NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
543728 2lrh 18372 cing 4-filtered-FRED STAR entry full 4595


data_FRED_restraints_with_modified_coordinates_PDB_code_2lrh

# This FRED archive file contains, for PDB entry <2lrh>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2lrh
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2lrh
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        16017.15

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $De_novo_designed_protein A . 1 1 
    stop_

save_


save_De_novo_designed_protein
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "De novo designed protein"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MKELILINTNNDELIKKIKKEVENQGYQVRDVNDSDELKKEMKKLAEEKNFEKILIISNDKQLLKEMLELISKLGYKVFLLLQDQDENELEEFKRKIESQGYEVRKVTDDEEALKIVREFMQKAGSLEHHHHHH
    _Entity.Number_of_monomers           134

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 LYS . 1 1 
         3 GLU . 1 1 
         4 LEU . 1 1 
         5 ILE . 1 1 
         6 LEU . 1 1 
         7 ILE . 1 1 
         8 ASN . 1 1 
         9 THR . 1 1 
        10 ASN . 1 1 
        11 ASN . 1 1 
        12 ASP . 1 1 
        13 GLU . 1 1 
        14 LEU . 1 1 
        15 ILE . 1 1 
        16 LYS . 1 1 
        17 LYS . 1 1 
        18 ILE . 1 1 
        19 LYS . 1 1 
        20 LYS . 1 1 
        21 GLU . 1 1 
        22 VAL . 1 1 
        23 GLU . 1 1 
        24 ASN . 1 1 
        25 GLN . 1 1 
        26 GLY . 1 1 
        27 TYR . 1 1 
        28 GLN . 1 1 
        29 VAL . 1 1 
        30 ARG . 1 1 
        31 ASP . 1 1 
        32 VAL . 1 1 
        33 ASN . 1 1 
        34 ASP . 1 1 
        35 SER . 1 1 
        36 ASP . 1 1 
        37 GLU . 1 1 
        38 LEU . 1 1 
        39 LYS . 1 1 
        40 LYS . 1 1 
        41 GLU . 1 1 
        42 MET . 1 1 
        43 LYS . 1 1 
        44 LYS . 1 1 
        45 LEU . 1 1 
        46 ALA . 1 1 
        47 GLU . 1 1 
        48 GLU . 1 1 
        49 LYS . 1 1 
        50 ASN . 1 1 
        51 PHE . 1 1 
        52 GLU . 1 1 
        53 LYS . 1 1 
        54 ILE . 1 1 
        55 LEU . 1 1 
        56 ILE . 1 1 
        57 ILE . 1 1 
        58 SER . 1 1 
        59 ASN . 1 1 
        60 ASP . 1 1 
        61 LYS . 1 1 
        62 GLN . 1 1 
        63 LEU . 1 1 
        64 LEU . 1 1 
        65 LYS . 1 1 
        66 GLU . 1 1 
        67 MET . 1 1 
        68 LEU . 1 1 
        69 GLU . 1 1 
        70 LEU . 1 1 
        71 ILE . 1 1 
        72 SER . 1 1 
        73 LYS . 1 1 
        74 LEU . 1 1 
        75 GLY . 1 1 
        76 TYR . 1 1 
        77 LYS . 1 1 
        78 VAL . 1 1 
        79 PHE . 1 1 
        80 LEU . 1 1 
        81 LEU . 1 1 
        82 LEU . 1 1 
        83 GLN . 1 1 
        84 ASP . 1 1 
        85 GLN . 1 1 
        86 ASP . 1 1 
        87 GLU . 1 1 
        88 ASN . 1 1 
        89 GLU . 1 1 
        90 LEU . 1 1 
        91 GLU . 1 1 
        92 GLU . 1 1 
        93 PHE . 1 1 
        94 LYS . 1 1 
        95 ARG . 1 1 
        96 LYS . 1 1 
        97 ILE . 1 1 
        98 GLU . 1 1 
        99 SER . 1 1 
       100 GLN . 1 1 
       101 GLY . 1 1 
       102 TYR . 1 1 
       103 GLU . 1 1 
       104 VAL . 1 1 
       105 ARG . 1 1 
       106 LYS . 1 1 
       107 VAL . 1 1 
       108 THR . 1 1 
       109 ASP . 1 1 
       110 ASP . 1 1 
       111 GLU . 1 1 
       112 GLU . 1 1 
       113 ALA . 1 1 
       114 LEU . 1 1 
       115 LYS . 1 1 
       116 ILE . 1 1 
       117 VAL . 1 1 
       118 ARG . 1 1 
       119 GLU . 1 1 
       120 PHE . 1 1 
       121 MET . 1 1 
       122 GLN . 1 1 
       123 LYS . 1 1 
       124 ALA . 1 1 
       125 GLY . 1 1 
       126 SER . 1 1 
       127 LEU . 1 1 
       128 GLU . 1 1 
       129 HIS . 1 1 
       130 HIS . 1 1 
       131 HIS . 1 1 
       132 HIS . 1 1 
       133 HIS . 1 1 
       134 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       LYS   2   2 1 1 
       GLU   3   3 1 1 
       LEU   4   4 1 1 
       ILE   5   5 1 1 
       LEU   6   6 1 1 
       ILE   7   7 1 1 
       ASN   8   8 1 1 
       THR   9   9 1 1 
       ASN  10  10 1 1 
       ASN  11  11 1 1 
       ASP  12  12 1 1 
       GLU  13  13 1 1 
       LEU  14  14 1 1 
       ILE  15  15 1 1 
       LYS  16  16 1 1 
       LYS  17  17 1 1 
       ILE  18  18 1 1 
       LYS  19  19 1 1 
       LYS  20  20 1 1 
       GLU  21  21 1 1 
       VAL  22  22 1 1 
       GLU  23  23 1 1 
       ASN  24  24 1 1 
       GLN  25  25 1 1 
       GLY  26  26 1 1 
       TYR  27  27 1 1 
       GLN  28  28 1 1 
       VAL  29  29 1 1 
       ARG  30  30 1 1 
       ASP  31  31 1 1 
       VAL  32  32 1 1 
       ASN  33  33 1 1 
       ASP  34  34 1 1 
       SER  35  35 1 1 
       ASP  36  36 1 1 
       GLU  37  37 1 1 
       LEU  38  38 1 1 
       LYS  39  39 1 1 
       LYS  40  40 1 1 
       GLU  41  41 1 1 
       MET  42  42 1 1 
       LYS  43  43 1 1 
       LYS  44  44 1 1 
       LEU  45  45 1 1 
       ALA  46  46 1 1 
       GLU  47  47 1 1 
       GLU  48  48 1 1 
       LYS  49  49 1 1 
       ASN  50  50 1 1 
       PHE  51  51 1 1 
       GLU  52  52 1 1 
       LYS  53  53 1 1 
       ILE  54  54 1 1 
       LEU  55  55 1 1 
       ILE  56  56 1 1 
       ILE  57  57 1 1 
       SER  58  58 1 1 
       ASN  59  59 1 1 
       ASP  60  60 1 1 
       LYS  61  61 1 1 
       GLN  62  62 1 1 
       LEU  63  63 1 1 
       LEU  64  64 1 1 
       LYS  65  65 1 1 
       GLU  66  66 1 1 
       MET  67  67 1 1 
       LEU  68  68 1 1 
       GLU  69  69 1 1 
       LEU  70  70 1 1 
       ILE  71  71 1 1 
       SER  72  72 1 1 
       LYS  73  73 1 1 
       LEU  74  74 1 1 
       GLY  75  75 1 1 
       TYR  76  76 1 1 
       LYS  77  77 1 1 
       VAL  78  78 1 1 
       PHE  79  79 1 1 
       LEU  80  80 1 1 
       LEU  81  81 1 1 
       LEU  82  82 1 1 
       GLN  83  83 1 1 
       ASP  84  84 1 1 
       GLN  85  85 1 1 
       ASP  86  86 1 1 
       GLU  87  87 1 1 
       ASN  88  88 1 1 
       GLU  89  89 1 1 
       LEU  90  90 1 1 
       GLU  91  91 1 1 
       GLU  92  92 1 1 
       PHE  93  93 1 1 
       LYS  94  94 1 1 
       ARG  95  95 1 1 
       LYS  96  96 1 1 
       ILE  97  97 1 1 
       GLU  98  98 1 1 
       SER  99  99 1 1 
       GLN 100 100 1 1 
       GLY 101 101 1 1 
       TYR 102 102 1 1 
       GLU 103 103 1 1 
       VAL 104 104 1 1 
       ARG 105 105 1 1 
       LYS 106 106 1 1 
       VAL 107 107 1 1 
       THR 108 108 1 1 
       ASP 109 109 1 1 
       ASP 110 110 1 1 
       GLU 111 111 1 1 
       GLU 112 112 1 1 
       ALA 113 113 1 1 
       LEU 114 114 1 1 
       LYS 115 115 1 1 
       ILE 116 116 1 1 
       VAL 117 117 1 1 
       ARG 118 118 1 1 
       GLU 119 119 1 1 
       PHE 120 120 1 1 
       MET 121 121 1 1 
       GLN 122 122 1 1 
       LYS 123 123 1 1 
       ALA 124 124 1 1 
       GLY 125 125 1 1 
       SER 126 126 1 1 
       LEU 127 127 1 1 
       GLU 128 128 1 1 
       HIS 129 129 1 1 
       HIS 130 130 1 1 
       HIS 131 131 1 1 
       HIS 132 132 1 1 
       HIS 133 133 1 1 
       HIS 134 134 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
       1795 1 . . . 1 1 
       1796 1 . . . 1 1 
       1797 1 . . . 1 1 
       1798 1 . . . 1 1 
       1799 1 . . . 1 1 
       1800 1 . . . 1 1 
       1801 1 . . . 1 1 
       1802 1 . . . 1 1 
       1803 1 . . . 1 1 
       1804 1 . . . 1 1 
       1805 1 . . . 1 1 
       1806 1 . . . 1 1 
       1807 1 . . . 1 1 
       1808 1 . . . 1 1 
       1809 1 . . . 1 1 
       1810 1 . . . 1 1 
       1811 1 . . . 1 1 
       1812 1 . . . 1 1 
       1813 1 . . . 1 1 
       1814 1 . . . 1 1 
       1815 1 . . . 1 1 
       1816 1 . . . 1 1 
       1817 1 . . . 1 1 
       1818 1 . . . 1 1 
       1819 1 . . . 1 1 
       1820 1 . . . 1 1 
       1821 1 . . . 1 1 
       1822 1 . . . 1 1 
       1823 1 . . . 1 1 
       1824 1 . . . 1 1 
       1825 1 . . . 1 1 
       1826 1 . . . 1 1 
       1827 1 . . . 1 1 
       1828 1 . . . 1 1 
       1829 1 . . . 1 1 
       1830 1 . . . 1 1 
       1831 1 . . . 1 1 
       1832 1 . . . 1 1 
       1833 1 . . . 1 1 
       1834 1 . . . 1 1 
       1835 1 . . . 1 1 
       1836 1 . . . 1 1 
       1837 1 . . . 1 1 
       1838 1 . . . 1 1 
       1839 1 . . . 1 1 
       1840 1 . . . 1 1 
       1841 1 . . . 1 1 
       1842 1 . . . 1 1 
       1843 1 . . . 1 1 
       1844 1 . . . 1 1 
       1845 1 . . . 1 1 
       1846 1 . . . 1 1 
       1847 1 . . . 1 1 
       1848 1 . . . 1 1 
       1849 1 . . . 1 1 
       1850 1 . . . 1 1 
       1851 1 . . . 1 1 
       1852 1 . . . 1 1 
       1853 1 . . . 1 1 
       1854 1 . . . 1 1 
       1855 1 . . . 1 1 
       1856 1 . . . 1 1 
       1857 1 . . . 1 1 
       1858 1 . . . 1 1 
       1859 1 . . . 1 1 
       1860 1 . . . 1 1 
       1861 1 . . . 1 1 
       1862 1 . . . 1 1 
       1863 1 . . . 1 1 
       1864 1 . . . 1 1 
       1865 1 . . . 1 1 
       1866 1 . . . 1 1 
       1867 1 . . . 1 1 
       1868 1 . . . 1 1 
       1869 1 . . . 1 1 
       1870 1 . . . 1 1 
       1871 1 . . . 1 1 
       1872 1 . . . 1 1 
       1873 1 . . . 1 1 
       1874 1 . . . 1 1 
       1875 1 . . . 1 1 
       1876 1 . . . 1 1 
       1877 1 . . . 1 1 
       1878 1 . . . 1 1 
       1879 1 . . . 1 1 
       1880 1 . . . 1 1 
       1881 1 . . . 1 1 
       1882 1 . . . 1 1 
       1883 1 . . . 1 1 
       1884 1 . . . 1 1 
       1885 1 . . . 1 1 
       1886 1 . . . 1 1 
       1887 1 . . . 1 1 
       1888 1 . . . 1 1 
       1889 1 . . . 1 1 
       1890 1 . . . 1 1 
       1891 1 . . . 1 1 
       1892 1 . . . 1 1 
       1893 1 . . . 1 1 
       1894 1 . . . 1 1 
       1895 1 . . . 1 1 
       1896 1 . . . 1 1 
       1897 1 . . . 1 1 
       1898 1 . . . 1 1 
       1899 1 . . . 1 1 
       1900 1 . . . 1 1 
       1901 1 . . . 1 1 
       1902 1 . . . 1 1 
       1903 1 . . . 1 1 
       1904 1 . . . 1 1 
       1905 1 . . . 1 1 
       1906 1 . . . 1 1 
       1907 1 . . . 1 1 
       1908 1 . . . 1 1 
       1909 1 . . . 1 1 
       1910 1 . . . 1 1 
       1911 1 . . . 1 1 
       1912 1 . . . 1 1 
       1913 1 . . . 1 1 
       1914 1 . . . 1 1 
       1915 1 . . . 1 1 
       1916 1 . . . 1 1 
       1917 1 . . . 1 1 
       1918 1 . . . 1 1 
       1919 1 . . . 1 1 
       1920 1 . . . 1 1 
       1921 1 . . . 1 1 
       1922 1 . . . 1 1 
       1923 1 . . . 1 1 
       1924 1 . . . 1 1 
       1925 1 . . . 1 1 
       1926 1 . . . 1 1 
       1927 1 . . . 1 1 
       1928 1 . . . 1 1 
       1929 1 . . . 1 1 
       1930 1 . . . 1 1 
       1931 1 . . . 1 1 
       1932 1 . . . 1 1 
       1933 1 . . . 1 1 
       1934 1 . . . 1 1 
       1935 1 . . . 1 1 
       1936 1 . . . 1 1 
       1937 1 . . . 1 1 
       1938 1 . . . 1 1 
       1939 1 . . . 1 1 
       1940 1 . . . 1 1 
       1941 1 . . . 1 1 
       1942 1 . . . 1 1 
       1943 1 . . . 1 1 
       1944 1 . . . 1 1 
       1945 1 . . . 1 1 
       1946 1 . . . 1 1 
       1947 1 . . . 1 1 
       1948 1 . . . 1 1 
       1949 1 . . . 1 1 
       1950 1 . . . 1 1 
       1951 1 . . . 1 1 
       1952 1 . . . 1 1 
       1953 1 . . . 1 1 
       1954 1 . . . 1 1 
       1955 1 . . . 1 1 
       1956 1 . . . 1 1 
       1957 1 . . . 1 1 
       1958 1 . . . 1 1 
       1959 1 . . . 1 1 
       1960 1 . . . 1 1 
       1961 1 . . . 1 1 
       1962 1 . . . 1 1 
       1963 1 . . . 1 1 
       1964 1 . . . 1 1 
       1965 1 . . . 1 1 
       1966 1 . . . 1 1 
       1967 1 . . . 1 1 
       1968 1 . . . 1 1 
       1969 1 . . . 1 1 
       1970 1 . . . 1 1 
       1971 1 . . . 1 1 
       1972 1 . . . 1 1 
       1973 1 . . . 1 1 
       1974 1 . . . 1 1 
       1975 1 . . . 1 1 
       1976 1 . . . 1 1 
       1977 1 . . . 1 1 
       1978 1 . . . 1 1 
       1979 1 . . . 1 1 
       1980 1 . . . 1 1 
       1981 1 . . . 1 1 
       1982 1 . . . 1 1 
       1983 1 . . . 1 1 
       1984 1 . . . 1 1 
       1985 1 . . . 1 1 
       1986 1 . . . 1 1 
       1987 1 . . . 1 1 
       1988 1 . . . 1 1 
       1989 1 . . . 1 1 
       1990 1 . . . 1 1 
       1991 1 . . . 1 1 
       1992 1 . . . 1 1 
       1993 1 . . . 1 1 
       1994 1 . . . 1 1 
       1995 1 . . . 1 1 
       1996 1 . . . 1 1 
       1997 1 . . . 1 1 
       1998 1 . . . 1 1 
       1999 1 . . . 1 1 
       2000 1 . . . 1 1 
       2001 1 . . . 1 1 
       2002 1 . . . 1 1 
       2003 1 . . . 1 1 
       2004 1 . . . 1 1 
       2005 1 . . . 1 1 
       2006 1 . . . 1 1 
       2007 1 . . . 1 1 
       2008 1 . . . 1 1 
       2009 1 . . . 1 1 
       2010 1 . . . 1 1 
       2011 1 . . . 1 1 
       2012 1 . . . 1 1 
       2013 1 . . . 1 1 
       2014 1 . . . 1 1 
       2015 1 . . . 1 1 
       2016 1 . . . 1 1 
       2017 1 . . . 1 1 
       2018 1 . . . 1 1 
       2019 1 . . . 1 1 
       2020 1 . . . 1 1 
       2021 1 . . . 1 1 
       2022 1 . . . 1 1 
       2023 1 . . . 1 1 
       2024 1 . . . 1 1 
       2025 1 . . . 1 1 
       2026 1 . . . 1 1 
       2027 1 . . . 1 1 
       2028 1 . . . 1 1 
       2029 1 . . . 1 1 
       2030 1 . . . 1 1 
       2031 1 . . . 1 1 
       2032 1 . . . 1 1 
       2033 1 . . . 1 1 
       2034 1 . . . 1 1 
       2035 1 . . . 1 1 
       2036 1 . . . 1 1 
       2037 1 . . . 1 1 
       2038 1 . . . 1 1 
       2039 1 . . . 1 1 
       2040 1 . . . 1 1 
       2041 1 . . . 1 1 
       2042 1 . . . 1 1 
       2043 1 . . . 1 1 
       2044 1 . . . 1 1 
       2045 1 . . . 1 1 
       2046 1 . . . 1 1 
       2047 1 . . . 1 1 
       2048 1 . . . 1 1 
       2049 1 . . . 1 1 
       2050 1 . . . 1 1 
       2051 1 . . . 1 1 
       2052 1 . . . 1 1 
       2053 1 . . . 1 1 
       2054 1 . . . 1 1 
       2055 1 . . . 1 1 
       2056 1 . . . 1 1 
       2057 1 . . . 1 1 
       2058 1 . . . 1 1 
       2059 1 . . . 1 1 
       2060 1 . . . 1 1 
       2061 1 . . . 1 1 
       2062 1 . . . 1 1 
       2063 1 . . . 1 1 
       2064 1 . . . 1 1 
       2065 1 . . . 1 1 
       2066 1 . . . 1 1 
       2067 1 . . . 1 1 
       2068 1 . . . 1 1 
       2069 1 . . . 1 1 
       2070 1 . . . 1 1 
       2071 1 . . . 1 1 
       2072 1 . . . 1 1 
       2073 1 . . . 1 1 
       2074 1 . . . 1 1 
       2075 1 . . . 1 1 
       2076 1 . . . 1 1 
       2077 1 . . . 1 1 
       2078 1 . . . 1 1 
       2079 1 . . . 1 1 
       2080 1 . . . 1 1 
       2081 1 . . . 1 1 
       2082 1 . . . 1 1 
       2083 1 . . . 1 1 
       2084 1 . . . 1 1 
       2085 1 . . . 1 1 
       2086 1 . . . 1 1 
       2087 1 . . . 1 1 
       2088 1 . . . 1 1 
       2089 1 . . . 1 1 
       2090 1 . . . 1 1 
       2091 1 . . . 1 1 
       2092 1 . . . 1 1 
       2093 1 . . . 1 1 
       2094 1 . . . 1 1 
       2095 1 . . . 1 1 
       2096 1 . . . 1 1 
       2097 1 . . . 1 1 
       2098 1 . . . 1 1 
       2099 1 . . . 1 1 
       2100 1 . . . 1 1 
       2101 1 . . . 1 1 
       2102 1 . . . 1 1 
       2103 1 . . . 1 1 
       2104 1 . . . 1 1 
       2105 1 . . . 1 1 
       2106 1 . . . 1 1 
       2107 1 . . . 1 1 
       2108 1 . . . 1 1 
       2109 1 . . . 1 1 
       2110 1 . . . 1 1 
       2111 1 . . . 1 1 
       2112 1 . . . 1 1 
       2113 1 . . . 1 1 
       2114 1 . . . 1 1 
       2115 1 . . . 1 1 
       2116 1 . . . 1 1 
       2117 1 . . . 1 1 
       2118 1 . . . 1 1 
       2119 1 . . . 1 1 
       2120 1 . . . 1 1 
       2121 1 . . . 1 1 
       2122 1 . . . 1 1 
       2123 1 . . . 1 1 
       2124 1 . . . 1 1 
       2125 1 . . . 1 1 
       2126 1 . . . 1 1 
       2127 1 . . . 1 1 
       2128 1 . . . 1 1 
       2129 1 . . . 1 1 
       2130 1 . . . 1 1 
       2131 1 . . . 1 1 
       2132 1 . . . 1 1 
       2133 1 . . . 1 1 
       2134 1 . . . 1 1 
       2135 1 . . . 1 1 
       2136 1 . . . 1 1 
       2137 1 . . . 1 1 
       2138 1 . . . 1 1 
       2139 1 . . . 1 1 
       2140 1 . . . 1 1 
       2141 1 . . . 1 1 
       2142 1 . . . 1 1 
       2143 1 . . . 1 1 
       2144 1 . . . 1 1 
       2145 1 . . . 1 1 
       2146 1 . . . 1 1 
       2147 1 . . . 1 1 
       2148 1 . . . 1 1 
       2149 1 . . . 1 1 
       2150 1 . . . 1 1 
       2151 1 . . . 1 1 
       2152 1 . . . 1 1 
       2153 1 . . . 1 1 
       2154 1 . . . 1 1 
       2155 1 . . . 1 1 
       2156 1 . . . 1 1 
       2157 1 . . . 1 1 
       2158 1 . . . 1 1 
       2159 1 . . . 1 1 
       2160 1 . . . 1 1 
       2161 1 . . . 1 1 
       2162 1 . . . 1 1 
       2163 1 . . . 1 1 
       2164 1 . . . 1 1 
       2165 1 . . . 1 1 
       2166 1 . . . 1 1 
       2167 1 . . . 1 1 
       2168 1 . . . 1 1 
       2169 1 . . . 1 1 
       2170 1 . . . 1 1 
       2171 1 . . . 1 1 
       2172 1 . . . 1 1 
       2173 1 . . . 1 1 
       2174 1 . . . 1 1 
       2175 1 . . . 1 1 
       2176 1 . . . 1 1 
       2177 1 . . . 1 1 
       2178 1 . . . 1 1 
       2179 1 . . . 1 1 
       2180 1 . . . 1 1 
       2181 1 . . . 1 1 
       2182 1 . . . 1 1 
       2183 1 . . . 1 1 
       2184 1 . . . 1 1 
       2185 1 . . . 1 1 
       2186 1 . . . 1 1 
       2187 1 . . . 1 1 
       2188 1 . . . 1 1 
       2189 1 . . . 1 1 
       2190 1 . . . 1 1 
       2191 1 . . . 1 1 
       2192 1 . . . 1 1 
       2193 1 . . . 1 1 
       2194 1 . . . 1 1 
       2195 1 . . . 1 1 
       2196 1 . . . 1 1 
       2197 1 . . . 1 1 
       2198 1 . . . 1 1 
       2199 1 . . . 1 1 
       2200 1 . . . 1 1 
       2201 1 . . . 1 1 
       2202 1 . . . 1 1 
       2203 1 . . . 1 1 
       2204 1 . . . 1 1 
       2205 1 . . . 1 1 
       2206 1 . . . 1 1 
       2207 1 . . . 1 1 
       2208 1 . . . 1 1 
       2209 1 . . . 1 1 
       2210 1 . . . 1 1 
       2211 1 . . . 1 1 
       2212 1 . . . 1 1 
       2213 1 . . . 1 1 
       2214 1 . . . 1 1 
       2215 1 . . . 1 1 
       2216 1 . . . 1 1 
       2217 1 . . . 1 1 
       2218 1 . . . 1 1 
       2219 1 . . . 1 1 
       2220 1 . . . 1 1 
       2221 1 . . . 1 1 
       2222 1 . . . 1 1 
       2223 1 . . . 1 1 
       2224 1 . . . 1 1 
       2225 1 . . . 1 1 
       2226 1 . . . 1 1 
       2227 1 . . . 1 1 
       2228 1 . . . 1 1 
       2229 1 . . . 1 1 
       2230 1 . . . 1 1 
       2231 1 . . . 1 1 
       2232 1 . . . 1 1 
       2233 1 . . . 1 1 
       2234 1 . . . 1 1 
       2235 1 . . . 1 1 
       2236 1 . . . 1 1 
       2237 1 . . . 1 1 
       2238 1 . . . 1 1 
       2239 1 . . . 1 1 
       2240 1 . . . 1 1 
       2241 1 . . . 1 1 
       2242 1 . . . 1 1 
       2243 1 . . . 1 1 
       2244 1 . . . 1 1 
       2245 1 . . . 1 1 
       2246 1 . . . 1 1 
       2247 1 . . . 1 1 
       2248 1 . . . 1 1 
       2249 1 . . . 1 1 
       2250 1 . . . 1 1 
       2251 1 . . . 1 1 
       2252 1 . . . 1 1 
       2253 1 . . . 1 1 
       2254 1 . . . 1 1 
       2255 1 . . . 1 1 
       2256 1 . . . 1 1 
       2257 1 . . . 1 1 
       2258 1 . . . 1 1 
       2259 1 . . . 1 1 
       2260 1 . . . 1 1 
       2261 1 . . . 1 1 
       2262 1 . . . 1 1 
       2263 1 . . . 1 1 
       2264 1 . . . 1 1 
       2265 1 . . . 1 1 
       2266 1 . . . 1 1 
       2267 1 . . . 1 1 
       2268 1 . . . 1 1 
       2269 1 . . . 1 1 
       2270 1 . . . 1 1 
       2271 1 . . . 1 1 
       2272 1 . . . 1 1 
       2273 1 . . . 1 1 
       2274 1 . . . 1 1 
       2275 1 . . . 1 1 
       2276 1 . . . 1 1 
       2277 1 . . . 1 1 
       2278 1 . . . 1 1 
       2279 1 . . . 1 1 
       2280 1 . . . 1 1 
       2281 1 . . . 1 1 
       2282 1 . . . 1 1 
       2283 1 . . . 1 1 
       2284 1 . . . 1 1 
       2285 1 . . . 1 1 
       2286 1 . . . 1 1 
       2287 1 . . . 1 1 
       2288 1 . . . 1 1 
       2289 1 . . . 1 1 
       2290 1 . . . 1 1 
       2291 1 . . . 1 1 
       2292 1 . . . 1 1 
       2293 1 . . . 1 1 
       2294 1 . . . 1 1 
       2295 1 . . . 1 1 
       2296 1 . . . 1 1 
       2297 1 . . . 1 1 
       2298 1 . . . 1 1 
       2299 1 . . . 1 1 
       2300 1 . . . 1 1 
       2301 1 . . . 1 1 
       2302 1 . . . 1 1 
       2303 1 . . . 1 1 
       2304 1 . . . 1 1 
       2305 1 . . . 1 1 
       2306 1 . . . 1 1 
       2307 1 . . . 1 1 
       2308 1 . . . 1 1 
       2309 1 . . . 1 1 
       2310 1 . . . 1 1 
       2311 1 . . . 1 1 
       2312 1 . . . 1 1 
       2313 1 . . . 1 1 
       2314 1 . . . 1 1 
       2315 1 . . . 1 1 
       2316 1 . . . 1 1 
       2317 1 . . . 1 1 
       2318 1 . . . 1 1 
       2319 1 . . . 1 1 
       2320 1 . . . 1 1 
       2321 1 . . . 1 1 
       2322 1 . . . 1 1 
       2323 1 . . . 1 1 
       2324 1 . . . 1 1 
       2325 1 . . . 1 1 
       2326 1 . . . 1 1 
       2327 1 . . . 1 1 
       2328 1 . . . 1 1 
       2329 1 . . . 1 1 
       2330 1 . . . 1 1 
       2331 1 . . . 1 1 
       2332 1 . . . 1 1 
       2333 1 . . . 1 1 
       2334 1 . . . 1 1 
       2335 1 . . . 1 1 
       2336 1 . . . 1 1 
       2337 1 . . . 1 1 
       2338 1 . . . 1 1 
       2339 1 . . . 1 1 
       2340 1 . . . 1 1 
       2341 1 . . . 1 1 
       2342 1 . . . 1 1 
       2343 1 . . . 1 1 
       2344 1 . . . 1 1 
       2345 1 . . . 1 1 
       2346 1 . . . 1 1 
       2347 1 . . . 1 1 
       2348 1 . . . 1 1 
       2349 1 . . . 1 1 
       2350 1 . . . 1 1 
       2351 1 . . . 1 1 
       2352 1 . . . 1 1 
       2353 1 . . . 1 1 
       2354 1 . . . 1 1 
       2355 1 . . . 1 1 
       2356 1 . . . 1 1 
       2357 1 . . . 1 1 
       2358 1 . . . 1 1 
       2359 1 . . . 1 1 
       2360 1 . . . 1 1 
       2361 1 . . . 1 1 
       2362 1 . . . 1 1 
       2363 1 . . . 1 1 
       2364 1 . . . 1 1 
       2365 1 . . . 1 1 
       2366 1 . . . 1 1 
       2367 1 . . . 1 1 
       2368 1 . . . 1 1 
       2369 1 . . . 1 1 
       2370 1 . . . 1 1 
       2371 1 . . . 1 1 
       2372 1 . . . 1 1 
       2373 1 . . . 1 1 
       2374 1 . . . 1 1 
       2375 1 . . . 1 1 
       2376 1 . . . 1 1 
       2377 1 . . . 1 1 
       2378 1 . . . 1 1 
       2379 1 . . . 1 1 
       2380 1 . . . 1 1 
       2381 1 . . . 1 1 
       2382 1 . . . 1 1 
       2383 1 . . . 1 1 
       2384 1 . . . 1 1 
       2385 1 . . . 1 1 
       2386 1 . . . 1 1 
       2387 1 . . . 1 1 
       2388 1 . . . 1 1 
       2389 1 . . . 1 1 
       2390 1 . . . 1 1 
       2391 1 . . . 1 1 
       2392 1 . . . 1 1 
       2393 1 . . . 1 1 
       2394 1 . . . 1 1 
       2395 1 . . . 1 1 
       2396 1 . . . 1 1 
       2397 1 . . . 1 1 
       2398 1 . . . 1 1 
       2399 1 . . . 1 1 
       2400 1 . . . 1 1 
       2401 1 . . . 1 1 
       2402 1 . . . 1 1 
       2403 1 . . . 1 1 
       2404 1 . . . 1 1 
       2405 1 . . . 1 1 
       2406 1 . . . 1 1 
       2407 1 . . . 1 1 
       2408 1 . . . 1 1 
       2409 1 . . . 1 1 
       2410 1 . . . 1 1 
       2411 1 . . . 1 1 
       2412 1 . . . 1 1 
       2413 1 . . . 1 1 
       2414 1 . . . 1 1 
       2415 1 . . . 1 1 
       2416 1 . . . 1 1 
       2417 1 . . . 1 1 
       2418 1 . . . 1 1 
       2419 1 . . . 1 1 
       2420 1 . . . 1 1 
       2421 1 . . . 1 1 
       2422 1 . . . 1 1 
       2423 1 . . . 1 1 
       2424 1 . . . 1 1 
       2425 1 . . . 1 1 
       2426 1 . . . 1 1 
       2427 1 . . . 1 1 
       2428 1 . . . 1 1 
       2429 1 . . . 1 1 
       2430 1 . . . 1 1 
       2431 1 . . . 1 1 
       2432 1 . . . 1 1 
       2433 1 . . . 1 1 
       2434 1 . . . 1 1 
       2435 1 . . . 1 1 
       2436 1 . . . 1 1 
       2437 1 . . . 1 1 
       2438 1 . . . 1 1 
       2439 1 . . . 1 1 
       2440 1 . . . 1 1 
       2441 1 . . . 1 1 
       2442 1 . . . 1 1 
       2443 1 . . . 1 1 
       2444 1 . . . 1 1 
       2445 1 . . . 1 1 
       2446 1 . . . 1 1 
       2447 1 . . . 1 1 
       2448 1 . . . 1 1 
       2449 1 . . . 1 1 
       2450 1 . . . 1 1 
       2451 1 . . . 1 1 
       2452 1 . . . 1 1 
       2453 1 . . . 1 1 
       2454 1 . . . 1 1 
       2455 1 . . . 1 1 
       2456 1 . . . 1 1 
       2457 1 . . . 1 1 
       2458 1 . . . 1 1 
       2459 1 . . . 1 1 
       2460 1 . . . 1 1 
       2461 1 . . . 1 1 
       2462 1 . . . 1 1 
       2463 1 . . . 1 1 
       2464 1 . . . 1 1 
       2465 1 . . . 1 1 
       2466 1 . . . 1 1 
       2467 1 . . . 1 1 
       2468 1 . . . 1 1 
       2469 1 . . . 1 1 
       2470 1 . . . 1 1 
       2471 1 . . . 1 1 
       2472 1 . . . 1 1 
       2473 1 . . . 1 1 
       2474 1 . . . 1 1 
       2475 1 . . . 1 1 
       2476 1 . . . 1 1 
       2477 1 . . . 1 1 
       2478 1 . . . 1 1 
       2479 1 . . . 1 1 
       2480 1 . . . 1 1 
       2481 1 . . . 1 1 
       2482 1 . . . 1 1 
       2483 1 . . . 1 1 
       2484 1 . . . 1 1 
       2485 1 . . . 1 1 
       2486 1 . . . 1 1 
       2487 1 . . . 1 1 
       2488 1 . . . 1 1 
       2489 1 . . . 1 1 
       2490 1 . . . 1 1 
       2491 1 . . . 1 1 
       2492 1 . . . 1 1 
       2493 1 . . . 1 1 
       2494 1 . . . 1 1 
       2495 1 . . . 1 1 
       2496 1 . . . 1 1 
       2497 1 . . . 1 1 
       2498 1 . . . 1 1 
       2499 1 . . . 1 1 
       2500 1 . . . 1 1 
       2501 1 . . . 1 1 
       2502 1 . . . 1 1 
       2503 1 . . . 1 1 
       2504 1 . . . 1 1 
       2505 1 . . . 1 1 
       2506 1 . . . 1 1 
       2507 1 . . . 1 1 
       2508 1 . . . 1 1 
       2509 1 . . . 1 1 
       2510 1 . . . 1 1 
       2511 1 . . . 1 1 
       2512 1 . . . 1 1 
       2513 1 . . . 1 1 
       2514 1 . . . 1 1 
       2515 1 . . . 1 1 
       2516 1 . . . 1 1 
       2517 1 . . . 1 1 
       2518 1 . . . 1 1 
       2519 1 . . . 1 1 
       2520 1 . . . 1 1 
       2521 1 . . . 1 1 
       2522 1 . . . 1 1 
       2523 1 . . . 1 1 
       2524 1 . . . 1 1 
       2525 1 . . . 1 1 
       2526 1 . . . 1 1 
       2527 1 . . . 1 1 
       2528 1 . . . 1 1 
       2529 1 . . . 1 1 
       2530 1 . . . 1 1 
       2531 1 . . . 1 1 
       2532 1 . . . 1 1 
       2533 1 . . . 1 1 
       2534 1 . . . 1 1 
       2535 1 . . . 1 1 
       2536 1 . . . 1 1 
       2537 1 . . . 1 1 
       2538 1 . . . 1 1 
       2539 1 . . . 1 1 
       2540 1 . . . 1 1 
       2541 1 . . . 1 1 
       2542 1 . . . 1 1 
       2543 1 . . . 1 1 
       2544 1 . . . 1 1 
       2545 1 . . . 1 1 
       2546 1 . . . 1 1 
       2547 1 . . . 1 1 
       2548 1 . . . 1 1 
       2549 1 . . . 1 1 
       2550 1 . . . 1 1 
       2551 1 . . . 1 1 
       2552 1 . . . 1 1 
       2553 1 . . . 1 1 
       2554 1 . . . 1 1 
       2555 1 . . . 1 1 
       2556 1 . . . 1 1 
       2557 1 . . . 1 1 
       2558 1 . . . 1 1 
       2559 1 . . . 1 1 
       2560 1 . . . 1 1 
       2561 1 . . . 1 1 
       2562 1 . . . 1 1 
       2563 1 . . . 1 1 
       2564 1 . . . 1 1 
       2565 1 . . . 1 1 
       2566 1 . . . 1 1 
       2567 1 . . . 1 1 
       2568 1 . . . 1 1 
       2569 1 . . . 1 1 
       2570 1 . . . 1 1 
       2571 1 . . . 1 1 
       2572 1 . . . 1 1 
       2573 1 . . . 1 1 
       2574 1 . . . 1 1 
       2575 1 . . . 1 1 
       2576 1 . . . 1 1 
       2577 1 . . . 1 1 
       2578 1 . . . 1 1 
       2579 1 . . . 1 1 
       2580 1 . . . 1 1 
       2581 1 . . . 1 1 
       2582 1 . . . 1 1 
       2583 1 . . . 1 1 
       2584 1 . . . 1 1 
       2585 1 . . . 1 1 
       2586 1 . . . 1 1 
       2587 1 . . . 1 1 
       2588 1 . . . 1 1 
       2589 1 . . . 1 1 
       2590 1 . . . 1 1 
       2591 1 . . . 1 1 
       2592 1 . . . 1 1 
       2593 1 . . . 1 1 
       2594 1 . . . 1 1 
       2595 1 . . . 1 1 
       2596 1 . . . 1 1 
       2597 1 . . . 1 1 
       2598 1 . . . 1 1 
       2599 1 . . . 1 1 
       2600 1 . . . 1 1 
       2601 1 . . . 1 1 
       2602 1 . . . 1 1 
       2603 1 . . . 1 1 
       2604 1 . . . 1 1 
       2605 1 . . . 1 1 
       2606 1 . . . 1 1 
       2607 1 . . . 1 1 
       2608 1 . . . 1 1 
       2609 1 . . . 1 1 
       2610 1 . . . 1 1 
       2611 1 . . . 1 1 
       2612 1 . . . 1 1 
       2613 1 . . . 1 1 
       2614 1 . . . 1 1 
       2615 1 . . . 1 1 
       2616 1 . . . 1 1 
       2617 1 . . . 1 1 
       2618 1 . . . 1 1 
       2619 1 . . . 1 1 
       2620 1 . . . 1 1 
       2621 1 . . . 1 1 
       2622 1 . . . 1 1 
       2623 1 . . . 1 1 
       2624 1 . . . 1 1 
       2625 1 . . . 1 1 
       2626 1 . . . 1 1 
       2627 1 . . . 1 1 
       2628 1 . . . 1 1 
       2629 1 . . . 1 1 
       2630 1 . . . 1 1 
       2631 1 . . . 1 1 
       2632 1 . . . 1 1 
       2633 1 . . . 1 1 
       2634 1 . . . 1 1 
       2635 1 . . . 1 1 
       2636 1 . . . 1 1 
       2637 1 . . . 1 1 
       2638 1 . . . 1 1 
       2639 1 . . . 1 1 
       2640 1 . . . 1 1 
       2641 1 . . . 1 1 
       2642 1 . . . 1 1 
       2643 1 . . . 1 1 
       2644 1 . . . 1 1 
       2645 1 . . . 1 1 
       2646 1 . . . 1 1 
       2647 1 . . . 1 1 
       2648 1 . . . 1 1 
       2649 1 . . . 1 1 
       2650 1 . . . 1 1 
       2651 1 . . . 1 1 
       2652 1 . . . 1 1 
       2653 1 . . . 1 1 
       2654 1 . . . 1 1 
       2655 1 . . . 1 1 
       2656 1 . . . 1 1 
       2657 1 . . . 1 1 
       2658 1 . . . 1 1 
       2659 1 . . . 1 1 
       2660 1 . . . 1 1 
       2661 1 . . . 1 1 
       2662 1 . . . 1 1 
       2663 1 . . . 1 1 
       2664 1 . . . 1 1 
       2665 1 . . . 1 1 
       2666 1 . . . 1 1 
       2667 1 . . . 1 1 
       2668 1 . . . 1 1 
       2669 1 . . . 1 1 
       2670 1 . . . 1 1 
       2671 1 . . . 1 1 
       2672 1 . . . 1 1 
       2673 1 . . . 1 1 
       2674 1 . . . 1 1 
       2675 1 . . . 1 1 
       2676 1 . . . 1 1 
       2677 1 . . . 1 1 
       2678 1 . . . 1 1 
       2679 1 . . . 1 1 
       2680 1 . . . 1 1 
       2681 1 . . . 1 1 
       2682 1 . . . 1 1 
       2683 1 . . . 1 1 
       2684 1 . . . 1 1 
       2685 1 . . . 1 1 
       2686 1 . . . 1 1 
       2687 1 . . . 1 1 
       2688 1 . . . 1 1 
       2689 1 . . . 1 1 
       2690 1 . . . 1 1 
       2691 1 . . . 1 1 
       2692 1 . . . 1 1 
       2693 1 . . . 1 1 
       2694 1 . . . 1 1 
       2695 1 . . . 1 1 
       2696 1 . . . 1 1 
       2697 1 . . . 1 1 
       2698 1 . . . 1 1 
       2699 1 . . . 1 1 
       2700 1 . . . 1 1 
       2701 1 . . . 1 1 
       2702 1 . . . 1 1 
       2703 1 . . . 1 1 
       2704 1 . . . 1 1 
       2705 1 . . . 1 1 
       2706 1 . . . 1 1 
       2707 1 . . . 1 1 
       2708 1 . . . 1 1 
       2709 1 . . . 1 1 
       2710 1 . . . 1 1 
       2711 1 . . . 1 1 
       2712 1 . . . 1 1 
       2713 1 . . . 1 1 
       2714 1 . . . 1 1 
       2715 1 . . . 1 1 
       2716 1 . . . 1 1 
       2717 1 . . . 1 1 
       2718 1 . . . 1 1 
       2719 1 . . . 1 1 
       2720 1 . . . 1 1 
       2721 1 . . . 1 1 
       2722 1 . . . 1 1 
       2723 1 . . . 1 1 
       2724 1 . . . 1 1 
       2725 1 . . . 1 1 
       2726 1 . . . 1 1 
       2727 1 . . . 1 1 
       2728 1 . . . 1 1 
       2729 1 . . . 1 1 
       2730 1 . . . 1 1 
       2731 1 . . . 1 1 
       2732 1 . . . 1 1 
       2733 1 . . . 1 1 
       2734 1 . . . 1 1 
       2735 1 . . . 1 1 
       2736 1 . . . 1 1 
       2737 1 . . . 1 1 
       2738 1 . . . 1 1 
       2739 1 . . . 1 1 
       2740 1 . . . 1 1 
       2741 1 . . . 1 1 
       2742 1 . . . 1 1 
       2743 1 . . . 1 1 
       2744 1 . . . 1 1 
       2745 1 . . . 1 1 
       2746 1 . . . 1 1 
       2747 1 . . . 1 1 
       2748 1 . . . 1 1 
       2749 1 . . . 1 1 
       2750 1 . . . 1 1 
       2751 1 . . . 1 1 
       2752 1 . . . 1 1 
       2753 1 . . . 1 1 
       2754 1 . . . 1 1 
       2755 1 . . . 1 1 
       2756 1 . . . 1 1 
       2757 1 . . . 1 1 
       2758 1 . . . 1 1 
       2759 1 . . . 1 1 
       2760 1 . . . 1 1 
       2761 1 . . . 1 1 
       2762 1 . . . 1 1 
       2763 1 . . . 1 1 
       2764 1 . . . 1 1 
       2765 1 . . . 1 1 
       2766 1 . . . 1 1 
       2767 1 . . . 1 1 
       2768 1 . . . 1 1 
       2769 1 . . . 1 1 
       2770 1 . . . 1 1 
       2771 1 . . . 1 1 
       2772 1 . . . 1 1 
       2773 1 . . . 1 1 
       2774 1 . . . 1 1 
       2775 1 . . . 1 1 
       2776 1 . . . 1 1 
       2777 1 . . . 1 1 
       2778 1 . . . 1 1 
       2779 1 . . . 1 1 
       2780 1 . . . 1 1 
       2781 1 . . . 1 1 
       2782 1 . . . 1 1 
       2783 1 . . . 1 1 
       2784 1 . . . 1 1 
       2785 1 . . . 1 1 
       2786 1 . . . 1 1 
       2787 1 . . . 1 1 
       2788 1 . . . 1 1 
       2789 1 . . . 1 1 
       2790 1 . . . 1 1 
       2791 1 . . . 1 1 
       2792 1 . . . 1 1 
       2793 1 . . . 1 1 
       2794 1 . . . 1 1 
       2795 1 . . . 1 1 
       2796 1 . . . 1 1 
       2797 1 . . . 1 1 
       2798 1 . . . 1 1 
       2799 1 . . . 1 1 
       2800 1 . . . 1 1 
       2801 1 . . . 1 1 
       2802 1 . . . 1 1 
       2803 1 . . . 1 1 
       2804 1 . . . 1 1 
       2805 1 . . . 1 1 
       2806 1 . . . 1 1 
       2807 1 . . . 1 1 
       2808 1 . . . 1 1 
       2809 1 . . . 1 1 
       2810 1 . . . 1 1 
       2811 1 . . . 1 1 
       2812 1 . . . 1 1 
       2813 1 . . . 1 1 
       2814 1 . . . 1 1 
       2815 1 . . . 1 1 
       2816 1 . . . 1 1 
       2817 1 . . . 1 1 
       2818 1 . . . 1 1 
       2819 1 . . . 1 1 
       2820 1 . . . 1 1 
       2821 1 . . . 1 1 
       2822 1 . . . 1 1 
       2823 1 . . . 1 1 
       2824 1 . . . 1 1 
       2825 1 . . . 1 1 
       2826 1 . . . 1 1 
       2827 1 . . . 1 1 
       2828 1 . . . 1 1 
       2829 1 . . . 1 1 
       2830 1 . . . 1 1 
       2831 1 . . . 1 1 
       2832 1 . . . 1 1 
       2833 1 . . . 1 1 
       2834 1 . . . 1 1 
       2835 1 . . . 1 1 
       2836 1 . . . 1 1 
       2837 1 . . . 1 1 
       2838 1 . . . 1 1 
       2839 1 . . . 1 1 
       2840 1 . . . 1 1 
       2841 1 . . . 1 1 
       2842 1 . . . 1 1 
       2843 1 . . . 1 1 
       2844 1 . . . 1 1 
       2845 1 . . . 1 1 
       2846 1 . . . 1 1 
       2847 1 . . . 1 1 
       2848 1 . . . 1 1 
       2849 1 . . . 1 1 
       2850 1 . . . 1 1 
       2851 1 . . . 1 1 
       2852 1 . . . 1 1 
       2853 1 . . . 1 1 
       2854 1 . . . 1 1 
       2855 1 . . . 1 1 
       2856 1 . . . 1 1 
       2857 1 . . . 1 1 
       2858 1 . . . 1 1 
       2859 1 . . . 1 1 
       2860 1 . . . 1 1 
       2861 1 . . . 1 1 
       2862 1 . . . 1 1 
       2863 1 . . . 1 1 
       2864 1 . . . 1 1 
       2865 1 . . . 1 1 
       2866 1 . . . 1 1 
       2867 1 . . . 1 1 
       2868 1 . . . 1 1 
       2869 1 . . . 1 1 
       2870 1 . . . 1 1 
       2871 1 . . . 1 1 
       2872 1 . . . 1 1 
       2873 1 . . . 1 1 
       2874 1 . . . 1 1 
       2875 1 . . . 1 1 
       2876 1 . . . 1 1 
       2877 1 . . . 1 1 
       2878 1 . . . 1 1 
       2879 1 . . . 1 1 
       2880 1 . . . 1 1 
       2881 1 . . . 1 1 
       2882 1 . . . 1 1 
       2883 1 . . . 1 1 
       2884 1 . . . 1 1 
       2885 1 . . . 1 1 
       2886 1 . . . 1 1 
       2887 1 . . . 1 1 
       2888 1 . . . 1 1 
       2889 1 . . . 1 1 
       2890 1 . . . 1 1 
       2891 1 . . . 1 1 
       2892 1 . . . 1 1 
       2893 1 . . . 1 1 
       2894 1 . . . 1 1 
       2895 1 . . . 1 1 
       2896 1 . . . 1 1 
       2897 1 . . . 1 1 
       2898 1 . . . 1 1 
       2899 1 . . . 1 1 
       2900 1 . . . 1 1 
       2901 1 . . . 1 1 
       2902 1 . . . 1 1 
       2903 1 . . . 1 1 
       2904 1 . . . 1 1 
       2905 1 . . . 1 1 
       2906 1 . . . 1 1 
       2907 1 . . . 1 1 
       2908 1 . . . 1 1 
       2909 1 . . . 1 1 
       2910 1 . . . 1 1 
       2911 1 . . . 1 1 
       2912 1 . . . 1 1 
       2913 1 . . . 1 1 
       2914 1 . . . 1 1 
       2915 1 . . . 1 1 
       2916 1 . . . 1 1 
       2917 1 . . . 1 1 
       2918 1 . . . 1 1 
       2919 1 . . . 1 1 
       2920 1 . . . 1 1 
       2921 1 . . . 1 1 
       2922 1 . . . 1 1 
       2923 1 . . . 1 1 
       2924 1 . . . 1 1 
       2925 1 . . . 1 1 
       2926 1 . . . 1 1 
       2927 1 . . . 1 1 
       2928 1 . . . 1 1 
       2929 1 . . . 1 1 
       2930 1 . . . 1 1 
       2931 1 . . . 1 1 
       2932 1 . . . 1 1 
       2933 1 . . . 1 1 
       2934 1 . . . 1 1 
       2935 1 . . . 1 1 
       2936 1 . . . 1 1 
       2937 1 . . . 1 1 
       2938 1 . . . 1 1 
       2939 1 . . . 1 1 
       2940 1 . . . 1 1 
       2941 1 . . . 1 1 
       2942 1 . . . 1 1 
       2943 1 . . . 1 1 
       2944 1 . . . 1 1 
       2945 1 . . . 1 1 
       2946 1 . . . 1 1 
       2947 1 . . . 1 1 
       2948 1 . . . 1 1 
       2949 1 . . . 1 1 
       2950 1 . . . 1 1 
       2951 1 . . . 1 1 
       2952 1 . . . 1 1 
       2953 1 . . . 1 1 
       2954 1 . . . 1 1 
       2955 1 . . . 1 1 
       2956 1 . . . 1 1 
       2957 1 . . . 1 1 
       2958 1 . . . 1 1 
       2959 1 . . . 1 1 
       2960 1 . . . 1 1 
       2961 1 . . . 1 1 
       2962 1 . . . 1 1 
       2963 1 . . . 1 1 
       2964 1 . . . 1 1 
       2965 1 . . . 1 1 
       2966 1 . . . 1 1 
       2967 1 . . . 1 1 
       2968 1 . . . 1 1 
       2969 1 . . . 1 1 
       2970 1 . . . 1 1 
       2971 1 . . . 1 1 
       2972 1 . . . 1 1 
       2973 1 . . . 1 1 
       2974 1 . . . 1 1 
       2975 1 . . . 1 1 
       2976 1 . . . 1 1 
       2977 1 . . . 1 1 
       2978 1 . . . 1 1 
       2979 1 . . . 1 1 
       2980 1 . . . 1 1 
       2981 1 . . . 1 1 
       2982 1 . . . 1 1 
       2983 1 . . . 1 1 
       2984 1 . . . 1 1 
       2985 1 . . . 1 1 
       2986 1 . . . 1 1 
       2987 1 . . . 1 1 
       2988 1 . . . 1 1 
       2989 1 . . . 1 1 
       2990 1 . . . 1 1 
       2991 1 . . . 1 1 
       2992 1 . . . 1 1 
       2993 1 . . . 1 1 
       2994 1 . . . 1 1 
       2995 1 . . . 1 1 
       2996 1 . . . 1 1 
       2997 1 . . . 1 1 
       2998 1 . . . 1 1 
       2999 1 . . . 1 1 
       3000 1 . . . 1 1 
       3001 1 . . . 1 1 
       3002 1 . . . 1 1 
       3003 1 . . . 1 1 
       3004 1 . . . 1 1 
       3005 1 . . . 1 1 
       3006 1 . . . 1 1 
       3007 1 . . . 1 1 
       3008 1 . . . 1 1 
       3009 1 . . . 1 1 
       3010 1 . . . 1 1 
       3011 1 . . . 1 1 
       3012 1 . . . 1 1 
       3013 1 . . . 1 1 
       3014 1 . . . 1 1 
       3015 1 . . . 1 1 
       3016 1 . . . 1 1 
       3017 1 . . . 1 1 
       3018 1 . . . 1 1 
       3019 1 . . . 1 1 
       3020 1 . . . 1 1 
       3021 1 . . . 1 1 
       3022 1 . . . 1 1 
       3023 1 . . . 1 1 
       3024 1 . . . 1 1 
       3025 1 . . . 1 1 
       3026 1 . . . 1 1 
       3027 1 . . . 1 1 
       3028 1 . . . 1 1 
       3029 1 . . . 1 1 
       3030 1 . . . 1 1 
       3031 1 . . . 1 1 
       3032 1 . . . 1 1 
       3033 1 . . . 1 1 
       3034 1 . . . 1 1 
       3035 1 . . . 1 1 
       3036 1 . . . 1 1 
       3037 1 . . . 1 1 
       3038 1 . . . 1 1 
       3039 1 . . . 1 1 
       3040 1 . . . 1 1 
       3041 1 . . . 1 1 
       3042 1 . . . 1 1 
       3043 1 . . . 1 1 
       3044 1 . . . 1 1 
       3045 1 . . . 1 1 
       3046 1 . . . 1 1 
       3047 1 . . . 1 1 
       3048 1 . . . 1 1 
       3049 1 . . . 1 1 
       3050 1 . . . 1 1 
       3051 1 . . . 1 1 
       3052 1 . . . 1 1 
       3053 1 . . . 1 1 
       3054 1 . . . 1 1 
       3055 1 . . . 1 1 
       3056 1 . . . 1 1 
       3057 1 . . . 1 1 
       3058 1 . . . 1 1 
       3059 1 . . . 1 1 
       3060 1 . . . 1 1 
       3061 1 . . . 1 1 
       3062 1 . . . 1 1 
       3063 1 . . . 1 1 
       3064 1 . . . 1 1 
       3065 1 . . . 1 1 
       3066 1 . . . 1 1 
       3067 1 . . . 1 1 
       3068 1 . . . 1 1 
       3069 1 . . . 1 1 
       3070 1 . . . 1 1 
       3071 1 . . . 1 1 
       3072 1 . . . 1 1 
       3073 1 . . . 1 1 
       3074 1 . . . 1 1 
       3075 1 . . . 1 1 
       3076 1 . . . 1 1 
       3077 1 . . . 1 1 
       3078 1 . . . 1 1 
       3079 1 . . . 1 1 
       3080 1 . . . 1 1 
       3081 1 . . . 1 1 
       3082 1 . . . 1 1 
       3083 1 . . . 1 1 
       3084 1 . . . 1 1 
       3085 1 . . . 1 1 
       3086 1 . . . 1 1 
       3087 1 . . . 1 1 
       3088 1 . . . 1 1 
       3089 1 . . . 1 1 
       3090 1 . . . 1 1 
       3091 1 . . . 1 1 
       3092 1 . . . 1 1 
       3093 1 . . . 1 1 
       3094 1 . . . 1 1 
       3095 1 . . . 1 1 
       3096 1 . . . 1 1 
       3097 1 . . . 1 1 
       3098 1 . . . 1 1 
       3099 1 . . . 1 1 
       3100 1 . . . 1 1 
       3101 1 . . . 1 1 
       3102 1 . . . 1 1 
       3103 1 . . . 1 1 
       3104 1 . . . 1 1 
       3105 1 . . . 1 1 
       3106 1 . . . 1 1 
       3107 1 . . . 1 1 
       3108 1 . . . 1 1 
       3109 1 . . . 1 1 
       3110 1 . . . 1 1 
       3111 1 . . . 1 1 
       3112 1 . . . 1 1 
       3113 1 . . . 1 1 
       3114 1 . . . 1 1 
       3115 1 . . . 1 1 
       3116 1 . . . 1 1 
       3117 1 . . . 1 1 
       3118 1 . . . 1 1 
       3119 1 . . . 1 1 
       3120 1 . . . 1 1 
       3121 1 . . . 1 1 
       3122 1 . . . 1 1 
       3123 1 . . . 1 1 
       3124 1 . . . 1 1 
       3125 1 . . . 1 1 
       3126 1 . . . 1 1 
       3127 1 . . . 1 1 
       3128 1 . . . 1 1 
       3129 1 . . . 1 1 
       3130 1 . . . 1 1 
       3131 1 . . . 1 1 
       3132 1 . . . 1 1 
       3133 1 . . . 1 1 
       3134 1 . . . 1 1 
       3135 1 . . . 1 1 
       3136 1 . . . 1 1 
       3137 1 . . . 1 1 
       3138 1 . . . 1 1 
       3139 1 . . . 1 1 
       3140 1 . . . 1 1 
       3141 1 . . . 1 1 
       3142 1 . . . 1 1 
       3143 1 . . . 1 1 
       3144 1 . . . 1 1 
       3145 1 . . . 1 1 
       3146 1 . . . 1 1 
       3147 1 . . . 1 1 
       3148 1 . . . 1 1 
       3149 1 . . . 1 1 
       3150 1 . . . 1 1 
       3151 1 . . . 1 1 
       3152 1 . . . 1 1 
       3153 1 . . . 1 1 
       3154 1 . . . 1 1 
       3155 1 . . . 1 1 
       3156 1 . . . 1 1 
       3157 1 . . . 1 1 
       3158 1 . . . 1 1 
       3159 1 . . . 1 1 
       3160 1 . . . 1 1 
       3161 1 . . . 1 1 
       3162 1 . . . 1 1 
       3163 1 . . . 1 1 
       3164 1 . . . 1 1 
       3165 1 . . . 1 1 
       3166 1 . . . 1 1 
       3167 1 . . . 1 1 
       3168 1 . . . 1 1 
       3169 1 . . . 1 1 
       3170 1 . . . 1 1 
       3171 1 . . . 1 1 
       3172 1 . . . 1 1 
       3173 1 . . . 1 1 
       3174 1 . . . 1 1 
       3175 1 . . . 1 1 
       3176 1 . . . 1 1 
       3177 1 . . . 1 1 
       3178 1 . . . 1 1 
       3179 1 . . . 1 1 
       3180 1 . . . 1 1 
       3181 1 . . . 1 1 
       3182 1 . . . 1 1 
       3183 1 . . . 1 1 
       3184 1 . . . 1 1 
       3185 1 . . . 1 1 
       3186 1 . . . 1 1 
       3187 1 . . . 1 1 
       3188 1 . . . 1 1 
       3189 1 . . . 1 1 
       3190 1 . . . 1 1 
       3191 1 . . . 1 1 
       3192 1 . . . 1 1 
       3193 1 . . . 1 1 
       3194 1 . . . 1 1 
       3195 1 . . . 1 1 
       3196 1 . . . 1 1 
       3197 1 . . . 1 1 
       3198 1 . . . 1 1 
       3199 1 . . . 1 1 
       3200 1 . . . 1 1 
       3201 1 . . . 1 1 
       3202 1 . . . 1 1 
       3203 1 . . . 1 1 
       3204 1 . . . 1 1 
       3205 1 . . . 1 1 
       3206 1 . . . 1 1 
       3207 1 . . . 1 1 
       3208 1 . . . 1 1 
       3209 1 . . . 1 1 
       3210 1 . . . 1 1 
       3211 1 . . . 1 1 
       3212 1 . . . 1 1 
       3213 1 . . . 1 1 
       3214 1 . . . 1 1 
       3215 1 . . . 1 1 
       3216 1 . . . 1 1 
       3217 1 . . . 1 1 
       3218 1 . . . 1 1 
       3219 1 . . . 1 1 
       3220 1 . . . 1 1 
       3221 1 . . . 1 1 
       3222 1 . . . 1 1 
       3223 1 . . . 1 1 
       3224 1 . . . 1 1 
       3225 1 . . . 1 1 
       3226 1 . . . 1 1 
       3227 1 . . . 1 1 
       3228 1 . . . 1 1 
       3229 1 . . . 1 1 
       3230 1 . . . 1 1 
       3231 1 . . . 1 1 
       3232 1 . . . 1 1 
       3233 1 . . . 1 1 
       3234 1 . . . 1 1 
       3235 1 . . . 1 1 
       3236 1 . . . 1 1 
       3237 1 . . . 1 1 
       3238 1 . . . 1 1 
       3239 1 . . . 1 1 
       3240 1 . . . 1 1 
       3241 1 . . . 1 1 
       3242 1 . . . 1 1 
       3243 1 . . . 1 1 
       3244 1 . . . 1 1 
       3245 1 . . . 1 1 
       3246 1 . . . 1 1 
       3247 1 . . . 1 1 
       3248 1 . . . 1 1 
       3249 1 . . . 1 1 
       3250 1 . . . 1 1 
       3251 1 . . . 1 1 
       3252 1 . . . 1 1 
       3253 1 . . . 1 1 
       3254 1 . . . 1 1 
       3255 1 . . . 1 1 
       3256 1 . . . 1 1 
       3257 1 . . . 1 1 
       3258 1 . . . 1 1 
       3259 1 . . . 1 1 
       3260 1 . . . 1 1 
       3261 1 . . . 1 1 
       3262 1 . . . 1 1 
       3263 1 . . . 1 1 
       3264 1 . . . 1 1 
       3265 1 . . . 1 1 
       3266 1 . . . 1 1 
       3267 1 . . . 1 1 
       3268 1 . . . 1 1 
       3269 1 . . . 1 1 
       3270 1 . . . 1 1 
       3271 1 . . . 1 1 
       3272 1 . . . 1 1 
       3273 1 . . . 1 1 
       3274 1 . . . 1 1 
       3275 1 . . . 1 1 
       3276 1 . . . 1 1 
       3277 1 . . . 1 1 
       3278 1 . . . 1 1 
       3279 1 . . . 1 1 
       3280 1 . . . 1 1 
       3281 1 . . . 1 1 
       3282 1 . . . 1 1 
       3283 1 . . . 1 1 
       3284 1 . . . 1 1 
       3285 1 . . . 1 1 
       3286 1 . . . 1 1 
       3287 1 . . . 1 1 
       3288 1 . . . 1 1 
       3289 1 . . . 1 1 
       3290 1 . . . 1 1 
       3291 1 . . . 1 1 
       3292 1 . . . 1 1 
       3293 1 . . . 1 1 
       3294 1 . . . 1 1 
       3295 1 . . . 1 1 
       3296 1 . . . 1 1 
       3297 1 . . . 1 1 
       3298 1 . . . 1 1 
       3299 1 . . . 1 1 
       3300 1 . . . 1 1 
       3301 1 . . . 1 1 
       3302 1 . . . 1 1 
       3303 1 . . . 1 1 
       3304 1 . . . 1 1 
       3305 1 . . . 1 1 
       3306 1 . . . 1 1 
       3307 1 . . . 1 1 
       3308 1 . . . 1 1 
       3309 1 . . . 1 1 
       3310 1 . . . 1 1 
       3311 1 . . . 1 1 
       3312 1 . . . 1 1 
       3313 1 . . . 1 1 
       3314 1 . . . 1 1 
       3315 1 . . . 1 1 
       3316 1 . . . 1 1 
       3317 1 . . . 1 1 
       3318 1 . . . 1 1 
       3319 1 . . . 1 1 
       3320 1 . . . 1 1 
       3321 1 . . . 1 1 
       3322 1 . . . 1 1 
       3323 1 . . . 1 1 
       3324 1 . . . 1 1 
       3325 1 . . . 1 1 
       3326 1 . . . 1 1 
       3327 1 . . . 1 1 
       3328 1 . . . 1 1 
       3329 1 . . . 1 1 
       3330 1 . . . 1 1 
       3331 1 . . . 1 1 
       3332 1 . . . 1 1 
       3333 1 . . . 1 1 
       3334 1 . . . 1 1 
       3335 1 . . . 1 1 
       3336 1 . . . 1 1 
       3337 1 . . . 1 1 
       3338 1 . . . 1 1 
       3339 1 . . . 1 1 
       3340 1 . . . 1 1 
       3341 1 . . . 1 1 
       3342 1 . . . 1 1 
       3343 1 . . . 1 1 
       3344 1 . . . 1 1 
       3345 1 . . . 1 1 
       3346 1 . . . 1 1 
       3347 1 . . . 1 1 
       3348 1 . . . 1 1 
       3349 1 . . . 1 1 
       3350 1 . . . 1 1 
       3351 1 . . . 1 1 
       3352 1 . . . 1 1 
       3353 1 . . . 1 1 
       3354 1 . . . 1 1 
       3355 1 . . . 1 1 
       3356 1 . . . 1 1 
       3357 1 . . . 1 1 
       3358 1 . . . 1 1 
       3359 1 . . . 1 1 
       3360 1 . . . 1 1 
       3361 1 . . . 1 1 
       3362 1 . . . 1 1 
       3363 1 . . . 1 1 
       3364 1 . . . 1 1 
       3365 1 . . . 1 1 
       3366 1 . . . 1 1 
       3367 1 . . . 1 1 
       3368 1 . . . 1 1 
       3369 1 . . . 1 1 
       3370 1 . . . 1 1 
       3371 1 . . . 1 1 
       3372 1 . . . 1 1 
       3373 1 . . . 1 1 
       3374 1 . . . 1 1 
       3375 1 . . . 1 1 
       3376 1 . . . 1 1 
       3377 1 . . . 1 1 
       3378 1 . . . 1 1 
       3379 1 . . . 1 1 
       3380 1 . . . 1 1 
       3381 1 . . . 1 1 
       3382 1 . . . 1 1 
       3383 1 . . . 1 1 
       3384 1 . . . 1 1 
       3385 1 . . . 1 1 
       3386 1 . . . 1 1 
       3387 1 . . . 1 1 
       3388 1 . . . 1 1 
       3389 1 . . . 1 1 
       3390 1 . . . 1 1 
       3391 1 . . . 1 1 
       3392 1 . . . 1 1 
       3393 1 . . . 1 1 
       3394 1 . . . 1 1 
       3395 1 . . . 1 1 
       3396 1 . . . 1 1 
       3397 1 . . . 1 1 
       3398 1 . . . 1 1 
       3399 1 . . . 1 1 
       3400 1 . . . 1 1 
       3401 1 . . . 1 1 
       3402 1 . . . 1 1 
       3403 1 . . . 1 1 
       3404 1 . . . 1 1 
       3405 1 . . . 1 1 
       3406 1 . . . 1 1 
       3407 1 . . . 1 1 
       3408 1 . . . 1 1 
       3409 1 . . . 1 1 
       3410 1 . . . 1 1 
       3411 1 . . . 1 1 
       3412 1 . . . 1 1 
       3413 1 . . . 1 1 
       3414 1 . . . 1 1 
       3415 1 . . . 1 1 
       3416 1 . . . 1 1 
       3417 1 . . . 1 1 
       3418 1 . . . 1 1 
       3419 1 . . . 1 1 
       3420 1 . . . 1 1 
       3421 1 . . . 1 1 
       3422 1 . . . 1 1 
       3423 1 . . . 1 1 
       3424 1 . . . 1 1 
       3425 1 . . . 1 1 
       3426 1 . . . 1 1 
       3427 1 . . . 1 1 
       3428 1 . . . 1 1 
       3429 1 . . . 1 1 
       3430 1 . . . 1 1 
       3431 1 . . . 1 1 
       3432 1 . . . 1 1 
       3433 1 . . . 1 1 
       3434 1 . . . 1 1 
       3435 1 . . . 1 1 
       3436 1 . . . 1 1 
       3437 1 . . . 1 1 
       3438 1 . . . 1 1 
       3439 1 . . . 1 1 
       3440 1 . . . 1 1 
       3441 1 . . . 1 1 
       3442 1 . . . 1 1 
       3443 1 . . . 1 1 
       3444 1 . . . 1 1 
       3445 1 . . . 1 1 
       3446 1 . . . 1 1 
       3447 1 . . . 1 1 
       3448 1 . . . 1 1 
       3449 1 . . . 1 1 
       3450 1 . . . 1 1 
       3451 1 . . . 1 1 
       3452 1 . . . 1 1 
       3453 1 . . . 1 1 
       3454 1 . . . 1 1 
       3455 1 . . . 1 1 
       3456 1 . . . 1 1 
       3457 1 . . . 1 1 
       3458 1 . . . 1 1 
       3459 1 . . . 1 1 
       3460 1 . . . 1 1 
       3461 1 . . . 1 1 
       3462 1 . . . 1 1 
       3463 1 . . . 1 1 
       3464 1 . . . 1 1 
       3465 1 . . . 1 1 
       3466 1 . . . 1 1 
       3467 1 . . . 1 1 
       3468 1 . . . 1 1 
       3469 1 . . . 1 1 
       3470 1 . . . 1 1 
       3471 1 . . . 1 1 
       3472 1 . . . 1 1 
       3473 1 . . . 1 1 
       3474 1 . . . 1 1 
       3475 1 . . . 1 1 
       3476 1 . . . 1 1 
       3477 1 . . . 1 1 
       3478 1 . . . 1 1 
       3479 1 . . . 1 1 
       3480 1 . . . 1 1 
       3481 1 . . . 1 1 
       3482 1 . . . 1 1 
       3483 1 . . . 1 1 
       3484 1 . . . 1 1 
       3485 1 . . . 1 1 
       3486 1 . . . 1 1 
       3487 1 . . . 1 1 
       3488 1 . . . 1 1 
       3489 1 . . . 1 1 
       3490 1 . . . 1 1 
       3491 1 . . . 1 1 
       3492 1 . . . 1 1 
       3493 1 . . . 1 1 
       3494 1 . . . 1 1 
       3495 1 . . . 1 1 
       3496 1 . . . 1 1 
       3497 1 . . . 1 1 
       3498 1 . . . 1 1 
       3499 1 . . . 1 1 
       3500 1 . . . 1 1 
       3501 1 . . . 1 1 
       3502 1 . . . 1 1 
       3503 1 . . . 1 1 
       3504 1 . . . 1 1 
       3505 1 . . . 1 1 
       3506 1 . . . 1 1 
       3507 1 . . . 1 1 
       3508 1 . . . 1 1 
       3509 1 . . . 1 1 
       3510 1 . . . 1 1 
       3511 1 . . . 1 1 
       3512 1 . . . 1 1 
       3513 1 . . . 1 1 
       3514 1 . . . 1 1 
       3515 1 . . . 1 1 
       3516 1 . . . 1 1 
       3517 1 . . . 1 1 
       3518 1 . . . 1 1 
       3519 1 . . . 1 1 
       3520 1 . . . 1 1 
       3521 1 . . . 1 1 
       3522 1 . . . 1 1 
       3523 1 . . . 1 1 
       3524 1 . . . 1 1 
       3525 1 . . . 1 1 
       3526 1 . . . 1 1 
       3527 1 . . . 1 1 
       3528 1 . . . 1 1 
       3529 1 . . . 1 1 
       3530 1 . . . 1 1 
       3531 1 . . . 1 1 
       3532 1 . . . 1 1 
       3533 1 . . . 1 1 
       3534 1 . . . 1 1 
       3535 1 . . . 1 1 
       3536 1 . . . 1 1 
       3537 1 . . . 1 1 
       3538 1 . . . 1 1 
       3539 1 . . . 1 1 
       3540 1 . . . 1 1 
       3541 1 . . . 1 1 
       3542 1 . . . 1 1 
       3543 1 . . . 1 1 
       3544 1 . . . 1 1 
       3545 1 . . . 1 1 
       3546 1 . . . 1 1 
       3547 1 . . . 1 1 
       3548 1 . . . 1 1 
       3549 1 . . . 1 1 
       3550 1 . . . 1 1 
       3551 1 . . . 1 1 
       3552 1 . . . 1 1 
       3553 1 . . . 1 1 
       3554 1 . . . 1 1 
       3555 1 . . . 1 1 
       3556 1 . . . 1 1 
       3557 1 . . . 1 1 
       3558 1 . . . 1 1 
       3559 1 . . . 1 1 
       3560 1 . . . 1 1 
       3561 1 . . . 1 1 
       3562 1 . . . 1 1 
       3563 1 . . . 1 1 
       3564 1 . . . 1 1 
       3565 1 . . . 1 1 
       3566 1 . . . 1 1 
       3567 1 . . . 1 1 
       3568 1 . . . 1 1 
       3569 1 . . . 1 1 
       3570 1 . . . 1 1 
       3571 1 . . . 1 1 
       3572 1 . . . 1 1 
       3573 1 . . . 1 1 
       3574 1 . . . 1 1 
       3575 1 . . . 1 1 
       3576 1 . . . 1 1 
       3577 1 . . . 1 1 
       3578 1 . . . 1 1 
       3579 1 . . . 1 1 
       3580 1 . . . 1 1 
       3581 1 . . . 1 1 
       3582 1 . . . 1 1 
       3583 1 . . . 1 1 
       3584 1 . . . 1 1 
       3585 1 . . . 1 1 
       3586 1 . . . 1 1 
       3587 1 . . . 1 1 
       3588 1 . . . 1 1 
       3589 1 . . . 1 1 
       3590 1 . . . 1 1 
       3591 1 . . . 1 1 
       3592 1 . . . 1 1 
       3593 1 . . . 1 1 
       3594 1 . . . 1 1 
       3595 1 . . . 1 1 
       3596 1 . . . 1 1 
       3597 1 . . . 1 1 
       3598 1 . . . 1 1 
       3599 1 . . . 1 1 
       3600 1 . . . 1 1 
       3601 1 . . . 1 1 
       3602 1 . . . 1 1 
       3603 1 . . . 1 1 
       3604 1 . . . 1 1 
       3605 1 . . . 1 1 
       3606 1 . . . 1 1 
       3607 1 . . . 1 1 
       3608 1 . . . 1 1 
       3609 1 . . . 1 1 
       3610 1 . . . 1 1 
       3611 1 . . . 1 1 
       3612 1 . . . 1 1 
       3613 1 . . . 1 1 
       3614 1 . . . 1 1 
       3615 1 . . . 1 1 
       3616 1 . . . 1 1 
       3617 1 . . . 1 1 
       3618 1 . . . 1 1 
       3619 1 . . . 1 1 
       3620 1 . . . 1 1 
       3621 1 . . . 1 1 
       3622 1 . . . 1 1 
       3623 1 . . . 1 1 
       3624 1 . . . 1 1 
       3625 1 . . . 1 1 
       3626 1 . . . 1 1 
       3627 1 . . . 1 1 
       3628 1 . . . 1 1 
       3629 1 . . . 1 1 
       3630 1 . . . 1 1 
       3631 1 . . . 1 1 
       3632 1 . . . 1 1 
       3633 1 . . . 1 1 
       3634 1 . . . 1 1 
       3635 1 . . . 1 1 
       3636 1 . . . 1 1 
       3637 1 . . . 1 1 
       3638 1 . . . 1 1 
       3639 1 . . . 1 1 
       3640 1 . . . 1 1 
       3641 1 . . . 1 1 
       3642 1 . . . 1 1 
       3643 1 . . . 1 1 
       3644 1 . . . 1 1 
       3645 1 . . . 1 1 
       3646 1 . . . 1 1 
       3647 1 . . . 1 1 
       3648 1 . . . 1 1 
       3649 1 . . . 1 1 
       3650 1 . . . 1 1 
       3651 1 . . . 1 1 
       3652 1 . . . 1 1 
       3653 1 . . . 1 1 
       3654 1 . . . 1 1 
       3655 1 . . . 1 1 
       3656 1 . . . 1 1 
       3657 1 . . . 1 1 
       3658 1 . . . 1 1 
       3659 1 . . . 1 1 
       3660 1 . . . 1 1 
       3661 1 . . . 1 1 
       3662 1 . . . 1 1 
       3663 1 . . . 1 1 
       3664 1 . . . 1 1 
       3665 1 . . . 1 1 
       3666 1 . . . 1 1 
       3667 1 . . . 1 1 
       3668 1 . . . 1 1 
       3669 1 . . . 1 1 
       3670 1 . . . 1 1 
       3671 1 . . . 1 1 
       3672 1 . . . 1 1 
       3673 1 . . . 1 1 
       3674 1 . . . 1 1 
       3675 1 . . . 1 1 
       3676 1 . . . 1 1 
       3677 1 . . . 1 1 
       3678 1 . . . 1 1 
       3679 1 . . . 1 1 
       3680 1 . . . 1 1 
       3681 1 . . . 1 1 
       3682 1 . . . 1 1 
       3683 1 . . . 1 1 
       3684 1 . . . 1 1 
       3685 1 . . . 1 1 
       3686 1 . . . 1 1 
       3687 1 . . . 1 1 
       3688 1 . . . 1 1 
       3689 1 . . . 1 1 
       3690 1 . . . 1 1 
       3691 1 . . . 1 1 
       3692 1 . . . 1 1 
       3693 1 . . . 1 1 
       3694 1 . . . 1 1 
       3695 1 . . . 1 1 
       3696 1 . . . 1 1 
       3697 1 . . . 1 1 
       3698 1 . . . 1 1 
       3699 1 . . . 1 1 
       3700 1 . . . 1 1 
       3701 1 . . . 1 1 
       3702 1 . . . 1 1 
       3703 1 . . . 1 1 
       3704 1 . . . 1 1 
       3705 1 . . . 1 1 
       3706 1 . . . 1 1 
       3707 1 . . . 1 1 
       3708 1 . . . 1 1 
       3709 1 . . . 1 1 
       3710 1 . . . 1 1 
       3711 1 . . . 1 1 
       3712 1 . . . 1 1 
       3713 1 . . . 1 1 
       3714 1 . . . 1 1 
       3715 1 . . . 1 1 
       3716 1 . . . 1 1 
       3717 1 . . . 1 1 
       3718 1 . . . 1 1 
       3719 1 . . . 1 1 
       3720 1 . . . 1 1 
       3721 1 . . . 1 1 
       3722 1 . . . 1 1 
       3723 1 . . . 1 1 
       3724 1 . . . 1 1 
       3725 1 . . . 1 1 
       3726 1 . . . 1 1 
       3727 1 . . . 1 1 
       3728 1 . . . 1 1 
       3729 1 . . . 1 1 
       3730 1 . . . 1 1 
       3731 1 . . . 1 1 
       3732 1 . . . 1 1 
       3733 1 . . . 1 1 
       3734 1 . . . 1 1 
       3735 1 . . . 1 1 
       3736 1 . . . 1 1 
       3737 1 . . . 1 1 
       3738 1 . . . 1 1 
       3739 1 . . . 1 1 
       3740 1 . . . 1 1 
       3741 1 . . . 1 1 
       3742 1 . . . 1 1 
       3743 1 . . . 1 1 
       3744 1 . . . 1 1 
       3745 1 . . . 1 1 
       3746 1 . . . 1 1 
       3747 1 . . . 1 1 
       3748 1 . . . 1 1 
       3749 1 . . . 1 1 
       3750 1 . . . 1 1 
       3751 1 . . . 1 1 
       3752 1 . . . 1 1 
       3753 1 . . . 1 1 
       3754 1 . . . 1 1 
       3755 1 . . . 1 1 
       3756 1 . . . 1 1 
       3757 1 . . . 1 1 
       3758 1 . . . 1 1 
       3759 1 . . . 1 1 
       3760 1 . . . 1 1 
       3761 1 . . . 1 1 
       3762 1 . . . 1 1 
       3763 1 . . . 1 1 
       3764 1 . . . 1 1 
       3765 1 . . . 1 1 
       3766 1 . . . 1 1 
       3767 1 . . . 1 1 
       3768 1 . . . 1 1 
       3769 1 . . . 1 1 
       3770 1 . . . 1 1 
       3771 1 . . . 1 1 
       3772 1 . . . 1 1 
       3773 1 . . . 1 1 
       3774 1 . . . 1 1 
       3775 1 . . . 1 1 
       3776 1 . . . 1 1 
       3777 1 . . . 1 1 
       3778 1 . . . 1 1 
       3779 1 . . . 1 1 
       3780 1 . . . 1 1 
       3781 1 . . . 1 1 
       3782 1 . . . 1 1 
       3783 1 . . . 1 1 
       3784 1 . . . 1 1 
       3785 1 . . . 1 1 
       3786 1 . . . 1 1 
       3787 1 . . . 1 1 
       3788 1 . . . 1 1 
       3789 1 . . . 1 1 
       3790 1 . . . 1 1 
       3791 1 . . . 1 1 
       3792 1 . . . 1 1 
       3793 1 . . . 1 1 
       3794 1 . . . 1 1 
       3795 1 . . . 1 1 
       3796 1 . . . 1 1 
       3797 1 . . . 1 1 
       3798 1 . . . 1 1 
       3799 1 . . . 1 1 
       3800 1 . . . 1 1 
       3801 1 . . . 1 1 
       3802 1 . . . 1 1 
       3803 1 . . . 1 1 
       3804 1 . . . 1 1 
       3805 1 . . . 1 1 
       3806 1 . . . 1 1 
       3807 1 . . . 1 1 
       3808 1 . . . 1 1 
       3809 1 . . . 1 1 
       3810 1 . . . 1 1 
       3811 1 . . . 1 1 
       3812 1 . . . 1 1 
       3813 1 . . . 1 1 
       3814 1 . . . 1 1 
       3815 1 . . . 1 1 
       3816 1 . . . 1 1 
       3817 1 . . . 1 1 
       3818 1 . . . 1 1 
       3819 1 . . . 1 1 
       3820 1 . . . 1 1 
       3821 1 . . . 1 1 
       3822 1 . . . 1 1 
       3823 1 . . . 1 1 
       3824 1 . . . 1 1 
       3825 1 . . . 1 1 
       3826 1 . . . 1 1 
       3827 1 . . . 1 1 
       3828 1 . . . 1 1 
       3829 1 . . . 1 1 
       3830 1 . . . 1 1 
       3831 1 . . . 1 1 
       3832 1 . . . 1 1 
       3833 1 . . . 1 1 
       3834 1 . . . 1 1 
       3835 1 . . . 1 1 
       3836 1 . . . 1 1 
       3837 1 . . . 1 1 
       3838 1 . . . 1 1 
       3839 1 . . . 1 1 
       3840 1 . . . 1 1 
       3841 1 . . . 1 1 
       3842 1 . . . 1 1 
       3843 1 . . . 1 1 
       3844 1 . . . 1 1 
       3845 1 . . . 1 1 
       3846 1 . . . 1 1 
       3847 1 . . . 1 1 
       3848 1 . . . 1 1 
       3849 1 . . . 1 1 
       3850 1 . . . 1 1 
       3851 1 . . . 1 1 
       3852 1 . . . 1 1 
       3853 1 . . . 1 1 
       3854 1 . . . 1 1 
       3855 1 . . . 1 1 
       3856 1 . . . 1 1 
       3857 1 . . . 1 1 
       3858 1 . . . 1 1 
       3859 1 . . . 1 1 
       3860 1 . . . 1 1 
       3861 1 . . . 1 1 
       3862 1 . . . 1 1 
       3863 1 . . . 1 1 
       3864 1 . . . 1 1 
       3865 1 . . . 1 1 
       3866 1 . . . 1 1 
       3867 1 . . . 1 1 
       3868 1 . . . 1 1 
       3869 1 . . . 1 1 
       3870 1 . . . 1 1 
       3871 1 . . . 1 1 
       3872 1 . . . 1 1 
       3873 1 . . . 1 1 
       3874 1 . . . 1 1 
       3875 1 . . . 1 1 
       3876 1 . . . 1 1 
       3877 1 . . . 1 1 
       3878 1 . . . 1 1 
       3879 1 . . . 1 1 
       3880 1 . . . 1 1 
       3881 1 . . . 1 1 
       3882 1 . . . 1 1 
       3883 1 . . . 1 1 
       3884 1 . . . 1 1 
       3885 1 . . . 1 1 
       3886 1 . . . 1 1 
       3887 1 . . . 1 1 
       3888 1 . . . 1 1 
       3889 1 . . . 1 1 
       3890 1 . . . 1 1 
       3891 1 . . . 1 1 
       3892 1 . . . 1 1 
       3893 1 . . . 1 1 
       3894 1 . . . 1 1 
       3895 1 . . . 1 1 
       3896 1 . . . 1 1 
       3897 1 . . . 1 1 
       3898 1 . . . 1 1 
       3899 1 . . . 1 1 
       3900 1 . . . 1 1 
       3901 1 . . . 1 1 
       3902 1 . . . 1 1 
       3903 1 . . . 1 1 
       3904 1 . . . 1 1 
       3905 1 . . . 1 1 
       3906 1 . . . 1 1 
       3907 1 . . . 1 1 
       3908 1 . . . 1 1 
       3909 1 . . . 1 1 
       3910 1 . . . 1 1 
       3911 1 . . . 1 1 
       3912 1 . . . 1 1 
       3913 1 . . . 1 1 
       3914 1 . . . 1 1 
       3915 1 . . . 1 1 
       3916 1 . . . 1 1 
       3917 1 . . . 1 1 
       3918 1 . . . 1 1 
       3919 1 . . . 1 1 
       3920 1 . . . 1 1 
       3921 1 . . . 1 1 
       3922 1 . . . 1 1 
       3923 1 . . . 1 1 
       3924 1 . . . 1 1 
       3925 1 . . . 1 1 
       3926 1 . . . 1 1 
       3927 1 . . . 1 1 
       3928 1 . . . 1 1 
       3929 1 . . . 1 1 
       3930 1 . . . 1 1 
       3931 1 . . . 1 1 
       3932 1 . . . 1 1 
       3933 1 . . . 1 1 
       3934 1 . . . 1 1 
       3935 1 . . . 1 1 
       3936 1 . . . 1 1 
       3937 1 . . . 1 1 
       3938 1 . . . 1 1 
       3939 1 . . . 1 1 
       3940 1 . . . 1 1 
       3941 1 . . . 1 1 
       3942 1 . . . 1 1 
       3943 1 . . . 1 1 
       3944 1 . . . 1 1 
       3945 1 . . . 1 1 
       3946 1 . . . 1 1 
       3947 1 . . . 1 1 
       3948 1 . . . 1 1 
       3949 1 . . . 1 1 
       3950 1 . . . 1 1 
       3951 1 . . . 1 1 
       3952 1 . . . 1 1 
       3953 1 . . . 1 1 
       3954 1 . . . 1 1 
       3955 1 . . . 1 1 
       3956 1 . . . 1 1 
       3957 1 . . . 1 1 
       3958 1 . . . 1 1 
       3959 1 . . . 1 1 
       3960 1 . . . 1 1 
       3961 1 . . . 1 1 
       3962 1 . . . 1 1 
       3963 1 . . . 1 1 
       3964 1 . . . 1 1 
       3965 1 . . . 1 1 
       3966 1 . . . 1 1 
       3967 1 . . . 1 1 
       3968 1 . . . 1 1 
       3969 1 . . . 1 1 
       3970 1 . . . 1 1 
       3971 1 . . . 1 1 
       3972 1 . . . 1 1 
       3973 1 . . . 1 1 
       3974 1 . . . 1 1 
       3975 1 . . . 1 1 
       3976 1 . . . 1 1 
       3977 1 . . . 1 1 
       3978 1 . . . 1 1 
       3979 1 . . . 1 1 
       3980 1 . . . 1 1 
       3981 1 . . . 1 1 
       3982 1 . . . 1 1 
       3983 1 . . . 1 1 
       3984 1 . . . 1 1 
       3985 1 . . . 1 1 
       3986 1 . . . 1 1 
       3987 1 . . . 1 1 
       3988 1 . . . 1 1 
       3989 1 . . . 1 1 
       3990 1 . . . 1 1 
       3991 1 . . . 1 1 
       3992 1 . . . 1 1 
       3993 1 . . . 1 1 
       3994 1 . . . 1 1 
       3995 1 . . . 1 1 
       3996 1 . . . 1 1 
       3997 1 . . . 1 1 
       3998 1 . . . 1 1 
       3999 1 . . . 1 1 
       4000 1 . . . 1 1 
       4001 1 . . . 1 1 
       4002 1 . . . 1 1 
       4003 1 . . . 1 1 
       4004 1 . . . 1 1 
       4005 1 . . . 1 1 
       4006 1 . . . 1 1 
       4007 1 . . . 1 1 
       4008 1 . . . 1 1 
       4009 1 . . . 1 1 
       4010 1 . . . 1 1 
       4011 1 . . . 1 1 
       4012 1 . . . 1 1 
       4013 1 . . . 1 1 
       4014 1 . . . 1 1 
       4015 1 . . . 1 1 
       4016 1 . . . 1 1 
       4017 1 . . . 1 1 
       4018 1 . . . 1 1 
       4019 1 . . . 1 1 
       4020 1 . . . 1 1 
       4021 1 . . . 1 1 
       4022 1 . . . 1 1 
       4023 1 . . . 1 1 
       4024 1 . . . 1 1 
       4025 1 . . . 1 1 
       4026 1 . . . 1 1 
       4027 1 . . . 1 1 
       4028 1 . . . 1 1 
       4029 1 . . . 1 1 
       4030 1 . . . 1 1 
       4031 1 . . . 1 1 
       4032 1 . . . 1 1 
       4033 1 . . . 1 1 
       4034 1 . . . 1 1 
       4035 1 . . . 1 1 
       4036 1 . . . 1 1 
       4037 1 . . . 1 1 
       4038 1 . . . 1 1 
       4039 1 . . . 1 1 
       4040 1 . . . 1 1 
       4041 1 . . . 1 1 
       4042 1 . . . 1 1 
       4043 1 . . . 1 1 
       4044 1 . . . 1 1 
       4045 1 . . . 1 1 
       4046 1 . . . 1 1 
       4047 1 . . . 1 1 
       4048 1 . . . 1 1 
       4049 1 . . . 1 1 
       4050 1 . . . 1 1 
       4051 1 . . . 1 1 
       4052 1 . . . 1 1 
       4053 1 . . . 1 1 
       4054 1 . . . 1 1 
       4055 1 . . . 1 1 
       4056 1 . . . 1 1 
       4057 1 . . . 1 1 
       4058 1 . . . 1 1 
       4059 1 . . . 1 1 
       4060 1 . . . 1 1 
       4061 1 . . . 1 1 
       4062 1 . . . 1 1 
       4063 1 . . . 1 1 
       4064 1 . . . 1 1 
       4065 1 . . . 1 1 
       4066 1 . . . 1 1 
       4067 1 . . . 1 1 
       4068 1 . . . 1 1 
       4069 1 . . . 1 1 
       4070 1 . . . 1 1 
       4071 1 . . . 1 1 
       4072 1 . . . 1 1 
       4073 1 . . . 1 1 
       4074 1 . . . 1 1 
       4075 1 . . . 1 1 
       4076 1 . . . 1 1 
       4077 1 . . . 1 1 
       4078 1 . . . 1 1 
       4079 1 . . . 1 1 
       4080 1 . . . 1 1 
       4081 1 . . . 1 1 
       4082 1 . . . 1 1 
       4083 1 . . . 1 1 
       4084 1 . . . 1 1 
       4085 1 . . . 1 1 
       4086 1 . . . 1 1 
       4087 1 . . . 1 1 
       4088 1 . . . 1 1 
       4089 1 . . . 1 1 
       4090 1 . . . 1 1 
       4091 1 . . . 1 1 
       4092 1 . . . 1 1 
       4093 1 . . . 1 1 
       4094 1 . . . 1 1 
       4095 1 . . . 1 1 
       4096 1 . . . 1 1 
       4097 1 . . . 1 1 
       4098 1 . . . 1 1 
       4099 1 . . . 1 1 
       4100 1 . . . 1 1 
       4101 1 . . . 1 1 
       4102 1 . . . 1 1 
       4103 1 . . . 1 1 
       4104 1 . . . 1 1 
       4105 1 . . . 1 1 
       4106 1 . . . 1 1 
       4107 1 . . . 1 1 
       4108 1 . . . 1 1 
       4109 1 . . . 1 1 
       4110 1 . . . 1 1 
       4111 1 . . . 1 1 
       4112 1 . . . 1 1 
       4113 1 . . . 1 1 
       4114 1 . . . 1 1 
       4115 1 . . . 1 1 
       4116 1 . . . 1 1 
       4117 1 . . . 1 1 
       4118 1 . . . 1 1 
       4119 1 . . . 1 1 
       4120 1 . . . 1 1 
       4121 1 . . . 1 1 
       4122 1 . . . 1 1 
       4123 1 . . . 1 1 
       4124 1 . . . 1 1 
       4125 1 . . . 1 1 
       4126 1 . . . 1 1 
       4127 1 . . . 1 1 
       4128 1 . . . 1 1 
       4129 1 . . . 1 1 
       4130 1 . . . 1 1 
       4131 1 . . . 1 1 
       4132 1 . . . 1 1 
       4133 1 . . . 1 1 
       4134 1 . . . 1 1 
       4135 1 . . . 1 1 
       4136 1 . . . 1 1 
       4137 1 . . . 1 1 
       4138 1 . . . 1 1 
       4139 1 . . . 1 1 
       4140 1 . . . 1 1 
       4141 1 . . . 1 1 
       4142 1 . . . 1 1 
       4143 1 . . . 1 1 
       4144 1 . . . 1 1 
       4145 1 . . . 1 1 
       4146 1 . . . 1 1 
       4147 1 . . . 1 1 
       4148 1 . . . 1 1 
       4149 1 . . . 1 1 
       4150 1 . . . 1 1 
       4151 1 . . . 1 1 
       4152 1 . . . 1 1 
       4153 1 . . . 1 1 
       4154 1 . . . 1 1 
       4155 1 . . . 1 1 
       4156 1 . . . 1 1 
       4157 1 . . . 1 1 
       4158 1 . . . 1 1 
       4159 1 . . . 1 1 
       4160 1 . . . 1 1 
       4161 1 . . . 1 1 
       4162 1 . . . 1 1 
       4163 1 . . . 1 1 
       4164 1 . . . 1 1 
       4165 1 . . . 1 1 
       4166 1 . . . 1 1 
       4167 1 . . . 1 1 
       4168 1 . . . 1 1 
       4169 1 . . . 1 1 
       4170 1 . . . 1 1 
       4171 1 . . . 1 1 
       4172 1 . . . 1 1 
       4173 1 . . . 1 1 
       4174 1 . . . 1 1 
       4175 1 . . . 1 1 
       4176 1 . . . 1 1 
       4177 1 . . . 1 1 
       4178 1 . . . 1 1 
       4179 1 . . . 1 1 
       4180 1 . . . 1 1 
       4181 1 . . . 1 1 
       4182 1 . . . 1 1 
       4183 1 . . . 1 1 
       4184 1 . . . 1 1 
       4185 1 . . . 1 1 
       4186 1 . . . 1 1 
       4187 1 . . . 1 1 
       4188 1 . . . 1 1 
       4189 1 . . . 1 1 
       4190 1 . . . 1 1 
       4191 1 . . . 1 1 
       4192 1 . . . 1 1 
       4193 1 . . . 1 1 
       4194 1 . . . 1 1 
       4195 1 . . . 1 1 
       4196 1 . . . 1 1 
       4197 1 . . . 1 1 
       4198 1 . . . 1 1 
       4199 1 . . . 1 1 
       4200 1 . . . 1 1 
       4201 1 . . . 1 1 
       4202 1 . . . 1 1 
       4203 1 . . . 1 1 
       4204 1 . . . 1 1 
       4205 1 . . . 1 1 
       4206 1 . . . 1 1 
       4207 1 . . . 1 1 
       4208 1 . . . 1 1 
       4209 1 . . . 1 1 
       4210 1 . . . 1 1 
       4211 1 . . . 1 1 
       4212 1 . . . 1 1 
       4213 1 . . . 1 1 
       4214 1 . . . 1 1 
       4215 1 . . . 1 1 
       4216 1 . . . 1 1 
       4217 1 . . . 1 1 
       4218 1 . . . 1 1 
       4219 1 . . . 1 1 
       4220 1 . . . 1 1 
       4221 1 . . . 1 1 
       4222 1 . . . 1 1 
       4223 1 . . . 1 1 
       4224 1 . . . 1 1 
       4225 1 . . . 1 1 
       4226 1 . . . 1 1 
       4227 1 . . . 1 1 
       4228 1 . . . 1 1 
       4229 1 . . . 1 1 
       4230 1 . . . 1 1 
       4231 1 . . . 1 1 
       4232 1 . . . 1 1 
       4233 1 . . . 1 1 
       4234 1 . . . 1 1 
       4235 1 . . . 1 1 
       4236 1 . . . 1 1 
       4237 1 . . . 1 1 
       4238 1 . . . 1 1 
       4239 1 . . . 1 1 
       4240 1 . . . 1 1 
       4241 1 . . . 1 1 
       4242 1 . . . 1 1 
       4243 1 . . . 1 1 
       4244 1 . . . 1 1 
       4245 1 . . . 1 1 
       4246 1 . . . 1 1 
       4247 1 . . . 1 1 
       4248 1 . . . 1 1 
       4249 1 . . . 1 1 
       4250 1 . . . 1 1 
       4251 1 . . . 1 1 
       4252 1 . . . 1 1 
       4253 1 . . . 1 1 
       4254 1 . . . 1 1 
       4255 1 . . . 1 1 
       4256 1 . . . 1 1 
       4257 1 . . . 1 1 
       4258 1 . . . 1 1 
       4259 1 . . . 1 1 
       4260 1 . . . 1 1 
       4261 1 . . . 1 1 
       4262 1 . . . 1 1 
       4263 1 . . . 1 1 
       4264 1 . . . 1 1 
       4265 1 . . . 1 1 
       4266 1 . . . 1 1 
       4267 1 . . . 1 1 
       4268 1 . . . 1 1 
       4269 1 . . . 1 1 
       4270 1 . . . 1 1 
       4271 1 . . . 1 1 
       4272 1 . . . 1 1 
       4273 1 . . . 1 1 
       4274 1 . . . 1 1 
       4275 1 . . . 1 1 
       4276 1 . . . 1 1 
       4277 1 . . . 1 1 
       4278 1 . . . 1 1 
       4279 1 . . . 1 1 
       4280 1 . . . 1 1 
       4281 1 . . . 1 1 
       4282 1 . . . 1 1 
       4283 1 . . . 1 1 
       4284 1 . . . 1 1 
       4285 1 . . . 1 1 
       4286 1 . . . 1 1 
       4287 1 . . . 1 1 
       4288 1 . . . 1 1 
       4289 1 . . . 1 1 
       4290 1 . . . 1 1 
       4291 1 . . . 1 1 
       4292 1 . . . 1 1 
       4293 1 . . . 1 1 
       4294 1 . . . 1 1 
       4295 1 . . . 1 1 
       4296 1 . . . 1 1 
       4297 1 . . . 1 1 
       4298 1 . . . 1 1 
       4299 1 . . . 1 1 
       4300 1 . . . 1 1 
       4301 1 . . . 1 1 
       4302 1 . . . 1 1 
       4303 1 . . . 1 1 
       4304 1 . . . 1 1 
       4305 1 . . . 1 1 
       4306 1 . . . 1 1 
       4307 1 . . . 1 1 
       4308 1 . . . 1 1 
       4309 1 . . . 1 1 
       4310 1 . . . 1 1 
       4311 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
          1 1 2 1 1   3 GLU H    .   3 . HN   1 1 
          2 1 1 1 1   2 LYS HB2  .   2 . HB2  1 1 
          2 1 2 1 1   3 GLU H    .   3 . HN   1 1 
          3 1 1 1 1   2 LYS HB3  .   2 . HB1  1 1 
          3 1 2 1 1   3 GLU H    .   3 . HN   1 1 
          4 1 1 1 1   2 LYS HG2  .   2 . HG2  1 1 
          4 1 2 1 1   3 GLU H    .   3 . HN   1 1 
          5 1 1 1 1   2 LYS HG3  .   2 . HG1  1 1 
          5 1 2 1 1   3 GLU H    .   3 . HN   1 1 
          6 1 1 1 1   3 GLU H    .   3 . HN   1 1 
          6 1 2 1 1   4 LEU H    .   4 . HN   1 1 
          7 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
          7 1 2 1 1   4 LEU H    .   4 . HN   1 1 
          8 1 1 1 1   3 GLU HB2  .   3 . HB2  1 1 
          8 1 2 1 1   4 LEU H    .   4 . HN   1 1 
          9 1 1 1 1   3 GLU HB3  .   3 . HB1  1 1 
          9 1 2 1 1   4 LEU H    .   4 . HN   1 1 
         10 1 1 1 1   5 ILE H    .   5 . HN   1 1 
         10 1 2 1 1  56 ILE H    .  56 . HN   1 1 
         11 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
         11 1 2 1 1   5 ILE H    .   5 . HN   1 1 
         12 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
         12 1 2 1 1   5 ILE H    .   5 . HN   1 1 
         13 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
         13 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         14 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
         14 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         15 1 1 1 1   5 ILE HG12 .   5 . HG12 1 1 
         15 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         16 1 1 1 1   5 ILE HG13 .   5 . HG11 1 1 
         16 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         17 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
         17 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         18 1 1 1 1   6 LEU H    .   6 . HN   1 1 
         18 1 2 1 1   7 ILE H    .   7 . HN   1 1 
         19 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
         19 1 2 1 1   7 ILE H    .   7 . HN   1 1 
         20 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
         20 1 2 1 1   7 ILE H    .   7 . HN   1 1 
         21 1 1 1 1   7 ILE H    .   7 . HN   1 1 
         21 1 2 1 1   7 ILE MG   .   7 . HG2* 1 1 
         22 1 1 1 1   7 ILE H    .   7 . HN   1 1 
         22 1 2 1 1   8 ASN H    .   8 . HN   1 1 
         23 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
         23 1 2 1 1   8 ASN H    .   8 . HN   1 1 
         24 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
         24 1 2 1 1   8 ASN H    .   8 . HN   1 1 
         25 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
         25 1 2 1 1   8 ASN H    .   8 . HN   1 1 
         26 1 1 1 1   8 ASN H    .   8 . HN   1 1 
         26 1 2 1 1   9 THR H    .   9 . HN   1 1 
         27 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
         27 1 2 1 1   9 THR H    .   9 . HN   1 1 
         28 1 1 1 1   8 ASN HB2  .   8 . HB2  1 1 
         28 1 2 1 1   9 THR H    .   9 . HN   1 1 
         29 1 1 1 1   8 ASN HB3  .   8 . HB1  1 1 
         29 1 2 1 1   9 THR H    .   9 . HN   1 1 
         30 1 1 1 1   8 ASN HD21 .   8 . HD21 1 1 
         30 1 2 1 1   9 THR H    .   9 . HN   1 1 
         31 1 1 1 1   8 ASN HD22 .   8 . HD22 1 1 
         31 1 2 1 1   9 THR H    .   9 . HN   1 1 
         32 1 1 1 1   9 THR H    .   9 . HN   1 1 
         32 1 2 1 1  10 ASN H    .  10 . HN   1 1 
         33 1 1 1 1   9 THR HA   .   9 . HA   1 1 
         33 1 2 1 1  10 ASN H    .  10 . HN   1 1 
         34 1 1 1 1   9 THR HB   .   9 . HB   1 1 
         34 1 2 1 1  10 ASN H    .  10 . HN   1 1 
         35 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
         35 1 2 1 1  10 ASN H    .  10 . HN   1 1 
         36 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
         36 1 2 1 1  10 ASN H    .  10 . HN   1 1 
         37 1 1 1 1  10 ASN HB2  .  10 . HB2  1 1 
         37 1 2 1 1  11 ASN H    .  11 . HN   1 1 
         38 1 1 1 1  11 ASN HA   .  11 . HA   1 1 
         38 1 2 1 1  12 ASP H    .  12 . HN   1 1 
         39 1 1 1 1  11 ASN HB2  .  11 . HB2  1 1 
         39 1 2 1 1  12 ASP H    .  12 . HN   1 1 
         40 1 1 1 1  11 ASN HB3  .  11 . HB1  1 1 
         40 1 2 1 1  12 ASP H    .  12 . HN   1 1 
         41 1 1 1 1  12 ASP HB3  .  12 . HB1  1 1 
         41 1 2 1 1  13 GLU H    .  13 . HN   1 1 
         42 1 1 1 1  13 GLU H    .  13 . HN   1 1 
         42 1 2 1 1  14 LEU H    .  14 . HN   1 1 
         43 1 1 1 1  13 GLU HB3  .  13 . HB1  1 1 
         43 1 2 1 1  14 LEU H    .  14 . HN   1 1 
         44 1 1 1 1  13 GLU HG3  .  13 . HG1  1 1 
         44 1 2 1 1  14 LEU H    .  14 . HN   1 1 
         45 1 1 1 1  14 LEU HB2  .  14 . HB2  1 1 
         45 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         46 1 1 1 1  14 LEU HB3  .  14 . HB1  1 1 
         46 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         47 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
         47 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         48 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
         48 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         49 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
         49 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         50 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
         50 1 2 1 1  16 LYS H    .  16 . HN   1 1 
         51 1 1 1 1  15 ILE HG12 .  15 . HG12 1 1 
         51 1 2 1 1  16 LYS H    .  16 . HN   1 1 
         52 1 1 1 1  15 ILE HG13 .  15 . HG11 1 1 
         52 1 2 1 1  16 LYS H    .  16 . HN   1 1 
         53 1 1 1 1  16 LYS HG2  .  16 . HG2  1 1 
         53 1 2 1 1  17 LYS H    .  17 . HN   1 1 
         54 1 1 1 1  17 LYS H    .  17 . HN   1 1 
         54 1 2 1 1  18 ILE H    .  18 . HN   1 1 
         55 1 1 1 1  17 LYS HB2  .  17 . HB2  1 1 
         55 1 2 1 1  18 ILE H    .  18 . HN   1 1 
         56 1 1 1 1  17 LYS HB3  .  17 . HB1  1 1 
         56 1 2 1 1  18 ILE H    .  18 . HN   1 1 
         57 1 1 1 1  19 LYS H    .  19 . HN   1 1 
         57 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
         58 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
         58 1 2 1 1  19 LYS H    .  19 . HN   1 1 
         59 1 1 1 1  19 LYS H    .  19 . HN   1 1 
         59 1 2 1 1  20 LYS H    .  20 . HN   1 1 
         60 1 1 1 1  19 LYS HG2  .  19 . HG2  1 1 
         60 1 2 1 1  20 LYS H    .  20 . HN   1 1 
         61 1 1 1 1  19 LYS HG3  .  19 . HG1  1 1 
         61 1 2 1 1  20 LYS H    .  20 . HN   1 1 
         62 1 1 1 1  20 LYS HG2  .  20 . HG2  1 1 
         62 1 2 1 1  21 GLU H    .  21 . HN   1 1 
         63 1 1 1 1  20 LYS HE2  .  20 . HE2  1 1 
         63 1 2 1 1  21 GLU H    .  21 . HN   1 1 
         64 1 1 1 1  20 LYS HE3  .  20 . HE1  1 1 
         64 1 2 1 1  21 GLU H    .  21 . HN   1 1 
         65 1 1 1 1  21 GLU HB3  .  21 . HB1  1 1 
         65 1 2 1 1  22 VAL H    .  22 . HN   1 1 
         66 1 1 1 1  22 VAL HB   .  22 . HB   1 1 
         66 1 2 1 1  23 GLU H    .  23 . HN   1 1 
         67 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
         67 1 2 1 1  23 GLU H    .  23 . HN   1 1 
         68 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
         68 1 2 1 1  23 GLU H    .  23 . HN   1 1 
         69 1 1 1 1  23 GLU H    .  23 . HN   1 1 
         69 1 2 1 1  24 ASN H    .  24 . HN   1 1 
         70 1 1 1 1  24 ASN H    .  24 . HN   1 1 
         70 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         71 1 1 1 1  24 ASN HB2  .  24 . HB2  1 1 
         71 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         72 1 1 1 1  24 ASN HB3  .  24 . HB1  1 1 
         72 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         73 1 1 1 1  25 GLN H    .  25 . HN   1 1 
         73 1 2 1 1  26 GLY H    .  26 . HN   1 1 
         74 1 1 1 1  27 TYR H    .  27 . HN   1 1 
         74 1 2 1 1  28 GLN H    .  28 . HN   1 1 
         75 1 1 1 1  27 TYR HA   .  27 . HA   1 1 
         75 1 2 1 1  28 GLN H    .  28 . HN   1 1 
         76 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
         76 1 2 1 1  28 GLN H    .  28 . HN   1 1 
         77 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
         77 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         78 1 1 1 1  28 GLN HB2  .  28 . HB2  1 1 
         78 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         79 1 1 1 1  29 VAL H    .  29 . HN   1 1 
         79 1 2 1 1  30 ARG H    .  30 . HN   1 1 
         80 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
         80 1 2 1 1  30 ARG H    .  30 . HN   1 1 
         81 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
         81 1 2 1 1  30 ARG H    .  30 . HN   1 1 
         82 1 1 1 1  29 VAL MG1  .  29 . HG1* 1 1 
         82 1 2 1 1  30 ARG H    .  30 . HN   1 1 
         83 1 1 1 1  30 ARG H    .  30 . HN   1 1 
         83 1 2 1 1  31 ASP H    .  31 . HN   1 1 
         84 1 1 1 1  30 ARG HA   .  30 . HA   1 1 
         84 1 2 1 1  31 ASP H    .  31 . HN   1 1 
         85 1 1 1 1  30 ARG HD2  .  30 . HD2  1 1 
         85 1 2 1 1  31 ASP H    .  31 . HN   1 1 
         86 1 1 1 1  30 ARG HD3  .  30 . HD1  1 1 
         86 1 2 1 1  31 ASP H    .  31 . HN   1 1 
         87 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
         87 1 2 1 1  32 VAL H    .  32 . HN   1 1 
         88 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
         88 1 2 1 1  33 ASN H    .  33 . HN   1 1 
         89 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
         89 1 2 1 1  33 ASN H    .  33 . HN   1 1 
         90 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
         90 1 2 1 1  33 ASN H    .  33 . HN   1 1 
         91 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
         91 1 2 1 1  33 ASN H    .  33 . HN   1 1 
         92 1 1 1 1  33 ASN H    .  33 . HN   1 1 
         92 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
         93 1 1 1 1  33 ASN H    .  33 . HN   1 1 
         93 1 2 1 1  34 ASP H    .  34 . HN   1 1 
         94 1 1 1 1  33 ASN HB2  .  33 . HB2  1 1 
         94 1 2 1 1  34 ASP H    .  34 . HN   1 1 
         95 1 1 1 1  34 ASP H    .  34 . HN   1 1 
         95 1 2 1 1  37 GLU HG3  .  37 . HG1  1 1 
         96 1 1 1 1  34 ASP HB2  .  34 . HB2  1 1 
         96 1 2 1 1  35 SER H    .  35 . HN   1 1 
         97 1 1 1 1  34 ASP HB3  .  34 . HB1  1 1 
         97 1 2 1 1  35 SER H    .  35 . HN   1 1 
         98 1 1 1 1  35 SER H    .  35 . HN   1 1 
         98 1 2 1 1  36 ASP H    .  36 . HN   1 1 
         99 1 1 1 1  35 SER HB3  .  35 . HB1  1 1 
         99 1 2 1 1  36 ASP H    .  36 . HN   1 1 
        100 1 1 1 1  36 ASP HB2  .  36 . HB2  1 1 
        100 1 2 1 1  37 GLU H    .  37 . HN   1 1 
        101 1 1 1 1  36 ASP HB3  .  36 . HB1  1 1 
        101 1 2 1 1  37 GLU H    .  37 . HN   1 1 
        102 1 1 1 1  37 GLU HB2  .  37 . HB2  1 1 
        102 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        103 1 1 1 1  37 GLU HB3  .  37 . HB1  1 1 
        103 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        104 1 1 1 1  37 GLU HG2  .  37 . HG2  1 1 
        104 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        105 1 1 1 1  37 GLU HG3  .  37 . HG1  1 1 
        105 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        106 1 1 1 1  38 LEU HG   .  38 . HG   1 1 
        106 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        107 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
        107 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        108 1 1 1 1  39 LYS HG2  .  39 . HG2  1 1 
        108 1 2 1 1  40 LYS H    .  40 . HN   1 1 
        109 1 1 1 1  39 LYS HG3  .  39 . HG1  1 1 
        109 1 2 1 1  40 LYS H    .  40 . HN   1 1 
        110 1 1 1 1  40 LYS HG2  .  40 . HG2  1 1 
        110 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        111 1 1 1 1  41 GLU HG2  .  41 . HG2  1 1 
        111 1 2 1 1  42 MET H    .  42 . HN   1 1 
        112 1 1 1 1  42 MET HB2  .  42 . HB2  1 1 
        112 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        113 1 1 1 1  42 MET HG2  .  42 . HG2  1 1 
        113 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        114 1 1 1 1  42 MET HG3  .  42 . HG1  1 1 
        114 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        115 1 1 1 1  43 LYS H    .  43 . HN   1 1 
        115 1 2 1 1  44 LYS H    .  44 . HN   1 1 
        116 1 1 1 1  44 LYS H    .  44 . HN   1 1 
        116 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        117 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        117 1 2 1 1  46 ALA MB   .  46 . HB*  1 1 
        118 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        118 1 2 1 1  46 ALA H    .  46 . HN   1 1 
        119 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
        119 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        120 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        120 1 2 1 1  48 GLU H    .  48 . HN   1 1 
        121 1 1 1 1  47 GLU HB2  .  47 . HB2  1 1 
        121 1 2 1 1  48 GLU H    .  48 . HN   1 1 
        122 1 1 1 1  49 LYS HB2  .  49 . HB2  1 1 
        122 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        123 1 1 1 1  49 LYS HB3  .  49 . HB1  1 1 
        123 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        124 1 1 1 1  50 ASN HB2  .  50 . HB2  1 1 
        124 1 2 1 1  51 PHE H    .  51 . HN   1 1 
        125 1 1 1 1  50 ASN HB3  .  50 . HB1  1 1 
        125 1 2 1 1  51 PHE H    .  51 . HN   1 1 
        126 1 1 1 1  52 GLU H    .  52 . HN   1 1 
        126 1 2 1 1  53 LYS H    .  53 . HN   1 1 
        127 1 1 1 1  52 GLU HA   .  52 . HA   1 1 
        127 1 2 1 1  53 LYS H    .  53 . HN   1 1 
        128 1 1 1 1  52 GLU HB2  .  52 . HB2  1 1 
        128 1 2 1 1  53 LYS H    .  53 . HN   1 1 
        129 1 1 1 1  52 GLU HB3  .  52 . HB1  1 1 
        129 1 2 1 1  53 LYS H    .  53 . HN   1 1 
        130 1 1 1 1  52 GLU HG2  .  52 . HG2  1 1 
        130 1 2 1 1  53 LYS H    .  53 . HN   1 1 
        131 1 1 1 1  52 GLU HG3  .  52 . HG1  1 1 
        131 1 2 1 1  53 LYS H    .  53 . HN   1 1 
        132 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        132 1 2 1 1  54 ILE H    .  54 . HN   1 1 
        133 1 1 1 1  53 LYS HB2  .  53 . HB2  1 1 
        133 1 2 1 1  54 ILE H    .  54 . HN   1 1 
        134 1 1 1 1  53 LYS HB3  .  53 . HB1  1 1 
        134 1 2 1 1  54 ILE H    .  54 . HN   1 1 
        135 1 1 1 1  53 LYS HG2  .  53 . HG2  1 1 
        135 1 2 1 1  54 ILE H    .  54 . HN   1 1 
        136 1 1 1 1  53 LYS HG3  .  53 . HG1  1 1 
        136 1 2 1 1  54 ILE H    .  54 . HN   1 1 
        137 1 1 1 1  54 ILE H    .  54 . HN   1 1 
        137 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        138 1 1 1 1  54 ILE HA   .  54 . HA   1 1 
        138 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        139 1 1 1 1  54 ILE HB   .  54 . HB   1 1 
        139 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        140 1 1 1 1  54 ILE MG   .  54 . HG2* 1 1 
        140 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        141 1 1 1 1  54 ILE HG12 .  54 . HG12 1 1 
        141 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        142 1 1 1 1  54 ILE HG13 .  54 . HG11 1 1 
        142 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        143 1 1 1 1  55 LEU H    .  55 . HN   1 1 
        143 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
        144 1 1 1 1  55 LEU H    .  55 . HN   1 1 
        144 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        145 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
        145 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        146 1 1 1 1  55 LEU HB2  .  55 . HB2  1 1 
        146 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        147 1 1 1 1  55 LEU HB3  .  55 . HB1  1 1 
        147 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        148 1 1 1 1  55 LEU HG   .  55 . HG   1 1 
        148 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        149 1 1 1 1  54 ILE MG   .  54 . HG2* 1 1 
        149 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        150 1 1 1 1  56 ILE HA   .  56 . HA   1 1 
        150 1 2 1 1  57 ILE H    .  57 . HN   1 1 
        151 1 1 1 1  56 ILE HB   .  56 . HB   1 1 
        151 1 2 1 1  57 ILE H    .  57 . HN   1 1 
        152 1 1 1 1  56 ILE MD   .  56 . HD1* 1 1 
        152 1 2 1 1  57 ILE H    .  57 . HN   1 1 
        153 1 1 1 1  57 ILE H    .  57 . HN   1 1 
        153 1 2 1 1  58 SER H    .  58 . HN   1 1 
        154 1 1 1 1  57 ILE HB   .  57 . HB   1 1 
        154 1 2 1 1  58 SER H    .  58 . HN   1 1 
        155 1 1 1 1  57 ILE MG   .  57 . HG2* 1 1 
        155 1 2 1 1  58 SER H    .  58 . HN   1 1 
        156 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
        156 1 2 1 1  58 SER H    .  58 . HN   1 1 
        157 1 1 1 1  58 SER HA   .  58 . HA   1 1 
        157 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        158 1 1 1 1  58 SER HB2  .  58 . HB2  1 1 
        158 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        159 1 1 1 1  58 SER HB3  .  58 . HB1  1 1 
        159 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        160 1 1 1 1  58 SER HG   .  58 . HG   1 1 
        160 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        161 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        161 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        162 1 1 1 1  59 ASN HB2  .  59 . HB2  1 1 
        162 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        163 1 1 1 1  59 ASN HB3  .  59 . HB1  1 1 
        163 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        164 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        164 1 2 1 1  61 LYS H    .  61 . HN   1 1 
        165 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
        165 1 2 1 1  61 LYS H    .  61 . HN   1 1 
        166 1 1 1 1  61 LYS H    .  61 . HN   1 1 
        166 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        167 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
        167 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        168 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
        168 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        169 1 1 1 1  61 LYS HG2  .  61 . HG2  1 1 
        169 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        170 1 1 1 1  61 LYS HG3  .  61 . HG1  1 1 
        170 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        171 1 1 1 1  61 LYS HD2  .  61 . HD2  1 1 
        171 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        172 1 1 1 1  61 LYS HD3  .  61 . HD1  1 1 
        172 1 2 1 1  62 GLN H    .  62 . HN   1 1 
        173 1 1 1 1  62 GLN HG3  .  62 . HG1  1 1 
        173 1 2 1 1  63 LEU H    .  63 . HN   1 1 
        174 1 1 1 1  63 LEU HG   .  63 . HG   1 1 
        174 1 2 1 1  64 LEU H    .  64 . HN   1 1 
        175 1 1 1 1  63 LEU MD1  .  63 . HD1* 1 1 
        175 1 2 1 1  64 LEU H    .  64 . HN   1 1 
        176 1 1 1 1  63 LEU MD2  .  63 . HD2* 1 1 
        176 1 2 1 1  64 LEU H    .  64 . HN   1 1 
        177 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        177 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        178 1 1 1 1  64 LEU HB2  .  64 . HB2  1 1 
        178 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        179 1 1 1 1  64 LEU MD1  .  64 . HD1* 1 1 
        179 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        180 1 1 1 1  64 LEU MD2  .  64 . HD2* 1 1 
        180 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        181 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        181 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
        182 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        182 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
        183 1 1 1 1  65 LYS HG3  .  65 . HG1  1 1 
        183 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        184 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        184 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
        185 1 1 1 1  66 GLU HB2  .  66 . HB2  1 1 
        185 1 2 1 1  67 MET H    .  67 . HN   1 1 
        186 1 1 1 1  67 MET H    .  67 . HN   1 1 
        186 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        187 1 1 1 1  67 MET HB2  .  67 . HB2  1 1 
        187 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        188 1 1 1 1  67 MET HB3  .  67 . HB1  1 1 
        188 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        189 1 1 1 1  67 MET HG2  .  67 . HG2  1 1 
        189 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        190 1 1 1 1  67 MET HG3  .  67 . HG1  1 1 
        190 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        191 1 1 1 1  68 LEU HB2  .  68 . HB2  1 1 
        191 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        192 1 1 1 1  68 LEU HB3  .  68 . HB1  1 1 
        192 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        193 1 1 1 1  68 LEU HG   .  68 . HG   1 1 
        193 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        194 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
        194 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        195 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
        195 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        196 1 1 1 1  69 GLU HB2  .  69 . HB2  1 1 
        196 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        197 1 1 1 1  69 GLU HB3  .  69 . HB1  1 1 
        197 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        198 1 1 1 1  69 GLU HG2  .  69 . HG2  1 1 
        198 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        199 1 1 1 1  70 LEU H    .  70 . HN   1 1 
        199 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        200 1 1 1 1  70 LEU HB2  .  70 . HB2  1 1 
        200 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        201 1 1 1 1  70 LEU HB3  .  70 . HB1  1 1 
        201 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        202 1 1 1 1  70 LEU MD1  .  70 . HD1* 1 1 
        202 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        203 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        203 1 2 1 1  72 SER H    .  72 . HN   1 1 
        204 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
        204 1 2 1 1  72 SER H    .  72 . HN   1 1 
        205 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
        205 1 2 1 1  72 SER H    .  72 . HN   1 1 
        206 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
        206 1 2 1 1  72 SER H    .  72 . HN   1 1 
        207 1 1 1 1  72 SER H    .  72 . HN   1 1 
        207 1 2 1 1  73 LYS H    .  73 . HN   1 1 
        208 1 1 1 1  73 LYS HB2  .  73 . HB2  1 1 
        208 1 2 1 1  74 LEU H    .  74 . HN   1 1 
        209 1 1 1 1  73 LYS HB3  .  73 . HB1  1 1 
        209 1 2 1 1  74 LEU H    .  74 . HN   1 1 
        210 1 1 1 1  73 LYS HD2  .  73 . HD2  1 1 
        210 1 2 1 1  74 LEU H    .  74 . HN   1 1 
        211 1 1 1 1  73 LYS HD3  .  73 . HD1  1 1 
        211 1 2 1 1  74 LEU H    .  74 . HN   1 1 
        212 1 1 1 1  74 LEU HB2  .  74 . HB2  1 1 
        212 1 2 1 1  75 GLY H    .  75 . HN   1 1 
        213 1 1 1 1  74 LEU HB3  .  74 . HB1  1 1 
        213 1 2 1 1  75 GLY H    .  75 . HN   1 1 
        214 1 1 1 1  74 LEU HG   .  74 . HG   1 1 
        214 1 2 1 1  75 GLY H    .  75 . HN   1 1 
        215 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
        215 1 2 1 1  75 GLY H    .  75 . HN   1 1 
        216 1 1 1 1  74 LEU MD2  .  74 . HD2* 1 1 
        216 1 2 1 1  75 GLY H    .  75 . HN   1 1 
        217 1 1 1 1  75 GLY H    .  75 . HN   1 1 
        217 1 2 1 1  76 TYR H    .  76 . HN   1 1 
        218 1 1 1 1  76 TYR HA   .  76 . HA   1 1 
        218 1 2 1 1  77 LYS H    .  77 . HN   1 1 
        219 1 1 1 1  76 TYR HB2  .  76 . HB2  1 1 
        219 1 2 1 1  77 LYS H    .  77 . HN   1 1 
        220 1 1 1 1  76 TYR HB3  .  76 . HB1  1 1 
        220 1 2 1 1  77 LYS H    .  77 . HN   1 1 
        221 1 1 1 1  76 TYR QD   .  76 . HD*  1 1 
        221 1 2 1 1  77 LYS H    .  77 . HN   1 1 
        222 1 1 1 1  77 LYS H    .  77 . HN   1 1 
        222 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        223 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
        223 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        224 1 1 1 1  77 LYS HB2  .  77 . HB2  1 1 
        224 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        225 1 1 1 1  77 LYS HB3  .  77 . HB1  1 1 
        225 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        226 1 1 1 1  77 LYS HG2  .  77 . HG2  1 1 
        226 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        227 1 1 1 1  77 LYS HG3  .  77 . HG1  1 1 
        227 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        228 1 1 1 1  78 VAL HA   .  78 . HA   1 1 
        228 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        229 1 1 1 1  78 VAL HB   .  78 . HB   1 1 
        229 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        230 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        230 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        231 1 1 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        231 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        232 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
        232 1 2 1 1  80 LEU H    .  80 . HN   1 1 
        233 1 1 1 1  79 PHE HB2  .  79 . HB2  1 1 
        233 1 2 1 1  80 LEU H    .  80 . HN   1 1 
        234 1 1 1 1  79 PHE HB3  .  79 . HB1  1 1 
        234 1 2 1 1  80 LEU H    .  80 . HN   1 1 
        235 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
        235 1 2 1 1  80 LEU H    .  80 . HN   1 1 
        236 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
        236 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        237 1 1 1 1  80 LEU HB2  .  80 . HB2  1 1 
        237 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        238 1 1 1 1  80 LEU HB3  .  80 . HB1  1 1 
        238 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        239 1 1 1 1  80 LEU HG   .  80 . HG   1 1 
        239 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        240 1 1 1 1  80 LEU MD1  .  80 . HD1* 1 1 
        240 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        241 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
        241 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        242 1 1 1 1  81 LEU HB2  .  81 . HB2  1 1 
        242 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        243 1 1 1 1  81 LEU HB3  .  81 . HB1  1 1 
        243 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        244 1 1 1 1  81 LEU HG   .  81 . HG   1 1 
        244 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        245 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
        245 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        246 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
        246 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        247 1 1 1 1  82 LEU H    .  82 . HN   1 1 
        247 1 2 1 1  83 GLN H    .  83 . HN   1 1 
        248 1 1 1 1  82 LEU HA   .  82 . HA   1 1 
        248 1 2 1 1  83 GLN H    .  83 . HN   1 1 
        249 1 1 1 1  82 LEU HG   .  82 . HG   1 1 
        249 1 2 1 1  83 GLN H    .  83 . HN   1 1 
        250 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
        250 1 2 1 1  83 GLN H    .  83 . HN   1 1 
        251 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
        251 1 2 1 1  84 ASP H    .  84 . HN   1 1 
        252 1 1 1 1  83 GLN HB2  .  83 . HB2  1 1 
        252 1 2 1 1  84 ASP H    .  84 . HN   1 1 
        253 1 1 1 1  83 GLN HB3  .  83 . HB1  1 1 
        253 1 2 1 1  84 ASP H    .  84 . HN   1 1 
        254 1 1 1 1  83 GLN HG2  .  83 . HG2  1 1 
        254 1 2 1 1  84 ASP H    .  84 . HN   1 1 
        255 1 1 1 1  83 GLN HG3  .  83 . HG1  1 1 
        255 1 2 1 1  84 ASP H    .  84 . HN   1 1 
        256 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
        256 1 2 1 1  85 GLN H    .  85 . HN   1 1 
        257 1 1 1 1  84 ASP HB2  .  84 . HB2  1 1 
        257 1 2 1 1  85 GLN H    .  85 . HN   1 1 
        258 1 1 1 1  84 ASP HB3  .  84 . HB1  1 1 
        258 1 2 1 1  85 GLN H    .  85 . HN   1 1 
        259 1 1 1 1  85 GLN HB3  .  85 . HB1  1 1 
        259 1 2 1 1  86 ASP H    .  86 . HN   1 1 
        260 1 1 1 1  86 ASP H    .  86 . HN   1 1 
        260 1 2 1 1  87 GLU H    .  87 . HN   1 1 
        261 1 1 1 1  86 ASP HA   .  86 . HA   1 1 
        261 1 2 1 1  87 GLU H    .  87 . HN   1 1 
        262 1 1 1 1  86 ASP HB2  .  86 . HB2  1 1 
        262 1 2 1 1  87 GLU H    .  87 . HN   1 1 
        263 1 1 1 1  86 ASP HB3  .  86 . HB1  1 1 
        263 1 2 1 1  87 GLU H    .  87 . HN   1 1 
        264 1 1 1 1  87 GLU HB2  .  87 . HB2  1 1 
        264 1 2 1 1  88 ASN H    .  88 . HN   1 1 
        265 1 1 1 1  87 GLU HB3  .  87 . HB1  1 1 
        265 1 2 1 1  88 ASN H    .  88 . HN   1 1 
        266 1 1 1 1  88 ASN H    .  88 . HN   1 1 
        266 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        267 1 1 1 1  88 ASN HB2  .  88 . HB2  1 1 
        267 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        268 1 1 1 1  88 ASN HB3  .  88 . HB1  1 1 
        268 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        269 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        269 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        270 1 1 1 1  90 LEU HB2  .  90 . HB2  1 1 
        270 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        271 1 1 1 1  90 LEU HB3  .  90 . HB1  1 1 
        271 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        272 1 1 1 1  90 LEU HG   .  90 . HG   1 1 
        272 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        273 1 1 1 1  92 GLU H    .  92 . HN   1 1 
        273 1 2 1 1  92 GLU HB3  .  92 . HB1  1 1 
        274 1 1 1 1  92 GLU H    .  92 . HN   1 1 
        274 1 2 1 1  92 GLU HB2  .  92 . HB2  1 1 
        275 1 1 1 1  92 GLU HB2  .  92 . HB2  1 1 
        275 1 2 1 1  93 PHE H    .  93 . HN   1 1 
        276 1 1 1 1  92 GLU HB3  .  92 . HB1  1 1 
        276 1 2 1 1  93 PHE H    .  93 . HN   1 1 
        277 1 1 1 1  93 PHE HB2  .  93 . HB2  1 1 
        277 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        278 1 1 1 1  93 PHE HB3  .  93 . HB1  1 1 
        278 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        279 1 1 1 1  93 PHE QD   .  93 . HD*  1 1 
        279 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        280 1 1 1 1  94 LYS H    .  94 . HN   1 1 
        280 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        281 1 1 1 1  94 LYS HB2  .  94 . HB2  1 1 
        281 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        282 1 1 1 1  94 LYS HG2  .  94 . HG2  1 1 
        282 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        283 1 1 1 1  94 LYS HG3  .  94 . HG1  1 1 
        283 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        284 1 1 1 1  95 ARG H    .  95 . HN   1 1 
        284 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        285 1 1 1 1  96 LYS HB2  .  96 . HB2  1 1 
        285 1 2 1 1  97 ILE H    .  97 . HN   1 1 
        286 1 1 1 1  96 LYS HB3  .  96 . HB1  1 1 
        286 1 2 1 1  97 ILE H    .  97 . HN   1 1 
        287 1 1 1 1  96 LYS HG2  .  96 . HG2  1 1 
        287 1 2 1 1  97 ILE H    .  97 . HN   1 1 
        288 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        288 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        289 1 1 1 1  97 ILE HB   .  97 . HB   1 1 
        289 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        290 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
        290 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        291 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        291 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
        292 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
        292 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        293 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        293 1 2 1 1  99 SER H    .  99 . HN   1 1 
        294 1 1 1 1  98 GLU HB2  .  98 . HB2  1 1 
        294 1 2 1 1  99 SER H    .  99 . HN   1 1 
        295 1 1 1 1  98 GLU HG2  .  98 . HG2  1 1 
        295 1 2 1 1  99 SER H    .  99 . HN   1 1 
        296 1 1 1 1  98 GLU HG3  .  98 . HG1  1 1 
        296 1 2 1 1  99 SER H    .  99 . HN   1 1 
        297 1 1 1 1 100 GLN H    . 100 . HN   1 1 
        297 1 2 1 1 101 GLY H    . 101 . HN   1 1 
        298 1 1 1 1  99 SER HA   .  99 . HA   1 1 
        298 1 2 1 1 101 GLY H    . 101 . HN   1 1 
        299 1 1 1 1 100 GLN HG3  . 100 . HG1  1 1 
        299 1 2 1 1 101 GLY H    . 101 . HN   1 1 
        300 1 1 1 1 102 TYR HB2  . 102 . HB2  1 1 
        300 1 2 1 1 103 GLU H    . 103 . HN   1 1 
        301 1 1 1 1 102 TYR HB3  . 102 . HB1  1 1 
        301 1 2 1 1 103 GLU H    . 103 . HN   1 1 
        302 1 1 1 1 103 GLU HA   . 103 . HA   1 1 
        302 1 2 1 1 104 VAL H    . 104 . HN   1 1 
        303 1 1 1 1 103 GLU HB2  . 103 . HB2  1 1 
        303 1 2 1 1 104 VAL H    . 104 . HN   1 1 
        304 1 1 1 1 103 GLU HB3  . 103 . HB1  1 1 
        304 1 2 1 1 104 VAL H    . 104 . HN   1 1 
        305 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
        305 1 2 1 1 105 ARG H    . 105 . HN   1 1 
        306 1 1 1 1 104 VAL HB   . 104 . HB   1 1 
        306 1 2 1 1 105 ARG H    . 105 . HN   1 1 
        307 1 1 1 1 104 VAL MG2  . 104 . HG2* 1 1 
        307 1 2 1 1 105 ARG H    . 105 . HN   1 1 
        308 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
        308 1 2 1 1 106 LYS H    . 106 . HN   1 1 
        309 1 1 1 1 105 ARG HB2  . 105 . HB2  1 1 
        309 1 2 1 1 106 LYS H    . 106 . HN   1 1 
        310 1 1 1 1 105 ARG HB3  . 105 . HB1  1 1 
        310 1 2 1 1 106 LYS H    . 106 . HN   1 1 
        311 1 1 1 1 106 LYS H    . 106 . HN   1 1 
        311 1 2 1 1 106 LYS HB3  . 106 . HB1  1 1 
        312 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
        312 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        313 1 1 1 1 106 LYS HB2  . 106 . HB2  1 1 
        313 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        314 1 1 1 1 106 LYS HB3  . 106 . HB1  1 1 
        314 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        315 1 1 1 1 106 LYS HG2  . 106 . HG2  1 1 
        315 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        316 1 1 1 1 106 LYS HG3  . 106 . HG1  1 1 
        316 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        317 1 1 1 1  82 LEU HG   .  82 . HG   1 1 
        317 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        318 1 1 1 1 106 LYS HE2  . 106 . HE2  1 1 
        318 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        319 1 1 1 1 106 LYS HE3  . 106 . HE1  1 1 
        319 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        320 1 1 1 1 107 VAL H    . 107 . HN   1 1 
        320 1 2 1 1 108 THR H    . 108 . HN   1 1 
        321 1 1 1 1 107 VAL HA   . 107 . HA   1 1 
        321 1 2 1 1 108 THR H    . 108 . HN   1 1 
        322 1 1 1 1 107 VAL HB   . 107 . HB   1 1 
        322 1 2 1 1 108 THR H    . 108 . HN   1 1 
        323 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
        323 1 2 1 1 108 THR H    . 108 . HN   1 1 
        324 1 1 1 1 108 THR MG   . 108 . HG2* 1 1 
        324 1 2 1 1 109 ASP H    . 109 . HN   1 1 
        325 1 1 1 1 109 ASP H    . 109 . HN   1 1 
        325 1 2 1 1 110 ASP H    . 110 . HN   1 1 
        326 1 1 1 1 109 ASP HA   . 109 . HA   1 1 
        326 1 2 1 1 110 ASP H    . 110 . HN   1 1 
        327 1 1 1 1 110 ASP H    . 110 . HN   1 1 
        327 1 2 1 1 111 GLU H    . 111 . HN   1 1 
        328 1 1 1 1 110 ASP HB2  . 110 . HB2  1 1 
        328 1 2 1 1 111 GLU H    . 111 . HN   1 1 
        329 1 1 1 1 111 GLU HB2  . 111 . HB2  1 1 
        329 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        330 1 1 1 1 111 GLU HB3  . 111 . HB1  1 1 
        330 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        331 1 1 1 1 111 GLU HG2  . 111 . HG2  1 1 
        331 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        332 1 1 1 1 111 GLU HG3  . 111 . HG1  1 1 
        332 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        333 1 1 1 1 112 GLU H    . 112 . HN   1 1 
        333 1 2 1 1 113 ALA H    . 113 . HN   1 1 
        334 1 1 1 1 112 GLU HG2  . 112 . HG2  1 1 
        334 1 2 1 1 113 ALA H    . 113 . HN   1 1 
        335 1 1 1 1 112 GLU HG3  . 112 . HG1  1 1 
        335 1 2 1 1 113 ALA H    . 113 . HN   1 1 
        336 1 1 1 1 113 ALA H    . 113 . HN   1 1 
        336 1 2 1 1 114 LEU H    . 114 . HN   1 1 
        337 1 1 1 1 113 ALA MB   . 113 . HB*  1 1 
        337 1 2 1 1 114 LEU H    . 114 . HN   1 1 
        338 1 1 1 1 114 LEU H    . 114 . HN   1 1 
        338 1 2 1 1 115 LYS H    . 115 . HN   1 1 
        339 1 1 1 1 114 LEU HB3  . 114 . HB1  1 1 
        339 1 2 1 1 115 LYS H    . 115 . HN   1 1 
        340 1 1 1 1 114 LEU HG   . 114 . HG   1 1 
        340 1 2 1 1 115 LYS H    . 115 . HN   1 1 
        341 1 1 1 1 115 LYS H    . 115 . HN   1 1 
        341 1 2 1 1 115 LYS HD2  . 115 . HD2  1 1 
        342 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
        342 1 2 1 1 115 LYS H    . 115 . HN   1 1 
        343 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
        343 1 2 1 1 115 LYS H    . 115 . HN   1 1 
        344 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        344 1 2 1 1  96 LYS HG3  .  96 . HG1  1 1 
        345 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        345 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        346 1 1 1 1 116 ILE HB   . 116 . HB   1 1 
        346 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        347 1 1 1 1 116 ILE MG   . 116 . HG2* 1 1 
        347 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        348 1 1 1 1 117 VAL HB   . 117 . HB   1 1 
        348 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        349 1 1 1 1 117 VAL MG2  . 117 . HG2* 1 1 
        349 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        350 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        350 1 2 1 1 119 GLU H    . 119 . HN   1 1 
        351 1 1 1 1 118 ARG HB2  . 118 . HB2  1 1 
        351 1 2 1 1 119 GLU H    . 119 . HN   1 1 
        352 1 1 1 1 118 ARG HB3  . 118 . HB1  1 1 
        352 1 2 1 1 119 GLU H    . 119 . HN   1 1 
        353 1 1 1 1 119 GLU HB3  . 119 . HB1  1 1 
        353 1 2 1 1 120 PHE H    . 120 . HN   1 1 
        354 1 1 1 1 119 GLU HB2  . 119 . HB2  1 1 
        354 1 2 1 1 120 PHE H    . 120 . HN   1 1 
        355 1 1 1 1 120 PHE HB2  . 120 . HB2  1 1 
        355 1 2 1 1 121 MET H    . 121 . HN   1 1 
        356 1 1 1 1 120 PHE QD   . 120 . HD*  1 1 
        356 1 2 1 1 121 MET H    . 121 . HN   1 1 
        357 1 1 1 1 121 MET H    . 121 . HN   1 1 
        357 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        358 1 1 1 1 121 MET HB2  . 121 . HB2  1 1 
        358 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        359 1 1 1 1 121 MET HG2  . 121 . HG2  1 1 
        359 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        360 1 1 1 1 121 MET HG3  . 121 . HG1  1 1 
        360 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        361 1 1 1 1 122 GLN HB2  . 122 . HB2  1 1 
        361 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        362 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
        362 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        363 1 1 1 1 122 GLN HG2  . 122 . HG2  1 1 
        363 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        364 1 1 1 1 122 GLN HG3  . 122 . HG1  1 1 
        364 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        365 1 1 1 1 123 LYS HB2  . 123 . HB2  1 1 
        365 1 2 1 1 124 ALA H    . 124 . HN   1 1 
        366 1 1 1 1 123 LYS HB3  . 123 . HB1  1 1 
        366 1 2 1 1 124 ALA H    . 124 . HN   1 1 
        367 1 1 1 1 123 LYS HG2  . 123 . HG2  1 1 
        367 1 2 1 1 124 ALA H    . 124 . HN   1 1 
        368 1 1 1 1 123 LYS HG3  . 123 . HG1  1 1 
        368 1 2 1 1 124 ALA H    . 124 . HN   1 1 
        369 1 1 1 1 127 LEU HB2  . 127 . HB2  1 1 
        369 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        370 1 1 1 1 127 LEU MD2  . 127 . HD2* 1 1 
        370 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        371 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
        371 1 2 1 1   8 ASN HD21 .   8 . HD21 1 1 
        372 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
        372 1 2 1 1   8 ASN HD22 .   8 . HD22 1 1 
        373 1 1 1 1  10 ASN HA   .  10 . HA   1 1 
        373 1 2 1 1  10 ASN HD22 .  10 . HD22 1 1 
        374 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        374 1 2 1 1  33 ASN HD21 .  33 . HD21 1 1 
        375 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
        375 1 2 1 1  33 ASN HD21 .  33 . HD21 1 1 
        376 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        376 1 2 1 1  33 ASN HD22 .  33 . HD22 1 1 
        377 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
        377 1 2 1 1  33 ASN HD22 .  33 . HD22 1 1 
        378 1 1 1 1  50 ASN HA   .  50 . HA   1 1 
        378 1 2 1 1  50 ASN HD22 .  50 . HD22 1 1 
        379 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        379 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
        380 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        380 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
        381 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
        381 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
        382 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
        382 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
        383 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
        383 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
        384 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
        384 1 2 1 1  28 GLN HE21 .  28 . HE21 1 1 
        385 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
        385 1 2 1 1  28 GLN HE22 .  28 . HE22 1 1 
        386 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
        386 1 2 1 1  62 GLN HE21 .  62 . HE21 1 1 
        387 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
        387 1 2 1 1  62 GLN HE22 .  62 . HE22 1 1 
        388 1 1 1 1 122 GLN HB2  . 122 . HB2  1 1 
        388 1 2 1 1 122 GLN HE22 . 122 . HE22 1 1 
        389 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
        389 1 2 1 1 122 GLN HE22 . 122 . HE22 1 1 
        390 1 1 1 1   3 GLU H    .   3 . HN   1 1 
        390 1 2 1 1   3 GLU HB2  .   3 . HB2  1 1 
        391 1 1 1 1   3 GLU H    .   3 . HN   1 1 
        391 1 2 1 1   3 GLU HB3  .   3 . HB1  1 1 
        392 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        392 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
        393 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        393 1 2 1 1   5 ILE HB   .   5 . HB   1 1 
        394 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        394 1 2 1 1   5 ILE MG   .   5 . HG2* 1 1 
        395 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        395 1 2 1 1   5 ILE HG12 .   5 . HG12 1 1 
        396 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        396 1 2 1 1   5 ILE HG13 .   5 . HG11 1 1 
        397 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        397 1 2 1 1   5 ILE MD   .   5 . HD1* 1 1 
        398 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        398 1 2 1 1   6 LEU HB2  .   6 . HB2  1 1 
        399 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        399 1 2 1 1   6 LEU HB3  .   6 . HB1  1 1 
        400 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        400 1 2 1 1   6 LEU HG   .   6 . HG   1 1 
        401 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        401 1 2 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        402 1 1 1 1   7 ILE H    .   7 . HN   1 1 
        402 1 2 1 1   7 ILE HB   .   7 . HB   1 1 
        403 1 1 1 1   7 ILE H    .   7 . HN   1 1 
        403 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
        404 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        404 1 2 1 1   8 ASN HB2  .   8 . HB2  1 1 
        405 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        405 1 2 1 1   8 ASN HB3  .   8 . HB1  1 1 
        406 1 1 1 1   9 THR H    .   9 . HN   1 1 
        406 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
        407 1 1 1 1   9 THR H    .   9 . HN   1 1 
        407 1 2 1 1   9 THR HB   .   9 . HB   1 1 
        408 1 1 1 1   9 THR H    .   9 . HN   1 1 
        408 1 2 1 1   9 THR MG   .   9 . HG2* 1 1 
        409 1 1 1 1   9 THR H    .   9 . HN   1 1 
        409 1 2 1 1   9 THR HG1  .   9 . HG1  1 1 
        410 1 1 1 1  10 ASN H    .  10 . HN   1 1 
        410 1 2 1 1  10 ASN HB2  .  10 . HB2  1 1 
        411 1 1 1 1  10 ASN H    .  10 . HN   1 1 
        411 1 2 1 1  10 ASN HB3  .  10 . HB1  1 1 
        412 1 1 1 1  11 ASN H    .  11 . HN   1 1 
        412 1 2 1 1  11 ASN HB2  .  11 . HB2  1 1 
        413 1 1 1 1  11 ASN H    .  11 . HN   1 1 
        413 1 2 1 1  11 ASN HB3  .  11 . HB1  1 1 
        414 1 1 1 1  12 ASP H    .  12 . HN   1 1 
        414 1 2 1 1  12 ASP HB3  .  12 . HB1  1 1 
        415 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        415 1 2 1 1  13 GLU HB2  .  13 . HB2  1 1 
        416 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        416 1 2 1 1  13 GLU HB3  .  13 . HB1  1 1 
        417 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        417 1 2 1 1  13 GLU HG2  .  13 . HG2  1 1 
        418 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        418 1 2 1 1  13 GLU HG3  .  13 . HG1  1 1 
        419 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        419 1 2 1 1  14 LEU HB2  .  14 . HB2  1 1 
        420 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        420 1 2 1 1  14 LEU HB3  .  14 . HB1  1 1 
        421 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        421 1 2 1 1  14 LEU HG   .  14 . HG   1 1 
        422 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        422 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
        423 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        423 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
        424 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        424 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
        425 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        425 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
        426 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        426 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
        427 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        427 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
        428 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        428 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        429 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
        429 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        430 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        430 1 2 1 1  16 LYS HG2  .  16 . HG2  1 1 
        431 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        431 1 2 1 1  16 LYS HG3  .  16 . HG1  1 1 
        432 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        432 1 2 1 1  16 LYS HE2  .  16 . HE2  1 1 
        433 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        433 1 2 1 1  16 LYS HE3  .  16 . HE1  1 1 
        434 1 1 1 1  17 LYS H    .  17 . HN   1 1 
        434 1 2 1 1  17 LYS HG2  .  17 . HG2  1 1 
        435 1 1 1 1  17 LYS H    .  17 . HN   1 1 
        435 1 2 1 1  17 LYS HG3  .  17 . HG1  1 1 
        436 1 1 1 1  17 LYS H    .  17 . HN   1 1 
        436 1 2 1 1  17 LYS HD2  .  17 . HD2  1 1 
        437 1 1 1 1  17 LYS H    .  17 . HN   1 1 
        437 1 2 1 1  17 LYS HD3  .  17 . HD1  1 1 
        438 1 1 1 1  17 LYS H    .  17 . HN   1 1 
        438 1 2 1 1  17 LYS HE2  .  17 . HE2  1 1 
        439 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        439 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
        440 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        440 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
        441 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        441 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
        442 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        442 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
        443 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
        443 1 2 1 1  19 LYS H    .  19 . HN   1 1 
        444 1 1 1 1  19 LYS H    .  19 . HN   1 1 
        444 1 2 1 1  19 LYS HG2  .  19 . HG2  1 1 
        445 1 1 1 1  19 LYS H    .  19 . HN   1 1 
        445 1 2 1 1  19 LYS HG3  .  19 . HG1  1 1 
        446 1 1 1 1  19 LYS H    .  19 . HN   1 1 
        446 1 2 1 1  19 LYS HE3  .  19 . HE1  1 1 
        447 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        447 1 2 1 1  20 LYS HG2  .  20 . HG2  1 1 
        448 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        448 1 2 1 1  20 LYS HG3  .  20 . HG1  1 1 
        449 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        449 1 2 1 1  20 LYS HD2  .  20 . HD2  1 1 
        450 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        450 1 2 1 1  20 LYS HD3  .  20 . HD1  1 1 
        451 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        451 1 2 1 1  21 GLU HB3  .  21 . HB1  1 1 
        452 1 1 1 1  22 VAL H    .  22 . HN   1 1 
        452 1 2 1 1  22 VAL HB   .  22 . HB   1 1 
        453 1 1 1 1  22 VAL H    .  22 . HN   1 1 
        453 1 2 1 1  22 VAL MG1  .  22 . HG1* 1 1 
        454 1 1 1 1  22 VAL H    .  22 . HN   1 1 
        454 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
        455 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        455 1 2 1 1  25 GLN HB3  .  25 . HB1  1 1 
        456 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        456 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
        457 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        457 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
        458 1 1 1 1  27 TYR H    .  27 . HN   1 1 
        458 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
        459 1 1 1 1  27 TYR H    .  27 . HN   1 1 
        459 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
        460 1 1 1 1  28 GLN H    .  28 . HN   1 1 
        460 1 2 1 1  28 GLN HB2  .  28 . HB2  1 1 
        461 1 1 1 1  28 GLN H    .  28 . HN   1 1 
        461 1 2 1 1  28 GLN HB3  .  28 . HB1  1 1 
        462 1 1 1 1  30 ARG H    .  30 . HN   1 1 
        462 1 2 1 1  30 ARG HD2  .  30 . HD2  1 1 
        463 1 1 1 1  30 ARG H    .  30 . HN   1 1 
        463 1 2 1 1  30 ARG HD3  .  30 . HD1  1 1 
        464 1 1 1 1  32 VAL H    .  32 . HN   1 1 
        464 1 2 1 1  32 VAL HB   .  32 . HB   1 1 
        465 1 1 1 1  32 VAL H    .  32 . HN   1 1 
        465 1 2 1 1  32 VAL MG1  .  32 . HG1* 1 1 
        466 1 1 1 1  32 VAL H    .  32 . HN   1 1 
        466 1 2 1 1  32 VAL MG2  .  32 . HG2* 1 1 
        467 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        467 1 2 1 1  33 ASN HB2  .  33 . HB2  1 1 
        468 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        468 1 2 1 1  37 GLU HG3  .  37 . HG1  1 1 
        469 1 1 1 1  36 ASP H    .  36 . HN   1 1 
        469 1 2 1 1  36 ASP HB2  .  36 . HB2  1 1 
        470 1 1 1 1  37 GLU H    .  37 . HN   1 1 
        470 1 2 1 1  37 GLU HB2  .  37 . HB2  1 1 
        471 1 1 1 1  37 GLU H    .  37 . HN   1 1 
        471 1 2 1 1  37 GLU HB3  .  37 . HB1  1 1 
        472 1 1 1 1  37 GLU H    .  37 . HN   1 1 
        472 1 2 1 1  37 GLU HG2  .  37 . HG2  1 1 
        473 1 1 1 1  37 GLU H    .  37 . HN   1 1 
        473 1 2 1 1  37 GLU HG3  .  37 . HG1  1 1 
        474 1 1 1 1  38 LEU H    .  38 . HN   1 1 
        474 1 2 1 1  38 LEU HB2  .  38 . HB2  1 1 
        475 1 1 1 1  38 LEU H    .  38 . HN   1 1 
        475 1 2 1 1  38 LEU HB3  .  38 . HB1  1 1 
        476 1 1 1 1  38 LEU H    .  38 . HN   1 1 
        476 1 2 1 1  38 LEU HG   .  38 . HG   1 1 
        477 1 1 1 1  38 LEU H    .  38 . HN   1 1 
        477 1 2 1 1  38 LEU MD1  .  38 . HD1* 1 1 
        478 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
        478 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        479 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        479 1 2 1 1  39 LYS HB2  .  39 . HB2  1 1 
        480 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        480 1 2 1 1  39 LYS HG2  .  39 . HG2  1 1 
        481 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        481 1 2 1 1  39 LYS HG3  .  39 . HG1  1 1 
        482 1 1 1 1  40 LYS H    .  40 . HN   1 1 
        482 1 2 1 1  40 LYS HG2  .  40 . HG2  1 1 
        483 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        483 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
        484 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        484 1 2 1 1  41 GLU HG2  .  41 . HG2  1 1 
        485 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        485 1 2 1 1  41 GLU HG3  .  41 . HG1  1 1 
        486 1 1 1 1  42 MET H    .  42 . HN   1 1 
        486 1 2 1 1  42 MET HB2  .  42 . HB2  1 1 
        487 1 1 1 1  42 MET H    .  42 . HN   1 1 
        487 1 2 1 1  42 MET HB3  .  42 . HB1  1 1 
        488 1 1 1 1  42 MET H    .  42 . HN   1 1 
        488 1 2 1 1  42 MET HG2  .  42 . HG2  1 1 
        489 1 1 1 1  42 MET H    .  42 . HN   1 1 
        489 1 2 1 1  42 MET HG3  .  42 . HG1  1 1 
        490 1 1 1 1  42 MET H    .  42 . HN   1 1 
        490 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
        491 1 1 1 1  43 LYS H    .  43 . HN   1 1 
        491 1 2 1 1  43 LYS HG2  .  43 . HG2  1 1 
        492 1 1 1 1  43 LYS H    .  43 . HN   1 1 
        492 1 2 1 1  43 LYS HG3  .  43 . HG1  1 1 
        493 1 1 1 1  43 LYS H    .  43 . HN   1 1 
        493 1 2 1 1  43 LYS HE2  .  43 . HE2  1 1 
        494 1 1 1 1  43 LYS H    .  43 . HN   1 1 
        494 1 2 1 1  43 LYS HE3  .  43 . HE1  1 1 
        495 1 1 1 1  44 LYS H    .  44 . HN   1 1 
        495 1 2 1 1  44 LYS HG2  .  44 . HG2  1 1 
        496 1 1 1 1  44 LYS H    .  44 . HN   1 1 
        496 1 2 1 1  44 LYS HG3  .  44 . HG1  1 1 
        497 1 1 1 1  44 LYS H    .  44 . HN   1 1 
        497 1 2 1 1  44 LYS HE2  .  44 . HE2  1 1 
        498 1 1 1 1  44 LYS H    .  44 . HN   1 1 
        498 1 2 1 1  44 LYS HE3  .  44 . HE1  1 1 
        499 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        499 1 2 1 1  45 LEU HB3  .  45 . HB1  1 1 
        500 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        500 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
        501 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        501 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        502 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        502 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        503 1 1 1 1  46 ALA H    .  46 . HN   1 1 
        503 1 2 1 1  46 ALA MB   .  46 . HB*  1 1 
        504 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        504 1 2 1 1  47 GLU HB2  .  47 . HB2  1 1 
        505 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        505 1 2 1 1  47 GLU HB3  .  47 . HB1  1 1 
        506 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        506 1 2 1 1  47 GLU HG2  .  47 . HG2  1 1 
        507 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        507 1 2 1 1  47 GLU HG3  .  47 . HG1  1 1 
        508 1 1 1 1  47 GLU HB3  .  47 . HB1  1 1 
        508 1 2 1 1  48 GLU H    .  48 . HN   1 1 
        509 1 1 1 1  48 GLU H    .  48 . HN   1 1 
        509 1 2 1 1  48 GLU HG2  .  48 . HG2  1 1 
        510 1 1 1 1  51 PHE H    .  51 . HN   1 1 
        510 1 2 1 1  51 PHE QD   .  51 . HD*  1 1 
        511 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        511 1 2 1 1  53 LYS HB2  .  53 . HB2  1 1 
        512 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        512 1 2 1 1  53 LYS HB3  .  53 . HB1  1 1 
        513 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        513 1 2 1 1  53 LYS HG2  .  53 . HG2  1 1 
        514 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        514 1 2 1 1  53 LYS HG3  .  53 . HG1  1 1 
        515 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        515 1 2 1 1  53 LYS HE2  .  53 . HE2  1 1 
        516 1 1 1 1  53 LYS H    .  53 . HN   1 1 
        516 1 2 1 1  53 LYS HE3  .  53 . HE1  1 1 
        517 1 1 1 1  53 LYS HA   .  53 . HA   1 1 
        517 1 2 1 1  54 ILE H    .  54 . HN   1 1 
        518 1 1 1 1  54 ILE H    .  54 . HN   1 1 
        518 1 2 1 1  54 ILE HB   .  54 . HB   1 1 
        519 1 1 1 1  54 ILE H    .  54 . HN   1 1 
        519 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
        520 1 1 1 1  54 ILE H    .  54 . HN   1 1 
        520 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
        521 1 1 1 1  55 LEU H    .  55 . HN   1 1 
        521 1 2 1 1  55 LEU HB2  .  55 . HB2  1 1 
        522 1 1 1 1  55 LEU H    .  55 . HN   1 1 
        522 1 2 1 1  55 LEU HB3  .  55 . HB1  1 1 
        523 1 1 1 1  55 LEU H    .  55 . HN   1 1 
        523 1 2 1 1  55 LEU HG   .  55 . HG   1 1 
        524 1 1 1 1  55 LEU H    .  55 . HN   1 1 
        524 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
        525 1 1 1 1  56 ILE H    .  56 . HN   1 1 
        525 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
        526 1 1 1 1  55 LEU MD2  .  55 . HD2* 1 1 
        526 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        527 1 1 1 1  56 ILE H    .  56 . HN   1 1 
        527 1 2 1 1  56 ILE HG12 .  56 . HG12 1 1 
        528 1 1 1 1  56 ILE H    .  56 . HN   1 1 
        528 1 2 1 1  56 ILE HG13 .  56 . HG11 1 1 
        529 1 1 1 1  56 ILE H    .  56 . HN   1 1 
        529 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
        530 1 1 1 1  57 ILE H    .  57 . HN   1 1 
        530 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
        531 1 1 1 1  57 ILE H    .  57 . HN   1 1 
        531 1 2 1 1  57 ILE HG13 .  57 . HG11 1 1 
        532 1 1 1 1  57 ILE H    .  57 . HN   1 1 
        532 1 2 1 1  57 ILE HG12 .  57 . HG12 1 1 
        533 1 1 1 1  56 ILE MG   .  56 . HG2* 1 1 
        533 1 2 1 1  57 ILE H    .  57 . HN   1 1 
        534 1 1 1 1  57 ILE HA   .  57 . HA   1 1 
        534 1 2 1 1  58 SER H    .  58 . HN   1 1 
        535 1 1 1 1  58 SER H    .  58 . HN   1 1 
        535 1 2 1 1  58 SER HG   .  58 . HG   1 1 
        536 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        536 1 2 1 1  59 ASN HB2  .  59 . HB2  1 1 
        537 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        537 1 2 1 1  59 ASN HB3  .  59 . HB1  1 1 
        538 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        538 1 2 1 1  60 ASP HB2  .  60 . HB2  1 1 
        539 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        539 1 2 1 1  60 ASP HB3  .  60 . HB1  1 1 
        540 1 1 1 1  61 LYS H    .  61 . HN   1 1 
        540 1 2 1 1  61 LYS HG2  .  61 . HG2  1 1 
        541 1 1 1 1  62 GLN H    .  62 . HN   1 1 
        541 1 2 1 1  62 GLN HG2  .  62 . HG2  1 1 
        542 1 1 1 1  62 GLN H    .  62 . HN   1 1 
        542 1 2 1 1  62 GLN HG3  .  62 . HG1  1 1 
        543 1 1 1 1  63 LEU H    .  63 . HN   1 1 
        543 1 2 1 1  63 LEU HB2  .  63 . HB2  1 1 
        544 1 1 1 1  63 LEU H    .  63 . HN   1 1 
        544 1 2 1 1  63 LEU HB3  .  63 . HB1  1 1 
        545 1 1 1 1  63 LEU H    .  63 . HN   1 1 
        545 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
        546 1 1 1 1  63 LEU H    .  63 . HN   1 1 
        546 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
        547 1 1 1 1  63 LEU H    .  63 . HN   1 1 
        547 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
        548 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        548 1 2 1 1  64 LEU HB2  .  64 . HB2  1 1 
        549 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        549 1 2 1 1  64 LEU HB3  .  64 . HB1  1 1 
        550 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        550 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
        551 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        551 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
        552 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        552 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
        553 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        553 1 2 1 1  65 LYS HB2  .  65 . HB2  1 1 
        554 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        554 1 2 1 1  65 LYS HB3  .  65 . HB1  1 1 
        555 1 1 1 1  64 LEU HB3  .  64 . HB1  1 1 
        555 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        556 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        556 1 2 1 1  65 LYS HG3  .  65 . HG1  1 1 
        557 1 1 1 1  64 LEU HG   .  64 . HG   1 1 
        557 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        558 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        558 1 2 1 1  66 GLU HG2  .  66 . HG2  1 1 
        559 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        559 1 2 1 1  66 GLU HG3  .  66 . HG1  1 1 
        560 1 1 1 1  67 MET H    .  67 . HN   1 1 
        560 1 2 1 1  67 MET HB2  .  67 . HB2  1 1 
        561 1 1 1 1  67 MET H    .  67 . HN   1 1 
        561 1 2 1 1  67 MET HB3  .  67 . HB1  1 1 
        562 1 1 1 1  67 MET H    .  67 . HN   1 1 
        562 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
        563 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        563 1 2 1 1  68 LEU HB2  .  68 . HB2  1 1 
        564 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        564 1 2 1 1  68 LEU HB3  .  68 . HB1  1 1 
        565 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        565 1 2 1 1  68 LEU HG   .  68 . HG   1 1 
        566 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        566 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
        567 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        567 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
        568 1 1 1 1  69 GLU H    .  69 . HN   1 1 
        568 1 2 1 1  69 GLU HB2  .  69 . HB2  1 1 
        569 1 1 1 1  69 GLU H    .  69 . HN   1 1 
        569 1 2 1 1  69 GLU HB3  .  69 . HB1  1 1 
        570 1 1 1 1  69 GLU H    .  69 . HN   1 1 
        570 1 2 1 1  69 GLU HG2  .  69 . HG2  1 1 
        571 1 1 1 1  69 GLU H    .  69 . HN   1 1 
        571 1 2 1 1  69 GLU HG3  .  69 . HG1  1 1 
        572 1 1 1 1  70 LEU H    .  70 . HN   1 1 
        572 1 2 1 1  70 LEU HG   .  70 . HG   1 1 
        573 1 1 1 1  95 ARG HG2  .  95 . HG2  1 1 
        573 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        574 1 1 1 1  70 LEU H    .  70 . HN   1 1 
        574 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
        575 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        575 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
        576 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        576 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
        577 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        577 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
        578 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        578 1 2 1 1  71 ILE HG12 .  71 . HG12 1 1 
        579 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        579 1 2 1 1  71 ILE HG13 .  71 . HG11 1 1 
        580 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        580 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
        581 1 1 1 1  72 SER H    .  72 . HN   1 1 
        581 1 2 1 1  72 SER HB2  .  72 . HB2  1 1 
        582 1 1 1 1  72 SER H    .  72 . HN   1 1 
        582 1 2 1 1  72 SER HB3  .  72 . HB1  1 1 
        583 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        583 1 2 1 1  73 LYS HG2  .  73 . HG2  1 1 
        584 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        584 1 2 1 1  73 LYS HG3  .  73 . HG1  1 1 
        585 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        585 1 2 1 1  73 LYS HD2  .  73 . HD2  1 1 
        586 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        586 1 2 1 1  73 LYS HD3  .  73 . HD1  1 1 
        587 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        587 1 2 1 1  73 LYS HE2  .  73 . HE2  1 1 
        588 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        588 1 2 1 1  73 LYS HE3  .  73 . HE1  1 1 
        589 1 1 1 1  74 LEU H    .  74 . HN   1 1 
        589 1 2 1 1  74 LEU HB2  .  74 . HB2  1 1 
        590 1 1 1 1  74 LEU H    .  74 . HN   1 1 
        590 1 2 1 1  74 LEU HB3  .  74 . HB1  1 1 
        591 1 1 1 1  74 LEU H    .  74 . HN   1 1 
        591 1 2 1 1  74 LEU HG   .  74 . HG   1 1 
        592 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
        592 1 2 1 1  74 LEU H    .  74 . HN   1 1 
        593 1 1 1 1  74 LEU H    .  74 . HN   1 1 
        593 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
        594 1 1 1 1  76 TYR H    .  76 . HN   1 1 
        594 1 2 1 1  76 TYR HB2  .  76 . HB2  1 1 
        595 1 1 1 1  76 TYR H    .  76 . HN   1 1 
        595 1 2 1 1  76 TYR HB3  .  76 . HB1  1 1 
        596 1 1 1 1  76 TYR H    .  76 . HN   1 1 
        596 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
        597 1 1 1 1  77 LYS H    .  77 . HN   1 1 
        597 1 2 1 1  77 LYS HB2  .  77 . HB2  1 1 
        598 1 1 1 1  77 LYS H    .  77 . HN   1 1 
        598 1 2 1 1  77 LYS HB3  .  77 . HB1  1 1 
        599 1 1 1 1  77 LYS H    .  77 . HN   1 1 
        599 1 2 1 1  77 LYS HG2  .  77 . HG2  1 1 
        600 1 1 1 1  77 LYS H    .  77 . HN   1 1 
        600 1 2 1 1  77 LYS HG3  .  77 . HG1  1 1 
        601 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        601 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
        602 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        602 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        603 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        603 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        604 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
        604 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        605 1 1 1 1  79 PHE H    .  79 . HN   1 1 
        605 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
        606 1 1 1 1  80 LEU H    .  80 . HN   1 1 
        606 1 2 1 1  80 LEU HB2  .  80 . HB2  1 1 
        607 1 1 1 1  80 LEU H    .  80 . HN   1 1 
        607 1 2 1 1  80 LEU HB3  .  80 . HB1  1 1 
        608 1 1 1 1  80 LEU H    .  80 . HN   1 1 
        608 1 2 1 1  80 LEU HG   .  80 . HG   1 1 
        609 1 1 1 1  80 LEU H    .  80 . HN   1 1 
        609 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
        610 1 1 1 1  81 LEU H    .  81 . HN   1 1 
        610 1 2 1 1  81 LEU HB2  .  81 . HB2  1 1 
        611 1 1 1 1  81 LEU H    .  81 . HN   1 1 
        611 1 2 1 1  81 LEU HB3  .  81 . HB1  1 1 
        612 1 1 1 1  81 LEU H    .  81 . HN   1 1 
        612 1 2 1 1  81 LEU HG   .  81 . HG   1 1 
        613 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
        613 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        614 1 1 1 1  82 LEU H    .  82 . HN   1 1 
        614 1 2 1 1  82 LEU HG   .  82 . HG   1 1 
        615 1 1 1 1  82 LEU H    .  82 . HN   1 1 
        615 1 2 1 1  82 LEU MD1  .  82 . HD1* 1 1 
        616 1 1 1 1  82 LEU H    .  82 . HN   1 1 
        616 1 2 1 1  82 LEU MD2  .  82 . HD2* 1 1 
        617 1 1 1 1  83 GLN H    .  83 . HN   1 1 
        617 1 2 1 1  83 GLN HB2  .  83 . HB2  1 1 
        618 1 1 1 1  83 GLN H    .  83 . HN   1 1 
        618 1 2 1 1  83 GLN HB3  .  83 . HB1  1 1 
        619 1 1 1 1  83 GLN H    .  83 . HN   1 1 
        619 1 2 1 1  83 GLN HG2  .  83 . HG2  1 1 
        620 1 1 1 1  83 GLN H    .  83 . HN   1 1 
        620 1 2 1 1  83 GLN HG3  .  83 . HG1  1 1 
        621 1 1 1 1  85 GLN H    .  85 . HN   1 1 
        621 1 2 1 1  85 GLN HB2  .  85 . HB2  1 1 
        622 1 1 1 1  85 GLN H    .  85 . HN   1 1 
        622 1 2 1 1  85 GLN HB3  .  85 . HB1  1 1 
        623 1 1 1 1  86 ASP H    .  86 . HN   1 1 
        623 1 2 1 1  86 ASP HB2  .  86 . HB2  1 1 
        624 1 1 1 1  86 ASP H    .  86 . HN   1 1 
        624 1 2 1 1  86 ASP HB3  .  86 . HB1  1 1 
        625 1 1 1 1  87 GLU H    .  87 . HN   1 1 
        625 1 2 1 1  87 GLU HB2  .  87 . HB2  1 1 
        626 1 1 1 1  87 GLU H    .  87 . HN   1 1 
        626 1 2 1 1  87 GLU HB3  .  87 . HB1  1 1 
        627 1 1 1 1  87 GLU H    .  87 . HN   1 1 
        627 1 2 1 1  87 GLU HG2  .  87 . HG2  1 1 
        628 1 1 1 1  87 GLU H    .  87 . HN   1 1 
        628 1 2 1 1  87 GLU HG3  .  87 . HG1  1 1 
        629 1 1 1 1  88 ASN H    .  88 . HN   1 1 
        629 1 2 1 1  88 ASN HB2  .  88 . HB2  1 1 
        630 1 1 1 1  88 ASN H    .  88 . HN   1 1 
        630 1 2 1 1  88 ASN HB3  .  88 . HB1  1 1 
        631 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        631 1 2 1 1  89 GLU HG2  .  89 . HG2  1 1 
        632 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        632 1 2 1 1  89 GLU HG3  .  89 . HG1  1 1 
        633 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        633 1 2 1 1  90 LEU HB2  .  90 . HB2  1 1 
        634 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        634 1 2 1 1  90 LEU HB3  .  90 . HB1  1 1 
        635 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        635 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
        636 1 1 1 1  91 GLU H    .  91 . HN   1 1 
        636 1 2 1 1  91 GLU HB2  .  91 . HB2  1 1 
        637 1 1 1 1  91 GLU H    .  91 . HN   1 1 
        637 1 2 1 1  91 GLU HB3  .  91 . HB1  1 1 
        638 1 1 1 1  91 GLU H    .  91 . HN   1 1 
        638 1 2 1 1  91 GLU HG2  .  91 . HG2  1 1 
        639 1 1 1 1  92 GLU H    .  92 . HN   1 1 
        639 1 2 1 1  92 GLU HG2  .  92 . HG2  1 1 
        640 1 1 1 1  92 GLU H    .  92 . HN   1 1 
        640 1 2 1 1  92 GLU HG3  .  92 . HG1  1 1 
        641 1 1 1 1  93 PHE H    .  93 . HN   1 1 
        641 1 2 1 1  93 PHE HB2  .  93 . HB2  1 1 
        642 1 1 1 1  93 PHE H    .  93 . HN   1 1 
        642 1 2 1 1  93 PHE HB3  .  93 . HB1  1 1 
        643 1 1 1 1  93 PHE H    .  93 . HN   1 1 
        643 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
        644 1 1 1 1  94 LYS H    .  94 . HN   1 1 
        644 1 2 1 1  94 LYS HB2  .  94 . HB2  1 1 
        645 1 1 1 1  94 LYS H    .  94 . HN   1 1 
        645 1 2 1 1  94 LYS HB3  .  94 . HB1  1 1 
        646 1 1 1 1  94 LYS H    .  94 . HN   1 1 
        646 1 2 1 1  94 LYS HG2  .  94 . HG2  1 1 
        647 1 1 1 1  94 LYS H    .  94 . HN   1 1 
        647 1 2 1 1  94 LYS HG3  .  94 . HG1  1 1 
        648 1 1 1 1  94 LYS HB3  .  94 . HB1  1 1 
        648 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        649 1 1 1 1  95 ARG H    .  95 . HN   1 1 
        649 1 2 1 1  95 ARG HG3  .  95 . HG1  1 1 
        650 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        650 1 2 1 1  96 LYS HB3  .  96 . HB1  1 1 
        651 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        651 1 2 1 1  96 LYS HG2  .  96 . HG2  1 1 
        652 1 1 1 1  95 ARG HG3  .  95 . HG1  1 1 
        652 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        653 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        653 1 2 1 1  97 ILE HB   .  97 . HB   1 1 
        654 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        654 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
        655 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        655 1 2 1 1  97 ILE HG12 .  97 . HG12 1 1 
        656 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        656 1 2 1 1  97 ILE HG13 .  97 . HG11 1 1 
        657 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        657 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
        658 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        658 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
        659 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        659 1 2 1 1  98 GLU HB3  .  98 . HB1  1 1 
        660 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        660 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
        661 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        661 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
        662 1 1 1 1 100 GLN H    . 100 . HN   1 1 
        662 1 2 1 1 100 GLN HB2  . 100 . HB2  1 1 
        663 1 1 1 1 100 GLN H    . 100 . HN   1 1 
        663 1 2 1 1 100 GLN HB3  . 100 . HB1  1 1 
        664 1 1 1 1 100 GLN H    . 100 . HN   1 1 
        664 1 2 1 1 100 GLN HG2  . 100 . HG2  1 1 
        665 1 1 1 1 100 GLN H    . 100 . HN   1 1 
        665 1 2 1 1 100 GLN HG3  . 100 . HG1  1 1 
        666 1 1 1 1 102 TYR H    . 102 . HN   1 1 
        666 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
        667 1 1 1 1 103 GLU H    . 103 . HN   1 1 
        667 1 2 1 1 103 GLU HB2  . 103 . HB2  1 1 
        668 1 1 1 1 103 GLU H    . 103 . HN   1 1 
        668 1 2 1 1 103 GLU HB3  . 103 . HB1  1 1 
        669 1 1 1 1 104 VAL H    . 104 . HN   1 1 
        669 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
        670 1 1 1 1 104 VAL H    . 104 . HN   1 1 
        670 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
        671 1 1 1 1 105 ARG H    . 105 . HN   1 1 
        671 1 2 1 1 105 ARG HB2  . 105 . HB2  1 1 
        672 1 1 1 1 105 ARG H    . 105 . HN   1 1 
        672 1 2 1 1 105 ARG HB3  . 105 . HB1  1 1 
        673 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
        673 1 2 1 1 105 ARG H    . 105 . HN   1 1 
        674 1 1 1 1 106 LYS H    . 106 . HN   1 1 
        674 1 2 1 1 106 LYS HB2  . 106 . HB2  1 1 
        675 1 1 1 1 106 LYS H    . 106 . HN   1 1 
        675 1 2 1 1 106 LYS HG3  . 106 . HG1  1 1 
        676 1 1 1 1 107 VAL H    . 107 . HN   1 1 
        676 1 2 1 1 107 VAL HB   . 107 . HB   1 1 
        677 1 1 1 1 107 VAL H    . 107 . HN   1 1 
        677 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
        678 1 1 1 1 108 THR H    . 108 . HN   1 1 
        678 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
        679 1 1 1 1 109 ASP H    . 109 . HN   1 1 
        679 1 2 1 1 109 ASP HB2  . 109 . HB2  1 1 
        680 1 1 1 1 110 ASP H    . 110 . HN   1 1 
        680 1 2 1 1 110 ASP HB2  . 110 . HB2  1 1 
        681 1 1 1 1 110 ASP H    . 110 . HN   1 1 
        681 1 2 1 1 110 ASP HB3  . 110 . HB1  1 1 
        682 1 1 1 1 111 GLU H    . 111 . HN   1 1 
        682 1 2 1 1 111 GLU HB2  . 111 . HB2  1 1 
        683 1 1 1 1 111 GLU H    . 111 . HN   1 1 
        683 1 2 1 1 111 GLU HB3  . 111 . HB1  1 1 
        684 1 1 1 1 112 GLU H    . 112 . HN   1 1 
        684 1 2 1 1 112 GLU HG2  . 112 . HG2  1 1 
        685 1 1 1 1 112 GLU H    . 112 . HN   1 1 
        685 1 2 1 1 112 GLU HG3  . 112 . HG1  1 1 
        686 1 1 1 1 113 ALA H    . 113 . HN   1 1 
        686 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
        687 1 1 1 1 114 LEU H    . 114 . HN   1 1 
        687 1 2 1 1 114 LEU HB3  . 114 . HB1  1 1 
        688 1 1 1 1 114 LEU H    . 114 . HN   1 1 
        688 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
        689 1 1 1 1 114 LEU H    . 114 . HN   1 1 
        689 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
        690 1 1 1 1 114 LEU H    . 114 . HN   1 1 
        690 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
        691 1 1 1 1 115 LYS H    . 115 . HN   1 1 
        691 1 2 1 1 115 LYS HG2  . 115 . HG2  1 1 
        692 1 1 1 1 115 LYS H    . 115 . HN   1 1 
        692 1 2 1 1 115 LYS HD3  . 115 . HD1  1 1 
        693 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        693 1 2 1 1 116 ILE HB   . 116 . HB   1 1 
        694 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        694 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
        695 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        695 1 2 1 1 116 ILE HG12 . 116 . HG12 1 1 
        696 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        696 1 2 1 1 116 ILE HG13 . 116 . HG11 1 1 
        697 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        697 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
        698 1 1 1 1 117 VAL H    . 117 . HN   1 1 
        698 1 2 1 1 117 VAL HB   . 117 . HB   1 1 
        699 1 1 1 1 117 VAL H    . 117 . HN   1 1 
        699 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
        700 1 1 1 1 117 VAL H    . 117 . HN   1 1 
        700 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
        701 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        701 1 2 1 1 118 ARG HB2  . 118 . HB2  1 1 
        702 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        702 1 2 1 1 118 ARG HB3  . 118 . HB1  1 1 
        703 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        703 1 2 1 1 118 ARG HG2  . 118 . HG2  1 1 
        704 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        704 1 2 1 1 118 ARG HG3  . 118 . HG1  1 1 
        705 1 1 1 1 119 GLU H    . 119 . HN   1 1 
        705 1 2 1 1 119 GLU HB2  . 119 . HB2  1 1 
        706 1 1 1 1 119 GLU H    . 119 . HN   1 1 
        706 1 2 1 1 119 GLU HG2  . 119 . HG2  1 1 
        707 1 1 1 1 119 GLU H    . 119 . HN   1 1 
        707 1 2 1 1 119 GLU HB3  . 119 . HB1  1 1 
        708 1 1 1 1 119 GLU H    . 119 . HN   1 1 
        708 1 2 1 1 119 GLU HG3  . 119 . HG1  1 1 
        709 1 1 1 1 120 PHE H    . 120 . HN   1 1 
        709 1 2 1 1 120 PHE HB2  . 120 . HB2  1 1 
        710 1 1 1 1 120 PHE H    . 120 . HN   1 1 
        710 1 2 1 1 120 PHE HB3  . 120 . HB1  1 1 
        711 1 1 1 1 120 PHE H    . 120 . HN   1 1 
        711 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
        712 1 1 1 1 121 MET H    . 121 . HN   1 1 
        712 1 2 1 1 121 MET HG2  . 121 . HG2  1 1 
        713 1 1 1 1 121 MET H    . 121 . HN   1 1 
        713 1 2 1 1 121 MET HG3  . 121 . HG1  1 1 
        714 1 1 1 1 122 GLN H    . 122 . HN   1 1 
        714 1 2 1 1 122 GLN HG2  . 122 . HG2  1 1 
        715 1 1 1 1 122 GLN H    . 122 . HN   1 1 
        715 1 2 1 1 122 GLN HG3  . 122 . HG1  1 1 
        716 1 1 1 1 123 LYS H    . 123 . HN   1 1 
        716 1 2 1 1 123 LYS HB2  . 123 . HB2  1 1 
        717 1 1 1 1 123 LYS H    . 123 . HN   1 1 
        717 1 2 1 1 123 LYS HB3  . 123 . HB1  1 1 
        718 1 1 1 1 123 LYS H    . 123 . HN   1 1 
        718 1 2 1 1 123 LYS HG3  . 123 . HG1  1 1 
        719 1 1 1 1 123 LYS H    . 123 . HN   1 1 
        719 1 2 1 1 123 LYS HD2  . 123 . HD2  1 1 
        720 1 1 1 1 123 LYS H    . 123 . HN   1 1 
        720 1 2 1 1 123 LYS HD3  . 123 . HD1  1 1 
        721 1 1 1 1 127 LEU H    . 127 . HN   1 1 
        721 1 2 1 1 127 LEU MD2  . 127 . HD2* 1 1 
        722 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        722 1 2 1 1 128 GLU HB2  . 128 . HB2  1 1 
        723 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        723 1 2 1 1 128 GLU HB3  . 128 . HB1  1 1 
        724 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        724 1 2 1 1 128 GLU HG2  . 128 . HG2  1 1 
        725 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        725 1 2 1 1 128 GLU HG3  . 128 . HG1  1 1 
        726 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        726 1 2 1 1   5 ILE H    .   5 . HN   1 1 
        727 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        727 1 2 1 1   6 LEU H    .   6 . HN   1 1 
        728 1 1 1 1  11 ASN H    .  11 . HN   1 1 
        728 1 2 1 1  12 ASP H    .  12 . HN   1 1 
        729 1 1 1 1  12 ASP H    .  12 . HN   1 1 
        729 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        730 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        730 1 2 1 1  15 ILE H    .  15 . HN   1 1 
        731 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        731 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        732 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        732 1 2 1 1  17 LYS H    .  17 . HN   1 1 
        733 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        733 1 2 1 1  19 LYS H    .  19 . HN   1 1 
        734 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        734 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        735 1 1 1 1  26 GLY H    .  26 . HN   1 1 
        735 1 2 1 1  27 TYR H    .  27 . HN   1 1 
        736 1 1 1 1  28 GLN H    .  28 . HN   1 1 
        736 1 2 1 1  29 VAL H    .  29 . HN   1 1 
        737 1 1 1 1  32 VAL H    .  32 . HN   1 1 
        737 1 2 1 1  33 ASN H    .  33 . HN   1 1 
        738 1 1 1 1  34 ASP H    .  34 . HN   1 1 
        738 1 2 1 1  35 SER H    .  35 . HN   1 1 
        739 1 1 1 1  36 ASP H    .  36 . HN   1 1 
        739 1 2 1 1  37 GLU H    .  37 . HN   1 1 
        740 1 1 1 1  37 GLU H    .  37 . HN   1 1 
        740 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        741 1 1 1 1  38 LEU H    .  38 . HN   1 1 
        741 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        742 1 1 1 1  40 LYS H    .  40 . HN   1 1 
        742 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        743 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        743 1 2 1 1  42 MET H    .  42 . HN   1 1 
        744 1 1 1 1  42 MET H    .  42 . HN   1 1 
        744 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        745 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        745 1 2 1 1  46 ALA H    .  46 . HN   1 1 
        746 1 1 1 1  50 ASN H    .  50 . HN   1 1 
        746 1 2 1 1  51 PHE H    .  51 . HN   1 1 
        747 1 1 1 1  56 ILE H    .  56 . HN   1 1 
        747 1 2 1 1  57 ILE H    .  57 . HN   1 1 
        748 1 1 1 1  58 SER H    .  58 . HN   1 1 
        748 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        749 1 1 1 1  62 GLN H    .  62 . HN   1 1 
        749 1 2 1 1  63 LEU H    .  63 . HN   1 1 
        750 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        750 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        751 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        751 1 2 1 1  67 MET H    .  67 . HN   1 1 
        752 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        752 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        753 1 1 1 1  69 GLU H    .  69 . HN   1 1 
        753 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        754 1 1 1 1  73 LYS H    .  73 . HN   1 1 
        754 1 2 1 1  74 LEU H    .  74 . HN   1 1 
        755 1 1 1 1  74 LEU H    .  74 . HN   1 1 
        755 1 2 1 1  75 GLY H    .  75 . HN   1 1 
        756 1 1 1 1  76 TYR H    .  76 . HN   1 1 
        756 1 2 1 1  77 LYS H    .  77 . HN   1 1 
        757 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        757 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        758 1 1 1 1  79 PHE H    .  79 . HN   1 1 
        758 1 2 1 1  80 LEU H    .  80 . HN   1 1 
        759 1 1 1 1  80 LEU H    .  80 . HN   1 1 
        759 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        760 1 1 1 1  81 LEU H    .  81 . HN   1 1 
        760 1 2 1 1  82 LEU H    .  82 . HN   1 1 
        761 1 1 1 1  83 GLN H    .  83 . HN   1 1 
        761 1 2 1 1  84 ASP H    .  84 . HN   1 1 
        762 1 1 1 1  85 GLN H    .  85 . HN   1 1 
        762 1 2 1 1  86 ASP H    .  86 . HN   1 1 
        763 1 1 1 1  87 GLU H    .  87 . HN   1 1 
        763 1 2 1 1  88 ASN H    .  88 . HN   1 1 
        764 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        764 1 2 1 1  90 LEU H    .  90 . HN   1 1 
        765 1 1 1 1  91 GLU H    .  91 . HN   1 1 
        765 1 2 1 1  92 GLU H    .  92 . HN   1 1 
        766 1 1 1 1  92 GLU H    .  92 . HN   1 1 
        766 1 2 1 1  93 PHE H    .  93 . HN   1 1 
        767 1 1 1 1  93 PHE H    .  93 . HN   1 1 
        767 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        768 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        768 1 2 1 1  97 ILE H    .  97 . HN   1 1 
        769 1 1 1 1  99 SER H    .  99 . HN   1 1 
        769 1 2 1 1 100 GLN H    . 100 . HN   1 1 
        770 1 1 1 1 101 GLY H    . 101 . HN   1 1 
        770 1 2 1 1 102 TYR H    . 102 . HN   1 1 
        771 1 1 1 1 102 TYR H    . 102 . HN   1 1 
        771 1 2 1 1 103 GLU H    . 103 . HN   1 1 
        772 1 1 1 1 104 VAL H    . 104 . HN   1 1 
        772 1 2 1 1 105 ARG H    . 105 . HN   1 1 
        773 1 1 1 1 106 LYS H    . 106 . HN   1 1 
        773 1 2 1 1 107 VAL H    . 107 . HN   1 1 
        774 1 1 1 1 108 THR H    . 108 . HN   1 1 
        774 1 2 1 1 109 ASP H    . 109 . HN   1 1 
        775 1 1 1 1 111 GLU H    . 111 . HN   1 1 
        775 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        776 1 1 1 1 115 LYS H    . 115 . HN   1 1 
        776 1 2 1 1 116 ILE H    . 116 . HN   1 1 
        777 1 1 1 1 117 VAL H    . 117 . HN   1 1 
        777 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        778 1 1 1 1 119 GLU H    . 119 . HN   1 1 
        778 1 2 1 1 120 PHE H    . 120 . HN   1 1 
        779 1 1 1 1 120 PHE H    . 120 . HN   1 1 
        779 1 2 1 1 121 MET H    . 121 . HN   1 1 
        780 1 1 1 1 122 GLN H    . 122 . HN   1 1 
        780 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        781 1 1 1 1 123 LYS H    . 123 . HN   1 1 
        781 1 2 1 1 124 ALA H    . 124 . HN   1 1 
        782 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        782 1 2 1 1 129 HIS H    . 129 . HN   1 1 
        783 1 1 1 1  12 ASP H    .  12 . HN   1 1 
        783 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        784 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
        784 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        785 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        785 1 2 1 1  15 ILE H    .  15 . HN   1 1 
        786 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
        786 1 2 1 1  15 ILE H    .  15 . HN   1 1 
        787 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        787 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        788 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        788 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        789 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        789 1 2 1 1  17 LYS H    .  17 . HN   1 1 
        790 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
        790 1 2 1 1  17 LYS H    .  17 . HN   1 1 
        791 1 1 1 1  17 LYS H    .  17 . HN   1 1 
        791 1 2 1 1  19 LYS H    .  19 . HN   1 1 
        792 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
        792 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        793 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
        793 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        794 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
        794 1 2 1 1  19 LYS H    .  19 . HN   1 1 
        795 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
        795 1 2 1 1  19 LYS H    .  19 . HN   1 1 
        796 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
        796 1 2 1 1  19 LYS H    .  19 . HN   1 1 
        797 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
        797 1 2 1 1  20 LYS H    .  20 . HN   1 1 
        798 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        798 1 2 1 1  20 LYS H    .  20 . HN   1 1 
        799 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
        799 1 2 1 1  20 LYS H    .  20 . HN   1 1 
        800 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        800 1 2 1 1  22 VAL H    .  22 . HN   1 1 
        801 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
        801 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        802 1 1 1 1  19 LYS H    .  19 . HN   1 1 
        802 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        803 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
        803 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        804 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        804 1 2 1 1  22 VAL H    .  22 . HN   1 1 
        805 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
        805 1 2 1 1  22 VAL H    .  22 . HN   1 1 
        806 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        806 1 2 1 1  23 GLU H    .  23 . HN   1 1 
        807 1 1 1 1  36 ASP H    .  36 . HN   1 1 
        807 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        808 1 1 1 1  35 SER H    .  35 . HN   1 1 
        808 1 2 1 1  37 GLU H    .  37 . HN   1 1 
        809 1 1 1 1  37 GLU H    .  37 . HN   1 1 
        809 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        810 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
        810 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        811 1 1 1 1  35 SER HA   .  35 . HA   1 1 
        811 1 2 1 1  38 LEU H    .  38 . HN   1 1 
        812 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
        812 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        813 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
        813 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        814 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        814 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        815 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
        815 1 2 1 1  40 LYS H    .  40 . HN   1 1 
        816 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
        816 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        817 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
        817 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        818 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
        818 1 2 1 1  42 MET H    .  42 . HN   1 1 
        819 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
        819 1 2 1 1  42 MET H    .  42 . HN   1 1 
        820 1 1 1 1  42 MET H    .  42 . HN   1 1 
        820 1 2 1 1  44 LYS H    .  44 . HN   1 1 
        821 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
        821 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        822 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        822 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        823 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
        823 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        824 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
        824 1 2 1 1  43 LYS H    .  43 . HN   1 1 
        825 1 1 1 1  42 MET HA   .  42 . HA   1 1 
        825 1 2 1 1  44 LYS H    .  44 . HN   1 1 
        826 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
        826 1 2 1 1  44 LYS H    .  44 . HN   1 1 
        827 1 1 1 1  43 LYS H    .  43 . HN   1 1 
        827 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        828 1 1 1 1  42 MET HA   .  42 . HA   1 1 
        828 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        829 1 1 1 1  44 LYS H    .  44 . HN   1 1 
        829 1 2 1 1  46 ALA H    .  46 . HN   1 1 
        830 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
        830 1 2 1 1  46 ALA H    .  46 . HN   1 1 
        831 1 1 1 1  42 MET HA   .  42 . HA   1 1 
        831 1 2 1 1  46 ALA H    .  46 . HN   1 1 
        832 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        832 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        833 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
        833 1 2 1 1  63 LEU H    .  63 . HN   1 1 
        834 1 1 1 1  63 LEU H    .  63 . HN   1 1 
        834 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        835 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
        835 1 2 1 1  64 LEU H    .  64 . HN   1 1 
        836 1 1 1 1  62 GLN H    .  62 . HN   1 1 
        836 1 2 1 1  64 LEU H    .  64 . HN   1 1 
        837 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
        837 1 2 1 1  64 LEU H    .  64 . HN   1 1 
        838 1 1 1 1  64 LEU H    .  64 . HN   1 1 
        838 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        839 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
        839 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        840 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
        840 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        841 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
        841 1 2 1 1  65 LYS H    .  65 . HN   1 1 
        842 1 1 1 1  65 LYS H    .  65 . HN   1 1 
        842 1 2 1 1  67 MET H    .  67 . HN   1 1 
        843 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
        843 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        844 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        844 1 2 1 1  63 LEU H    .  63 . HN   1 1 
        845 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
        845 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        846 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
        846 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        847 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        847 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        848 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
        848 1 2 1 1  67 MET H    .  67 . HN   1 1 
        849 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
        849 1 2 1 1  67 MET H    .  67 . HN   1 1 
        850 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
        850 1 2 1 1  67 MET H    .  67 . HN   1 1 
        851 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
        851 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        852 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
        852 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        853 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
        853 1 2 1 1  68 LEU H    .  68 . HN   1 1 
        854 1 1 1 1  67 MET HA   .  67 . HA   1 1 
        854 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        855 1 1 1 1  67 MET H    .  67 . HN   1 1 
        855 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        856 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
        856 1 2 1 1  69 GLU H    .  69 . HN   1 1 
        857 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
        857 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        858 1 1 1 1  68 LEU H    .  68 . HN   1 1 
        858 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        859 1 1 1 1  67 MET HA   .  67 . HA   1 1 
        859 1 2 1 1  70 LEU H    .  70 . HN   1 1 
        860 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
        860 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        861 1 1 1 1  69 GLU H    .  69 . HN   1 1 
        861 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        862 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
        862 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        863 1 1 1 1  67 MET HA   .  67 . HA   1 1 
        863 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        864 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        864 1 2 1 1  73 LYS H    .  73 . HN   1 1 
        865 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
        865 1 2 1 1  72 SER H    .  72 . HN   1 1 
        866 1 1 1 1  70 LEU H    .  70 . HN   1 1 
        866 1 2 1 1  72 SER H    .  72 . HN   1 1 
        867 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
        867 1 2 1 1  72 SER H    .  72 . HN   1 1 
        868 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
        868 1 2 1 1  72 SER H    .  72 . HN   1 1 
        869 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
        869 1 2 1 1  73 LYS H    .  73 . HN   1 1 
        870 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
        870 1 2 1 1  73 LYS H    .  73 . HN   1 1 
        871 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
        871 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        872 1 1 1 1  87 GLU H    .  87 . HN   1 1 
        872 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        873 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
        873 1 2 1 1  90 LEU H    .  90 . HN   1 1 
        874 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
        874 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        875 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
        875 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        876 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        876 1 2 1 1  91 GLU H    .  91 . HN   1 1 
        877 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        877 1 2 1 1  92 GLU H    .  92 . HN   1 1 
        878 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
        878 1 2 1 1  92 GLU H    .  92 . HN   1 1 
        879 1 1 1 1  91 GLU H    .  91 . HN   1 1 
        879 1 2 1 1  93 PHE H    .  93 . HN   1 1 
        880 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
        880 1 2 1 1  93 PHE H    .  93 . HN   1 1 
        881 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        881 1 2 1 1  93 PHE H    .  93 . HN   1 1 
        882 1 1 1 1  92 GLU H    .  92 . HN   1 1 
        882 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        883 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
        883 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        884 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
        884 1 2 1 1  94 LYS H    .  94 . HN   1 1 
        885 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
        885 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        886 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
        886 1 2 1 1  95 ARG H    .  95 . HN   1 1 
        887 1 1 1 1  95 ARG H    .  95 . HN   1 1 
        887 1 2 1 1  97 ILE H    .  97 . HN   1 1 
        888 1 1 1 1  94 LYS H    .  94 . HN   1 1 
        888 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        889 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
        889 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        890 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        890 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        891 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
        891 1 2 1 1  97 ILE H    .  97 . HN   1 1 
        892 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
        892 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        893 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
        893 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        894 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
        894 1 2 1 1  99 SER H    .  99 . HN   1 1 
        895 1 1 1 1  97 ILE H    .  97 . HN   1 1 
        895 1 2 1 1  99 SER H    .  99 . HN   1 1 
        896 1 1 1 1 110 ASP H    . 110 . HN   1 1 
        896 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        897 1 1 1 1 109 ASP H    . 109 . HN   1 1 
        897 1 2 1 1 112 GLU H    . 112 . HN   1 1 
        898 1 1 1 1 111 GLU H    . 111 . HN   1 1 
        898 1 2 1 1 113 ALA H    . 113 . HN   1 1 
        899 1 1 1 1 110 ASP HA   . 110 . HA   1 1 
        899 1 2 1 1 113 ALA H    . 113 . HN   1 1 
        900 1 1 1 1 112 GLU H    . 112 . HN   1 1 
        900 1 2 1 1 114 LEU H    . 114 . HN   1 1 
        901 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
        901 1 2 1 1 114 LEU H    . 114 . HN   1 1 
        902 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
        902 1 2 1 1 114 LEU H    . 114 . HN   1 1 
        903 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
        903 1 2 1 1 115 LYS H    . 115 . HN   1 1 
        904 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
        904 1 2 1 1 116 ILE H    . 116 . HN   1 1 
        905 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
        905 1 2 1 1 116 ILE H    . 116 . HN   1 1 
        906 1 1 1 1 116 ILE H    . 116 . HN   1 1 
        906 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        907 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
        907 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        908 1 1 1 1 115 LYS H    . 115 . HN   1 1 
        908 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        909 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
        909 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        910 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
        910 1 2 1 1 117 VAL H    . 117 . HN   1 1 
        911 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
        911 1 2 1 1 119 GLU H    . 119 . HN   1 1 
        912 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
        912 1 2 1 1 119 GLU H    . 119 . HN   1 1 
        913 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
        913 1 2 1 1 120 PHE H    . 120 . HN   1 1 
        914 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
        914 1 2 1 1 121 MET H    . 121 . HN   1 1 
        915 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
        915 1 2 1 1 121 MET H    . 121 . HN   1 1 
        916 1 1 1 1 120 PHE HA   . 120 . HA   1 1 
        916 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        917 1 1 1 1 120 PHE H    . 120 . HN   1 1 
        917 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        918 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
        918 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        919 1 1 1 1 121 MET HA   . 121 . HA   1 1 
        919 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        920 1 1 1 1 121 MET H    . 121 . HN   1 1 
        920 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        921 1 1 1 1 120 PHE HA   . 120 . HA   1 1 
        921 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        922 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
        922 1 2 1 1 123 LYS H    . 123 . HN   1 1 
        923 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        923 1 2 1 1  77 LYS H    .  77 . HN   1 1 
        924 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        924 1 2 1 1  79 PHE H    .  79 . HN   1 1 
        925 1 1 1 1   3 GLU H    .   3 . HN   1 1 
        925 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
        926 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        926 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
        927 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        927 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
        928 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        928 1 2 1 1  76 TYR HB2  .  76 . HB2  1 1 
        929 1 1 1 1   4 LEU H    .   4 . HN   1 1 
        929 1 2 1 1  76 TYR HB3  .  76 . HB1  1 1 
        930 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        930 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
        931 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        931 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
        932 1 1 1 1   5 ILE H    .   5 . HN   1 1 
        932 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
        933 1 1 1 1   7 ILE H    .   7 . HN   1 1 
        933 1 2 1 1  56 ILE H    .  56 . HN   1 1 
        934 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        934 1 2 1 1  81 LEU H    .  81 . HN   1 1 
        935 1 1 1 1   7 ILE H    .   7 . HN   1 1 
        935 1 2 1 1  57 ILE HA   .  57 . HA   1 1 
        936 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        936 1 2 1 1  82 LEU HA   .  82 . HA   1 1 
        937 1 1 1 1   8 ASN HD22 .   8 . HD22 1 1 
        937 1 2 1 1  61 LYS HA   .  61 . HA   1 1 
        938 1 1 1 1   8 ASN HD21 .   8 . HD21 1 1 
        938 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
        939 1 1 1 1   8 ASN HD22 .   8 . HD22 1 1 
        939 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
        940 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        940 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
        941 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        941 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
        942 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        942 1 2 1 1   9 THR MG   .   9 . HG2* 1 1 
        943 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        943 1 2 1 1  80 LEU HG   .  80 . HG   1 1 
        944 1 1 1 1   8 ASN H    .   8 . HN   1 1 
        944 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
        945 1 1 1 1   9 THR H    .   9 . HN   1 1 
        945 1 2 1 1  10 ASN HA   .  10 . HA   1 1 
        946 1 1 1 1   9 THR H    .   9 . HN   1 1 
        946 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        947 1 1 1 1   9 THR H    .   9 . HN   1 1 
        947 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
        948 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
        948 1 2 1 1   9 THR H    .   9 . HN   1 1 
        949 1 1 1 1  11 ASN H    .  11 . HN   1 1 
        949 1 2 1 1  14 LEU HB2  .  14 . HB2  1 1 
        950 1 1 1 1  11 ASN H    .  11 . HN   1 1 
        950 1 2 1 1  14 LEU HB3  .  14 . HB1  1 1 
        951 1 1 1 1  11 ASN HD21 .  11 . HD21 1 1 
        951 1 2 1 1  13 GLU HB3  .  13 . HB1  1 1 
        952 1 1 1 1  11 ASN HD22 .  11 . HD22 1 1 
        952 1 2 1 1  13 GLU HB3  .  13 . HB1  1 1 
        953 1 1 1 1   9 THR HB   .   9 . HB   1 1 
        953 1 2 1 1  11 ASN H    .  11 . HN   1 1 
        954 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
        954 1 2 1 1  11 ASN H    .  11 . HN   1 1 
        955 1 1 1 1  12 ASP H    .  12 . HN   1 1 
        955 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        956 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        956 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        957 1 1 1 1  11 ASN HB3  .  11 . HB1  1 1 
        957 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        958 1 1 1 1  11 ASN HB2  .  11 . HB2  1 1 
        958 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        959 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        959 1 2 1 1  15 ILE HA   .  15 . HA   1 1 
        960 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
        960 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        961 1 1 1 1  20 LYS H    .  20 . HN   1 1 
        961 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
        962 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
        962 1 2 1 1  20 LYS H    .  20 . HN   1 1 
        963 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        963 1 2 1 1  22 VAL MG2  .  22 . HG2* 1 1 
        964 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
        964 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        965 1 1 1 1  23 GLU H    .  23 . HN   1 1 
        965 1 2 1 1  23 GLU HG2  .  23 . HG2  1 1 
        966 1 1 1 1  23 GLU H    .  23 . HN   1 1 
        966 1 2 1 1  23 GLU HG3  .  23 . HG1  1 1 
        967 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
        967 1 2 1 1  24 ASN HD21 .  24 . HD21 1 1 
        968 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
        968 1 2 1 1  24 ASN HD22 .  24 . HD22 1 1 
        969 1 1 1 1  23 GLU H    .  23 . HN   1 1 
        969 1 2 1 1  25 GLN H    .  25 . HN   1 1 
        970 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        970 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
        971 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        971 1 2 1 1  26 GLY HA2  .  26 . HA2  1 1 
        972 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
        972 1 2 1 1  25 GLN H    .  25 . HN   1 1 
        973 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        973 1 2 1 1  26 GLY HA3  .  26 . HA1  1 1 
        974 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        974 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
        975 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
        975 1 2 1 1  25 GLN H    .  25 . HN   1 1 
        976 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
        976 1 2 1 1  25 GLN H    .  25 . HN   1 1 
        977 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
        977 1 2 1 1  26 GLY H    .  26 . HN   1 1 
        978 1 1 1 1  27 TYR H    .  27 . HN   1 1 
        978 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
        979 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
        979 1 2 1 1  27 TYR H    .  27 . HN   1 1 
        980 1 1 1 1  28 GLN HE21 .  28 . HE21 1 1 
        980 1 2 1 1  52 GLU HG2  .  52 . HG2  1 1 
        981 1 1 1 1  28 GLN HE21 .  28 . HE21 1 1 
        981 1 2 1 1  52 GLU HG3  .  52 . HG1  1 1 
        982 1 1 1 1  28 GLN HE22 .  28 . HE22 1 1 
        982 1 2 1 1  52 GLU HG2  .  52 . HG2  1 1 
        983 1 1 1 1  28 GLN HE22 .  28 . HE22 1 1 
        983 1 2 1 1  52 GLU HG3  .  52 . HG1  1 1 
        984 1 1 1 1  28 GLN H    .  28 . HN   1 1 
        984 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
        985 1 1 1 1  28 GLN H    .  28 . HN   1 1 
        985 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
        986 1 1 1 1  28 GLN H    .  28 . HN   1 1 
        986 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
        987 1 1 1 1  28 GLN HE21 .  28 . HE21 1 1 
        987 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
        988 1 1 1 1  29 VAL H    .  29 . HN   1 1 
        988 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
        989 1 1 1 1  30 ARG H    .  30 . HN   1 1 
        989 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
        990 1 1 1 1  30 ARG H    .  30 . HN   1 1 
        990 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
        991 1 1 1 1  30 ARG H    .  30 . HN   1 1 
        991 1 2 1 1  56 ILE HA   .  56 . HA   1 1 
        992 1 1 1 1  30 ARG H    .  30 . HN   1 1 
        992 1 2 1 1  55 LEU H    .  55 . HN   1 1 
        993 1 1 1 1  31 ASP H    .  31 . HN   1 1 
        993 1 2 1 1  32 VAL MG2  .  32 . HG2* 1 1 
        994 1 1 1 1  31 ASP H    .  31 . HN   1 1 
        994 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
        995 1 1 1 1  32 VAL H    .  32 . HN   1 1 
        995 1 2 1 1  33 ASN HD21 .  33 . HD21 1 1 
        996 1 1 1 1  32 VAL H    .  32 . HN   1 1 
        996 1 2 1 1  58 SER HA   .  58 . HA   1 1 
        997 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        997 1 2 1 1  37 GLU HB3  .  37 . HB1  1 1 
        998 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        998 1 2 1 1  37 GLU HB2  .  37 . HB2  1 1 
        999 1 1 1 1  33 ASN H    .  33 . HN   1 1 
        999 1 2 1 1  37 GLU HG2  .  37 . HG2  1 1 
       1000 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       1000 1 2 1 1  37 GLU HA   .  37 . HA   1 1 
       1001 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       1001 1 2 1 1  38 LEU H    .  38 . HN   1 1 
       1002 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       1002 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       1003 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1003 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       1004 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       1004 1 2 1 1  34 ASP H    .  34 . HN   1 1 
       1005 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1005 1 2 1 1  33 ASN HD21 .  33 . HD21 1 1 
       1006 1 1 1 1  33 ASN HD21 .  33 . HD21 1 1 
       1006 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1007 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1007 1 2 1 1  33 ASN HD22 .  33 . HD22 1 1 
       1008 1 1 1 1  33 ASN HD22 .  33 . HD22 1 1 
       1008 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1009 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1009 1 2 1 1  38 LEU HA   .  38 . HA   1 1 
       1010 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1010 1 2 1 1  35 SER HA   .  35 . HA   1 1 
       1011 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1011 1 2 1 1  37 GLU HG2  .  37 . HG2  1 1 
       1012 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       1012 1 2 1 1  34 ASP H    .  34 . HN   1 1 
       1013 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1013 1 2 1 1  34 ASP H    .  34 . HN   1 1 
       1014 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1014 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1015 1 1 1 1  35 SER H    .  35 . HN   1 1 
       1015 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       1016 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       1016 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       1017 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       1017 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1018 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       1018 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       1019 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1019 1 2 1 1  36 ASP H    .  36 . HN   1 1 
       1020 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1020 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       1021 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1021 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       1022 1 1 1 1  37 GLU H    .  37 . HN   1 1 
       1022 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1023 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1023 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       1024 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1024 1 2 1 1  38 LEU H    .  38 . HN   1 1 
       1025 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1025 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       1026 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1026 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       1027 1 1 1 1  42 MET H    .  42 . HN   1 1 
       1027 1 2 1 1  43 LYS HA   .  43 . HA   1 1 
       1028 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       1028 1 2 1 1  42 MET H    .  42 . HN   1 1 
       1029 1 1 1 1  42 MET H    .  42 . HN   1 1 
       1029 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1030 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       1030 1 2 1 1  42 MET H    .  42 . HN   1 1 
       1031 1 1 1 1  46 ALA H    .  46 . HN   1 1 
       1031 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       1032 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
       1032 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1033 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       1033 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1034 1 1 1 1  28 GLN H    .  28 . HN   1 1 
       1034 1 2 1 1  55 LEU H    .  55 . HN   1 1 
       1035 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       1035 1 2 1 1  55 LEU H    .  55 . HN   1 1 
       1036 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1036 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       1037 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       1037 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1038 1 1 1 1  30 ARG H    .  30 . HN   1 1 
       1038 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1039 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1039 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1040 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       1040 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1041 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       1041 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1042 1 1 1 1   9 THR H    .   9 . HN   1 1 
       1042 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1043 1 1 1 1  91 GLU H    .  91 . HN   1 1 
       1043 1 2 1 1  94 LYS H    .  94 . HN   1 1 
       1044 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       1044 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       1045 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       1045 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
       1046 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       1046 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
       1047 1 1 1 1  33 ASN HB2  .  33 . HB2  1 1 
       1047 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
       1048 1 1 1 1  33 ASN HB3  .  33 . HB1  1 1 
       1048 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
       1049 1 1 1 1  33 ASN HB2  .  33 . HB2  1 1 
       1049 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
       1050 1 1 1 1  33 ASN HB3  .  33 . HB1  1 1 
       1050 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
       1051 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       1051 1 2 1 1  60 ASP HB2  .  60 . HB2  1 1 
       1052 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       1052 1 2 1 1  60 ASP HB3  .  60 . HB1  1 1 
       1053 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       1053 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       1054 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1054 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
       1055 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1055 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
       1056 1 1 1 1  57 ILE MG   .  57 . HG2* 1 1 
       1056 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       1057 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       1057 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       1058 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       1058 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1059 1 1 1 1   8 ASN HD22 .   8 . HD22 1 1 
       1059 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       1060 1 1 1 1   8 ASN HD21 .   8 . HD21 1 1 
       1060 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       1061 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       1061 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       1062 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1062 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       1063 1 1 1 1  63 LEU H    .  63 . HN   1 1 
       1063 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       1064 1 1 1 1  60 ASP HB3  .  60 . HB1  1 1 
       1064 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       1065 1 1 1 1  60 ASP HB2  .  60 . HB2  1 1 
       1065 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       1066 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1066 1 2 1 1  65 LYS H    .  65 . HN   1 1 
       1067 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1067 1 2 1 1  65 LYS H    .  65 . HN   1 1 
       1068 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       1068 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       1069 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       1069 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       1070 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       1070 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       1071 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       1071 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       1072 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1072 1 2 1 1  67 MET H    .  67 . HN   1 1 
       1073 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1073 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       1074 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1074 1 2 1 1  69 GLU H    .  69 . HN   1 1 
       1075 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1075 1 2 1 1  69 GLU H    .  69 . HN   1 1 
       1076 1 1 1 1  69 GLU H    .  69 . HN   1 1 
       1076 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1077 1 1 1 1  69 GLU H    .  69 . HN   1 1 
       1077 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       1078 1 1 1 1  69 GLU H    .  69 . HN   1 1 
       1078 1 2 1 1  70 LEU HG   .  70 . HG   1 1 
       1079 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1079 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1080 1 1 1 1  68 LEU H    .  68 . HN   1 1 
       1080 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       1081 1 1 1 1  72 SER H    .  72 . HN   1 1 
       1081 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       1082 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       1082 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       1083 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       1083 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       1084 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       1084 1 2 1 1  74 LEU HG   .  74 . HG   1 1 
       1085 1 1 1 1  72 SER H    .  72 . HN   1 1 
       1085 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       1086 1 1 1 1  74 LEU H    .  74 . HN   1 1 
       1086 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       1087 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
       1087 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       1088 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1088 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       1089 1 1 1 1  72 SER HA   .  72 . HA   1 1 
       1089 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       1090 1 1 1 1  73 LYS HB2  .  73 . HB2  1 1 
       1090 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       1091 1 1 1 1  73 LYS HB3  .  73 . HB1  1 1 
       1091 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       1092 1 1 1 1  75 GLY H    .  75 . HN   1 1 
       1092 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       1093 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       1093 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       1094 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1094 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       1095 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       1095 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       1096 1 1 1 1  77 LYS H    .  77 . HN   1 1 
       1096 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1097 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       1097 1 2 1 1  77 LYS H    .  77 . HN   1 1 
       1098 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1098 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       1099 1 1 1 1  78 VAL H    .  78 . HN   1 1 
       1099 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       1100 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1100 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       1101 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1101 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       1102 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       1102 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       1103 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       1103 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       1104 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       1104 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       1105 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       1105 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1106 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       1106 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1107 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       1107 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       1108 1 1 1 1   8 ASN H    .   8 . HN   1 1 
       1108 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       1109 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       1109 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       1110 1 1 1 1  82 LEU H    .  82 . HN   1 1 
       1110 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       1111 1 1 1 1  82 LEU H    .  82 . HN   1 1 
       1111 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       1112 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       1112 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       1113 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       1113 1 2 1 1  83 GLN HE21 .  83 . HE21 1 1 
       1114 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       1114 1 2 1 1  83 GLN HE22 .  83 . HE22 1 1 
       1115 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       1115 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       1116 1 1 1 1   8 ASN H    .   8 . HN   1 1 
       1116 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       1117 1 1 1 1  83 GLN HE21 .  83 . HE21 1 1 
       1117 1 2 1 1  84 ASP HA   .  84 . HA   1 1 
       1118 1 1 1 1  83 GLN HE22 .  83 . HE22 1 1 
       1118 1 2 1 1  84 ASP HA   .  84 . HA   1 1 
       1119 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1119 1 2 1 1  83 GLN HE21 .  83 . HE21 1 1 
       1120 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1120 1 2 1 1  83 GLN HE22 .  83 . HE22 1 1 
       1121 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1121 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       1122 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1122 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1123 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1123 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1124 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1124 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       1125 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1125 1 2 1 1 108 THR HA   . 108 . HA   1 1 
       1126 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1126 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       1127 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1127 1 2 1 1  86 ASP H    .  86 . HN   1 1 
       1128 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       1128 1 2 1 1  86 ASP H    .  86 . HN   1 1 
       1129 1 1 1 1  86 ASP HB2  .  86 . HB2  1 1 
       1129 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       1130 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       1130 1 2 1 1  93 PHE H    .  93 . HN   1 1 
       1131 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       1131 1 2 1 1  93 PHE H    .  93 . HN   1 1 
       1132 1 1 1 1  94 LYS H    .  94 . HN   1 1 
       1132 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       1133 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       1133 1 2 1 1  94 LYS H    .  94 . HN   1 1 
       1134 1 1 1 1  95 ARG H    .  95 . HN   1 1 
       1134 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1135 1 1 1 1  99 SER H    .  99 . HN   1 1 
       1135 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1136 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1136 1 2 1 1  99 SER H    .  99 . HN   1 1 
       1137 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1137 1 2 1 1 100 GLN H    . 100 . HN   1 1 
       1138 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1138 1 2 1 1 100 GLN HE21 . 100 . HE21 1 1 
       1139 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1139 1 2 1 1 100 GLN HE21 . 100 . HE21 1 1 
       1140 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1140 1 2 1 1 100 GLN HE22 . 100 . HE22 1 1 
       1141 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1141 1 2 1 1 100 GLN HE22 . 100 . HE22 1 1 
       1142 1 1 1 1 101 GLY H    . 101 . HN   1 1 
       1142 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       1143 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       1143 1 2 1 1 102 TYR H    . 102 . HN   1 1 
       1144 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1144 1 2 1 1 102 TYR H    . 102 . HN   1 1 
       1145 1 1 1 1 102 TYR H    . 102 . HN   1 1 
       1145 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1146 1 1 1 1 103 GLU H    . 103 . HN   1 1 
       1146 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1147 1 1 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1147 1 2 1 1 103 GLU H    . 103 . HN   1 1 
       1148 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1148 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       1149 1 1 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1149 1 2 1 1 106 LYS H    . 106 . HN   1 1 
       1150 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       1150 1 2 1 1 106 LYS H    . 106 . HN   1 1 
       1151 1 1 1 1 106 LYS H    . 106 . HN   1 1 
       1151 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       1152 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       1152 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       1153 1 1 1 1 107 VAL HA   . 107 . HA   1 1 
       1153 1 2 1 1 109 ASP H    . 109 . HN   1 1 
       1154 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       1154 1 2 1 1 112 GLU HG3  . 112 . HG1  1 1 
       1155 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       1155 1 2 1 1 112 GLU HG2  . 112 . HG2  1 1 
       1156 1 1 1 1 107 VAL HB   . 107 . HB   1 1 
       1156 1 2 1 1 109 ASP H    . 109 . HN   1 1 
       1157 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       1157 1 2 1 1 110 ASP HA   . 110 . HA   1 1 
       1158 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       1158 1 2 1 1 109 ASP H    . 109 . HN   1 1 
       1159 1 1 1 1  83 GLN HE21 .  83 . HE21 1 1 
       1159 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       1160 1 1 1 1  83 GLN HE22 .  83 . HE22 1 1 
       1160 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       1161 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       1161 1 2 1 1 111 GLU H    . 111 . HN   1 1 
       1162 1 1 1 1 111 GLU H    . 111 . HN   1 1 
       1162 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       1163 1 1 1 1 111 GLU H    . 111 . HN   1 1 
       1163 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       1164 1 1 1 1 111 GLU H    . 111 . HN   1 1 
       1164 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1165 1 1 1 1 109 ASP HB3  . 109 . HB1  1 1 
       1165 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       1166 1 1 1 1 112 GLU H    . 112 . HN   1 1 
       1166 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       1167 1 1 1 1 112 GLU H    . 112 . HN   1 1 
       1167 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       1168 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       1168 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       1169 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       1169 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       1170 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       1170 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       1171 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1171 1 2 1 1 114 LEU H    . 114 . HN   1 1 
       1172 1 1 1 1 120 PHE H    . 120 . HN   1 1 
       1172 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       1173 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1173 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1174 1 1 1 1 116 ILE MG   . 116 . HG2* 1 1 
       1174 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1175 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1175 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1176 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1176 1 2 1 1 121 MET H    . 121 . HN   1 1 
       1177 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1177 1 2 1 1 121 MET H    . 121 . HN   1 1 
       1178 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       1178 1 2 1 1 122 GLN HE21 . 122 . HE21 1 1 
       1179 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       1179 1 2 1 1 122 GLN HE22 . 122 . HE22 1 1 
       1180 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       1180 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       1181 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       1181 1 2 1 1  53 LYS HA   .  53 . HA   1 1 
       1182 1 1 1 1   4 LEU H    .   4 . HN   1 1 
       1182 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       1183 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       1183 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       1184 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1184 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       1185 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       1185 1 2 1 1  11 ASN H    .  11 . HN   1 1 
       1186 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       1186 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1187 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       1187 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       1188 1 1 1 1  11 ASN HD21 .  11 . HD21 1 1 
       1188 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       1189 1 1 1 1  11 ASN HD22 .  11 . HD22 1 1 
       1189 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       1190 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       1190 1 2 1 1  21 GLU HG2  .  21 . HG2  1 1 
       1191 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       1191 1 2 1 1  21 GLU HG3  .  21 . HG1  1 1 
       1192 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1192 1 2 1 1  19 LYS H    .  19 . HN   1 1 
       1193 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       1193 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       1194 1 1 1 1  24 ASN HA   .  24 . HA   1 1 
       1194 1 2 1 1  26 GLY H    .  26 . HN   1 1 
       1195 1 1 1 1  31 ASP H    .  31 . HN   1 1 
       1195 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
       1196 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       1196 1 2 1 1  33 ASN HD22 .  33 . HD22 1 1 
       1197 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       1197 1 2 1 1  34 ASP HA   .  34 . HA   1 1 
       1198 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1198 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       1199 1 1 1 1  72 SER HA   .  72 . HA   1 1 
       1199 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       1200 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1200 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       1201 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       1201 1 2 1 1  80 LEU H    .  80 . HN   1 1 
       1202 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       1202 1 2 1 1  80 LEU H    .  80 . HN   1 1 
       1203 1 1 1 1   9 THR H    .   9 . HN   1 1 
       1203 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       1204 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       1204 1 2 1 1  95 ARG H    .  95 . HN   1 1 
       1205 1 1 1 1 110 ASP H    . 110 . HN   1 1 
       1205 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       1206 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1206 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       1207 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1207 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       1208 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       1208 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       1209 1 1 1 1  41 GLU H    .  41 . HN   1 1 
       1209 1 2 1 1  44 LYS H    .  44 . HN   1 1 
       1210 1 1 1 1  44 LYS H    .  44 . HN   1 1 
       1210 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1211 1 1 1 1  42 MET H    .  42 . HN   1 1 
       1211 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       1212 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       1212 1 2 1 1  48 GLU H    .  48 . HN   1 1 
       1213 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1213 1 2 1 1  48 GLU H    .  48 . HN   1 1 
       1214 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       1214 1 2 1 1  51 PHE H    .  51 . HN   1 1 
       1215 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       1215 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1216 1 1 1 1  54 ILE H    .  54 . HN   1 1 
       1216 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       1217 1 1 1 1   4 LEU H    .   4 . HN   1 1 
       1217 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1218 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1218 1 2 1 1  55 LEU H    .  55 . HN   1 1 
       1219 1 1 1 1  62 GLN H    .  62 . HN   1 1 
       1219 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1220 1 1 1 1  63 LEU H    .  63 . HN   1 1 
       1220 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       1221 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1221 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       1222 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1222 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       1223 1 1 1 1  69 GLU H    .  69 . HN   1 1 
       1223 1 2 1 1  72 SER H    .  72 . HN   1 1 
       1224 1 1 1 1  72 SER HA   .  72 . HA   1 1 
       1224 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       1225 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       1225 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       1226 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       1226 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       1227 1 1 1 1  87 GLU H    .  87 . HN   1 1 
       1227 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       1228 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       1228 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       1229 1 1 1 1 111 GLU H    . 111 . HN   1 1 
       1229 1 2 1 1 114 LEU H    . 114 . HN   1 1 
       1230 1 1 1 1 113 ALA MB   . 113 . HB*  1 1 
       1230 1 2 1 1 117 VAL H    . 117 . HN   1 1 
       1231 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       1231 1 2 1 1 121 MET H    . 121 . HN   1 1 
       1232 1 1 1 1  11 ASN HD21 .  11 . HD21 1 1 
       1232 1 2 1 1  12 ASP H    .  12 . HN   1 1 
       1233 1 1 1 1  11 ASN HD22 .  11 . HD22 1 1 
       1233 1 2 1 1  12 ASP H    .  12 . HN   1 1 
       1234 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       1234 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1235 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1235 1 2 1 1  20 LYS H    .  20 . HN   1 1 
       1236 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       1236 1 2 1 1  77 LYS H    .  77 . HN   1 1 
       1237 1 1 1 1  79 PHE H    .  79 . HN   1 1 
       1237 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       1238 1 1 1 1 104 VAL H    . 104 . HN   1 1 
       1238 1 2 1 1 105 ARG HA   . 105 . HA   1 1 
       1239 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       1239 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       1240 1 1 1 1  51 PHE QD   .  51 . HD*  1 1 
       1240 1 2 1 1  53 LYS H    .  53 . HN   1 1 
       1241 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       1241 1 2 1 1  53 LYS H    .  53 . HN   1 1 
       1242 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       1242 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       1243 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       1243 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       1244 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       1244 1 2 1 1  38 LEU H    .  38 . HN   1 1 
       1245 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1245 1 2 1 1  17 LYS H    .  17 . HN   1 1 
       1246 1 1 1 1  17 LYS H    .  17 . HN   1 1 
       1246 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1247 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       1247 1 2 1 1  41 GLU HA   .  41 . HA   1 1 
       1248 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       1248 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       1249 1 1 1 1  38 LEU H    .  38 . HN   1 1 
       1249 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       1250 1 1 1 1  58 SER HG   .  58 . HG   1 1 
       1250 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       1251 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       1251 1 2 1 1  55 LEU H    .  55 . HN   1 1 
       1252 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1252 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       1253 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       1253 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       1254 1 1 1 1  43 LYS H    .  43 . HN   1 1 
       1254 1 2 1 1  46 ALA H    .  46 . HN   1 1 
       1255 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       1255 1 2 1 1  43 LYS H    .  43 . HN   1 1 
       1256 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       1256 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
       1257 1 1 1 1  62 GLN H    .  62 . HN   1 1 
       1257 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
       1258 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       1258 1 2 1 1  48 GLU H    .  48 . HN   1 1 
       1259 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       1259 1 2 1 1  48 GLU H    .  48 . HN   1 1 
       1260 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       1260 1 2 1 1   2 LYS HD2  .   2 . HD2  1 1 
       1261 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       1261 1 2 1 1   2 LYS HD3  .   2 . HD1  1 1 
       1262 1 1 1 1   2 LYS HB3  .   2 . HB1  1 1 
       1262 1 2 1 1   2 LYS HD3  .   2 . HD1  1 1 
       1263 1 1 1 1   2 LYS HB2  .   2 . HB2  1 1 
       1263 1 2 1 1   2 LYS HD2  .   2 . HD2  1 1 
       1264 1 1 1 1   2 LYS HB3  .   2 . HB1  1 1 
       1264 1 2 1 1   2 LYS HD2  .   2 . HD2  1 1 
       1265 1 1 1 1   2 LYS HB2  .   2 . HB2  1 1 
       1265 1 2 1 1   2 LYS HD3  .   2 . HD1  1 1 
       1266 1 1 1 1   2 LYS HB3  .   2 . HB1  1 1 
       1266 1 2 1 1   2 LYS HE2  .   2 . HE2  1 1 
       1267 1 1 1 1   2 LYS HB3  .   2 . HB1  1 1 
       1267 1 2 1 1   2 LYS HE3  .   2 . HE1  1 1 
       1268 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
       1268 1 2 1 1   4 LEU HG   .   4 . HG   1 1 
       1269 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1269 1 2 1 1  55 LEU HG   .  55 . HG   1 1 
       1270 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1270 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       1271 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
       1271 1 2 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1272 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
       1272 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       1273 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       1273 1 2 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1274 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1274 1 2 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1275 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1275 1 2 1 1   6 LEU HG   .   6 . HG   1 1 
       1276 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1276 1 2 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1277 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1277 1 2 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1278 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       1278 1 2 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1279 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       1279 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1280 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       1280 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1281 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       1281 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       1282 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1282 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1283 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       1283 1 2 1 1  57 ILE HG12 .  57 . HG12 1 1 
       1284 1 1 1 1   7 ILE HG12 .   7 . HG12 1 1 
       1284 1 2 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1285 1 1 1 1   7 ILE HG13 .   7 . HG11 1 1 
       1285 1 2 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1286 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1286 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1287 1 1 1 1  11 ASN HA   .  11 . HA   1 1 
       1287 1 2 1 1  11 ASN HD22 .  11 . HD22 1 1 
       1288 1 1 1 1  12 ASP H    .  12 . HN   1 1 
       1288 1 2 1 1  12 ASP HB2  .  12 . HB2  1 1 
       1289 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       1289 1 2 1 1  13 GLU HG2  .  13 . HG2  1 1 
       1290 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       1290 1 2 1 1  87 GLU HG3  .  87 . HG1  1 1 
       1291 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       1291 1 2 1 1  87 GLU HG2  .  87 . HG2  1 1 
       1292 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1292 1 2 1 1  14 LEU HG   .  14 . HG   1 1 
       1293 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1293 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1294 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       1294 1 2 1 1  14 LEU HB2  .  14 . HB2  1 1 
       1295 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1295 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1296 1 1 1 1  14 LEU HB2  .  14 . HB2  1 1 
       1296 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1297 1 1 1 1  14 LEU HB3  .  14 . HB1  1 1 
       1297 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1298 1 1 1 1  14 LEU HB2  .  14 . HB2  1 1 
       1298 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1299 1 1 1 1  14 LEU HB3  .  14 . HB1  1 1 
       1299 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       1300 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1300 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1301 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1301 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
       1302 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1302 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
       1303 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1303 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1304 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       1304 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1305 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1305 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1306 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1306 1 2 1 1  16 LYS HG3  .  16 . HG1  1 1 
       1307 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1307 1 2 1 1  16 LYS HG2  .  16 . HG2  1 1 
       1308 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1308 1 2 1 1  16 LYS HD2  .  16 . HD2  1 1 
       1309 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1309 1 2 1 1  16 LYS HD3  .  16 . HD1  1 1 
       1310 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       1310 1 2 1 1  17 LYS HG2  .  17 . HG2  1 1 
       1311 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       1311 1 2 1 1  17 LYS HG3  .  17 . HG1  1 1 
       1312 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       1312 1 2 1 1  20 LYS HG2  .  20 . HG2  1 1 
       1313 1 1 1 1  17 LYS HB2  .  17 . HB2  1 1 
       1313 1 2 1 1  17 LYS HD3  .  17 . HD1  1 1 
       1314 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1314 1 2 1 1  17 LYS HD2  .  17 . HD2  1 1 
       1315 1 1 1 1  17 LYS HB2  .  17 . HB2  1 1 
       1315 1 2 1 1  17 LYS HD2  .  17 . HD2  1 1 
       1316 1 1 1 1  17 LYS HB3  .  17 . HB1  1 1 
       1316 1 2 1 1  17 LYS HD2  .  17 . HD2  1 1 
       1317 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1317 1 2 1 1  17 LYS HD3  .  17 . HD1  1 1 
       1318 1 1 1 1  17 LYS HB3  .  17 . HB1  1 1 
       1318 1 2 1 1  17 LYS HD3  .  17 . HD1  1 1 
       1319 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       1319 1 2 1 1  17 LYS HE2  .  17 . HE2  1 1 
       1320 1 1 1 1  17 LYS HB2  .  17 . HB2  1 1 
       1320 1 2 1 1  17 LYS HE2  .  17 . HE2  1 1 
       1321 1 1 1 1  17 LYS HB3  .  17 . HB1  1 1 
       1321 1 2 1 1  17 LYS HE2  .  17 . HE2  1 1 
       1322 1 1 1 1  17 LYS HE2  .  17 . HE2  1 1 
       1322 1 2 1 1  17 LYS HG2  .  17 . HG2  1 1 
       1323 1 1 1 1  17 LYS HE2  .  17 . HE2  1 1 
       1323 1 2 1 1  17 LYS HG3  .  17 . HG1  1 1 
       1324 1 1 1 1  17 LYS H    .  17 . HN   1 1 
       1324 1 2 1 1  17 LYS HE3  .  17 . HE1  1 1 
       1325 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       1325 1 2 1 1  17 LYS HE3  .  17 . HE1  1 1 
       1326 1 1 1 1  17 LYS HB2  .  17 . HB2  1 1 
       1326 1 2 1 1  17 LYS HE3  .  17 . HE1  1 1 
       1327 1 1 1 1  17 LYS HB3  .  17 . HB1  1 1 
       1327 1 2 1 1  17 LYS HE3  .  17 . HE1  1 1 
       1328 1 1 1 1  17 LYS HE3  .  17 . HE1  1 1 
       1328 1 2 1 1  17 LYS HG2  .  17 . HG2  1 1 
       1329 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1329 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
       1330 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1330 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1331 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1331 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
       1332 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1332 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1333 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       1333 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1334 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1334 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1335 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       1335 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1336 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1336 1 2 1 1  19 LYS HG2  .  19 . HG2  1 1 
       1337 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1337 1 2 1 1  19 LYS HG3  .  19 . HG1  1 1 
       1338 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1338 1 2 1 1  19 LYS HD2  .  19 . HD2  1 1 
       1339 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1339 1 2 1 1  19 LYS HD3  .  19 . HD1  1 1 
       1340 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       1340 1 2 1 1  19 LYS HE2  .  19 . HE2  1 1 
       1341 1 1 1 1  19 LYS HB2  .  19 . HB2  1 1 
       1341 1 2 1 1  19 LYS HE2  .  19 . HE2  1 1 
       1342 1 1 1 1  19 LYS HB3  .  19 . HB1  1 1 
       1342 1 2 1 1  19 LYS HE2  .  19 . HE2  1 1 
       1343 1 1 1 1  19 LYS HB2  .  19 . HB2  1 1 
       1343 1 2 1 1  19 LYS HE3  .  19 . HE1  1 1 
       1344 1 1 1 1  19 LYS HB3  .  19 . HB1  1 1 
       1344 1 2 1 1  19 LYS HE3  .  19 . HE1  1 1 
       1345 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1345 1 2 1 1  20 LYS HE2  .  20 . HE2  1 1 
       1346 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1346 1 2 1 1  20 LYS HE3  .  20 . HE1  1 1 
       1347 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1347 1 2 1 1  20 LYS HG2  .  20 . HG2  1 1 
       1348 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1348 1 2 1 1  20 LYS HG3  .  20 . HG1  1 1 
       1349 1 1 1 1  21 GLU H    .  21 . HN   1 1 
       1349 1 2 1 1  21 GLU HB2  .  21 . HB2  1 1 
       1350 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       1350 1 2 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       1351 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1351 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1352 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       1352 1 2 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1353 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1353 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       1354 1 1 1 1  23 GLU H    .  23 . HN   1 1 
       1354 1 2 1 1  23 GLU HB2  .  23 . HB2  1 1 
       1355 1 1 1 1  23 GLU H    .  23 . HN   1 1 
       1355 1 2 1 1  23 GLU HB3  .  23 . HB1  1 1 
       1356 1 1 1 1  24 ASN H    .  24 . HN   1 1 
       1356 1 2 1 1  24 ASN HB2  .  24 . HB2  1 1 
       1357 1 1 1 1  24 ASN H    .  24 . HN   1 1 
       1357 1 2 1 1  24 ASN HB3  .  24 . HB1  1 1 
       1358 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1358 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       1359 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1359 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1360 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1360 1 2 1 1  27 TYR H    .  27 . HN   1 1 
       1361 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1361 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
       1362 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       1362 1 2 1 1  25 GLN HB2  .  25 . HB2  1 1 
       1363 1 1 1 1  28 GLN H    .  28 . HN   1 1 
       1363 1 2 1 1  28 GLN HG2  .  28 . HG2  1 1 
       1364 1 1 1 1  28 GLN H    .  28 . HN   1 1 
       1364 1 2 1 1  28 GLN HG3  .  28 . HG1  1 1 
       1365 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       1365 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       1366 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       1366 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       1367 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       1367 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1368 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       1368 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1369 1 1 1 1  30 ARG HA   .  30 . HA   1 1 
       1369 1 2 1 1  30 ARG HD3  .  30 . HD1  1 1 
       1370 1 1 1 1  30 ARG H    .  30 . HN   1 1 
       1370 1 2 1 1  30 ARG HG2  .  30 . HG2  1 1 
       1371 1 1 1 1  30 ARG H    .  30 . HN   1 1 
       1371 1 2 1 1  30 ARG HG3  .  30 . HG1  1 1 
       1372 1 1 1 1  30 ARG HA   .  30 . HA   1 1 
       1372 1 2 1 1  30 ARG HD2  .  30 . HD2  1 1 
       1373 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1373 1 2 1 1  36 ASP H    .  36 . HN   1 1 
       1374 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1374 1 2 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1375 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       1375 1 2 1 1  33 ASN HB3  .  33 . HB1  1 1 
       1376 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       1376 1 2 1 1  36 ASP HB3  .  36 . HB1  1 1 
       1377 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1377 1 2 1 1  38 LEU HB2  .  38 . HB2  1 1 
       1378 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
       1378 1 2 1 1  38 LEU HG   .  38 . HG   1 1 
       1379 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
       1379 1 2 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       1380 1 1 1 1  38 LEU H    .  38 . HN   1 1 
       1380 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1381 1 1 1 1  35 SER HB2  .  35 . HB2  1 1 
       1381 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1382 1 1 1 1  38 LEU HB2  .  38 . HB2  1 1 
       1382 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1383 1 1 1 1  38 LEU HB3  .  38 . HB1  1 1 
       1383 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1384 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       1384 1 2 1 1 118 ARG HG3  . 118 . HG1  1 1 
       1385 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       1385 1 2 1 1 118 ARG HG2  . 118 . HG2  1 1 
       1386 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1386 1 2 1 1  39 LYS HE2  .  39 . HE2  1 1 
       1387 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1387 1 2 1 1  39 LYS HE3  .  39 . HE1  1 1 
       1388 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1388 1 2 1 1  39 LYS HG2  .  39 . HG2  1 1 
       1389 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1389 1 2 1 1  39 LYS HG3  .  39 . HG1  1 1 
       1390 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       1390 1 2 1 1  40 LYS HG2  .  40 . HG2  1 1 
       1391 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       1391 1 2 1 1  40 LYS HG3  .  40 . HG1  1 1 
       1392 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       1392 1 2 1 1  40 LYS HG3  .  40 . HG1  1 1 
       1393 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       1393 1 2 1 1  43 LYS HE2  .  43 . HE2  1 1 
       1394 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       1394 1 2 1 1  43 LYS HE3  .  43 . HE1  1 1 
       1395 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       1395 1 2 1 1  42 MET HG2  .  42 . HG2  1 1 
       1396 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       1396 1 2 1 1  42 MET HG3  .  42 . HG1  1 1 
       1397 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       1397 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       1398 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       1398 1 2 1 1  42 MET HG2  .  42 . HG2  1 1 
       1399 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       1399 1 2 1 1  42 MET HG3  .  42 . HG1  1 1 
       1400 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
       1400 1 2 1 1  43 LYS HG2  .  43 . HG2  1 1 
       1401 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
       1401 1 2 1 1  43 LYS HG3  .  43 . HG1  1 1 
       1402 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       1402 1 2 1 1  44 LYS HG3  .  44 . HG1  1 1 
       1403 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       1403 1 2 1 1 106 LYS HE2  . 106 . HE2  1 1 
       1404 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       1404 1 2 1 1 106 LYS HE3  . 106 . HE1  1 1 
       1405 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       1405 1 2 1 1  44 LYS HG2  .  44 . HG2  1 1 
       1406 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       1406 1 2 1 1  44 LYS HD2  .  44 . HD2  1 1 
       1407 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       1407 1 2 1 1  44 LYS HD3  .  44 . HD1  1 1 
       1408 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       1408 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1409 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       1409 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1410 1 1 1 1  45 LEU H    .  45 . HN   1 1 
       1410 1 2 1 1  45 LEU HB2  .  45 . HB2  1 1 
       1411 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       1411 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1412 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       1412 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1413 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       1413 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       1414 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       1414 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1415 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       1415 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1416 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       1416 1 2 1 1 116 ILE HB   . 116 . HB   1 1 
       1417 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1417 1 2 1 1  47 GLU HG2  .  47 . HG2  1 1 
       1418 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1418 1 2 1 1  47 GLU HG3  .  47 . HG1  1 1 
       1419 1 1 1 1  48 GLU HA   .  48 . HA   1 1 
       1419 1 2 1 1  48 GLU HG3  .  48 . HG1  1 1 
       1420 1 1 1 1  48 GLU HA   .  48 . HA   1 1 
       1420 1 2 1 1  48 GLU HG2  .  48 . HG2  1 1 
       1421 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       1421 1 2 1 1  49 LYS HE2  .  49 . HE2  1 1 
       1422 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       1422 1 2 1 1  49 LYS HE3  .  49 . HE1  1 1 
       1423 1 1 1 1  51 PHE HA   .  51 . HA   1 1 
       1423 1 2 1 1  51 PHE QD   .  51 . HD*  1 1 
       1424 1 1 1 1   2 LYS HE3  .   2 . HE1  1 1 
       1424 1 2 1 1  53 LYS HA   .  53 . HA   1 1 
       1425 1 1 1 1   2 LYS HE3  .   2 . HE1  1 1 
       1425 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1426 1 1 1 1   2 LYS HB2  .   2 . HB2  1 1 
       1426 1 2 1 1   2 LYS HE3  .   2 . HE1  1 1 
       1427 1 1 1 1  53 LYS HE2  .  53 . HE2  1 1 
       1427 1 2 1 1  53 LYS HG2  .  53 . HG2  1 1 
       1428 1 1 1 1  53 LYS HE2  .  53 . HE2  1 1 
       1428 1 2 1 1  53 LYS HG3  .  53 . HG1  1 1 
       1429 1 1 1 1   2 LYS HE2  .   2 . HE2  1 1 
       1429 1 2 1 1  53 LYS HA   .  53 . HA   1 1 
       1430 1 1 1 1   2 LYS HE2  .   2 . HE2  1 1 
       1430 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1431 1 1 1 1   2 LYS HB2  .   2 . HB2  1 1 
       1431 1 2 1 1   2 LYS HE2  .   2 . HE2  1 1 
       1432 1 1 1 1  53 LYS HE3  .  53 . HE1  1 1 
       1432 1 2 1 1  53 LYS HG2  .  53 . HG2  1 1 
       1433 1 1 1 1  53 LYS HE3  .  53 . HE1  1 1 
       1433 1 2 1 1  53 LYS HG3  .  53 . HG1  1 1 
       1434 1 1 1 1  54 ILE HA   .  54 . HA   1 1 
       1434 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1435 1 1 1 1  54 ILE HB   .  54 . HB   1 1 
       1435 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1436 1 1 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1436 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       1437 1 1 1 1  54 ILE HG12 .  54 . HG12 1 1 
       1437 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1438 1 1 1 1  54 ILE HG13 .  54 . HG11 1 1 
       1438 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1439 1 1 1 1  53 LYS HA   .  53 . HA   1 1 
       1439 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1440 1 1 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1440 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1441 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       1441 1 2 1 1  55 LEU HG   .  55 . HG   1 1 
       1442 1 1 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1442 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       1443 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       1443 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       1444 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       1444 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       1445 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1445 1 2 1 1  55 LEU HG   .  55 . HG   1 1 
       1446 1 1 1 1  55 LEU H    .  55 . HN   1 1 
       1446 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       1447 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1447 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       1448 1 1 1 1  56 ILE HA   .  56 . HA   1 1 
       1448 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       1449 1 1 1 1  56 ILE HA   .  56 . HA   1 1 
       1449 1 2 1 1  56 ILE HG12 .  56 . HG12 1 1 
       1450 1 1 1 1  56 ILE HA   .  56 . HA   1 1 
       1450 1 2 1 1  56 ILE HG13 .  56 . HG11 1 1 
       1451 1 1 1 1  56 ILE HA   .  56 . HA   1 1 
       1451 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       1452 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1452 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       1453 1 1 1 1  56 ILE H    .  56 . HN   1 1 
       1453 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       1454 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1454 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       1455 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1455 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       1456 1 1 1 1  54 ILE HB   .  54 . HB   1 1 
       1456 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       1457 1 1 1 1  56 ILE MD   .  56 . HD1* 1 1 
       1457 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       1458 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1458 1 2 1 1  57 ILE HA   .  57 . HA   1 1 
       1459 1 1 1 1  57 ILE H    .  57 . HN   1 1 
       1459 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       1460 1 1 1 1  57 ILE HA   .  57 . HA   1 1 
       1460 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       1461 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1461 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       1462 1 1 1 1  57 ILE H    .  57 . HN   1 1 
       1462 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1463 1 1 1 1  57 ILE HA   .  57 . HA   1 1 
       1463 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1464 1 1 1 1  57 ILE HB   .  57 . HB   1 1 
       1464 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1465 1 1 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       1465 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1466 1 1 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1466 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       1467 1 1 1 1  58 SER HA   .  58 . HA   1 1 
       1467 1 2 1 1  58 SER HG   .  58 . HG   1 1 
       1468 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       1468 1 2 1 1  61 LYS HG2  .  61 . HG2  1 1 
       1469 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       1469 1 2 1 1  61 LYS HG3  .  61 . HG1  1 1 
       1470 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       1470 1 2 1 1  61 LYS HE2  .  61 . HE2  1 1 
       1471 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       1471 1 2 1 1  61 LYS HE2  .  61 . HE2  1 1 
       1472 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       1472 1 2 1 1  61 LYS HE3  .  61 . HE1  1 1 
       1473 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       1473 1 2 1 1  61 LYS HE3  .  61 . HE1  1 1 
       1474 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       1474 1 2 1 1  62 GLN HG2  .  62 . HG2  1 1 
       1475 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       1475 1 2 1 1  62 GLN HG3  .  62 . HG1  1 1 
       1476 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
       1476 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
       1477 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
       1477 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       1478 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
       1478 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       1479 1 1 1 1  63 LEU HB2  .  63 . HB2  1 1 
       1479 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       1480 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       1480 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1481 1 1 1 1  63 LEU HB3  .  63 . HB1  1 1 
       1481 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       1482 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       1482 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
       1483 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       1483 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       1484 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       1484 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       1485 1 1 1 1  64 LEU HB2  .  64 . HB2  1 1 
       1485 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       1486 1 1 1 1  64 LEU HB3  .  64 . HB1  1 1 
       1486 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       1487 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       1487 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       1488 1 1 1 1  64 LEU HB2  .  64 . HB2  1 1 
       1488 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       1489 1 1 1 1  64 LEU HB3  .  64 . HB1  1 1 
       1489 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       1490 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       1490 1 2 1 1  65 LYS HG2  .  65 . HG2  1 1 
       1491 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       1491 1 2 1 1  65 LYS HG3  .  65 . HG1  1 1 
       1492 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       1492 1 2 1 1  65 LYS HG2  .  65 . HG2  1 1 
       1493 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       1493 1 2 1 1  66 GLU HG2  .  66 . HG2  1 1 
       1494 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       1494 1 2 1 1  66 GLU HG3  .  66 . HG1  1 1 
       1495 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       1495 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       1496 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       1496 1 2 1 1  70 LEU HG   .  70 . HG   1 1 
       1497 1 1 1 1  67 MET HB3  .  67 . HB1  1 1 
       1497 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       1498 1 1 1 1  67 MET H    .  67 . HN   1 1 
       1498 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       1499 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       1499 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       1500 1 1 1 1  67 MET H    .  67 . HN   1 1 
       1500 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       1501 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       1501 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       1502 1 1 1 1  67 MET HB2  .  67 . HB2  1 1 
       1502 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       1503 1 1 1 1  67 MET ME   .  67 . HE*  1 1 
       1503 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       1504 1 1 1 1  67 MET ME   .  67 . HE*  1 1 
       1504 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       1505 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       1505 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       1506 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       1506 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       1507 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
       1507 1 2 1 1  70 LEU HG   .  70 . HG   1 1 
       1508 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
       1508 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       1509 1 1 1 1  70 LEU HB2  .  70 . HB2  1 1 
       1509 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       1510 1 1 1 1  70 LEU HB3  .  70 . HB1  1 1 
       1510 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       1511 1 1 1 1  70 LEU H    .  70 . HN   1 1 
       1511 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       1512 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
       1512 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       1513 1 1 1 1  70 LEU HB2  .  70 . HB2  1 1 
       1513 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       1514 1 1 1 1  70 LEU HB3  .  70 . HB1  1 1 
       1514 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       1515 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1515 1 2 1 1  74 LEU HG   .  74 . HG   1 1 
       1516 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1516 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1517 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1517 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       1518 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1518 1 2 1 1  71 ILE HG12 .  71 . HG12 1 1 
       1519 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1519 1 2 1 1  71 ILE HG13 .  71 . HG11 1 1 
       1520 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1520 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1521 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       1521 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1522 1 1 1 1   4 LEU H    .   4 . HN   1 1 
       1522 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1523 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1523 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1524 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1524 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1525 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       1525 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1526 1 1 1 1  74 LEU HA   .  74 . HA   1 1 
       1526 1 2 1 1  74 LEU HG   .  74 . HG   1 1 
       1527 1 1 1 1  74 LEU H    .  74 . HN   1 1 
       1527 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       1528 1 1 1 1  74 LEU HA   .  74 . HA   1 1 
       1528 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       1529 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       1529 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       1530 1 1 1 1  74 LEU HA   .  74 . HA   1 1 
       1530 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       1531 1 1 1 1  97 ILE HB   .  97 . HB   1 1 
       1531 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1532 1 1 1 1  76 TYR H    .  76 . HN   1 1 
       1532 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       1533 1 1 1 1  76 TYR HA   .  76 . HA   1 1 
       1533 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       1534 1 1 1 1  17 LYS HE3  .  17 . HE1  1 1 
       1534 1 2 1 1  17 LYS HG3  .  17 . HG1  1 1 
       1535 1 1 1 1  78 VAL HA   .  78 . HA   1 1 
       1535 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1536 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
       1536 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       1537 1 1 1 1   6 LEU HB2  .   6 . HB2  1 1 
       1537 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       1538 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       1538 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       1539 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       1539 1 2 1 1  81 LEU HG   .  81 . HG   1 1 
       1540 1 1 1 1  81 LEU H    .  81 . HN   1 1 
       1540 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       1541 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       1541 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       1542 1 1 1 1  81 LEU HB2  .  81 . HB2  1 1 
       1542 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       1543 1 1 1 1 114 LEU HB2  . 114 . HB2  1 1 
       1543 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1544 1 1 1 1  81 LEU HB3  .  81 . HB1  1 1 
       1544 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       1545 1 1 1 1  81 LEU H    .  81 . HN   1 1 
       1545 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       1546 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       1546 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       1547 1 1 1 1  82 LEU HA   .  82 . HA   1 1 
       1547 1 2 1 1  82 LEU HG   .  82 . HG   1 1 
       1548 1 1 1 1  82 LEU HA   .  82 . HA   1 1 
       1548 1 2 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       1549 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1549 1 2 1 1  33 ASN HA   .  33 . HA   1 1 
       1550 1 1 1 1  82 LEU HA   .  82 . HA   1 1 
       1550 1 2 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       1551 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
       1551 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
       1552 1 1 1 1  91 GLU H    .  91 . HN   1 1 
       1552 1 2 1 1  91 GLU HG3  .  91 . HG1  1 1 
       1553 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       1553 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       1554 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       1554 1 2 1 1  94 LYS HG2  .  94 . HG2  1 1 
       1555 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       1555 1 2 1 1  94 LYS HG3  .  94 . HG1  1 1 
       1556 1 1 1 1  95 ARG HB2  .  95 . HB2  1 1 
       1556 1 2 1 1  95 ARG HD2  .  95 . HD2  1 1 
       1557 1 1 1 1  95 ARG HB3  .  95 . HB1  1 1 
       1557 1 2 1 1  95 ARG HD3  .  95 . HD1  1 1 
       1558 1 1 1 1  95 ARG H    .  95 . HN   1 1 
       1558 1 2 1 1  95 ARG HG2  .  95 . HG2  1 1 
       1559 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       1559 1 2 1 1  95 ARG HG2  .  95 . HG2  1 1 
       1560 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       1560 1 2 1 1  95 ARG HG3  .  95 . HG1  1 1 
       1561 1 1 1 1  95 ARG H    .  95 . HN   1 1 
       1561 1 2 1 1  95 ARG HD2  .  95 . HD2  1 1 
       1562 1 1 1 1  95 ARG HB3  .  95 . HB1  1 1 
       1562 1 2 1 1  95 ARG HD2  .  95 . HD2  1 1 
       1563 1 1 1 1  95 ARG H    .  95 . HN   1 1 
       1563 1 2 1 1  95 ARG HD3  .  95 . HD1  1 1 
       1564 1 1 1 1  95 ARG HB2  .  95 . HB2  1 1 
       1564 1 2 1 1  95 ARG HD3  .  95 . HD1  1 1 
       1565 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1565 1 2 1 1  96 LYS HG3  .  96 . HG1  1 1 
       1566 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       1566 1 2 1 1  96 LYS HB2  .  96 . HB2  1 1 
       1567 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1567 1 2 1 1  96 LYS HG2  .  96 . HG2  1 1 
       1568 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       1568 1 2 1 1  96 LYS HD2  .  96 . HD2  1 1 
       1569 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       1569 1 2 1 1  96 LYS HD3  .  96 . HD1  1 1 
       1570 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1570 1 2 1 1  96 LYS HD2  .  96 . HD2  1 1 
       1571 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1571 1 2 1 1  96 LYS HD3  .  96 . HD1  1 1 
       1572 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1572 1 2 1 1  97 ILE HG12 .  97 . HG12 1 1 
       1573 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1573 1 2 1 1  97 ILE HG13 .  97 . HG11 1 1 
       1574 1 1 1 1  97 ILE HB   .  97 . HB   1 1 
       1574 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1575 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1575 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1576 1 1 1 1  97 ILE HG12 .  97 . HG12 1 1 
       1576 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1577 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1577 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1578 1 1 1 1  97 ILE HG13 .  97 . HG11 1 1 
       1578 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1579 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
       1579 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       1580 1 1 1 1  97 ILE H    .  97 . HN   1 1 
       1580 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       1581 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       1581 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       1582 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       1582 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       1583 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       1583 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       1584 1 1 1 1 100 GLN HA   . 100 . HA   1 1 
       1584 1 2 1 1 100 GLN HG2  . 100 . HG2  1 1 
       1585 1 1 1 1 100 GLN HA   . 100 . HA   1 1 
       1585 1 2 1 1 100 GLN HG3  . 100 . HG1  1 1 
       1586 1 1 1 1 102 TYR H    . 102 . HN   1 1 
       1586 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       1587 1 1 1 1 102 TYR HA   . 102 . HA   1 1 
       1587 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       1588 1 1 1 1 103 GLU HA   . 103 . HA   1 1 
       1588 1 2 1 1 103 GLU HG2  . 103 . HG2  1 1 
       1589 1 1 1 1 103 GLU HA   . 103 . HA   1 1 
       1589 1 2 1 1 103 GLU HG3  . 103 . HG1  1 1 
       1590 1 1 1 1 103 GLU H    . 103 . HN   1 1 
       1590 1 2 1 1 103 GLU HG2  . 103 . HG2  1 1 
       1591 1 1 1 1 103 GLU H    . 103 . HN   1 1 
       1591 1 2 1 1 103 GLU HG3  . 103 . HG1  1 1 
       1592 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       1592 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1593 1 1 1 1 104 VAL H    . 104 . HN   1 1 
       1593 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1594 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       1594 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1595 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       1595 1 2 1 1 105 ARG HB2  . 105 . HB2  1 1 
       1596 1 1 1 1  82 LEU HG   .  82 . HG   1 1 
       1596 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       1597 1 1 1 1 106 LYS H    . 106 . HN   1 1 
       1597 1 2 1 1 106 LYS HG2  . 106 . HG2  1 1 
       1598 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       1598 1 2 1 1 106 LYS HE2  . 106 . HE2  1 1 
       1599 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       1599 1 2 1 1 106 LYS HE3  . 106 . HE1  1 1 
       1600 1 1 1 1 107 VAL HA   . 107 . HA   1 1 
       1600 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       1601 1 1 1 1 107 VAL H    . 107 . HN   1 1 
       1601 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       1602 1 1 1 1  83 GLN HB2  .  83 . HB2  1 1 
       1602 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       1603 1 1 1 1 108 THR H    . 108 . HN   1 1 
       1603 1 2 1 1 108 THR HB   . 108 . HB   1 1 
       1604 1 1 1 1 108 THR HA   . 108 . HA   1 1 
       1604 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       1605 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       1605 1 2 1 1 109 ASP HB3  . 109 . HB1  1 1 
       1606 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       1606 1 2 1 1  13 GLU HG3  .  13 . HG1  1 1 
       1607 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1607 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       1608 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1608 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1609 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1609 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1610 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       1610 1 2 1 1 114 LEU HB2  . 114 . HB2  1 1 
       1611 1 1 1 1 114 LEU HB3  . 114 . HB1  1 1 
       1611 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1612 1 1 1 1 114 LEU HB2  . 114 . HB2  1 1 
       1612 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1613 1 1 1 1 114 LEU HB3  . 114 . HB1  1 1 
       1613 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1614 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       1614 1 2 1 1 115 LYS HG2  . 115 . HG2  1 1 
       1615 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1615 1 2 1 1  16 LYS HE2  .  16 . HE2  1 1 
       1616 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1616 1 2 1 1  16 LYS HE3  .  16 . HE1  1 1 
       1617 1 1 1 1 115 LYS H    . 115 . HN   1 1 
       1617 1 2 1 1 115 LYS HG3  . 115 . HG1  1 1 
       1618 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       1618 1 2 1 1 115 LYS HG3  . 115 . HG1  1 1 
       1619 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       1619 1 2 1 1 115 LYS HE2  . 115 . HE2  1 1 
       1620 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       1620 1 2 1 1 115 LYS HE3  . 115 . HE1  1 1 
       1621 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1621 1 2 1 1 116 ILE HG12 . 116 . HG12 1 1 
       1622 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1622 1 2 1 1 116 ILE HG13 . 116 . HG11 1 1 
       1623 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1623 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       1624 1 1 1 1 116 ILE HB   . 116 . HB   1 1 
       1624 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       1625 1 1 1 1 116 ILE MD   . 116 . HD1* 1 1 
       1625 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       1626 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       1626 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1627 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       1627 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1628 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       1628 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       1629 1 1 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       1629 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       1630 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       1630 1 2 1 1 118 ARG HD2  . 118 . HD2  1 1 
       1631 1 1 1 1 118 ARG HB2  . 118 . HB2  1 1 
       1631 1 2 1 1 118 ARG HD2  . 118 . HD2  1 1 
       1632 1 1 1 1 118 ARG HB3  . 118 . HB1  1 1 
       1632 1 2 1 1 118 ARG HD2  . 118 . HD2  1 1 
       1633 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       1633 1 2 1 1 118 ARG HD3  . 118 . HD1  1 1 
       1634 1 1 1 1 118 ARG HB2  . 118 . HB2  1 1 
       1634 1 2 1 1 118 ARG HD3  . 118 . HD1  1 1 
       1635 1 1 1 1 118 ARG HB3  . 118 . HB1  1 1 
       1635 1 2 1 1 118 ARG HD3  . 118 . HD1  1 1 
       1636 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       1636 1 2 1 1 119 GLU HG2  . 119 . HG2  1 1 
       1637 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       1637 1 2 1 1 119 GLU HG3  . 119 . HG1  1 1 
       1638 1 1 1 1 120 PHE HA   . 120 . HA   1 1 
       1638 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       1639 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       1639 1 2 1 1 120 PHE HA   . 120 . HA   1 1 
       1640 1 1 1 1 121 MET HA   . 121 . HA   1 1 
       1640 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       1641 1 1 1 1 121 MET HA   . 121 . HA   1 1 
       1641 1 2 1 1 121 MET HG2  . 121 . HG2  1 1 
       1642 1 1 1 1 121 MET HA   . 121 . HA   1 1 
       1642 1 2 1 1 121 MET HG3  . 121 . HG1  1 1 
       1643 1 1 1 1 121 MET H    . 121 . HN   1 1 
       1643 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       1644 1 1 1 1 121 MET ME   . 121 . HE*  1 1 
       1644 1 2 1 1 121 MET HG2  . 121 . HG2  1 1 
       1645 1 1 1 1 121 MET ME   . 121 . HE*  1 1 
       1645 1 2 1 1 121 MET HG3  . 121 . HG1  1 1 
       1646 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       1646 1 2 1 1 122 GLN HG3  . 122 . HG1  1 1 
       1647 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       1647 1 2 1 1 122 GLN HG2  . 122 . HG2  1 1 
       1648 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       1648 1 2 1 1 123 LYS HG2  . 123 . HG2  1 1 
       1649 1 1 1 1 123 LYS H    . 123 . HN   1 1 
       1649 1 2 1 1 123 LYS HG2  . 123 . HG2  1 1 
       1650 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       1650 1 2 1 1 123 LYS HG3  . 123 . HG1  1 1 
       1651 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       1651 1 2 1 1 123 LYS HD2  . 123 . HD2  1 1 
       1652 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       1652 1 2 1 1 123 LYS HD3  . 123 . HD1  1 1 
       1653 1 1 1 1 127 LEU HA   . 127 . HA   1 1 
       1653 1 2 1 1 127 LEU HG   . 127 . HG   1 1 
       1654 1 1 1 1 127 LEU HA   . 127 . HA   1 1 
       1654 1 2 1 1 127 LEU MD2  . 127 . HD2* 1 1 
       1655 1 1 1 1 127 LEU HB3  . 127 . HB1  1 1 
       1655 1 2 1 1 127 LEU MD2  . 127 . HD2* 1 1 
       1656 1 1 1 1 127 LEU H    . 127 . HN   1 1 
       1656 1 2 1 1 127 LEU HG   . 127 . HG   1 1 
       1657 1 1 1 1 127 LEU HB2  . 127 . HB2  1 1 
       1657 1 2 1 1 127 LEU MD2  . 127 . HD2* 1 1 
       1658 1 1 1 1 127 LEU H    . 127 . HN   1 1 
       1658 1 2 1 1 127 LEU MD1  . 127 . HD1* 1 1 
       1659 1 1 1 1 127 LEU HA   . 127 . HA   1 1 
       1659 1 2 1 1 127 LEU MD1  . 127 . HD1* 1 1 
       1660 1 1 1 1 127 LEU HB2  . 127 . HB2  1 1 
       1660 1 2 1 1 127 LEU MD1  . 127 . HD1* 1 1 
       1661 1 1 1 1 127 LEU HB3  . 127 . HB1  1 1 
       1661 1 2 1 1 127 LEU MD1  . 127 . HD1* 1 1 
       1662 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       1662 1 2 1 1  55 LEU HG   .  55 . HG   1 1 
       1663 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       1663 1 2 1 1   5 ILE H    .   5 . HN   1 1 
       1664 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1664 1 2 1 1   6 LEU H    .   6 . HN   1 1 
       1665 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1665 1 2 1 1   7 ILE H    .   7 . HN   1 1 
       1666 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1666 1 2 1 1   8 ASN H    .   8 . HN   1 1 
       1667 1 1 1 1  10 ASN HB3  .  10 . HB1  1 1 
       1667 1 2 1 1  11 ASN H    .  11 . HN   1 1 
       1668 1 1 1 1  12 ASP HB2  .  12 . HB2  1 1 
       1668 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       1669 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
       1669 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       1670 1 1 1 1  13 GLU HG2  .  13 . HG2  1 1 
       1670 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       1671 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1671 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       1672 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1672 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       1673 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1673 1 2 1 1  17 LYS H    .  17 . HN   1 1 
       1674 1 1 1 1  16 LYS HG3  .  16 . HG1  1 1 
       1674 1 2 1 1  17 LYS H    .  17 . HN   1 1 
       1675 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1675 1 2 1 1  19 LYS H    .  19 . HN   1 1 
       1676 1 1 1 1  20 LYS HG3  .  20 . HG1  1 1 
       1676 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       1677 1 1 1 1  21 GLU HB2  .  21 . HB2  1 1 
       1677 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       1678 1 1 1 1  21 GLU HG2  .  21 . HG2  1 1 
       1678 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       1679 1 1 1 1  21 GLU HG3  .  21 . HG1  1 1 
       1679 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       1680 1 1 1 1  22 VAL H    .  22 . HN   1 1 
       1680 1 2 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1681 1 1 1 1  28 GLN HB3  .  28 . HB1  1 1 
       1681 1 2 1 1  29 VAL H    .  29 . HN   1 1 
       1682 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1682 1 2 1 1  30 ARG H    .  30 . HN   1 1 
       1683 1 1 1 1  30 ARG HG2  .  30 . HG2  1 1 
       1683 1 2 1 1  31 ASP H    .  31 . HN   1 1 
       1684 1 1 1 1  30 ARG HG3  .  30 . HG1  1 1 
       1684 1 2 1 1  31 ASP H    .  31 . HN   1 1 
       1685 1 1 1 1  33 ASN HB3  .  33 . HB1  1 1 
       1685 1 2 1 1  34 ASP H    .  34 . HN   1 1 
       1686 1 1 1 1  35 SER HB2  .  35 . HB2  1 1 
       1686 1 2 1 1  36 ASP H    .  36 . HN   1 1 
       1687 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       1687 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       1688 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       1688 1 2 1 1  39 LYS HB3  .  39 . HB1  1 1 
       1689 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       1689 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       1690 1 1 1 1  40 LYS HG3  .  40 . HG1  1 1 
       1690 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       1691 1 1 1 1  40 LYS HD2  .  40 . HD2  1 1 
       1691 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       1692 1 1 1 1  40 LYS HD3  .  40 . HD1  1 1 
       1692 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       1693 1 1 1 1  41 GLU HG3  .  41 . HG1  1 1 
       1693 1 2 1 1  42 MET H    .  42 . HN   1 1 
       1694 1 1 1 1  42 MET HB3  .  42 . HB1  1 1 
       1694 1 2 1 1  43 LYS H    .  43 . HN   1 1 
       1695 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       1695 1 2 1 1  43 LYS H    .  43 . HN   1 1 
       1696 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       1696 1 2 1 1  47 GLU H    .  47 . HN   1 1 
       1697 1 1 1 1  45 LEU HG   .  45 . HG   1 1 
       1697 1 2 1 1  46 ALA H    .  46 . HN   1 1 
       1698 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1698 1 2 1 1  46 ALA H    .  46 . HN   1 1 
       1699 1 1 1 1  49 LYS HG2  .  49 . HG2  1 1 
       1699 1 2 1 1  50 ASN H    .  50 . HN   1 1 
       1700 1 1 1 1  49 LYS HG3  .  49 . HG1  1 1 
       1700 1 2 1 1  50 ASN H    .  50 . HN   1 1 
       1701 1 1 1 1  51 PHE HB2  .  51 . HB2  1 1 
       1701 1 2 1 1  52 GLU H    .  52 . HN   1 1 
       1702 1 1 1 1  51 PHE HB3  .  51 . HB1  1 1 
       1702 1 2 1 1  52 GLU H    .  52 . HN   1 1 
       1703 1 1 1 1   2 LYS HE3  .   2 . HE1  1 1 
       1703 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1704 1 1 1 1   2 LYS HE2  .   2 . HE2  1 1 
       1704 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1705 1 1 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1705 1 2 1 1  55 LEU H    .  55 . HN   1 1 
       1706 1 1 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       1706 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       1707 1 1 1 1  56 ILE HG12 .  56 . HG12 1 1 
       1707 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1708 1 1 1 1  56 ILE HG13 .  56 . HG11 1 1 
       1708 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1709 1 1 1 1  57 ILE HG12 .  57 . HG12 1 1 
       1709 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1710 1 1 1 1  57 ILE HG13 .  57 . HG11 1 1 
       1710 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1711 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1711 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1712 1 1 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1712 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1713 1 1 1 1  62 GLN HG2  .  62 . HG2  1 1 
       1713 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       1714 1 1 1 1  65 LYS HG2  .  65 . HG2  1 1 
       1714 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       1715 1 1 1 1  66 GLU HB3  .  66 . HB1  1 1 
       1715 1 2 1 1  67 MET H    .  67 . HN   1 1 
       1716 1 1 1 1  66 GLU HG2  .  66 . HG2  1 1 
       1716 1 2 1 1  67 MET H    .  67 . HN   1 1 
       1717 1 1 1 1  66 GLU HG3  .  66 . HG1  1 1 
       1717 1 2 1 1  67 MET H    .  67 . HN   1 1 
       1718 1 1 1 1  67 MET ME   .  67 . HE*  1 1 
       1718 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       1719 1 1 1 1  70 LEU HG   .  70 . HG   1 1 
       1719 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       1720 1 1 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       1720 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       1721 1 1 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       1721 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       1722 1 1 1 1  77 LYS HD2  .  77 . HD2  1 1 
       1722 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       1723 1 1 1 1  77 LYS HD3  .  77 . HD1  1 1 
       1723 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       1724 1 1 1 1  77 LYS HE2  .  77 . HE2  1 1 
       1724 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       1725 1 1 1 1  77 LYS HE3  .  77 . HE1  1 1 
       1725 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       1726 1 1 1 1  72 SER H    .  72 . HN   1 1 
       1726 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1727 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       1727 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       1728 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       1728 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       1729 1 1 1 1  85 GLN HB2  .  85 . HB2  1 1 
       1729 1 2 1 1  86 ASP H    .  86 . HN   1 1 
       1730 1 1 1 1  89 GLU HG2  .  89 . HG2  1 1 
       1730 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       1731 1 1 1 1  89 GLU HG3  .  89 . HG1  1 1 
       1731 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       1732 1 1 1 1  91 GLU HB2  .  91 . HB2  1 1 
       1732 1 2 1 1  92 GLU H    .  92 . HN   1 1 
       1733 1 1 1 1  91 GLU HB3  .  91 . HB1  1 1 
       1733 1 2 1 1  92 GLU H    .  92 . HN   1 1 
       1734 1 1 1 1  95 ARG HB2  .  95 . HB2  1 1 
       1734 1 2 1 1  96 LYS H    .  96 . HN   1 1 
       1735 1 1 1 1  95 ARG HB3  .  95 . HB1  1 1 
       1735 1 2 1 1  96 LYS H    .  96 . HN   1 1 
       1736 1 1 1 1  96 LYS HG3  .  96 . HG1  1 1 
       1736 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       1737 1 1 1 1  96 LYS HD2  .  96 . HD2  1 1 
       1737 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       1738 1 1 1 1  96 LYS HD3  .  96 . HD1  1 1 
       1738 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       1739 1 1 1 1  98 GLU HB3  .  98 . HB1  1 1 
       1739 1 2 1 1  99 SER H    .  99 . HN   1 1 
       1740 1 1 1 1 100 GLN HG2  . 100 . HG2  1 1 
       1740 1 2 1 1 101 GLY H    . 101 . HN   1 1 
       1741 1 1 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1741 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       1742 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       1742 1 2 1 1 108 THR H    . 108 . HN   1 1 
       1743 1 1 1 1 108 THR HB   . 108 . HB   1 1 
       1743 1 2 1 1 109 ASP H    . 109 . HN   1 1 
       1744 1 1 1 1 110 ASP HB3  . 110 . HB1  1 1 
       1744 1 2 1 1 111 GLU H    . 111 . HN   1 1 
       1745 1 1 1 1  48 GLU H    .  48 . HN   1 1 
       1745 1 2 1 1  48 GLU HG3  .  48 . HG1  1 1 
       1746 1 1 1 1  69 GLU HG3  .  69 . HG1  1 1 
       1746 1 2 1 1  70 LEU H    .  70 . HN   1 1 
       1747 1 1 1 1 114 LEU HB2  . 114 . HB2  1 1 
       1747 1 2 1 1 115 LYS H    . 115 . HN   1 1 
       1748 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1748 1 2 1 1 115 LYS H    . 115 . HN   1 1 
       1749 1 1 1 1 116 ILE MD   . 116 . HD1* 1 1 
       1749 1 2 1 1 117 VAL H    . 117 . HN   1 1 
       1750 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1750 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       1751 1 1 1 1 119 GLU HG2  . 119 . HG2  1 1 
       1751 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1752 1 1 1 1 119 GLU HG3  . 119 . HG1  1 1 
       1752 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1753 1 1 1 1 120 PHE HB3  . 120 . HB1  1 1 
       1753 1 2 1 1 121 MET H    . 121 . HN   1 1 
       1754 1 1 1 1 121 MET HB3  . 121 . HB1  1 1 
       1754 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       1755 1 1 1 1 123 LYS HD2  . 123 . HD2  1 1 
       1755 1 2 1 1 124 ALA H    . 124 . HN   1 1 
       1756 1 1 1 1 123 LYS HD3  . 123 . HD1  1 1 
       1756 1 2 1 1 124 ALA H    . 124 . HN   1 1 
       1757 1 1 1 1 124 ALA MB   . 124 . HB*  1 1 
       1757 1 2 1 1 125 GLY H    . 125 . HN   1 1 
       1758 1 1 1 1 127 LEU HB3  . 127 . HB1  1 1 
       1758 1 2 1 1 128 GLU H    . 128 . HN   1 1 
       1759 1 1 1 1 127 LEU HG   . 127 . HG   1 1 
       1759 1 2 1 1 128 GLU H    . 128 . HN   1 1 
       1760 1 1 1 1 127 LEU MD1  . 127 . HD1* 1 1 
       1760 1 2 1 1 128 GLU H    . 128 . HN   1 1 
       1761 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       1761 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       1762 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       1762 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       1763 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1763 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       1764 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1764 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       1765 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1765 1 2 1 1  17 LYS H    .  17 . HN   1 1 
       1766 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1766 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
       1767 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1767 1 2 1 1  21 GLU HB2  .  21 . HB2  1 1 
       1768 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1768 1 2 1 1  21 GLU HB3  .  21 . HB1  1 1 
       1769 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1769 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       1770 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1770 1 2 1 1  22 VAL HB   .  22 . HB   1 1 
       1771 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1771 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       1772 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1772 1 2 1 1  23 GLU H    .  23 . HN   1 1 
       1773 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1773 1 2 1 1  23 GLU H    .  23 . HN   1 1 
       1774 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1774 1 2 1 1  23 GLU HB2  .  23 . HB2  1 1 
       1775 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1775 1 2 1 1  23 GLU HB3  .  23 . HB1  1 1 
       1776 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       1776 1 2 1 1  24 ASN H    .  24 . HN   1 1 
       1777 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       1777 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       1778 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       1778 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       1779 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       1779 1 2 1 1  39 LYS HB2  .  39 . HB2  1 1 
       1780 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       1780 1 2 1 1  39 LYS HB3  .  39 . HB1  1 1 
       1781 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
       1781 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       1782 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1782 1 2 1 1  42 MET HB2  .  42 . HB2  1 1 
       1783 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1783 1 2 1 1  42 MET HB3  .  42 . HB1  1 1 
       1784 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       1784 1 2 1 1  42 MET H    .  42 . HN   1 1 
       1785 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       1785 1 2 1 1  44 LYS H    .  44 . HN   1 1 
       1786 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       1786 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       1787 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       1787 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       1788 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       1788 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       1789 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
       1789 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       1790 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
       1790 1 2 1 1  46 ALA MB   .  46 . HB*  1 1 
       1791 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       1791 1 2 1 1  47 GLU H    .  47 . HN   1 1 
       1792 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       1792 1 2 1 1  65 LYS HB3  .  65 . HB1  1 1 
       1793 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       1793 1 2 1 1  67 MET HB2  .  67 . HB2  1 1 
       1794 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       1794 1 2 1 1  67 MET HB3  .  67 . HB1  1 1 
       1795 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       1795 1 2 1 1  69 GLU H    .  69 . HN   1 1 
       1796 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       1796 1 2 1 1  70 LEU HB2  .  70 . HB2  1 1 
       1797 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       1797 1 2 1 1  70 LEU HB3  .  70 . HB1  1 1 
       1798 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       1798 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
       1799 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
       1799 1 2 1 1  72 SER HB2  .  72 . HB2  1 1 
       1800 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
       1800 1 2 1 1  72 SER HB3  .  72 . HB1  1 1 
       1801 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
       1801 1 2 1 1  73 LYS H    .  73 . HN   1 1 
       1802 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       1802 1 2 1 1  65 LYS HB2  .  65 . HB2  1 1 
       1803 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       1803 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       1804 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       1804 1 2 1 1  24 ASN H    .  24 . HN   1 1 
       1805 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
       1805 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       1806 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
       1806 1 2 1 1  91 GLU H    .  91 . HN   1 1 
       1807 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
       1807 1 2 1 1  92 GLU H    .  92 . HN   1 1 
       1808 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
       1808 1 2 1 1  93 PHE HB2  .  93 . HB2  1 1 
       1809 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
       1809 1 2 1 1  93 PHE HB3  .  93 . HB1  1 1 
       1810 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       1810 1 2 1 1  94 LYS HB2  .  94 . HB2  1 1 
       1811 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       1811 1 2 1 1  94 LYS HB3  .  94 . HB1  1 1 
       1812 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       1812 1 2 1 1  96 LYS HB2  .  96 . HB2  1 1 
       1813 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       1813 1 2 1 1  96 LYS HB3  .  96 . HB1  1 1 
       1814 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       1814 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       1815 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       1815 1 2 1 1  96 LYS H    .  96 . HN   1 1 
       1816 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       1816 1 2 1 1  97 ILE HB   .  97 . HB   1 1 
       1817 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       1817 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       1818 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       1818 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
       1819 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       1819 1 2 1 1  98 GLU HB3  .  98 . HB1  1 1 
       1820 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       1820 1 2 1 1  99 SER H    .  99 . HN   1 1 
       1821 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1821 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       1822 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       1822 1 2 1 1  99 SER H    .  99 . HN   1 1 
       1823 1 1 1 1 110 ASP HA   . 110 . HA   1 1 
       1823 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       1824 1 1 1 1 110 ASP HA   . 110 . HA   1 1 
       1824 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       1825 1 1 1 1 110 ASP HA   . 110 . HA   1 1 
       1825 1 2 1 1 114 LEU H    . 114 . HN   1 1 
       1826 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       1826 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       1827 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       1827 1 2 1 1 115 LYS H    . 115 . HN   1 1 
       1828 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
       1828 1 2 1 1 115 LYS H    . 115 . HN   1 1 
       1829 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
       1829 1 2 1 1 116 ILE HB   . 116 . HB   1 1 
       1830 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1830 1 2 1 1 117 VAL HB   . 117 . HB   1 1 
       1831 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1831 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       1832 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1832 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       1833 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1833 1 2 1 1 119 GLU HB2  . 119 . HB2  1 1 
       1834 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1834 1 2 1 1 119 GLU HG2  . 119 . HG2  1 1 
       1835 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1835 1 2 1 1 119 GLU HB3  . 119 . HB1  1 1 
       1836 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       1836 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1837 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       1837 1 2 1 1 120 PHE HB2  . 120 . HB2  1 1 
       1838 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       1838 1 2 1 1 120 PHE HB3  . 120 . HB1  1 1 
       1839 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       1839 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       1840 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       1840 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       1841 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       1841 1 2 1 1 121 MET H    . 121 . HN   1 1 
       1842 1 1 1 1 120 PHE HA   . 120 . HA   1 1 
       1842 1 2 1 1 123 LYS HB2  . 123 . HB2  1 1 
       1843 1 1 1 1 120 PHE HA   . 120 . HA   1 1 
       1843 1 2 1 1 123 LYS HB3  . 123 . HB1  1 1 
       1844 1 1 1 1   4 LEU HB2  .   4 . HB2  1 1 
       1844 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1845 1 1 1 1   4 LEU HB3  .   4 . HB1  1 1 
       1845 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1846 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1846 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       1847 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1847 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       1848 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1848 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       1849 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1849 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       1850 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1850 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       1851 1 1 1 1 105 ARG HE   . 105 . HE   1 1 
       1851 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       1852 1 1 1 1  55 LEU HG   .  55 . HG   1 1 
       1852 1 2 1 1  56 ILE HA   .  56 . HA   1 1 
       1853 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1853 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       1854 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1854 1 2 1 1  76 TYR HB2  .  76 . HB2  1 1 
       1855 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       1855 1 2 1 1  76 TYR HB3  .  76 . HB1  1 1 
       1856 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       1856 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1857 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1857 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1858 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1858 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       1859 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1859 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       1860 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1860 1 2 1 1 120 PHE HB3  . 120 . HB1  1 1 
       1861 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1861 1 2 1 1 120 PHE HB2  . 120 . HB2  1 1 
       1862 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1862 1 2 1 1 120 PHE HB3  . 120 . HB1  1 1 
       1863 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1863 1 2 1 1 120 PHE HB2  . 120 . HB2  1 1 
       1864 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1864 1 2 1 1 117 VAL HA   . 117 . HA   1 1 
       1865 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1865 1 2 1 1 120 PHE HA   . 120 . HA   1 1 
       1866 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1866 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       1867 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1867 1 2 1 1   7 ILE HA   .   7 . HA   1 1 
       1868 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1868 1 2 1 1   6 LEU HA   .   6 . HA   1 1 
       1869 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       1869 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       1870 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       1870 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       1871 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       1871 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       1872 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1872 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       1873 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1873 1 2 1 1  79 PHE QE   .  79 . HE*  1 1 
       1874 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1874 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       1875 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1875 1 2 1 1 117 VAL H    . 117 . HN   1 1 
       1876 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1876 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       1877 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1877 1 2 1 1  58 SER H    .  58 . HN   1 1 
       1878 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1878 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       1879 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1879 1 2 1 1  67 MET H    .  67 . HN   1 1 
       1880 1 1 1 1   6 LEU HB2  .   6 . HB2  1 1 
       1880 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       1881 1 1 1 1   6 LEU HB3  .   6 . HB1  1 1 
       1881 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       1882 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1882 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       1883 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       1883 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       1884 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       1884 1 2 1 1  82 LEU HA   .  82 . HA   1 1 
       1885 1 1 1 1   8 ASN HB2  .   8 . HB2  1 1 
       1885 1 2 1 1  82 LEU HA   .  82 . HA   1 1 
       1886 1 1 1 1   8 ASN HB3  .   8 . HB1  1 1 
       1886 1 2 1 1  82 LEU HA   .  82 . HA   1 1 
       1887 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1887 1 2 1 1   8 ASN HB3  .   8 . HB1  1 1 
       1888 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       1888 1 2 1 1   9 THR MG   .   9 . HG2* 1 1 
       1889 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       1889 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       1890 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1890 1 2 1 1   8 ASN HA   .   8 . HA   1 1 
       1891 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       1891 1 2 1 1  10 ASN HA   .  10 . HA   1 1 
       1892 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       1892 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       1893 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       1893 1 2 1 1   9 THR MG   .   9 . HG2* 1 1 
       1894 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       1894 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       1895 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       1895 1 2 1 1  14 LEU HB3  .  14 . HB1  1 1 
       1896 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       1896 1 2 1 1  12 ASP H    .  12 . HN   1 1 
       1897 1 1 1 1  11 ASN HB2  .  11 . HB2  1 1 
       1897 1 2 1 1  14 LEU HB2  .  14 . HB2  1 1 
       1898 1 1 1 1  11 ASN HB3  .  11 . HB1  1 1 
       1898 1 2 1 1  14 LEU HB2  .  14 . HB2  1 1 
       1899 1 1 1 1  11 ASN HB3  .  11 . HB1  1 1 
       1899 1 2 1 1  14 LEU HB3  .  14 . HB1  1 1 
       1900 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       1900 1 2 1 1  11 ASN HB3  .  11 . HB1  1 1 
       1901 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       1901 1 2 1 1  11 ASN HB2  .  11 . HB2  1 1 
       1902 1 1 1 1  12 ASP HB3  .  12 . HB1  1 1 
       1902 1 2 1 1  13 GLU HA   .  13 . HA   1 1 
       1903 1 1 1 1  12 ASP HB2  .  12 . HB2  1 1 
       1903 1 2 1 1  13 GLU HA   .  13 . HA   1 1 
       1904 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       1904 1 2 1 1  44 LYS HE2  .  44 . HE2  1 1 
       1905 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       1905 1 2 1 1  44 LYS HE3  .  44 . HE1  1 1 
       1906 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       1906 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
       1907 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       1907 1 2 1 1  44 LYS HG2  .  44 . HG2  1 1 
       1908 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       1908 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1909 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       1909 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1910 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       1910 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
       1911 1 1 1 1  11 ASN HB2  .  11 . HB2  1 1 
       1911 1 2 1 1  14 LEU HB3  .  14 . HB1  1 1 
       1912 1 1 1 1  11 ASN HB2  .  11 . HB2  1 1 
       1912 1 2 1 1  14 LEU HG   .  14 . HG   1 1 
       1913 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       1913 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1914 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1914 1 2 1 1 110 ASP HB3  . 110 . HB1  1 1 
       1915 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       1915 1 2 1 1 110 ASP HB2  . 110 . HB2  1 1 
       1916 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1916 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1917 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       1917 1 2 1 1  15 ILE HA   .  15 . HA   1 1 
       1918 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1918 1 2 1 1  19 LYS HE2  .  19 . HE2  1 1 
       1919 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1919 1 2 1 1  19 LYS HE3  .  19 . HE1  1 1 
       1920 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1920 1 2 1 1  16 LYS HA   .  16 . HA   1 1 
       1921 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1921 1 2 1 1  59 ASN HB3  .  59 . HB1  1 1 
       1922 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1922 1 2 1 1  59 ASN HB2  .  59 . HB2  1 1 
       1923 1 1 1 1  10 ASN HA   .  10 . HA   1 1 
       1923 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1924 1 1 1 1  14 LEU H    .  14 . HN   1 1 
       1924 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1925 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       1925 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1926 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       1926 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1927 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1927 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       1928 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1928 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       1929 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1929 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1930 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1930 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1931 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1931 1 2 1 1 114 LEU HA   . 114 . HA   1 1 
       1932 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       1932 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1933 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1933 1 2 1 1  19 LYS HA   .  19 . HA   1 1 
       1934 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1934 1 2 1 1 114 LEU HA   . 114 . HA   1 1 
       1935 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1935 1 2 1 1  19 LYS HA   .  19 . HA   1 1 
       1936 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1936 1 2 1 1 114 LEU HA   . 114 . HA   1 1 
       1937 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       1937 1 2 1 1  18 ILE HA   .  18 . HA   1 1 
       1938 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1938 1 2 1 1  21 GLU HA   .  21 . HA   1 1 
       1939 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1939 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       1940 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       1940 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1941 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       1941 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
       1942 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       1942 1 2 1 1  19 LYS HA   .  19 . HA   1 1 
       1943 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       1943 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1944 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1944 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       1945 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       1945 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1946 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1946 1 2 1 1  27 TYR HB2  .  27 . HB2  1 1 
       1947 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1947 1 2 1 1  27 TYR HB3  .  27 . HB1  1 1 
       1948 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1948 1 2 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       1949 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1949 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1950 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       1950 1 2 1 1  27 TYR H    .  27 . HN   1 1 
       1951 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
       1951 1 2 1 1  27 TYR H    .  27 . HN   1 1 
       1952 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
       1952 1 2 1 1  23 GLU HG2  .  23 . HG2  1 1 
       1953 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
       1953 1 2 1 1  23 GLU HG3  .  23 . HG1  1 1 
       1954 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1954 1 2 1 1  23 GLU HG3  .  23 . HG1  1 1 
       1955 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       1955 1 2 1 1  23 GLU HG2  .  23 . HG2  1 1 
       1956 1 1 1 1  23 GLU HG3  .  23 . HG1  1 1 
       1956 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1957 1 1 1 1  23 GLU HG2  .  23 . HG2  1 1 
       1957 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1958 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
       1958 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1959 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       1959 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1960 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       1960 1 2 1 1  23 GLU HA   .  23 . HA   1 1 
       1961 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       1961 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       1962 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       1962 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       1963 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       1963 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       1964 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
       1964 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1965 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       1965 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1966 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1966 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       1967 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       1967 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       1968 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
       1968 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1969 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
       1969 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1970 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
       1970 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1971 1 1 1 1  28 GLN HB3  .  28 . HB1  1 1 
       1971 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       1972 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       1972 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       1973 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
       1973 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1974 1 1 1 1  30 ARG HD2  .  30 . HD2  1 1 
       1974 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1975 1 1 1 1  30 ARG HD2  .  30 . HD2  1 1 
       1975 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       1976 1 1 1 1  30 ARG HD3  .  30 . HD1  1 1 
       1976 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       1977 1 1 1 1  30 ARG HD3  .  30 . HD1  1 1 
       1977 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       1978 1 1 1 1  31 ASP HB2  .  31 . HB2  1 1 
       1978 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1979 1 1 1 1  31 ASP HB3  .  31 . HB1  1 1 
       1979 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       1980 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1980 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
       1981 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1981 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1982 1 1 1 1  31 ASP HB2  .  31 . HB2  1 1 
       1982 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
       1983 1 1 1 1  31 ASP HB3  .  31 . HB1  1 1 
       1983 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
       1984 1 1 1 1  31 ASP HB2  .  31 . HB2  1 1 
       1984 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1985 1 1 1 1  31 ASP HB3  .  31 . HB1  1 1 
       1985 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       1986 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1986 1 2 1 1  34 ASP H    .  34 . HN   1 1 
       1987 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1987 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       1988 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1988 1 2 1 1  33 ASN HA   .  33 . HA   1 1 
       1989 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1989 1 2 1 1  58 SER HA   .  58 . HA   1 1 
       1990 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1990 1 2 1 1  32 VAL HA   .  32 . HA   1 1 
       1991 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       1991 1 2 1 1  58 SER HB2  .  58 . HB2  1 1 
       1992 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       1992 1 2 1 1  58 SER HA   .  58 . HA   1 1 
       1993 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1993 1 2 1 1  32 VAL HB   .  32 . HB   1 1 
       1994 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1994 1 2 1 1  58 SER HA   .  58 . HA   1 1 
       1995 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1995 1 2 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       1996 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1996 1 2 1 1  58 SER HA   .  58 . HA   1 1 
       1997 1 1 1 1  31 ASP HA   .  31 . HA   1 1 
       1997 1 2 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       1998 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1998 1 2 1 1  37 GLU HG3  .  37 . HG1  1 1 
       1999 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       1999 1 2 1 1  37 GLU HG2  .  37 . HG2  1 1 
       2000 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       2000 1 2 1 1  37 GLU HB3  .  37 . HB1  1 1 
       2001 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       2001 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2002 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       2002 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       2003 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       2003 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2004 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2004 1 2 1 1  33 ASN HB2  .  33 . HB2  1 1 
       2005 1 1 1 1  33 ASN HB2  .  33 . HB2  1 1 
       2005 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2006 1 1 1 1  33 ASN HB3  .  33 . HB1  1 1 
       2006 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2007 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2007 1 2 1 1  33 ASN HB3  .  33 . HB1  1 1 
       2008 1 1 1 1  34 ASP HA   .  34 . HA   1 1 
       2008 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2009 1 1 1 1  34 ASP HA   .  34 . HA   1 1 
       2009 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2010 1 1 1 1  34 ASP HB3  .  34 . HB1  1 1 
       2010 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2011 1 1 1 1  34 ASP HB2  .  34 . HB2  1 1 
       2011 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2012 1 1 1 1  35 SER HB3  .  35 . HB1  1 1 
       2012 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2013 1 1 1 1  35 SER HB2  .  35 . HB2  1 1 
       2013 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2014 1 1 1 1  37 GLU HB2  .  37 . HB2  1 1 
       2014 1 2 1 1  40 LYS HD2  .  40 . HD2  1 1 
       2015 1 1 1 1  37 GLU HB2  .  37 . HB2  1 1 
       2015 1 2 1 1  40 LYS HD3  .  40 . HD1  1 1 
       2016 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       2016 1 2 1 1  37 GLU HG3  .  37 . HG1  1 1 
       2017 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       2017 1 2 1 1  37 GLU HB2  .  37 . HB2  1 1 
       2018 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       2018 1 2 1 1  38 LEU HG   .  38 . HG   1 1 
       2019 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       2019 1 2 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2020 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2020 1 2 1 1  67 MET H    .  67 . HN   1 1 
       2021 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2021 1 2 1 1  67 MET H    .  67 . HN   1 1 
       2022 1 1 1 1  35 SER H    .  35 . HN   1 1 
       2022 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2023 1 1 1 1  38 LEU HG   .  38 . HG   1 1 
       2023 1 2 1 1  42 MET H    .  42 . HN   1 1 
       2024 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2024 1 2 1 1  39 LYS HA   .  39 . HA   1 1 
       2025 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2025 1 2 1 1  64 LEU HA   .  64 . HA   1 1 
       2026 1 1 1 1  35 SER HB3  .  35 . HB1  1 1 
       2026 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2027 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       2027 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2028 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2028 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       2029 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2029 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       2030 1 1 1 1  38 LEU HB3  .  38 . HB1  1 1 
       2030 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2031 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2031 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2032 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2032 1 2 1 1  41 GLU HG3  .  41 . HG1  1 1 
       2033 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2033 1 2 1 1  42 MET HG3  .  42 . HG1  1 1 
       2034 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       2034 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       2035 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2035 1 2 1 1  70 LEU HA   .  70 . HA   1 1 
       2036 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2036 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       2037 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2037 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2038 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2038 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2039 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2039 1 2 1 1  46 ALA H    .  46 . HN   1 1 
       2040 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2040 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       2041 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2041 1 2 1 1  67 MET H    .  67 . HN   1 1 
       2042 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2042 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       2043 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2043 1 2 1 1  70 LEU H    .  70 . HN   1 1 
       2044 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       2044 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2045 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       2045 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       2046 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2046 1 2 1 1  42 MET HG3  .  42 . HG1  1 1 
       2047 1 1 1 1  42 MET HG2  .  42 . HG2  1 1 
       2047 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       2048 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2048 1 2 1 1  42 MET HG2  .  42 . HG2  1 1 
       2049 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2049 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       2050 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2050 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2051 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2051 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2052 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2052 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2053 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2053 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2054 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2054 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2055 1 1 1 1  44 LYS H    .  44 . HN   1 1 
       2055 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       2056 1 1 1 1  45 LEU HG   .  45 . HG   1 1 
       2056 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2057 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2057 1 2 1 1 117 VAL H    . 117 . HN   1 1 
       2058 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       2058 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2059 1 1 1 1  58 SER H    .  58 . HN   1 1 
       2059 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2060 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       2060 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2061 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2061 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       2062 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2062 1 2 1 1  46 ALA HA   .  46 . HA   1 1 
       2063 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       2063 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2064 1 1 1 1  46 ALA HA   .  46 . HA   1 1 
       2064 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       2065 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2065 1 2 1 1  46 ALA MB   .  46 . HB*  1 1 
       2066 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       2066 1 2 1 1  47 GLU HG2  .  47 . HG2  1 1 
       2067 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       2067 1 2 1 1  47 GLU HG3  .  47 . HG1  1 1 
       2068 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       2068 1 2 1 1  50 ASN HB2  .  50 . HB2  1 1 
       2069 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       2069 1 2 1 1  50 ASN HB3  .  50 . HB1  1 1 
       2070 1 1 1 1  28 GLN HB2  .  28 . HB2  1 1 
       2070 1 2 1 1  54 ILE HG12 .  54 . HG12 1 1 
       2071 1 1 1 1  28 GLN HB2  .  28 . HB2  1 1 
       2071 1 2 1 1  54 ILE HG13 .  54 . HG11 1 1 
       2072 1 1 1 1  28 GLN HB2  .  28 . HB2  1 1 
       2072 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2073 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
       2073 1 2 1 1  54 ILE HB   .  54 . HB   1 1 
       2074 1 1 1 1  54 ILE HB   .  54 . HB   1 1 
       2074 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2075 1 1 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2075 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2076 1 1 1 1  53 LYS H    .  53 . HN   1 1 
       2076 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2077 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2077 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2078 1 1 1 1  28 GLN HE22 .  28 . HE22 1 1 
       2078 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2079 1 1 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2079 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2080 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       2080 1 2 1 1  56 ILE HA   .  56 . HA   1 1 
       2081 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       2081 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       2082 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2082 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       2083 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       2083 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       2084 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       2084 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2085 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       2085 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2086 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       2086 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
       2087 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       2087 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       2088 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       2088 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2089 1 1 1 1  19 LYS HE2  .  19 . HE2  1 1 
       2089 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2090 1 1 1 1  19 LYS HE3  .  19 . HE1  1 1 
       2090 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2091 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       2091 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2092 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2092 1 2 1 1 117 VAL HA   . 117 . HA   1 1 
       2093 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       2093 1 2 1 1  58 SER HB3  .  58 . HB1  1 1 
       2094 1 1 1 1  58 SER HB3  .  58 . HB1  1 1 
       2094 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
       2095 1 1 1 1  58 SER HB2  .  58 . HB2  1 1 
       2095 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
       2096 1 1 1 1  57 ILE MG   .  57 . HG2* 1 1 
       2096 1 2 1 1  58 SER HA   .  58 . HA   1 1 
       2097 1 1 1 1  58 SER HA   .  58 . HA   1 1 
       2097 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2098 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       2098 1 2 1 1  60 ASP HB2  .  60 . HB2  1 1 
       2099 1 1 1 1  58 SER HA   .  58 . HA   1 1 
       2099 1 2 1 1  60 ASP HB2  .  60 . HB2  1 1 
       2100 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       2100 1 2 1 1  60 ASP HB3  .  60 . HB1  1 1 
       2101 1 1 1 1  58 SER HA   .  58 . HA   1 1 
       2101 1 2 1 1  60 ASP HB3  .  60 . HB1  1 1 
       2102 1 1 1 1  60 ASP HB2  .  60 . HB2  1 1 
       2102 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
       2103 1 1 1 1  60 ASP HB3  .  60 . HB1  1 1 
       2103 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
       2104 1 1 1 1  60 ASP HB3  .  60 . HB1  1 1 
       2104 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2105 1 1 1 1   8 ASN HD21 .   8 . HD21 1 1 
       2105 1 2 1 1  61 LYS HA   .  61 . HA   1 1 
       2106 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       2106 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2107 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       2107 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2108 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       2108 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2109 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       2109 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2110 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       2110 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2111 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       2111 1 2 1 1  61 LYS HG3  .  61 . HG1  1 1 
       2112 1 1 1 1 127 LEU MD2  . 127 . HD2* 1 1 
       2112 1 2 1 1 128 GLU HA   . 128 . HA   1 1 
       2113 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2113 1 2 1 1  63 LEU HA   .  63 . HA   1 1 
       2114 1 1 1 1  60 ASP HB2  .  60 . HB2  1 1 
       2114 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2115 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       2115 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2116 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       2116 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2117 1 1 1 1  62 GLN H    .  62 . HN   1 1 
       2117 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2118 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       2118 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       2119 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2119 1 2 1 1  64 LEU HA   .  64 . HA   1 1 
       2120 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2120 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2121 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2121 1 2 1 1  65 LYS HA   .  65 . HA   1 1 
       2122 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2122 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2123 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2123 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2124 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2124 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2125 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2125 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2126 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2126 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2127 1 1 1 1  58 SER HB3  .  58 . HB1  1 1 
       2127 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2128 1 1 1 1  58 SER HB2  .  58 . HB2  1 1 
       2128 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2129 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       2129 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2130 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       2130 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       2131 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       2131 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       2132 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2132 1 2 1 1  67 MET HA   .  67 . HA   1 1 
       2133 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2133 1 2 1 1  67 MET HA   .  67 . HA   1 1 
       2134 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       2134 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2135 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2135 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       2136 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2136 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       2137 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2137 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       2138 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2138 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       2139 1 1 1 1  63 LEU HB3  .  63 . HB1  1 1 
       2139 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2140 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       2140 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2141 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       2141 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2142 1 1 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       2142 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2143 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2143 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2144 1 1 1 1  58 SER H    .  58 . HN   1 1 
       2144 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2145 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       2145 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2146 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       2146 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2147 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       2147 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2148 1 1 1 1  64 LEU H    .  64 . HN   1 1 
       2148 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2149 1 1 1 1  68 LEU HB3  .  68 . HB1  1 1 
       2149 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2150 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2150 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2151 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2151 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2152 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2152 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2153 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2153 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2154 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       2154 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2155 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2155 1 2 1 1  80 LEU HB2  .  80 . HB2  1 1 
       2156 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2156 1 2 1 1  80 LEU HB2  .  80 . HB2  1 1 
       2157 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2157 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2158 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2158 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2159 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2159 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       2160 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2160 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2161 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2161 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2162 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2162 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2163 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2163 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2164 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2164 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       2165 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2165 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       2166 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       2166 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       2167 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       2167 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       2168 1 1 1 1  70 LEU H    .  70 . HN   1 1 
       2168 1 2 1 1  71 ILE HA   .  71 . HA   1 1 
       2169 1 1 1 1  70 LEU H    .  70 . HN   1 1 
       2169 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
       2170 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2170 1 2 1 1  74 LEU HB3  .  74 . HB1  1 1 
       2171 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2171 1 2 1 1  71 ILE HA   .  71 . HA   1 1 
       2172 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2172 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
       2173 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2173 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2174 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2174 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2175 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2175 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2176 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       2176 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2177 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2177 1 2 1 1  76 TYR HB2  .  76 . HB2  1 1 
       2178 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       2178 1 2 1 1  71 ILE HG12 .  71 . HG12 1 1 
       2179 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       2179 1 2 1 1  71 ILE HG13 .  71 . HG11 1 1 
       2180 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       2180 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2181 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2181 1 2 1 1  72 SER HB2  .  72 . HB2  1 1 
       2182 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2182 1 2 1 1  72 SER HB3  .  72 . HB1  1 1 
       2183 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2183 1 2 1 1  72 SER HA   .  72 . HA   1 1 
       2184 1 1 1 1  70 LEU H    .  70 . HN   1 1 
       2184 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2185 1 1 1 1  68 LEU H    .  68 . HN   1 1 
       2185 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2186 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2186 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2187 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2187 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2188 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2188 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2189 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2189 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2190 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       2190 1 2 1 1  72 SER HB2  .  72 . HB2  1 1 
       2191 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       2191 1 2 1 1  72 SER HB3  .  72 . HB1  1 1 
       2192 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2192 1 2 1 1  72 SER HB2  .  72 . HB2  1 1 
       2193 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2193 1 2 1 1  72 SER HB3  .  72 . HB1  1 1 
       2194 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       2194 1 2 1 1  72 SER HB2  .  72 . HB2  1 1 
       2195 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       2195 1 2 1 1  72 SER HB3  .  72 . HB1  1 1 
       2196 1 1 1 1  72 SER HB2  .  72 . HB2  1 1 
       2196 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2197 1 1 1 1  72 SER HB3  .  72 . HB1  1 1 
       2197 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2198 1 1 1 1  73 LYS HA   .  73 . HA   1 1 
       2198 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       2199 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       2199 1 2 1 1  74 LEU HA   .  74 . HA   1 1 
       2200 1 1 1 1  74 LEU HA   .  74 . HA   1 1 
       2200 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       2201 1 1 1 1  74 LEU HA   .  74 . HA   1 1 
       2201 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2202 1 1 1 1  74 LEU HA   .  74 . HA   1 1 
       2202 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2203 1 1 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2203 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2204 1 1 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       2204 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2205 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2205 1 2 1 1  74 LEU HB2  .  74 . HB2  1 1 
       2206 1 1 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       2206 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2207 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       2207 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2208 1 1 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2208 1 2 1 1 105 ARG HE   . 105 . HE   1 1 
       2209 1 1 1 1  75 GLY HA2  .  75 . HA2  1 1 
       2209 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2210 1 1 1 1  75 GLY HA3  .  75 . HA1  1 1 
       2210 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2211 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2211 1 2 1 1  76 TYR HB2  .  76 . HB2  1 1 
       2212 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2212 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2213 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2213 1 2 1 1  76 TYR HB3  .  76 . HB1  1 1 
       2214 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2214 1 2 1 1  76 TYR HB3  .  76 . HB1  1 1 
       2215 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2215 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       2216 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2216 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       2217 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2217 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       2218 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2218 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2219 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2219 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2220 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2220 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2221 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
       2221 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       2222 1 1 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2222 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2223 1 1 1 1  76 TYR QD   .  76 . HD*  1 1 
       2223 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2224 1 1 1 1  80 LEU HB2  .  80 . HB2  1 1 
       2224 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       2225 1 1 1 1  80 LEU HB3  .  80 . HB1  1 1 
       2225 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       2226 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
       2226 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       2227 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
       2227 1 2 1 1  81 LEU HA   .  81 . HA   1 1 
       2228 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       2228 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2229 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
       2229 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2230 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       2230 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2231 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2231 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2232 1 1 1 1  80 LEU HB2  .  80 . HB2  1 1 
       2232 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2233 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2233 1 2 1 1  80 LEU HB2  .  80 . HB2  1 1 
       2234 1 1 1 1  80 LEU HG   .  80 . HG   1 1 
       2234 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2235 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2235 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2236 1 1 1 1  80 LEU HB2  .  80 . HB2  1 1 
       2236 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2237 1 1 1 1  80 LEU HB3  .  80 . HB1  1 1 
       2237 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2238 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2238 1 2 1 1  80 LEU HB3  .  80 . HB1  1 1 
       2239 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2239 1 2 1 1  80 LEU HB3  .  80 . HB1  1 1 
       2240 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2240 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       2241 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2241 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       2242 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2242 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2243 1 1 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2243 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       2244 1 1 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2244 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2245 1 1 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2245 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2246 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2246 1 2 1 1 105 ARG HE   . 105 . HE   1 1 
       2247 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2247 1 2 1 1  81 LEU HB2  .  81 . HB2  1 1 
       2248 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2248 1 2 1 1  81 LEU HB3  .  81 . HB1  1 1 
       2249 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       2249 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2250 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2250 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       2251 1 1 1 1  58 SER H    .  58 . HN   1 1 
       2251 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2252 1 1 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2252 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2253 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       2253 1 2 1 1  81 LEU HB2  .  81 . HB2  1 1 
       2254 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       2254 1 2 1 1  81 LEU HB3  .  81 . HB1  1 1 
       2255 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       2255 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2256 1 1 1 1  58 SER HG   .  58 . HG   1 1 
       2256 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2257 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2257 1 2 1 1  94 LYS H    .  94 . HN   1 1 
       2258 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2258 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       2259 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2259 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2260 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2260 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       2261 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2261 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2262 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       2262 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2263 1 1 1 1  83 GLN HB2  .  83 . HB2  1 1 
       2263 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2264 1 1 1 1  83 GLN HB3  .  83 . HB1  1 1 
       2264 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2265 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       2265 1 2 1 1  83 GLN HG2  .  83 . HG2  1 1 
       2266 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       2266 1 2 1 1  83 GLN HG3  .  83 . HG1  1 1 
       2267 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       2267 1 2 1 1  83 GLN HG3  .  83 . HG1  1 1 
       2268 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       2268 1 2 1 1  83 GLN HG2  .  83 . HG2  1 1 
       2269 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       2269 1 2 1 1  83 GLN HB3  .  83 . HB1  1 1 
       2270 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       2270 1 2 1 1  83 GLN HB2  .  83 . HB2  1 1 
       2271 1 1 1 1  82 LEU H    .  82 . HN   1 1 
       2271 1 2 1 1  83 GLN HA   .  83 . HA   1 1 
       2272 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       2272 1 2 1 1 108 THR H    . 108 . HN   1 1 
       2273 1 1 1 1  84 ASP HB2  .  84 . HB2  1 1 
       2273 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
       2274 1 1 1 1  84 ASP HB3  .  84 . HB1  1 1 
       2274 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
       2275 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       2275 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       2276 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       2276 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       2277 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       2277 1 2 1 1  84 ASP HA   .  84 . HA   1 1 
       2278 1 1 1 1  84 ASP HB3  .  84 . HB1  1 1 
       2278 1 2 1 1  90 LEU HA   .  90 . HA   1 1 
       2279 1 1 1 1  48 GLU HA   .  48 . HA   1 1 
       2279 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2280 1 1 1 1  86 ASP HB3  .  86 . HB1  1 1 
       2280 1 2 1 1  89 GLU HG2  .  89 . HG2  1 1 
       2281 1 1 1 1  86 ASP HB3  .  86 . HB1  1 1 
       2281 1 2 1 1  89 GLU HG3  .  89 . HG1  1 1 
       2282 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       2282 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       2283 1 1 1 1  88 ASN HB2  .  88 . HB2  1 1 
       2283 1 2 1 1  89 GLU HA   .  89 . HA   1 1 
       2284 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
       2284 1 2 1 1  91 GLU HG3  .  91 . HG1  1 1 
       2285 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       2285 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
       2286 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2286 1 2 1 1  93 PHE HA   .  93 . HA   1 1 
       2287 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2287 1 2 1 1  93 PHE HA   .  93 . HA   1 1 
       2288 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2288 1 2 1 1  93 PHE HA   .  93 . HA   1 1 
       2289 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2289 1 2 1 1  93 PHE HB2  .  93 . HB2  1 1 
       2290 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2290 1 2 1 1  93 PHE HB2  .  93 . HB2  1 1 
       2291 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2291 1 2 1 1  93 PHE HB3  .  93 . HB1  1 1 
       2292 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2292 1 2 1 1  93 PHE HB3  .  93 . HB1  1 1 
       2293 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       2293 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2294 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2294 1 2 1 1  94 LYS HA   .  94 . HA   1 1 
       2295 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       2295 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2296 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       2296 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2297 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2297 1 2 1 1  94 LYS HB2  .  94 . HB2  1 1 
       2298 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2298 1 2 1 1  94 LYS HB3  .  94 . HB1  1 1 
       2299 1 1 1 1  94 LYS HG3  .  94 . HG1  1 1 
       2299 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2300 1 1 1 1  94 LYS HD2  .  94 . HD2  1 1 
       2300 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2301 1 1 1 1  94 LYS HD3  .  94 . HD1  1 1 
       2301 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2302 1 1 1 1  92 GLU HA   .  92 . HA   1 1 
       2302 1 2 1 1  95 ARG HD2  .  95 . HD2  1 1 
       2303 1 1 1 1  65 LYS HD2  .  65 . HD2  1 1 
       2303 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       2304 1 1 1 1  65 LYS HD3  .  65 . HD1  1 1 
       2304 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       2305 1 1 1 1  96 LYS HB2  .  96 . HB2  1 1 
       2305 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       2306 1 1 1 1  96 LYS HB3  .  96 . HB1  1 1 
       2306 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       2307 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       2307 1 2 1 1 100 GLN HB3  . 100 . HB1  1 1 
       2308 1 1 1 1  97 ILE HB   .  97 . HB   1 1 
       2308 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2309 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2309 1 2 1 1  97 ILE HB   .  97 . HB   1 1 
       2310 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2310 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2311 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2311 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2312 1 1 1 1  65 LYS HD2  .  65 . HD2  1 1 
       2312 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2313 1 1 1 1  65 LYS HD3  .  65 . HD1  1 1 
       2313 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2314 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2314 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2315 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2315 1 2 1 1 102 TYR HB2  . 102 . HB2  1 1 
       2316 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       2316 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2317 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       2317 1 2 1 1  97 ILE HG13 .  97 . HG11 1 1 
       2318 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2318 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2319 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       2319 1 2 1 1  97 ILE HG12 .  97 . HG12 1 1 
       2320 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2320 1 2 1 1  98 GLU HA   .  98 . HA   1 1 
       2321 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2321 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2322 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       2322 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2323 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       2323 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2324 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       2324 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       2325 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       2325 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2326 1 1 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2326 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2327 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       2327 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2328 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       2328 1 2 1 1 100 GLN HB2  . 100 . HB2  1 1 
       2329 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       2329 1 2 1 1 100 GLN HG2  . 100 . HG2  1 1 
       2330 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       2330 1 2 1 1 100 GLN HG3  . 100 . HG1  1 1 
       2331 1 1 1 1 100 GLN HG2  . 100 . HG2  1 1 
       2331 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2332 1 1 1 1 100 GLN HG3  . 100 . HG1  1 1 
       2332 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2333 1 1 1 1 100 GLN HA   . 100 . HA   1 1 
       2333 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2334 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2334 1 2 1 1 102 TYR HB2  . 102 . HB2  1 1 
       2335 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2335 1 2 1 1 102 TYR HB3  . 102 . HB1  1 1 
       2336 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2336 1 2 1 1 102 TYR HB3  . 102 . HB1  1 1 
       2337 1 1 1 1  78 VAL HB   .  78 . HB   1 1 
       2337 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2338 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2338 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2339 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2339 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2340 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
       2340 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2341 1 1 1 1 103 GLU HA   . 103 . HA   1 1 
       2341 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2342 1 1 1 1 103 GLU HA   . 103 . HA   1 1 
       2342 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2343 1 1 1 1 103 GLU HA   . 103 . HA   1 1 
       2343 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2344 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2344 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2345 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2345 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2346 1 1 1 1  94 LYS HG2  .  94 . HG2  1 1 
       2346 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2347 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2347 1 2 1 1  38 LEU HB3  .  38 . HB1  1 1 
       2348 1 1 1 1 105 ARG HD2  . 105 . HD2  1 1 
       2348 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2349 1 1 1 1 105 ARG HD3  . 105 . HD1  1 1 
       2349 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2350 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2350 1 2 1 1 105 ARG HA   . 105 . HA   1 1 
       2351 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
       2351 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2352 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2352 1 2 1 1 105 ARG HD3  . 105 . HD1  1 1 
       2353 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2353 1 2 1 1 105 ARG HD2  . 105 . HD2  1 1 
       2354 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2354 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2355 1 1 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2355 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2356 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2356 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2357 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2357 1 2 1 1 106 LYS HB2  . 106 . HB2  1 1 
       2358 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2358 1 2 1 1 106 LYS HB3  . 106 . HB1  1 1 
       2359 1 1 1 1 107 VAL HB   . 107 . HB   1 1 
       2359 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2360 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2360 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2361 1 1 1 1  83 GLN HB3  .  83 . HB1  1 1 
       2361 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2362 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2362 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       2363 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2363 1 2 1 1 112 GLU HA   . 112 . HA   1 1 
       2364 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2364 1 2 1 1 112 GLU HA   . 112 . HA   1 1 
       2365 1 1 1 1 107 VAL HB   . 107 . HB   1 1 
       2365 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       2366 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       2366 1 2 1 1 107 VAL HB   . 107 . HB   1 1 
       2367 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       2367 1 2 1 1 107 VAL HB   . 107 . HB   1 1 
       2368 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       2368 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2369 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       2369 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2370 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       2370 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2371 1 1 1 1 107 VAL HB   . 107 . HB   1 1 
       2371 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       2372 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2372 1 2 1 1 109 ASP H    . 109 . HN   1 1 
       2373 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       2373 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2374 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2374 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       2375 1 1 1 1  87 GLU H    .  87 . HN   1 1 
       2375 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       2376 1 1 1 1 107 VAL HA   . 107 . HA   1 1 
       2376 1 2 1 1 108 THR HB   . 108 . HB   1 1 
       2377 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2377 1 2 1 1 108 THR HB   . 108 . HB   1 1 
       2378 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2378 1 2 1 1 109 ASP HB2  . 109 . HB2  1 1 
       2379 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2379 1 2 1 1 109 ASP HB3  . 109 . HB1  1 1 
       2380 1 1 1 1 109 ASP HB2  . 109 . HB2  1 1 
       2380 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       2381 1 1 1 1 109 ASP HB2  . 109 . HB2  1 1 
       2381 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       2382 1 1 1 1 109 ASP HB3  . 109 . HB1  1 1 
       2382 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       2383 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2383 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2384 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2384 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2385 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2385 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2386 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       2386 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2387 1 1 1 1 113 ALA MB   . 113 . HB*  1 1 
       2387 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       2388 1 1 1 1  83 GLN HG3  .  83 . HG1  1 1 
       2388 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2389 1 1 1 1  83 GLN HG2  .  83 . HG2  1 1 
       2389 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2390 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2390 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       2391 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
       2391 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2392 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
       2392 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       2393 1 1 1 1 113 ALA MB   . 113 . HB*  1 1 
       2393 1 2 1 1 114 LEU HA   . 114 . HA   1 1 
       2394 1 1 1 1  82 LEU H    .  82 . HN   1 1 
       2394 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       2395 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       2395 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2396 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       2396 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       2397 1 1 1 1   8 ASN HB2  .   8 . HB2  1 1 
       2397 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2398 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       2398 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       2399 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       2399 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2400 1 1 1 1 113 ALA MB   . 113 . HB*  1 1 
       2400 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       2401 1 1 1 1 107 VAL HB   . 107 . HB   1 1 
       2401 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       2402 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
       2402 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       2403 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       2403 1 2 1 1 119 GLU HG3  . 119 . HG1  1 1 
       2404 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
       2404 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       2405 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2405 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       2406 1 1 1 1 105 ARG HE   . 105 . HE   1 1 
       2406 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2407 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2407 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2408 1 1 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2408 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2409 1 1 1 1 116 ILE H    . 116 . HN   1 1 
       2409 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2410 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2410 1 2 1 1 117 VAL HA   . 117 . HA   1 1 
       2411 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       2411 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2412 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2412 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2413 1 1 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2413 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2414 1 1 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2414 1 2 1 1 117 VAL HA   . 117 . HA   1 1 
       2415 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2415 1 2 1 1 117 VAL HA   . 117 . HA   1 1 
       2416 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2416 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2417 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       2417 1 2 1 1 118 ARG HA   . 118 . HA   1 1 
       2418 1 1 1 1 120 PHE QE   . 120 . HE*  1 1 
       2418 1 2 1 1 121 MET HA   . 121 . HA   1 1 
       2419 1 1 1 1 120 PHE QD   . 120 . HD*  1 1 
       2419 1 2 1 1 121 MET HA   . 121 . HA   1 1 
       2420 1 1 1 1 120 PHE QD   . 120 . HD*  1 1 
       2420 1 2 1 1 121 MET HG2  . 121 . HG2  1 1 
       2421 1 1 1 1 120 PHE QD   . 120 . HD*  1 1 
       2421 1 2 1 1 121 MET HG3  . 121 . HG1  1 1 
       2422 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2422 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2423 1 1 1 1  22 VAL H    .  22 . HN   1 1 
       2423 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2424 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       2424 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2425 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2425 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2426 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2426 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2427 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2427 1 2 1 1 121 MET HA   . 121 . HA   1 1 
       2428 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       2428 1 2 1 1 121 MET HG3  . 121 . HG1  1 1 
       2429 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       2429 1 2 1 1 121 MET HG2  . 121 . HG2  1 1 
       2430 1 1 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2430 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2431 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       2431 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2432 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       2432 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2433 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2433 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2434 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2434 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2435 1 1 1 1 120 PHE QE   . 120 . HE*  1 1 
       2435 1 2 1 1 124 ALA HA   . 124 . HA   1 1 
       2436 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2436 1 2 1 1 124 ALA HA   . 124 . HA   1 1 
       2437 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2437 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2438 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2438 1 2 1 1  77 LYS HG3  .  77 . HG1  1 1 
       2439 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2439 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2440 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2440 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2441 1 1 1 1   3 GLU HB3  .   3 . HB1  1 1 
       2441 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2442 1 1 1 1   3 GLU HB3  .   3 . HB1  1 1 
       2442 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2443 1 1 1 1   2 LYS HB2  .   2 . HB2  1 1 
       2443 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2444 1 1 1 1   2 LYS HB3  .   2 . HB1  1 1 
       2444 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2445 1 1 1 1   2 LYS HG2  .   2 . HG2  1 1 
       2445 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2446 1 1 1 1   2 LYS HG3  .   2 . HG1  1 1 
       2446 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2447 1 1 1 1   2 LYS HD2  .   2 . HD2  1 1 
       2447 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2448 1 1 1 1   2 LYS HD3  .   2 . HD1  1 1 
       2448 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2449 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       2449 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2450 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       2450 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2451 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       2451 1 2 1 1  51 PHE QD   .  51 . HD*  1 1 
       2452 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       2452 1 2 1 1  51 PHE QE   .  51 . HE*  1 1 
       2453 1 1 1 1   2 LYS HD2  .   2 . HD2  1 1 
       2453 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2454 1 1 1 1   2 LYS HD3  .   2 . HD1  1 1 
       2454 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2455 1 1 1 1   1 MET HA   .   1 . HA   1 1 
       2455 1 2 1 1   2 LYS HA   .   2 . HA   1 1 
       2456 1 1 1 1   1 MET HA   .   1 . HA   1 1 
       2456 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2457 1 1 1 1   1 MET HA   .   1 . HA   1 1 
       2457 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2458 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       2458 1 2 1 1   3 GLU HA   .   3 . HA   1 1 
       2459 1 1 1 1   1 MET HA   .   1 . HA   1 1 
       2459 1 2 1 1   2 LYS HG2  .   2 . HG2  1 1 
       2460 1 1 1 1   1 MET HA   .   1 . HA   1 1 
       2460 1 2 1 1   2 LYS HG3  .   2 . HG1  1 1 
       2461 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2461 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2462 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2462 1 2 1 1   6 LEU H    .   6 . HN   1 1 
       2463 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       2463 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       2464 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       2464 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2465 1 1 1 1  55 LEU HA   .  55 . HA   1 1 
       2465 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2466 1 1 1 1  27 TYR HB2  .  27 . HB2  1 1 
       2466 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2467 1 1 1 1  27 TYR HB3  .  27 . HB1  1 1 
       2467 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2468 1 1 1 1  54 ILE HA   .  54 . HA   1 1 
       2468 1 2 1 1  55 LEU HB2  .  55 . HB2  1 1 
       2469 1 1 1 1  54 ILE HA   .  54 . HA   1 1 
       2469 1 2 1 1  55 LEU HB3  .  55 . HB1  1 1 
       2470 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2470 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       2471 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2471 1 2 1 1   7 ILE H    .   7 . HN   1 1 
       2472 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2472 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       2473 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2473 1 2 1 1   7 ILE HA   .   7 . HA   1 1 
       2474 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2474 1 2 1 1  68 LEU HA   .  68 . HA   1 1 
       2475 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2475 1 2 1 1  68 LEU HA   .  68 . HA   1 1 
       2476 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2476 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       2477 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2477 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       2478 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       2478 1 2 1 1  81 LEU HG   .  81 . HG   1 1 
       2479 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       2479 1 2 1 1  15 ILE HA   .  15 . HA   1 1 
       2480 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       2480 1 2 1 1   9 THR HB   .   9 . HB   1 1 
       2481 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2481 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2482 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       2482 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       2483 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       2483 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2484 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2484 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2485 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2485 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2486 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       2486 1 2 1 1  58 SER HB2  .  58 . HB2  1 1 
       2487 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       2487 1 2 1 1  58 SER HB3  .  58 . HB1  1 1 
       2488 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       2488 1 2 1 1   8 ASN HA   .   8 . HA   1 1 
       2489 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       2489 1 2 1 1   8 ASN HA   .   8 . HA   1 1 
       2490 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       2490 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       2491 1 1 1 1   9 THR HA   .   9 . HA   1 1 
       2491 1 2 1 1  10 ASN HA   .  10 . HA   1 1 
       2492 1 1 1 1  10 ASN HA   .  10 . HA   1 1 
       2492 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       2493 1 1 1 1  11 ASN HB2  .  11 . HB2  1 1 
       2493 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       2494 1 1 1 1  11 ASN HB3  .  11 . HB1  1 1 
       2494 1 2 1 1  14 LEU HG   .  14 . HG   1 1 
       2495 1 1 1 1  11 ASN HB3  .  11 . HB1  1 1 
       2495 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       2496 1 1 1 1  12 ASP HB2  .  12 . HB2  1 1 
       2496 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       2497 1 1 1 1  12 ASP HB3  .  12 . HB1  1 1 
       2497 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       2498 1 1 1 1  11 ASN HD21 .  11 . HD21 1 1 
       2498 1 2 1 1  13 GLU HB2  .  13 . HB2  1 1 
       2499 1 1 1 1  11 ASN HD22 .  11 . HD22 1 1 
       2499 1 2 1 1  13 GLU HB2  .  13 . HB2  1 1 
       2500 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       2500 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       2501 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       2501 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       2502 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       2502 1 2 1 1  14 LEU HA   .  14 . HA   1 1 
       2503 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       2503 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       2504 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       2504 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       2505 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
       2505 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2506 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       2506 1 2 1 1  15 ILE HA   .  15 . HA   1 1 
       2507 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       2507 1 2 1 1  15 ILE HA   .  15 . HA   1 1 
       2508 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       2508 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2509 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2509 1 2 1 1  19 LYS HA   .  19 . HA   1 1 
       2510 1 1 1 1  14 LEU H    .  14 . HN   1 1 
       2510 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       2511 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       2511 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       2512 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       2512 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       2513 1 1 1 1  15 ILE H    .  15 . HN   1 1 
       2513 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2514 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       2514 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2515 1 1 1 1  17 LYS H    .  17 . HN   1 1 
       2515 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2516 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2516 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       2517 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       2517 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
       2518 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       2518 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
       2519 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       2519 1 2 1 1  18 ILE HA   .  18 . HA   1 1 
       2520 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       2520 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2521 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       2521 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       2522 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       2522 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2523 1 1 1 1  19 LYS HG2  .  19 . HG2  1 1 
       2523 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2524 1 1 1 1  19 LYS HD2  .  19 . HD2  1 1 
       2524 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2525 1 1 1 1  19 LYS HD3  .  19 . HD1  1 1 
       2525 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2526 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2526 1 2 1 1  19 LYS HD2  .  19 . HD2  1 1 
       2527 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2527 1 2 1 1  19 LYS HD3  .  19 . HD1  1 1 
       2528 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       2528 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2529 1 1 1 1  22 VAL HB   .  22 . HB   1 1 
       2529 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2530 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       2530 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2531 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       2531 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2532 1 1 1 1  20 LYS H    .  20 . HN   1 1 
       2532 1 2 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       2533 1 1 1 1  69 GLU H    .  69 . HN   1 1 
       2533 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2534 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
       2534 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2535 1 1 1 1  19 LYS HG3  .  19 . HG1  1 1 
       2535 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       2536 1 1 1 1  30 ARG HG2  .  30 . HG2  1 1 
       2536 1 2 1 1  56 ILE HA   .  56 . HA   1 1 
       2537 1 1 1 1  30 ARG HG3  .  30 . HG1  1 1 
       2537 1 2 1 1  56 ILE HA   .  56 . HA   1 1 
       2538 1 1 1 1  30 ARG HB2  .  30 . HB2  1 1 
       2538 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       2539 1 1 1 1  30 ARG HB3  .  30 . HB1  1 1 
       2539 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       2540 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       2540 1 2 1 1  38 LEU HA   .  38 . HA   1 1 
       2541 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2541 1 2 1 1  38 LEU HA   .  38 . HA   1 1 
       2542 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       2542 1 2 1 1  38 LEU HA   .  38 . HA   1 1 
       2543 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       2543 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       2544 1 1 1 1  80 LEU HB3  .  80 . HB1  1 1 
       2544 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       2545 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2545 1 2 1 1  80 LEU HB3  .  80 . HB1  1 1 
       2546 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       2546 1 2 1 1   6 LEU HG   .   6 . HG   1 1 
       2547 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2547 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2548 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2548 1 2 1 1  80 LEU HG   .  80 . HG   1 1 
       2549 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2549 1 2 1 1  80 LEU HG   .  80 . HG   1 1 
       2550 1 1 1 1  35 SER H    .  35 . HN   1 1 
       2550 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2551 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2551 1 2 1 1  82 LEU HG   .  82 . HG   1 1 
       2552 1 1 1 1  84 ASP HB2  .  84 . HB2  1 1 
       2552 1 2 1 1  90 LEU HA   .  90 . HA   1 1 
       2553 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       2553 1 2 1 1  85 GLN HA   .  85 . HA   1 1 
       2554 1 1 1 1  86 ASP HB3  .  86 . HB1  1 1 
       2554 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       2555 1 1 1 1  61 LYS HE3  .  61 . HE1  1 1 
       2555 1 2 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2556 1 1 1 1  61 LYS HE2  .  61 . HE2  1 1 
       2556 1 2 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2557 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
       2557 1 2 1 1  91 GLU HG2  .  91 . HG2  1 1 
       2558 1 1 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2558 1 2 1 1  97 ILE HG13 .  97 . HG11 1 1 
       2559 1 1 1 1  64 LEU HG   .  64 . HG   1 1 
       2559 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2560 1 1 1 1  93 PHE QD   .  93 . HD*  1 1 
       2560 1 2 1 1  94 LYS HA   .  94 . HA   1 1 
       2561 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       2561 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2562 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2562 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2563 1 1 1 1  93 PHE QE   .  93 . HE*  1 1 
       2563 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2564 1 1 1 1 124 ALA MB   . 124 . HB*  1 1 
       2564 1 2 1 1 125 GLY HA2  . 125 . HA2  1 1 
       2565 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2565 1 2 1 1 103 GLU HB2  . 103 . HB2  1 1 
       2566 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       2566 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2567 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       2567 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2568 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       2568 1 2 1 1 110 ASP HA   . 110 . HA   1 1 
       2569 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       2569 1 2 1 1 110 ASP HA   . 110 . HA   1 1 
       2570 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2570 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2571 1 1 1 1  51 PHE HB2  .  51 . HB2  1 1 
       2571 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2572 1 1 1 1  74 LEU HG   .  74 . HG   1 1 
       2572 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2573 1 1 1 1   2 LYS HD2  .   2 . HD2  1 1 
       2573 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2574 1 1 1 1   2 LYS HD3  .   2 . HD1  1 1 
       2574 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2575 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2575 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2576 1 1 1 1   1 MET HA   .   1 . HA   1 1 
       2576 1 2 1 1   1 MET ME   .   1 . HE*  1 1 
       2577 1 1 1 1   1 MET ME   .   1 . HE*  1 1 
       2577 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2578 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2578 1 2 1 1  81 LEU HA   .  81 . HA   1 1 
       2579 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       2579 1 2 1 1  37 GLU HG3  .  37 . HG1  1 1 
       2580 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       2580 1 2 1 1  37 GLU HG2  .  37 . HG2  1 1 
       2581 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       2581 1 2 1 1  37 GLU HG2  .  37 . HG2  1 1 
       2582 1 1 1 1  37 GLU HB3  .  37 . HB1  1 1 
       2582 1 2 1 1  40 LYS HD2  .  40 . HD2  1 1 
       2583 1 1 1 1  37 GLU HB3  .  37 . HB1  1 1 
       2583 1 2 1 1  40 LYS HD3  .  40 . HD1  1 1 
       2584 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2584 1 2 1 1  42 MET HG2  .  42 . HG2  1 1 
       2585 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       2585 1 2 1 1  39 LYS HG2  .  39 . HG2  1 1 
       2586 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       2586 1 2 1 1  39 LYS HG3  .  39 . HG1  1 1 
       2587 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       2587 1 2 1 1  39 LYS HD2  .  39 . HD2  1 1 
       2588 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       2588 1 2 1 1  39 LYS HD3  .  39 . HD1  1 1 
       2589 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2589 1 2 1 1  41 GLU HG2  .  41 . HG2  1 1 
       2590 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2590 1 2 1 1  37 GLU HA   .  37 . HA   1 1 
       2591 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       2591 1 2 1 1  37 GLU HA   .  37 . HA   1 1 
       2592 1 1 1 1  96 LYS HD2  .  96 . HD2  1 1 
       2592 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2593 1 1 1 1  96 LYS HD3  .  96 . HD1  1 1 
       2593 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2594 1 1 1 1   2 LYS HD2  .   2 . HD2  1 1 
       2594 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2595 1 1 1 1   2 LYS HD3  .   2 . HD1  1 1 
       2595 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2596 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2596 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2597 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2597 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2598 1 1 1 1  52 GLU HA   .  52 . HA   1 1 
       2598 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2599 1 1 1 1  53 LYS HG2  .  53 . HG2  1 1 
       2599 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2600 1 1 1 1  53 LYS HG3  .  53 . HG1  1 1 
       2600 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2601 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       2601 1 2 1 1  53 LYS HD2  .  53 . HD2  1 1 
       2602 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       2602 1 2 1 1  53 LYS HD3  .  53 . HD1  1 1 
       2603 1 1 1 1  51 PHE HB3  .  51 . HB1  1 1 
       2603 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2604 1 1 1 1   2 LYS HE2  .   2 . HE2  1 1 
       2604 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2605 1 1 1 1   2 LYS HE3  .   2 . HE1  1 1 
       2605 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2606 1 1 1 1  54 ILE HB   .  54 . HB   1 1 
       2606 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       2607 1 1 1 1  30 ARG H    .  30 . HN   1 1 
       2607 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       2608 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2608 1 2 1 1  54 ILE HB   .  54 . HB   1 1 
       2609 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2609 1 2 1 1  55 LEU HG   .  55 . HG   1 1 
       2610 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2610 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2611 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2611 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       2612 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       2612 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2613 1 1 1 1  61 LYS HE3  .  61 . HE1  1 1 
       2613 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2614 1 1 1 1  61 LYS HE2  .  61 . HE2  1 1 
       2614 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2615 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       2615 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2616 1 1 1 1  72 SER HA   .  72 . HA   1 1 
       2616 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2617 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       2617 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2618 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2618 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2619 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2619 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       2620 1 1 1 1  88 ASN HB3  .  88 . HB1  1 1 
       2620 1 2 1 1  89 GLU HA   .  89 . HA   1 1 
       2621 1 1 1 1  86 ASP HB2  .  86 . HB2  1 1 
       2621 1 2 1 1  89 GLU HG2  .  89 . HG2  1 1 
       2622 1 1 1 1  86 ASP HB2  .  86 . HB2  1 1 
       2622 1 2 1 1  89 GLU HG3  .  89 . HG1  1 1 
       2623 1 1 1 1  94 LYS HE2  .  94 . HE2  1 1 
       2623 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2624 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       2624 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       2625 1 1 1 1  96 LYS HG3  .  96 . HG1  1 1 
       2625 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2626 1 1 1 1  96 LYS HG2  .  96 . HG2  1 1 
       2626 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2627 1 1 1 1 121 MET HA   . 121 . HA   1 1 
       2627 1 2 1 1 122 GLN HA   . 122 . HA   1 1 
       2628 1 1 1 1 124 ALA MB   . 124 . HB*  1 1 
       2628 1 2 1 1 125 GLY HA3  . 125 . HA1  1 1 
       2629 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2629 1 2 1 1  77 LYS HG2  .  77 . HG2  1 1 
       2630 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       2630 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2631 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2631 1 2 1 1  80 LEU HA   .  80 . HA   1 1 
       2632 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2632 1 2 1 1 103 GLU HB2  . 103 . HB2  1 1 
       2633 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2633 1 2 1 1 103 GLU HB3  . 103 . HB1  1 1 
       2634 1 1 1 1  22 VAL HB   .  22 . HB   1 1 
       2634 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       2635 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       2635 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       2636 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2636 1 2 1 1 116 ILE HB   . 116 . HB   1 1 
       2637 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       2637 1 2 1 1 117 VAL HB   . 117 . HB   1 1 
       2638 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2638 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       2639 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2639 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       2640 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2640 1 2 1 1  97 ILE HB   .  97 . HB   1 1 
       2641 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2641 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2642 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2642 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2643 1 1 1 1 121 MET HA   . 121 . HA   1 1 
       2643 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2644 1 1 1 1  17 LYS HG2  .  17 . HG2  1 1 
       2644 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       2645 1 1 1 1  17 LYS HG3  .  17 . HG1  1 1 
       2645 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       2646 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       2646 1 2 1 1  20 LYS HG3  .  20 . HG1  1 1 
       2647 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       2647 1 2 1 1  27 TYR HB2  .  27 . HB2  1 1 
       2648 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       2648 1 2 1 1  27 TYR HB3  .  27 . HB1  1 1 
       2649 1 1 1 1  19 LYS HG2  .  19 . HG2  1 1 
       2649 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       2650 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2650 1 2 1 1  76 TYR HB3  .  76 . HB1  1 1 
       2651 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2651 1 2 1 1  76 TYR HB2  .  76 . HB2  1 1 
       2652 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2652 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2653 1 1 1 1  30 ARG HG2  .  30 . HG2  1 1 
       2653 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2654 1 1 1 1  30 ARG HG3  .  30 . HG1  1 1 
       2654 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2655 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2655 1 2 1 1  37 GLU HB2  .  37 . HB2  1 1 
       2656 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2656 1 2 1 1  37 GLU HB3  .  37 . HB1  1 1 
       2657 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       2657 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2658 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       2658 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2659 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2659 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2660 1 1 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2660 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2661 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       2661 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       2662 1 1 1 1  38 LEU HB2  .  38 . HB2  1 1 
       2662 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       2663 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2663 1 2 1 1 117 VAL HB   . 117 . HB   1 1 
       2664 1 1 1 1  64 LEU HB3  .  64 . HB1  1 1 
       2664 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2665 1 1 1 1  64 LEU HB2  .  64 . HB2  1 1 
       2665 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2666 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2666 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2667 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       2667 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2668 1 1 1 1  42 MET HG3  .  42 . HG1  1 1 
       2668 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       2669 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2669 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2670 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       2670 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2671 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       2671 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       2672 1 1 1 1  73 LYS HD2  .  73 . HD2  1 1 
       2672 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2673 1 1 1 1  73 LYS HD3  .  73 . HD1  1 1 
       2673 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2674 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2674 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2675 1 1 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       2675 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2676 1 1 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       2676 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2677 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       2677 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       2678 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2678 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       2679 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2679 1 2 1 1 103 GLU H    . 103 . HN   1 1 
       2680 1 1 1 1  98 GLU H    .  98 . HN   1 1 
       2680 1 2 1 1  99 SER HA   .  99 . HA   1 1 
       2681 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       2681 1 2 1 1  19 LYS HE3  .  19 . HE1  1 1 
       2682 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       2682 1 2 1 1  19 LYS HE2  .  19 . HE2  1 1 
       2683 1 1 1 1   2 LYS HE3  .   2 . HE1  1 1 
       2683 1 2 1 1  51 PHE QE   .  51 . HE*  1 1 
       2684 1 1 1 1   2 LYS HE2  .   2 . HE2  1 1 
       2684 1 2 1 1  51 PHE QE   .  51 . HE*  1 1 
       2685 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2685 1 2 1 1  65 LYS HE2  .  65 . HE2  1 1 
       2686 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2686 1 2 1 1  65 LYS HE3  .  65 . HE1  1 1 
       2687 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2687 1 2 1 1 105 ARG HB2  . 105 . HB2  1 1 
       2688 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2688 1 2 1 1 105 ARG HB3  . 105 . HB1  1 1 
       2689 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2689 1 2 1 1 105 ARG HG2  . 105 . HG2  1 1 
       2690 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2690 1 2 1 1 105 ARG HG3  . 105 . HG1  1 1 
       2691 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
       2691 1 2 1 1 105 ARG HD2  . 105 . HD2  1 1 
       2692 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
       2692 1 2 1 1 105 ARG HD3  . 105 . HD1  1 1 
       2693 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2693 1 2 1 1  80 LEU H    .  80 . HN   1 1 
       2694 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2694 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2695 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       2695 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2696 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       2696 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2697 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       2697 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       2698 1 1 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       2698 1 2 1 1  57 ILE H    .  57 . HN   1 1 
       2699 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       2699 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       2700 1 1 1 1  46 ALA H    .  46 . HN   1 1 
       2700 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       2701 1 1 1 1  94 LYS HE3  .  94 . HE1  1 1 
       2701 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2702 1 1 1 1  81 LEU HG   .  81 . HG   1 1 
       2702 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2703 1 1 1 1 120 PHE QD   . 120 . HD*  1 1 
       2703 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2704 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       2704 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2705 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       2705 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2706 1 1 1 1  27 TYR HA   .  27 . HA   1 1 
       2706 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2707 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2707 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2708 1 1 1 1  28 GLN HB3  .  28 . HB1  1 1 
       2708 1 2 1 1  54 ILE HG13 .  54 . HG11 1 1 
       2709 1 1 1 1  28 GLN HB3  .  28 . HB1  1 1 
       2709 1 2 1 1  54 ILE HG12 .  54 . HG12 1 1 
       2710 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2710 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2711 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2711 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2712 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2712 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       2713 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2713 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2714 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       2714 1 2 1 1  44 LYS HD2  .  44 . HD2  1 1 
       2715 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       2715 1 2 1 1  44 LYS HD3  .  44 . HD1  1 1 
       2716 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       2716 1 2 1 1  44 LYS HG3  .  44 . HG1  1 1 
       2717 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2717 1 2 1 1  53 LYS HD2  .  53 . HD2  1 1 
       2718 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2718 1 2 1 1  53 LYS HD3  .  53 . HD1  1 1 
       2719 1 1 1 1   2 LYS HG2  .   2 . HG2  1 1 
       2719 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2720 1 1 1 1   2 LYS HG3  .   2 . HG1  1 1 
       2720 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2721 1 1 1 1  22 VAL HB   .  22 . HB   1 1 
       2721 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       2722 1 1 1 1  54 ILE HA   .  54 . HA   1 1 
       2722 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2723 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       2723 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       2724 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       2724 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2725 1 1 1 1  19 LYS HG3  .  19 . HG1  1 1 
       2725 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       2726 1 1 1 1  58 SER HG   .  58 . HG   1 1 
       2726 1 2 1 1  63 LEU HB3  .  63 . HB1  1 1 
       2727 1 1 1 1  58 SER HG   .  58 . HG   1 1 
       2727 1 2 1 1  63 LEU HB2  .  63 . HB2  1 1 
       2728 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       2728 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2729 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       2729 1 2 1 1  69 GLU HA   .  69 . HA   1 1 
       2730 1 1 1 1  68 LEU HG   .  68 . HG   1 1 
       2730 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2731 1 1 1 1  68 LEU HG   .  68 . HG   1 1 
       2731 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2732 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
       2732 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2733 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
       2733 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2734 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2734 1 2 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2735 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2735 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2736 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2736 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2737 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2737 1 2 1 1  90 LEU HA   .  90 . HA   1 1 
       2738 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2738 1 2 1 1  90 LEU HA   .  90 . HA   1 1 
       2739 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2739 1 2 1 1  94 LYS HG3  .  94 . HG1  1 1 
       2740 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2740 1 2 1 1  94 LYS HG2  .  94 . HG2  1 1 
       2741 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       2741 1 2 1 1  15 ILE HA   .  15 . HA   1 1 
       2742 1 1 1 1  92 GLU HA   .  92 . HA   1 1 
       2742 1 2 1 1  95 ARG HD3  .  95 . HD1  1 1 
       2743 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       2743 1 2 1 1  94 LYS HD2  .  94 . HD2  1 1 
       2744 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       2744 1 2 1 1  94 LYS HD3  .  94 . HD1  1 1 
       2745 1 1 1 1  94 LYS HD2  .  94 . HD2  1 1 
       2745 1 2 1 1 105 ARG HA   . 105 . HA   1 1 
       2746 1 1 1 1  94 LYS HD3  .  94 . HD1  1 1 
       2746 1 2 1 1 105 ARG HA   . 105 . HA   1 1 
       2747 1 1 1 1  94 LYS HG3  .  94 . HG1  1 1 
       2747 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       2748 1 1 1 1  93 PHE QD   .  93 . HD*  1 1 
       2748 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2749 1 1 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2749 1 2 1 1  97 ILE HG12 .  97 . HG12 1 1 
       2750 1 1 1 1  94 LYS HG3  .  94 . HG1  1 1 
       2750 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       2751 1 1 1 1  94 LYS HG2  .  94 . HG2  1 1 
       2751 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       2752 1 1 1 1  94 LYS HG2  .  94 . HG2  1 1 
       2752 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       2753 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2753 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2754 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       2754 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2755 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2755 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2756 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2756 1 2 1 1  81 LEU HG   .  81 . HG   1 1 
       2757 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2757 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2758 1 1 1 1   5 ILE HG13 .   5 . HG11 1 1 
       2758 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2759 1 1 1 1   5 ILE HG12 .   5 . HG12 1 1 
       2759 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2760 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       2760 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2761 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       2761 1 2 1 1  57 ILE HG13 .  57 . HG11 1 1 
       2762 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       2762 1 2 1 1  57 ILE HA   .  57 . HA   1 1 
       2763 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       2763 1 2 1 1 107 VAL HA   . 107 . HA   1 1 
       2764 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       2764 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2765 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       2765 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2766 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       2766 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       2767 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       2767 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       2768 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       2768 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       2769 1 1 1 1   3 GLU HB2  .   3 . HB2  1 1 
       2769 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2770 1 1 1 1   3 GLU HB3  .   3 . HB1  1 1 
       2770 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2771 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       2771 1 2 1 1  39 LYS HE2  .  39 . HE2  1 1 
       2772 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       2772 1 2 1 1  39 LYS HE3  .  39 . HE1  1 1 
       2773 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2773 1 2 1 1   6 LEU HA   .   6 . HA   1 1 
       2774 1 1 1 1   4 LEU HB2  .   4 . HB2  1 1 
       2774 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       2775 1 1 1 1   4 LEU HB3  .   4 . HB1  1 1 
       2775 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       2776 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2776 1 2 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2777 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2777 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       2778 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2778 1 2 1 1  67 MET HG3  .  67 . HG1  1 1 
       2779 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2779 1 2 1 1  71 ILE HA   .  71 . HA   1 1 
       2780 1 1 1 1  48 GLU HB3  .  48 . HB1  1 1 
       2780 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2781 1 1 1 1  48 GLU HB2  .  48 . HB2  1 1 
       2781 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2782 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
       2782 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2783 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2783 1 2 1 1  66 GLU HA   .  66 . HA   1 1 
       2784 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       2784 1 2 1 1  68 LEU HG   .  68 . HG   1 1 
       2785 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2785 1 2 1 1  67 MET HG2  .  67 . HG2  1 1 
       2786 1 1 1 1  63 LEU HB2  .  63 . HB2  1 1 
       2786 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2787 1 1 1 1  68 LEU HB2  .  68 . HB2  1 1 
       2787 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2788 1 1 1 1  80 LEU HG   .  80 . HG   1 1 
       2788 1 2 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2789 1 1 1 1  80 LEU HG   .  80 . HG   1 1 
       2789 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2790 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2790 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2791 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2791 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2792 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       2792 1 2 1 1  94 LYS HA   .  94 . HA   1 1 
       2793 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2793 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       2794 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2794 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       2795 1 1 1 1   6 LEU HB3  .   6 . HB1  1 1 
       2795 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2796 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       2796 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       2797 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2797 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       2798 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2798 1 2 1 1   7 ILE HB   .   7 . HB   1 1 
       2799 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2799 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2800 1 1 1 1   8 ASN HB3  .   8 . HB1  1 1 
       2800 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2801 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       2801 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       2802 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2802 1 2 1 1 116 ILE H    . 116 . HN   1 1 
       2803 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       2803 1 2 1 1   8 ASN HB2  .   8 . HB2  1 1 
       2804 1 1 1 1  80 LEU HA   .  80 . HA   1 1 
       2804 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2805 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       2805 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       2806 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2806 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2807 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2807 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       2808 1 1 1 1  32 VAL HB   .  32 . HB   1 1 
       2808 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       2809 1 1 1 1  56 ILE MG   .  56 . HG2* 1 1 
       2809 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       2810 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       2810 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2811 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       2811 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       2812 1 1 1 1  38 LEU H    .  38 . HN   1 1 
       2812 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       2813 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2813 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       2814 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2814 1 2 1 1  77 LYS H    .  77 . HN   1 1 
       2815 1 1 1 1  55 LEU HG   .  55 . HG   1 1 
       2815 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2816 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2816 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2817 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       2817 1 2 1 1  55 LEU HA   .  55 . HA   1 1 
       2818 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       2818 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       2819 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       2819 1 2 1 1 120 PHE HA   . 120 . HA   1 1 
       2820 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2820 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2821 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2821 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2822 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       2822 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       2823 1 1 1 1  27 TYR HA   .  27 . HA   1 1 
       2823 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2824 1 1 1 1  76 TYR HA   .  76 . HA   1 1 
       2824 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2825 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       2825 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       2826 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2826 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       2827 1 1 1 1 102 TYR HA   . 102 . HA   1 1 
       2827 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2828 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       2828 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2829 1 1 1 1   4 LEU HA   .   4 . HA   1 1 
       2829 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2830 1 1 1 1  27 TYR HA   .  27 . HA   1 1 
       2830 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       2831 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2831 1 2 1 1 121 MET HA   . 121 . HA   1 1 
       2832 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       2832 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2833 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       2833 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2834 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2834 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2835 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2835 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       2836 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       2836 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       2837 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
       2837 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       2838 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2838 1 2 1 1  53 LYS HG2  .  53 . HG2  1 1 
       2839 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2839 1 2 1 1  53 LYS HG3  .  53 . HG1  1 1 
       2840 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       2840 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2841 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2841 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       2842 1 1 1 1  51 PHE QD   .  51 . HD*  1 1 
       2842 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2843 1 1 1 1   2 LYS HG2  .   2 . HG2  1 1 
       2843 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2844 1 1 1 1   2 LYS HG3  .   2 . HG1  1 1 
       2844 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2845 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2845 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2846 1 1 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       2846 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2847 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       2847 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2848 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2848 1 2 1 1  80 LEU H    .  80 . HN   1 1 
       2849 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       2849 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2850 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       2850 1 2 1 1  79 PHE QE   .  79 . HE*  1 1 
       2851 1 1 1 1   3 GLU HB2  .   3 . HB2  1 1 
       2851 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2852 1 1 1 1 120 PHE QE   . 120 . HE*  1 1 
       2852 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       2853 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2853 1 2 1 1 105 ARG HG2  . 105 . HG2  1 1 
       2854 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2854 1 2 1 1 105 ARG HG3  . 105 . HG1  1 1 
       2855 1 1 1 1 120 PHE QE   . 120 . HE*  1 1 
       2855 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2856 1 1 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2856 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2857 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2857 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       2858 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2858 1 2 1 1 103 GLU HB3  . 103 . HB1  1 1 
       2859 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       2859 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2860 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2860 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       2861 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2861 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2862 1 1 1 1  80 LEU HG   .  80 . HG   1 1 
       2862 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2863 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       2863 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2864 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       2864 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2865 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2865 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       2866 1 1 1 1 100 GLN HB2  . 100 . HB2  1 1 
       2866 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2867 1 1 1 1 100 GLN HB3  . 100 . HB1  1 1 
       2867 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2868 1 1 1 1  78 VAL HB   .  78 . HB   1 1 
       2868 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2869 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2869 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2870 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2870 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2871 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
       2871 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       2872 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
       2872 1 2 1 1 103 GLU H    . 103 . HN   1 1 
       2873 1 1 1 1 100 GLN HB2  . 100 . HB2  1 1 
       2873 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2874 1 1 1 1 100 GLN HB3  . 100 . HB1  1 1 
       2874 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2875 1 1 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2875 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2876 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       2876 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2877 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       2877 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       2878 1 1 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       2878 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2879 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2879 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2880 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2880 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2881 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2881 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2882 1 1 1 1   4 LEU HG   .   4 . HG   1 1 
       2882 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2883 1 1 1 1   3 GLU HB2  .   3 . HB2  1 1 
       2883 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2884 1 1 1 1   5 ILE HG13 .   5 . HG11 1 1 
       2884 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       2885 1 1 1 1   5 ILE HG12 .   5 . HG12 1 1 
       2885 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       2886 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       2886 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2887 1 1 1 1  65 LYS HG2  .  65 . HG2  1 1 
       2887 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2888 1 1 1 1  82 LEU HG   .  82 . HG   1 1 
       2888 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2889 1 1 1 1  65 LYS HG3  .  65 . HG1  1 1 
       2889 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       2890 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       2890 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2891 1 1 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2891 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2892 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       2892 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2893 1 1 1 1  51 PHE QE   .  51 . HE*  1 1 
       2893 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2894 1 1 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2894 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2895 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       2895 1 2 1 1 105 ARG HB3  . 105 . HB1  1 1 
       2896 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       2896 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       2897 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2897 1 2 1 1  79 PHE HZ   .  79 . HZ   1 1 
       2898 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       2898 1 2 1 1   2 LYS QG   .   2 . HG*  1 1 
       2899 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       2899 1 2 1 1   2 LYS QD   .   2 . HD*  1 1 
       2900 1 1 1 1   2 LYS HA   .   2 . HA   1 1 
       2900 1 2 1 1   2 LYS QE   .   2 . HE*  1 1 
       2901 1 1 1 1   2 LYS QB   .   2 . HB*  1 1 
       2901 1 2 1 1   2 LYS QD   .   2 . HD*  1 1 
       2902 1 1 1 1   2 LYS QB   .   2 . HB*  1 1 
       2902 1 2 1 1   2 LYS QE   .   2 . HE*  1 1 
       2903 1 1 1 1   2 LYS QB   .   2 . HB*  1 1 
       2903 1 2 1 1  76 TYR HA   .  76 . HA   1 1 
       2904 1 1 1 1   2 LYS QB   .   2 . HB*  1 1 
       2904 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2905 1 1 1 1   2 LYS QB   .   2 . HB*  1 1 
       2905 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2906 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2906 1 2 1 1   2 LYS QG   .   2 . HG*  1 1 
       2907 1 1 1 1   2 LYS QG   .   2 . HG*  1 1 
       2907 1 2 1 1   3 GLU H    .   3 . HN   1 1 
       2908 1 1 1 1   2 LYS QG   .   2 . HG*  1 1 
       2908 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2909 1 1 1 1   2 LYS QG   .   2 . HG*  1 1 
       2909 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2910 1 1 1 1   2 LYS QG   .   2 . HG*  1 1 
       2910 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2911 1 1 1 1   2 LYS QG   .   2 . HG*  1 1 
       2911 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2912 1 1 1 1   2 LYS QD   .   2 . HD*  1 1 
       2912 1 2 1 1   3 GLU H    .   3 . HN   1 1 
       2913 1 1 1 1   2 LYS QD   .   2 . HD*  1 1 
       2913 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2914 1 1 1 1   2 LYS QD   .   2 . HD*  1 1 
       2914 1 2 1 1  51 PHE QD   .  51 . HD*  1 1 
       2915 1 1 1 1   2 LYS QD   .   2 . HD*  1 1 
       2915 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2916 1 1 1 1   2 LYS QD   .   2 . HD*  1 1 
       2916 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2917 1 1 1 1   2 LYS QD   .   2 . HD*  1 1 
       2917 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2918 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2918 1 2 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2919 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2919 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2920 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2920 1 2 1 1  51 PHE QE   .  51 . HE*  1 1 
       2921 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2921 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       2922 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2922 1 2 1 1  53 LYS HA   .  53 . HA   1 1 
       2923 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2923 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       2924 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2924 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       2925 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2925 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2926 1 1 1 1   2 LYS QE   .   2 . HE*  1 1 
       2926 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       2927 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2927 1 2 1 1   3 GLU QB   .   3 . HB*  1 1 
       2928 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2928 1 2 1 1   3 GLU QG   .   3 . HG*  1 1 
       2929 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2929 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       2930 1 1 1 1   3 GLU H    .   3 . HN   1 1 
       2930 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       2931 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2931 1 2 1 1   3 GLU QG   .   3 . HG*  1 1 
       2932 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2932 1 2 1 1   4 LEU QB   .   4 . HB*  1 1 
       2933 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2933 1 2 1 1  77 LYS QB   .  77 . HB*  1 1 
       2934 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2934 1 2 1 1  77 LYS QG   .  77 . HG*  1 1 
       2935 1 1 1 1   3 GLU HA   .   3 . HA   1 1 
       2935 1 2 1 1  77 LYS QD   .  77 . HD*  1 1 
       2936 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2936 1 2 1 1   3 GLU QG   .   3 . HG*  1 1 
       2937 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2937 1 2 1 1   4 LEU H    .   4 . HN   1 1 
       2938 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2938 1 2 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2939 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2939 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       2940 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2940 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       2941 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2941 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       2942 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2942 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       2943 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2943 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       2944 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2944 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2945 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2945 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2946 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2946 1 2 1 1 124 ALA HA   . 124 . HA   1 1 
       2947 1 1 1 1   3 GLU QB   .   3 . HB*  1 1 
       2947 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2948 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2948 1 2 1 1   4 LEU H    .   4 . HN   1 1 
       2949 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2949 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       2950 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2950 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       2951 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2951 1 2 1 1  77 LYS H    .  77 . HN   1 1 
       2952 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2952 1 2 1 1  77 LYS QB   .  77 . HB*  1 1 
       2953 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2953 1 2 1 1  77 LYS QG   .  77 . HG*  1 1 
       2954 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2954 1 2 1 1  77 LYS QD   .  77 . HD*  1 1 
       2955 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2955 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       2956 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2956 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       2957 1 1 1 1   3 GLU QG   .   3 . HG*  1 1 
       2957 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       2958 1 1 1 1   4 LEU H    .   4 . HN   1 1 
       2958 1 2 1 1   4 LEU QB   .   4 . HB*  1 1 
       2959 1 1 1 1   4 LEU H    .   4 . HN   1 1 
       2959 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       2960 1 1 1 1   4 LEU H    .   4 . HN   1 1 
       2960 1 2 1 1  77 LYS QB   .  77 . HB*  1 1 
       2961 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2961 1 2 1 1   4 LEU HG   .   4 . HG   1 1 
       2962 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2962 1 2 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2963 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2963 1 2 1 1   5 ILE H    .   5 . HN   1 1 
       2964 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2964 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       2965 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2965 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
       2966 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2966 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2967 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2967 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2968 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2968 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       2969 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2969 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       2970 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2970 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       2971 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2971 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2972 1 1 1 1   4 LEU QB   .   4 . HB*  1 1 
       2972 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       2973 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2973 1 2 1 1  56 ILE QG   .  56 . HG1* 1 1 
       2974 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2974 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       2975 1 1 1 1   4 LEU MD1  .   4 . HD1* 1 1 
       2975 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       2976 1 1 1 1   4 LEU MD2  .   4 . HD2* 1 1 
       2976 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       2977 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2977 1 2 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2978 1 1 1 1   5 ILE H    .   5 . HN   1 1 
       2978 1 2 1 1  56 ILE QG   .  56 . HG1* 1 1 
       2979 1 1 1 1   5 ILE HA   .   5 . HA   1 1 
       2979 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       2980 1 1 1 1   5 ILE HB   .   5 . HB   1 1 
       2980 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       2981 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2981 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       2982 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2982 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       2983 1 1 1 1   5 ILE MG   .   5 . HG2* 1 1 
       2983 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       2984 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2984 1 2 1 1   6 LEU H    .   6 . HN   1 1 
       2985 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2985 1 2 1 1   7 ILE QG   .   7 . HG1* 1 1 
       2986 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2986 1 2 1 1   7 ILE MD   .   7 . HD1* 1 1 
       2987 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2987 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       2988 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2988 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       2989 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2989 1 2 1 1  79 PHE QD   .  79 . HD*  1 1 
       2990 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2990 1 2 1 1  79 PHE QE   .  79 . HE*  1 1 
       2991 1 1 1 1   5 ILE QG   .   5 . HG1* 1 1 
       2991 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       2992 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2992 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       2993 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2993 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       2994 1 1 1 1   5 ILE MD   .   5 . HD1* 1 1 
       2994 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       2995 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2995 1 2 1 1   6 LEU QB   .   6 . HB*  1 1 
       2996 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2996 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       2997 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2997 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       2998 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2998 1 2 1 1   6 LEU HG   .   6 . HG   1 1 
       2999 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2999 1 2 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       3000 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3000 1 2 1 1   7 ILE H    .   7 . HN   1 1 
       3001 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3001 1 2 1 1   7 ILE HA   .   7 . HA   1 1 
       3002 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3002 1 2 1 1   8 ASN H    .   8 . HN   1 1 
       3003 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3003 1 2 1 1  56 ILE HB   .  56 . HB   1 1 
       3004 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3004 1 2 1 1  64 LEU QB   .  64 . HB*  1 1 
       3005 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3005 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       3006 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3006 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       3007 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3007 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       3008 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3008 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3009 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       3009 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       3010 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       3010 1 2 1 1  67 MET QB   .  67 . HB*  1 1 
       3011 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       3011 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3012 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       3012 1 2 1 1  64 LEU QB   .  64 . HB*  1 1 
       3013 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       3013 1 2 1 1  67 MET QB   .  67 . HB*  1 1 
       3014 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       3014 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3015 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       3015 1 2 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3016 1 1 1 1   7 ILE H    .   7 . HN   1 1 
       3016 1 2 1 1  57 ILE QG   .  57 . HG1* 1 1 
       3017 1 1 1 1   7 ILE HA   .   7 . HA   1 1 
       3017 1 2 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3018 1 1 1 1   7 ILE HB   .   7 . HB   1 1 
       3018 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       3019 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       3019 1 2 1 1   8 ASN QB   .   8 . HB*  1 1 
       3020 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       3020 1 2 1 1  57 ILE QG   .  57 . HG1* 1 1 
       3021 1 1 1 1   7 ILE MG   .   7 . HG2* 1 1 
       3021 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       3022 1 1 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3022 1 2 1 1   8 ASN H    .   8 . HN   1 1 
       3023 1 1 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3023 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3024 1 1 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3024 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       3025 1 1 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3025 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       3026 1 1 1 1   7 ILE QG   .   7 . HG1* 1 1 
       3026 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       3027 1 1 1 1   7 ILE MD   .   7 . HD1* 1 1 
       3027 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       3028 1 1 1 1   8 ASN H    .   8 . HN   1 1 
       3028 1 2 1 1   8 ASN QB   .   8 . HB*  1 1 
       3029 1 1 1 1   8 ASN H    .   8 . HN   1 1 
       3029 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       3030 1 1 1 1   8 ASN H    .   8 . HN   1 1 
       3030 1 2 1 1  82 LEU QB   .  82 . HB*  1 1 
       3031 1 1 1 1   8 ASN HA   .   8 . HA   1 1 
       3031 1 2 1 1  58 SER QB   .  58 . HB*  1 1 
       3032 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3032 1 2 1 1  58 SER H    .  58 . HN   1 1 
       3033 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3033 1 2 1 1  61 LYS QG   .  61 . HG*  1 1 
       3034 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3034 1 2 1 1  64 LEU QB   .  64 . HB*  1 1 
       3035 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3035 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
       3036 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3036 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       3037 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3037 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       3038 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3038 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       3039 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3039 1 2 1 1  82 LEU QB   .  82 . HB*  1 1 
       3040 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3040 1 2 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       3041 1 1 1 1   8 ASN QB   .   8 . HB*  1 1 
       3041 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       3042 1 1 1 1   9 THR H    .   9 . HN   1 1 
       3042 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       3043 1 1 1 1   9 THR HA   .   9 . HA   1 1 
       3043 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3044 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       3044 1 2 1 1  11 ASN QB   .  11 . HB*  1 1 
       3045 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       3045 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3046 1 1 1 1   9 THR HB   .   9 . HB   1 1 
       3046 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3047 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       3047 1 2 1 1  11 ASN QB   .  11 . HB*  1 1 
       3048 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       3048 1 2 1 1  14 LEU QB   .  14 . HB*  1 1 
       3049 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       3049 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3050 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       3050 1 2 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3051 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       3051 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3052 1 1 1 1   9 THR MG   .   9 . HG2* 1 1 
       3052 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3053 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       3053 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3054 1 1 1 1   9 THR HG1  .   9 . HG1  1 1 
       3054 1 2 1 1  83 GLN QE   .  83 . HE*  1 1 
       3055 1 1 1 1  10 ASN H    .  10 . HN   1 1 
       3055 1 2 1 1  11 ASN QB   .  11 . HB*  1 1 
       3056 1 1 1 1  10 ASN HA   .  10 . HA   1 1 
       3056 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       3057 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       3057 1 2 1 1  14 LEU QB   .  14 . HB*  1 1 
       3058 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       3058 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3059 1 1 1 1  11 ASN H    .  11 . HN   1 1 
       3059 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3060 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3060 1 2 1 1  13 GLU QB   .  13 . HB*  1 1 
       3061 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3061 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       3062 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3062 1 2 1 1  14 LEU QB   .  14 . HB*  1 1 
       3063 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3063 1 2 1 1  14 LEU HG   .  14 . HG   1 1 
       3064 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3064 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       3065 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3065 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       3066 1 1 1 1  11 ASN QB   .  11 . HB*  1 1 
       3066 1 2 1 1  83 GLN QE   .  83 . HE*  1 1 
       3067 1 1 1 1  12 ASP H    .  12 . HN   1 1 
       3067 1 2 1 1  12 ASP QB   .  12 . HB*  1 1 
       3068 1 1 1 1  12 ASP H    .  12 . HN   1 1 
       3068 1 2 1 1  13 GLU QB   .  13 . HB*  1 1 
       3069 1 1 1 1  12 ASP H    .  12 . HN   1 1 
       3069 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       3070 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       3070 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3071 1 1 1 1  12 ASP HA   .  12 . HA   1 1 
       3071 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3072 1 1 1 1  12 ASP QB   .  12 . HB*  1 1 
       3072 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       3073 1 1 1 1  12 ASP QB   .  12 . HB*  1 1 
       3073 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       3074 1 1 1 1  12 ASP QB   .  12 . HB*  1 1 
       3074 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       3075 1 1 1 1  12 ASP QB   .  12 . HB*  1 1 
       3075 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       3076 1 1 1 1  12 ASP QB   .  12 . HB*  1 1 
       3076 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       3077 1 1 1 1  12 ASP QB   .  12 . HB*  1 1 
       3077 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       3078 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       3078 1 2 1 1  14 LEU QB   .  14 . HB*  1 1 
       3079 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       3079 1 2 1 1  13 GLU QB   .  13 . HB*  1 1 
       3080 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       3080 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       3081 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       3081 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       3082 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       3082 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3083 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       3083 1 2 1 1  16 LYS QE   .  16 . HE*  1 1 
       3084 1 1 1 1  13 GLU QB   .  13 . HB*  1 1 
       3084 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       3085 1 1 1 1  13 GLU QB   .  13 . HB*  1 1 
       3085 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       3086 1 1 1 1  13 GLU QG   .  13 . HG*  1 1 
       3086 1 2 1 1  14 LEU H    .  14 . HN   1 1 
       3087 1 1 1 1  14 LEU H    .  14 . HN   1 1 
       3087 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3088 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       3088 1 2 1 1  17 LYS QB   .  17 . HB*  1 1 
       3089 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       3089 1 2 1 1  17 LYS QG   .  17 . HG*  1 1 
       3090 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       3090 1 2 1 1  17 LYS QE   .  17 . HE*  1 1 
       3091 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
       3091 1 2 1 1 110 ASP QB   . 110 . HB*  1 1 
       3092 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
       3092 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       3093 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
       3093 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       3094 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
       3094 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       3095 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
       3095 1 2 1 1 110 ASP QB   . 110 . HB*  1 1 
       3096 1 1 1 1  14 LEU HG   .  14 . HG   1 1 
       3096 1 2 1 1 110 ASP QB   . 110 . HB*  1 1 
       3097 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       3097 1 2 1 1  17 LYS QG   .  17 . HG*  1 1 
       3098 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       3098 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3099 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       3099 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3100 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
       3100 1 2 1 1 110 ASP QB   . 110 . HB*  1 1 
       3101 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       3101 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3102 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
       3102 1 2 1 1  83 GLN QE   .  83 . HE*  1 1 
       3103 1 1 1 1  15 ILE H    .  15 . HN   1 1 
       3103 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3104 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       3104 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3105 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       3105 1 2 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3106 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       3106 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3107 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       3107 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3108 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       3108 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3109 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       3109 1 2 1 1  19 LYS QE   .  19 . HE*  1 1 
       3110 1 1 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3110 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3111 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3111 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3112 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3112 1 2 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3113 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3113 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3114 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3114 1 2 1 1  19 LYS QD   .  19 . HD*  1 1 
       3115 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3115 1 2 1 1  19 LYS QE   .  19 . HE*  1 1 
       3116 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       3116 1 2 1 1  57 ILE QG   .  57 . HG1* 1 1 
       3117 1 1 1 1  15 ILE QG   .  15 . HG1* 1 1 
       3117 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       3118 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       3118 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       3119 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       3119 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       3120 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       3120 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3121 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       3121 1 2 1 1  16 LYS QD   .  16 . HD*  1 1 
       3122 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       3122 1 2 1 1  16 LYS QE   .  16 . HE*  1 1 
       3123 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3123 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       3124 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3124 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3125 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3125 1 2 1 1  16 LYS QD   .  16 . HD*  1 1 
       3126 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3126 1 2 1 1  19 LYS QB   .  19 . HB*  1 1 
       3127 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3127 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3128 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3128 1 2 1 1  19 LYS QD   .  19 . HD*  1 1 
       3129 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       3129 1 2 1 1  16 LYS QD   .  16 . HD*  1 1 
       3130 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       3130 1 2 1 1  16 LYS QE   .  16 . HE*  1 1 
       3131 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       3131 1 2 1 1  17 LYS H    .  17 . HN   1 1 
       3132 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       3132 1 2 1 1  17 LYS QG   .  17 . HG*  1 1 
       3133 1 1 1 1  16 LYS QE   .  16 . HE*  1 1 
       3133 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       3134 1 1 1 1  17 LYS H    .  17 . HN   1 1 
       3134 1 2 1 1  17 LYS QB   .  17 . HB*  1 1 
       3135 1 1 1 1  17 LYS H    .  17 . HN   1 1 
       3135 1 2 1 1  17 LYS QG   .  17 . HG*  1 1 
       3136 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       3136 1 2 1 1  17 LYS QG   .  17 . HG*  1 1 
       3137 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       3137 1 2 1 1  17 LYS QD   .  17 . HD*  1 1 
       3138 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       3138 1 2 1 1  17 LYS QE   .  17 . HE*  1 1 
       3139 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       3139 1 2 1 1  20 LYS QB   .  20 . HB*  1 1 
       3140 1 1 1 1  17 LYS HA   .  17 . HA   1 1 
       3140 1 2 1 1  20 LYS QG   .  20 . HG*  1 1 
       3141 1 1 1 1  17 LYS QB   .  17 . HB*  1 1 
       3141 1 2 1 1  17 LYS QD   .  17 . HD*  1 1 
       3142 1 1 1 1  17 LYS QB   .  17 . HB*  1 1 
       3142 1 2 1 1  17 LYS QE   .  17 . HE*  1 1 
       3143 1 1 1 1  17 LYS QB   .  17 . HB*  1 1 
       3143 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       3144 1 1 1 1  17 LYS QB   .  17 . HB*  1 1 
       3144 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       3145 1 1 1 1  17 LYS QE   .  17 . HE*  1 1 
       3145 1 2 1 1  17 LYS QG   .  17 . HG*  1 1 
       3146 1 1 1 1  17 LYS QG   .  17 . HG*  1 1 
       3146 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       3147 1 1 1 1  17 LYS QG   .  17 . HG*  1 1 
       3147 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       3148 1 1 1 1  17 LYS QG   .  17 . HG*  1 1 
       3148 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       3149 1 1 1 1  17 LYS QD   .  17 . HD*  1 1 
       3149 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       3150 1 1 1 1  17 LYS QD   .  17 . HD*  1 1 
       3150 1 2 1 1 110 ASP QB   . 110 . HB*  1 1 
       3151 1 1 1 1  17 LYS QD   .  17 . HD*  1 1 
       3151 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       3152 1 1 1 1  17 LYS QD   .  17 . HD*  1 1 
       3152 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       3153 1 1 1 1  17 LYS QE   .  17 . HE*  1 1 
       3153 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       3154 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       3154 1 2 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3155 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       3155 1 2 1 1  20 LYS QG   .  20 . HG*  1 1 
       3156 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       3156 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3157 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3157 1 2 1 1  21 GLU QB   .  21 . HB*  1 1 
       3158 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3158 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3159 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3159 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
       3160 1 1 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3160 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3161 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3161 1 2 1 1  21 GLU QB   .  21 . HB*  1 1 
       3162 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3162 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3163 1 1 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3163 1 2 1 1  19 LYS H    .  19 . HN   1 1 
       3164 1 1 1 1  18 ILE QG   .  18 . HG1* 1 1 
       3164 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3165 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       3165 1 2 1 1  19 LYS QB   .  19 . HB*  1 1 
       3166 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       3166 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3167 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       3167 1 2 1 1  19 LYS QD   .  19 . HD*  1 1 
       3168 1 1 1 1  19 LYS H    .  19 . HN   1 1 
       3168 1 2 1 1  19 LYS QE   .  19 . HE*  1 1 
       3169 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       3169 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3170 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       3170 1 2 1 1  19 LYS QD   .  19 . HD*  1 1 
       3171 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       3171 1 2 1 1  19 LYS QE   .  19 . HE*  1 1 
       3172 1 1 1 1  19 LYS HA   .  19 . HA   1 1 
       3172 1 2 1 1  23 GLU QG   .  23 . HG*  1 1 
       3173 1 1 1 1  19 LYS QB   .  19 . HB*  1 1 
       3173 1 2 1 1  19 LYS QD   .  19 . HD*  1 1 
       3174 1 1 1 1  19 LYS QB   .  19 . HB*  1 1 
       3174 1 2 1 1  19 LYS QE   .  19 . HE*  1 1 
       3175 1 1 1 1  19 LYS QB   .  19 . HB*  1 1 
       3175 1 2 1 1  20 LYS H    .  20 . HN   1 1 
       3176 1 1 1 1  19 LYS QB   .  19 . HB*  1 1 
       3176 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       3177 1 1 1 1  19 LYS QB   .  19 . HB*  1 1 
       3177 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3178 1 1 1 1  19 LYS QE   .  19 . HE*  1 1 
       3178 1 2 1 1  19 LYS QG   .  19 . HG*  1 1 
       3179 1 1 1 1  19 LYS QG   .  19 . HG*  1 1 
       3179 1 2 1 1  20 LYS H    .  20 . HN   1 1 
       3180 1 1 1 1  19 LYS QG   .  19 . HG*  1 1 
       3180 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       3181 1 1 1 1  19 LYS QG   .  19 . HG*  1 1 
       3181 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3182 1 1 1 1  19 LYS QG   .  19 . HG*  1 1 
       3182 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       3183 1 1 1 1  19 LYS QD   .  19 . HD*  1 1 
       3183 1 2 1 1  20 LYS H    .  20 . HN   1 1 
       3184 1 1 1 1  19 LYS QD   .  19 . HD*  1 1 
       3184 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       3185 1 1 1 1  19 LYS QD   .  19 . HD*  1 1 
       3185 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       3186 1 1 1 1  19 LYS QE   .  19 . HE*  1 1 
       3186 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       3187 1 1 1 1  19 LYS QE   .  19 . HE*  1 1 
       3187 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       3188 1 1 1 1  20 LYS H    .  20 . HN   1 1 
       3188 1 2 1 1  20 LYS QB   .  20 . HB*  1 1 
       3189 1 1 1 1  20 LYS H    .  20 . HN   1 1 
       3189 1 2 1 1  20 LYS QG   .  20 . HG*  1 1 
       3190 1 1 1 1  20 LYS H    .  20 . HN   1 1 
       3190 1 2 1 1  20 LYS QD   .  20 . HD*  1 1 
       3191 1 1 1 1  20 LYS H    .  20 . HN   1 1 
       3191 1 2 1 1  21 GLU QB   .  21 . HB*  1 1 
       3192 1 1 1 1  20 LYS H    .  20 . HN   1 1 
       3192 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3193 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       3193 1 2 1 1  20 LYS QB   .  20 . HB*  1 1 
       3194 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       3194 1 2 1 1  20 LYS QG   .  20 . HG*  1 1 
       3195 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       3195 1 2 1 1  20 LYS QD   .  20 . HD*  1 1 
       3196 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       3196 1 2 1 1  20 LYS QE   .  20 . HE*  1 1 
       3197 1 1 1 1  20 LYS HA   .  20 . HA   1 1 
       3197 1 2 1 1  23 GLU QB   .  23 . HB*  1 1 
       3198 1 1 1 1  20 LYS QB   .  20 . HB*  1 1 
       3198 1 2 1 1  20 LYS QD   .  20 . HD*  1 1 
       3199 1 1 1 1  20 LYS QB   .  20 . HB*  1 1 
       3199 1 2 1 1  20 LYS QE   .  20 . HE*  1 1 
       3200 1 1 1 1  20 LYS QB   .  20 . HB*  1 1 
       3200 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       3201 1 1 1 1  20 LYS QB   .  20 . HB*  1 1 
       3201 1 2 1 1  21 GLU HA   .  21 . HA   1 1 
       3202 1 1 1 1  20 LYS QD   .  20 . HD*  1 1 
       3202 1 2 1 1  20 LYS QG   .  20 . HG*  1 1 
       3203 1 1 1 1  20 LYS QE   .  20 . HE*  1 1 
       3203 1 2 1 1  20 LYS QG   .  20 . HG*  1 1 
       3204 1 1 1 1  20 LYS QG   .  20 . HG*  1 1 
       3204 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       3205 1 1 1 1  20 LYS QG   .  20 . HG*  1 1 
       3205 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3206 1 1 1 1  20 LYS QD   .  20 . HD*  1 1 
       3206 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       3207 1 1 1 1  21 GLU H    .  21 . HN   1 1 
       3207 1 2 1 1  21 GLU QB   .  21 . HB*  1 1 
       3208 1 1 1 1  21 GLU H    .  21 . HN   1 1 
       3208 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3209 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       3209 1 2 1 1  21 GLU QB   .  21 . HB*  1 1 
       3210 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       3210 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       3211 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       3211 1 2 1 1  24 ASN QB   .  24 . HB*  1 1 
       3212 1 1 1 1  21 GLU QB   .  21 . HB*  1 1 
       3212 1 2 1 1  22 VAL HA   .  22 . HA   1 1 
       3213 1 1 1 1  21 GLU QB   .  21 . HB*  1 1 
       3213 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3214 1 1 1 1  21 GLU QB   .  21 . HB*  1 1 
       3214 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3215 1 1 1 1  21 GLU QB   .  21 . HB*  1 1 
       3215 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       3216 1 1 1 1  21 GLU QB   .  21 . HB*  1 1 
       3216 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       3217 1 1 1 1  21 GLU QB   .  21 . HB*  1 1 
       3217 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       3218 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       3218 1 2 1 1  22 VAL H    .  22 . HN   1 1 
       3219 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       3219 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       3220 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       3220 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       3221 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       3221 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       3222 1 1 1 1  22 VAL H    .  22 . HN   1 1 
       3222 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3223 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       3223 1 2 1 1  25 GLN QB   .  25 . HB*  1 1 
       3224 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       3224 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3225 1 1 1 1  22 VAL HA   .  22 . HA   1 1 
       3225 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3226 1 1 1 1  22 VAL HB   .  22 . HB   1 1 
       3226 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3227 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       3227 1 2 1 1  23 GLU QG   .  23 . HG*  1 1 
       3228 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       3228 1 2 1 1  25 GLN QB   .  25 . HB*  1 1 
       3229 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       3229 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3230 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       3230 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3231 1 1 1 1  22 VAL MG1  .  22 . HG1* 1 1 
       3231 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3232 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       3232 1 2 1 1  23 GLU QG   .  23 . HG*  1 1 
       3233 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       3233 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3234 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       3234 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3235 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       3235 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3236 1 1 1 1  22 VAL MG2  .  22 . HG2* 1 1 
       3236 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3237 1 1 1 1  23 GLU H    .  23 . HN   1 1 
       3237 1 2 1 1  23 GLU QB   .  23 . HB*  1 1 
       3238 1 1 1 1  23 GLU H    .  23 . HN   1 1 
       3238 1 2 1 1  23 GLU QG   .  23 . HG*  1 1 
       3239 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
       3239 1 2 1 1  23 GLU QG   .  23 . HG*  1 1 
       3240 1 1 1 1  23 GLU HA   .  23 . HA   1 1 
       3240 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3241 1 1 1 1  23 GLU QB   .  23 . HB*  1 1 
       3241 1 2 1 1  24 ASN H    .  24 . HN   1 1 
       3242 1 1 1 1  23 GLU QB   .  23 . HB*  1 1 
       3242 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3243 1 1 1 1  24 ASN H    .  24 . HN   1 1 
       3243 1 2 1 1  24 ASN QB   .  24 . HB*  1 1 
       3244 1 1 1 1  24 ASN QB   .  24 . HB*  1 1 
       3244 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3245 1 1 1 1  24 ASN QB   .  24 . HB*  1 1 
       3245 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3246 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       3246 1 2 1 1  25 GLN QB   .  25 . HB*  1 1 
       3247 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       3247 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3248 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       3248 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3249 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       3249 1 2 1 1  26 GLY QA   .  26 . HA*  1 1 
       3250 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       3250 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3251 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       3251 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3252 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3252 1 2 1 1  25 GLN QE   .  25 . HE*  1 1 
       3253 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3253 1 2 1 1  26 GLY H    .  26 . HN   1 1 
       3254 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3254 1 2 1 1  26 GLY QA   .  26 . HA*  1 1 
       3255 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3255 1 2 1 1  27 TYR H    .  27 . HN   1 1 
       3256 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3256 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       3257 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3257 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       3258 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3258 1 2 1 1 121 MET QB   . 121 . HB*  1 1 
       3259 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3259 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       3260 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
       3260 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       3261 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3261 1 2 1 1  25 GLN QG   .  25 . HG*  1 1 
       3262 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3262 1 2 1 1  26 GLY H    .  26 . HN   1 1 
       3263 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3263 1 2 1 1  27 TYR QD   .  27 . HD*  1 1 
       3264 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3264 1 2 1 1  27 TYR QE   .  27 . HE*  1 1 
       3265 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3265 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3266 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3266 1 2 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       3267 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3267 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       3268 1 1 1 1  25 GLN QG   .  25 . HG*  1 1 
       3268 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       3269 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3269 1 2 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       3270 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3270 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       3271 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3271 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       3272 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3272 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       3273 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3273 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       3274 1 1 1 1  25 GLN QE   .  25 . HE*  1 1 
       3274 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       3275 1 1 1 1  26 GLY H    .  26 . HN   1 1 
       3275 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3276 1 1 1 1  26 GLY QA   .  26 . HA*  1 1 
       3276 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3277 1 1 1 1  27 TYR H    .  27 . HN   1 1 
       3277 1 2 1 1  27 TYR QB   .  27 . HB*  1 1 
       3278 1 1 1 1  27 TYR QB   .  27 . HB*  1 1 
       3278 1 2 1 1  28 GLN H    .  28 . HN   1 1 
       3279 1 1 1 1  27 TYR QB   .  27 . HB*  1 1 
       3279 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3280 1 1 1 1  27 TYR QB   .  27 . HB*  1 1 
       3280 1 2 1 1  55 LEU H    .  55 . HN   1 1 
       3281 1 1 1 1  27 TYR QB   .  27 . HB*  1 1 
       3281 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3282 1 1 1 1  27 TYR QB   .  27 . HB*  1 1 
       3282 1 2 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       3283 1 1 1 1  27 TYR QB   .  27 . HB*  1 1 
       3283 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       3284 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       3284 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       3285 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       3285 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3286 1 1 1 1  27 TYR QD   .  27 . HD*  1 1 
       3286 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3287 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3287 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       3288 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3288 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3289 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3289 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       3290 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3290 1 2 1 1  53 LYS QE   .  53 . HE*  1 1 
       3291 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3291 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3292 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3292 1 2 1 1 121 MET QB   . 121 . HB*  1 1 
       3293 1 1 1 1  27 TYR QE   .  27 . HE*  1 1 
       3293 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       3294 1 1 1 1  28 GLN H    .  28 . HN   1 1 
       3294 1 2 1 1  28 GLN QB   .  28 . HB*  1 1 
       3295 1 1 1 1  28 GLN H    .  28 . HN   1 1 
       3295 1 2 1 1  28 GLN QG   .  28 . HG*  1 1 
       3296 1 1 1 1  28 GLN H    .  28 . HN   1 1 
       3296 1 2 1 1  54 ILE QG   .  54 . HG1* 1 1 
       3297 1 1 1 1  28 GLN HA   .  28 . HA   1 1 
       3297 1 2 1 1  28 GLN QG   .  28 . HG*  1 1 
       3298 1 1 1 1  28 GLN QB   .  28 . HB*  1 1 
       3298 1 2 1 1  29 VAL H    .  29 . HN   1 1 
       3299 1 1 1 1  28 GLN QB   .  28 . HB*  1 1 
       3299 1 2 1 1  54 ILE HA   .  54 . HA   1 1 
       3300 1 1 1 1  28 GLN QB   .  28 . HB*  1 1 
       3300 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3301 1 1 1 1  28 GLN QB   .  28 . HB*  1 1 
       3301 1 2 1 1  54 ILE QG   .  54 . HG1* 1 1 
       3302 1 1 1 1  28 GLN QB   .  28 . HB*  1 1 
       3302 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3303 1 1 1 1  28 GLN QB   .  28 . HB*  1 1 
       3303 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       3304 1 1 1 1  28 GLN QE   .  28 . HE*  1 1 
       3304 1 2 1 1  28 GLN QG   .  28 . HG*  1 1 
       3305 1 1 1 1  28 GLN QG   .  28 . HG*  1 1 
       3305 1 2 1 1  29 VAL H    .  29 . HN   1 1 
       3306 1 1 1 1  28 GLN QG   .  28 . HG*  1 1 
       3306 1 2 1 1  51 PHE QB   .  51 . HB*  1 1 
       3307 1 1 1 1  28 GLN QG   .  28 . HG*  1 1 
       3307 1 2 1 1  54 ILE HA   .  54 . HA   1 1 
       3308 1 1 1 1  28 GLN QG   .  28 . HG*  1 1 
       3308 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3309 1 1 1 1  28 GLN QG   .  28 . HG*  1 1 
       3309 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3310 1 1 1 1  28 GLN QE   .  28 . HE*  1 1 
       3310 1 2 1 1  52 GLU QB   .  52 . HB*  1 1 
       3311 1 1 1 1  28 GLN QE   .  28 . HE*  1 1 
       3311 1 2 1 1  52 GLU QG   .  52 . HG*  1 1 
       3312 1 1 1 1  28 GLN QE   .  28 . HE*  1 1 
       3312 1 2 1 1  54 ILE HA   .  54 . HA   1 1 
       3313 1 1 1 1  28 GLN QE   .  28 . HE*  1 1 
       3313 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3314 1 1 1 1  28 GLN QE   .  28 . HE*  1 1 
       3314 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3315 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       3315 1 2 1 1  30 ARG QG   .  30 . HG*  1 1 
       3316 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       3316 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3317 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       3317 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3318 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
       3318 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3319 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3319 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3320 1 1 1 1  30 ARG H    .  30 . HN   1 1 
       3320 1 2 1 1  30 ARG QB   .  30 . HB*  1 1 
       3321 1 1 1 1  30 ARG H    .  30 . HN   1 1 
       3321 1 2 1 1  30 ARG QG   .  30 . HG*  1 1 
       3322 1 1 1 1  30 ARG HA   .  30 . HA   1 1 
       3322 1 2 1 1  30 ARG QD   .  30 . HD*  1 1 
       3323 1 1 1 1  30 ARG HA   .  30 . HA   1 1 
       3323 1 2 1 1  31 ASP QB   .  31 . HB*  1 1 
       3324 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3324 1 2 1 1  30 ARG QD   .  30 . HD*  1 1 
       3325 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3325 1 2 1 1  31 ASP H    .  31 . HN   1 1 
       3326 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3326 1 2 1 1  31 ASP QB   .  31 . HB*  1 1 
       3327 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3327 1 2 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       3328 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3328 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
       3329 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3329 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3330 1 1 1 1  30 ARG QB   .  30 . HB*  1 1 
       3330 1 2 1 1  55 LEU MD2  .  55 . HD2* 1 1 
       3331 1 1 1 1  30 ARG QG   .  30 . HG*  1 1 
       3331 1 2 1 1  31 ASP H    .  31 . HN   1 1 
       3332 1 1 1 1  30 ARG QG   .  30 . HG*  1 1 
       3332 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3333 1 1 1 1  30 ARG QG   .  30 . HG*  1 1 
       3333 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       3334 1 1 1 1  30 ARG QD   .  30 . HD*  1 1 
       3334 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3335 1 1 1 1  30 ARG QD   .  30 . HD*  1 1 
       3335 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3336 1 1 1 1  30 ARG QD   .  30 . HD*  1 1 
       3336 1 2 1 1  56 ILE QG   .  56 . HG1* 1 1 
       3337 1 1 1 1  31 ASP H    .  31 . HN   1 1 
       3337 1 2 1 1  31 ASP QB   .  31 . HB*  1 1 
       3338 1 1 1 1  31 ASP QB   .  31 . HB*  1 1 
       3338 1 2 1 1  32 VAL H    .  32 . HN   1 1 
       3339 1 1 1 1  31 ASP QB   .  31 . HB*  1 1 
       3339 1 2 1 1  32 VAL HA   .  32 . HA   1 1 
       3340 1 1 1 1  31 ASP QB   .  31 . HB*  1 1 
       3340 1 2 1 1  57 ILE HB   .  57 . HB   1 1 
       3341 1 1 1 1  31 ASP QB   .  31 . HB*  1 1 
       3341 1 2 1 1  57 ILE MG   .  57 . HG2* 1 1 
       3342 1 1 1 1  31 ASP QB   .  31 . HB*  1 1 
       3342 1 2 1 1  57 ILE MD   .  57 . HD1* 1 1 
       3343 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       3343 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3344 1 1 1 1  32 VAL H    .  32 . HN   1 1 
       3344 1 2 1 1  58 SER QB   .  58 . HB*  1 1 
       3345 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       3345 1 2 1 1  33 ASN QB   .  33 . HB*  1 1 
       3346 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       3346 1 2 1 1  34 ASP QB   .  34 . HB*  1 1 
       3347 1 1 1 1  32 VAL HA   .  32 . HA   1 1 
       3347 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3348 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       3348 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3349 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       3349 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3350 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       3350 1 2 1 1  38 LEU QB   .  38 . HB*  1 1 
       3351 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       3351 1 2 1 1  41 GLU QB   .  41 . HB*  1 1 
       3352 1 1 1 1  32 VAL MG1  .  32 . HG1* 1 1 
       3352 1 2 1 1  58 SER QB   .  58 . HB*  1 1 
       3353 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       3353 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3354 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       3354 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3355 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       3355 1 2 1 1  41 GLU QB   .  41 . HB*  1 1 
       3356 1 1 1 1  32 VAL MG2  .  32 . HG2* 1 1 
       3356 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
       3357 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       3357 1 2 1 1  33 ASN QB   .  33 . HB*  1 1 
       3358 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       3358 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3359 1 1 1 1  33 ASN H    .  33 . HN   1 1 
       3359 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3360 1 1 1 1  33 ASN HA   .  33 . HA   1 1 
       3360 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       3361 1 1 1 1  33 ASN QB   .  33 . HB*  1 1 
       3361 1 2 1 1  34 ASP H    .  34 . HN   1 1 
       3362 1 1 1 1  33 ASN QB   .  33 . HB*  1 1 
       3362 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3363 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       3363 1 2 1 1  34 ASP QB   .  34 . HB*  1 1 
       3364 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       3364 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3365 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       3365 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3366 1 1 1 1  34 ASP H    .  34 . HN   1 1 
       3366 1 2 1 1  38 LEU QB   .  38 . HB*  1 1 
       3367 1 1 1 1  34 ASP QB   .  34 . HB*  1 1 
       3367 1 2 1 1  35 SER H    .  35 . HN   1 1 
       3368 1 1 1 1  34 ASP QB   .  34 . HB*  1 1 
       3368 1 2 1 1  36 ASP H    .  36 . HN   1 1 
       3369 1 1 1 1  34 ASP QB   .  34 . HB*  1 1 
       3369 1 2 1 1  37 GLU H    .  37 . HN   1 1 
       3370 1 1 1 1  34 ASP QB   .  34 . HB*  1 1 
       3370 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3371 1 1 1 1  34 ASP QB   .  34 . HB*  1 1 
       3371 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       3372 1 1 1 1  35 SER HA   .  35 . HA   1 1 
       3372 1 2 1 1  38 LEU QB   .  38 . HB*  1 1 
       3373 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3373 1 2 1 1  36 ASP H    .  36 . HN   1 1 
       3374 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3374 1 2 1 1  38 LEU QB   .  38 . HB*  1 1 
       3375 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3375 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3376 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3376 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       3377 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3377 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3378 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3378 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       3379 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3379 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       3380 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3380 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       3381 1 1 1 1  35 SER QB   .  35 . HB*  1 1 
       3381 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       3382 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       3382 1 2 1 1  36 ASP QB   .  36 . HB*  1 1 
       3383 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       3383 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3384 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       3384 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3385 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       3385 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3386 1 1 1 1  36 ASP H    .  36 . HN   1 1 
       3386 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       3387 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       3387 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       3388 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       3388 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3389 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       3389 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       3390 1 1 1 1  36 ASP HA   .  36 . HA   1 1 
       3390 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       3391 1 1 1 1  36 ASP QB   .  36 . HB*  1 1 
       3391 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       3392 1 1 1 1  36 ASP QB   .  36 . HB*  1 1 
       3392 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       3393 1 1 1 1  37 GLU H    .  37 . HN   1 1 
       3393 1 2 1 1  37 GLU QB   .  37 . HB*  1 1 
       3394 1 1 1 1  37 GLU H    .  37 . HN   1 1 
       3394 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3395 1 1 1 1  37 GLU H    .  37 . HN   1 1 
       3395 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3396 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
       3396 1 2 1 1  37 GLU QG   .  37 . HG*  1 1 
       3397 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
       3397 1 2 1 1  40 LYS QB   .  40 . HB*  1 1 
       3398 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
       3398 1 2 1 1  40 LYS QG   .  40 . HG*  1 1 
       3399 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
       3399 1 2 1 1  40 LYS QD   .  40 . HD*  1 1 
       3400 1 1 1 1  37 GLU HA   .  37 . HA   1 1 
       3400 1 2 1 1  40 LYS QE   .  40 . HE*  1 1 
       3401 1 1 1 1  37 GLU QB   .  37 . HB*  1 1 
       3401 1 2 1 1  38 LEU H    .  38 . HN   1 1 
       3402 1 1 1 1  37 GLU QB   .  37 . HB*  1 1 
       3402 1 2 1 1  40 LYS QG   .  40 . HG*  1 1 
       3403 1 1 1 1  37 GLU QB   .  37 . HB*  1 1 
       3403 1 2 1 1  40 LYS QD   .  40 . HD*  1 1 
       3404 1 1 1 1  37 GLU QB   .  37 . HB*  1 1 
       3404 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3405 1 1 1 1  37 GLU QG   .  37 . HG*  1 1 
       3405 1 2 1 1  38 LEU H    .  38 . HN   1 1 
       3406 1 1 1 1  37 GLU QG   .  37 . HG*  1 1 
       3406 1 2 1 1  38 LEU QB   .  38 . HB*  1 1 
       3407 1 1 1 1  37 GLU QG   .  37 . HG*  1 1 
       3407 1 2 1 1  40 LYS QD   .  40 . HD*  1 1 
       3408 1 1 1 1  38 LEU H    .  38 . HN   1 1 
       3408 1 2 1 1  38 LEU QB   .  38 . HB*  1 1 
       3409 1 1 1 1  38 LEU H    .  38 . HN   1 1 
       3409 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3410 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
       3410 1 2 1 1  41 GLU QB   .  41 . HB*  1 1 
       3411 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
       3411 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
       3412 1 1 1 1  38 LEU HA   .  38 . HA   1 1 
       3412 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3413 1 1 1 1  38 LEU QB   .  38 . HB*  1 1 
       3413 1 2 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3414 1 1 1 1  38 LEU QB   .  38 . HB*  1 1 
       3414 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       3415 1 1 1 1  38 LEU QB   .  38 . HB*  1 1 
       3415 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3416 1 1 1 1  38 LEU QB   .  38 . HB*  1 1 
       3416 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3417 1 1 1 1  38 LEU QB   .  38 . HB*  1 1 
       3417 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       3418 1 1 1 1  38 LEU HG   .  38 . HG   1 1 
       3418 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3419 1 1 1 1  38 LEU HG   .  38 . HG   1 1 
       3419 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3420 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3420 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       3421 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3421 1 2 1 1  42 MET QB   .  42 . HB*  1 1 
       3422 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3422 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3423 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3423 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3424 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3424 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       3425 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3425 1 2 1 1  67 MET QB   .  67 . HB*  1 1 
       3426 1 1 1 1  38 LEU MD1  .  38 . HD1* 1 1 
       3426 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3427 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3427 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       3428 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3428 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       3429 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3429 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3430 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3430 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       3431 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3431 1 2 1 1  67 MET QB   .  67 . HB*  1 1 
       3432 1 1 1 1  38 LEU MD2  .  38 . HD2* 1 1 
       3432 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3433 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       3433 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       3434 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       3434 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3435 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       3435 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       3436 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       3436 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       3437 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       3437 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3438 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       3438 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3439 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       3439 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       3440 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       3440 1 2 1 1  42 MET QB   .  42 . HB*  1 1 
       3441 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       3441 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3442 1 1 1 1  39 LYS QB   .  39 . HB*  1 1 
       3442 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3443 1 1 1 1  39 LYS QB   .  39 . HB*  1 1 
       3443 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       3444 1 1 1 1  39 LYS QB   .  39 . HB*  1 1 
       3444 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       3445 1 1 1 1  39 LYS QD   .  39 . HD*  1 1 
       3445 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3446 1 1 1 1  39 LYS QE   .  39 . HE*  1 1 
       3446 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       3447 1 1 1 1  39 LYS QG   .  39 . HG*  1 1 
       3447 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       3448 1 1 1 1  39 LYS QG   .  39 . HG*  1 1 
       3448 1 2 1 1  40 LYS HA   .  40 . HA   1 1 
       3449 1 1 1 1  39 LYS QG   .  39 . HG*  1 1 
       3449 1 2 1 1  40 LYS QB   .  40 . HB*  1 1 
       3450 1 1 1 1  39 LYS QG   .  39 . HG*  1 1 
       3450 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       3451 1 1 1 1  39 LYS QG   .  39 . HG*  1 1 
       3451 1 2 1 1  42 MET H    .  42 . HN   1 1 
       3452 1 1 1 1  39 LYS QD   .  39 . HD*  1 1 
       3452 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       3453 1 1 1 1  39 LYS QE   .  39 . HE*  1 1 
       3453 1 2 1 1  40 LYS H    .  40 . HN   1 1 
       3454 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       3454 1 2 1 1  40 LYS QB   .  40 . HB*  1 1 
       3455 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       3455 1 2 1 1  40 LYS QG   .  40 . HG*  1 1 
       3456 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       3456 1 2 1 1  40 LYS QD   .  40 . HD*  1 1 
       3457 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       3457 1 2 1 1  40 LYS QE   .  40 . HE*  1 1 
       3458 1 1 1 1  40 LYS H    .  40 . HN   1 1 
       3458 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3459 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       3459 1 2 1 1  40 LYS QB   .  40 . HB*  1 1 
       3460 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       3460 1 2 1 1  40 LYS QG   .  40 . HG*  1 1 
       3461 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       3461 1 2 1 1  40 LYS QE   .  40 . HE*  1 1 
       3462 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       3462 1 2 1 1  43 LYS QB   .  43 . HB*  1 1 
       3463 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       3463 1 2 1 1  43 LYS QG   .  43 . HG*  1 1 
       3464 1 1 1 1  40 LYS HA   .  40 . HA   1 1 
       3464 1 2 1 1  43 LYS QD   .  43 . HD*  1 1 
       3465 1 1 1 1  40 LYS QB   .  40 . HB*  1 1 
       3465 1 2 1 1  40 LYS QD   .  40 . HD*  1 1 
       3466 1 1 1 1  40 LYS QB   .  40 . HB*  1 1 
       3466 1 2 1 1  40 LYS QE   .  40 . HE*  1 1 
       3467 1 1 1 1  40 LYS QB   .  40 . HB*  1 1 
       3467 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       3468 1 1 1 1  40 LYS QD   .  40 . HD*  1 1 
       3468 1 2 1 1  40 LYS QG   .  40 . HG*  1 1 
       3469 1 1 1 1  40 LYS QE   .  40 . HE*  1 1 
       3469 1 2 1 1  40 LYS QG   .  40 . HG*  1 1 
       3470 1 1 1 1  40 LYS QG   .  40 . HG*  1 1 
       3470 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       3471 1 1 1 1  40 LYS QD   .  40 . HD*  1 1 
       3471 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       3472 1 1 1 1  40 LYS QE   .  40 . HE*  1 1 
       3472 1 2 1 1  41 GLU H    .  41 . HN   1 1 
       3473 1 1 1 1  41 GLU H    .  41 . HN   1 1 
       3473 1 2 1 1  41 GLU QB   .  41 . HB*  1 1 
       3474 1 1 1 1  41 GLU H    .  41 . HN   1 1 
       3474 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
       3475 1 1 1 1  41 GLU H    .  41 . HN   1 1 
       3475 1 2 1 1  42 MET QG   .  42 . HG*  1 1 
       3476 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       3476 1 2 1 1  44 LYS QB   .  44 . HB*  1 1 
       3477 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       3477 1 2 1 1  44 LYS QG   .  44 . HG*  1 1 
       3478 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       3478 1 2 1 1  44 LYS QD   .  44 . HD*  1 1 
       3479 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
       3479 1 2 1 1  44 LYS QE   .  44 . HE*  1 1 
       3480 1 1 1 1  41 GLU QB   .  41 . HB*  1 1 
       3480 1 2 1 1  42 MET H    .  42 . HN   1 1 
       3481 1 1 1 1  41 GLU QB   .  41 . HB*  1 1 
       3481 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3482 1 1 1 1  41 GLU QB   .  41 . HB*  1 1 
       3482 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       3483 1 1 1 1  41 GLU QG   .  41 . HG*  1 1 
       3483 1 2 1 1  42 MET H    .  42 . HN   1 1 
       3484 1 1 1 1  41 GLU QG   .  41 . HG*  1 1 
       3484 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       3485 1 1 1 1  41 GLU QG   .  41 . HG*  1 1 
       3485 1 2 1 1  56 ILE MD   .  56 . HD1* 1 1 
       3486 1 1 1 1  42 MET H    .  42 . HN   1 1 
       3486 1 2 1 1  42 MET QB   .  42 . HB*  1 1 
       3487 1 1 1 1  42 MET H    .  42 . HN   1 1 
       3487 1 2 1 1  43 LYS QD   .  43 . HD*  1 1 
       3488 1 1 1 1  42 MET HA   .  42 . HA   1 1 
       3488 1 2 1 1  45 LEU QB   .  45 . HB*  1 1 
       3489 1 1 1 1  42 MET QB   .  42 . HB*  1 1 
       3489 1 2 1 1  42 MET ME   .  42 . HE*  1 1 
       3490 1 1 1 1  42 MET QB   .  42 . HB*  1 1 
       3490 1 2 1 1  43 LYS QG   .  43 . HG*  1 1 
       3491 1 1 1 1  42 MET QB   .  42 . HB*  1 1 
       3491 1 2 1 1  46 ALA MB   .  46 . HB*  1 1 
       3492 1 1 1 1  42 MET QB   .  42 . HB*  1 1 
       3492 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3493 1 1 1 1  42 MET QB   .  42 . HB*  1 1 
       3493 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       3494 1 1 1 1  42 MET QG   .  42 . HG*  1 1 
       3494 1 2 1 1  43 LYS H    .  43 . HN   1 1 
       3495 1 1 1 1  42 MET QG   .  42 . HG*  1 1 
       3495 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3496 1 1 1 1  42 MET QG   .  42 . HG*  1 1 
       3496 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       3497 1 1 1 1  42 MET QG   .  42 . HG*  1 1 
       3497 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       3498 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       3498 1 2 1 1  45 LEU QB   .  45 . HB*  1 1 
       3499 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       3499 1 2 1 1  67 MET QB   .  67 . HB*  1 1 
       3500 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       3500 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3501 1 1 1 1  42 MET ME   .  42 . HE*  1 1 
       3501 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3502 1 1 1 1  43 LYS H    .  43 . HN   1 1 
       3502 1 2 1 1  43 LYS QB   .  43 . HB*  1 1 
       3503 1 1 1 1  43 LYS H    .  43 . HN   1 1 
       3503 1 2 1 1  43 LYS QG   .  43 . HG*  1 1 
       3504 1 1 1 1  43 LYS H    .  43 . HN   1 1 
       3504 1 2 1 1  43 LYS QD   .  43 . HD*  1 1 
       3505 1 1 1 1  43 LYS H    .  43 . HN   1 1 
       3505 1 2 1 1  43 LYS QE   .  43 . HE*  1 1 
       3506 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
       3506 1 2 1 1  43 LYS QB   .  43 . HB*  1 1 
       3507 1 1 1 1  43 LYS HA   .  43 . HA   1 1 
       3507 1 2 1 1  43 LYS QG   .  43 . HG*  1 1 
       3508 1 1 1 1  43 LYS QB   .  43 . HB*  1 1 
       3508 1 2 1 1  43 LYS QD   .  43 . HD*  1 1 
       3509 1 1 1 1  43 LYS QB   .  43 . HB*  1 1 
       3509 1 2 1 1  44 LYS H    .  44 . HN   1 1 
       3510 1 1 1 1  43 LYS QB   .  43 . HB*  1 1 
       3510 1 2 1 1  46 ALA MB   .  46 . HB*  1 1 
       3511 1 1 1 1  43 LYS QD   .  43 . HD*  1 1 
       3511 1 2 1 1  43 LYS QG   .  43 . HG*  1 1 
       3512 1 1 1 1  43 LYS QE   .  43 . HE*  1 1 
       3512 1 2 1 1  43 LYS QG   .  43 . HG*  1 1 
       3513 1 1 1 1  43 LYS QG   .  43 . HG*  1 1 
       3513 1 2 1 1  44 LYS H    .  44 . HN   1 1 
       3514 1 1 1 1  43 LYS QG   .  43 . HG*  1 1 
       3514 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       3515 1 1 1 1  44 LYS H    .  44 . HN   1 1 
       3515 1 2 1 1  44 LYS QB   .  44 . HB*  1 1 
       3516 1 1 1 1  44 LYS H    .  44 . HN   1 1 
       3516 1 2 1 1  44 LYS QD   .  44 . HD*  1 1 
       3517 1 1 1 1  44 LYS H    .  44 . HN   1 1 
       3517 1 2 1 1  44 LYS QE   .  44 . HE*  1 1 
       3518 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       3518 1 2 1 1  44 LYS QB   .  44 . HB*  1 1 
       3519 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       3519 1 2 1 1  44 LYS QG   .  44 . HG*  1 1 
       3520 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       3520 1 2 1 1  44 LYS QD   .  44 . HD*  1 1 
       3521 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       3521 1 2 1 1  44 LYS QE   .  44 . HE*  1 1 
       3522 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       3522 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       3523 1 1 1 1  44 LYS HA   .  44 . HA   1 1 
       3523 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       3524 1 1 1 1  44 LYS QB   .  44 . HB*  1 1 
       3524 1 2 1 1  44 LYS QD   .  44 . HD*  1 1 
       3525 1 1 1 1  44 LYS QB   .  44 . HB*  1 1 
       3525 1 2 1 1  44 LYS QE   .  44 . HE*  1 1 
       3526 1 1 1 1  44 LYS QB   .  44 . HB*  1 1 
       3526 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       3527 1 1 1 1  44 LYS QD   .  44 . HD*  1 1 
       3527 1 2 1 1  44 LYS QG   .  44 . HG*  1 1 
       3528 1 1 1 1  44 LYS QG   .  44 . HG*  1 1 
       3528 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       3529 1 1 1 1  44 LYS QD   .  44 . HD*  1 1 
       3529 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       3530 1 1 1 1  45 LEU H    .  45 . HN   1 1 
       3530 1 2 1 1  45 LEU QB   .  45 . HB*  1 1 
       3531 1 1 1 1  45 LEU QB   .  45 . HB*  1 1 
       3531 1 2 1 1  46 ALA H    .  46 . HN   1 1 
       3532 1 1 1 1  45 LEU QB   .  45 . HB*  1 1 
       3532 1 2 1 1  46 ALA HA   .  46 . HA   1 1 
       3533 1 1 1 1  45 LEU QB   .  45 . HB*  1 1 
       3533 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       3534 1 1 1 1  45 LEU QB   .  45 . HB*  1 1 
       3534 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       3535 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       3535 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       3536 1 1 1 1  46 ALA MB   .  46 . HB*  1 1 
       3536 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       3537 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       3537 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       3538 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       3538 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       3539 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       3539 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       3540 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
       3540 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       3541 1 1 1 1  47 GLU QG   .  47 . HG*  1 1 
       3541 1 2 1 1  48 GLU H    .  48 . HN   1 1 
       3542 1 1 1 1  48 GLU H    .  48 . HN   1 1 
       3542 1 2 1 1  48 GLU QB   .  48 . HB*  1 1 
       3543 1 1 1 1  48 GLU HA   .  48 . HA   1 1 
       3543 1 2 1 1  48 GLU QG   .  48 . HG*  1 1 
       3544 1 1 1 1  48 GLU QB   .  48 . HB*  1 1 
       3544 1 2 1 1  48 GLU QG   .  48 . HG*  1 1 
       3545 1 1 1 1  48 GLU QB   .  48 . HB*  1 1 
       3545 1 2 1 1  51 PHE QB   .  51 . HB*  1 1 
       3546 1 1 1 1  48 GLU QB   .  48 . HB*  1 1 
       3546 1 2 1 1  51 PHE QD   .  51 . HD*  1 1 
       3547 1 1 1 1  48 GLU QG   .  48 . HG*  1 1 
       3547 1 2 1 1  51 PHE QB   .  51 . HB*  1 1 
       3548 1 1 1 1  48 GLU QG   .  48 . HG*  1 1 
       3548 1 2 1 1  51 PHE QD   .  51 . HD*  1 1 
       3549 1 1 1 1  48 GLU QG   .  48 . HG*  1 1 
       3549 1 2 1 1  51 PHE QE   .  51 . HE*  1 1 
       3550 1 1 1 1  48 GLU QG   .  48 . HG*  1 1 
       3550 1 2 1 1  51 PHE HZ   .  51 . HZ   1 1 
       3551 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       3551 1 2 1 1  49 LYS QE   .  49 . HE*  1 1 
       3552 1 1 1 1  49 LYS HA   .  49 . HA   1 1 
       3552 1 2 1 1  50 ASN QB   .  50 . HB*  1 1 
       3553 1 1 1 1  49 LYS QB   .  49 . HB*  1 1 
       3553 1 2 1 1  49 LYS QD   .  49 . HD*  1 1 
       3554 1 1 1 1  49 LYS QB   .  49 . HB*  1 1 
       3554 1 2 1 1  49 LYS QE   .  49 . HE*  1 1 
       3555 1 1 1 1  49 LYS QB   .  49 . HB*  1 1 
       3555 1 2 1 1  50 ASN H    .  50 . HN   1 1 
       3556 1 1 1 1  49 LYS QD   .  49 . HD*  1 1 
       3556 1 2 1 1  49 LYS QG   .  49 . HG*  1 1 
       3557 1 1 1 1  49 LYS QE   .  49 . HE*  1 1 
       3557 1 2 1 1  49 LYS QG   .  49 . HG*  1 1 
       3558 1 1 1 1  49 LYS QG   .  49 . HG*  1 1 
       3558 1 2 1 1  50 ASN H    .  50 . HN   1 1 
       3559 1 1 1 1  50 ASN QB   .  50 . HB*  1 1 
       3559 1 2 1 1  51 PHE H    .  51 . HN   1 1 
       3560 1 1 1 1  51 PHE QB   .  51 . HB*  1 1 
       3560 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3561 1 1 1 1  52 GLU H    .  52 . HN   1 1 
       3561 1 2 1 1  52 GLU QB   .  52 . HB*  1 1 
       3562 1 1 1 1  52 GLU HA   .  52 . HA   1 1 
       3562 1 2 1 1  52 GLU QG   .  52 . HG*  1 1 
       3563 1 1 1 1  52 GLU HA   .  52 . HA   1 1 
       3563 1 2 1 1  53 LYS QE   .  53 . HE*  1 1 
       3564 1 1 1 1  52 GLU QB   .  52 . HB*  1 1 
       3564 1 2 1 1  53 LYS H    .  53 . HN   1 1 
       3565 1 1 1 1  52 GLU QB   .  52 . HB*  1 1 
       3565 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       3566 1 1 1 1  52 GLU QB   .  52 . HB*  1 1 
       3566 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3567 1 1 1 1  52 GLU QB   .  52 . HB*  1 1 
       3567 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       3568 1 1 1 1  52 GLU QB   .  52 . HB*  1 1 
       3568 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3569 1 1 1 1  52 GLU QG   .  52 . HG*  1 1 
       3569 1 2 1 1  53 LYS H    .  53 . HN   1 1 
       3570 1 1 1 1  52 GLU QG   .  52 . HG*  1 1 
       3570 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3571 1 1 1 1  52 GLU QG   .  52 . HG*  1 1 
       3571 1 2 1 1  54 ILE QG   .  54 . HG1* 1 1 
       3572 1 1 1 1  52 GLU QG   .  52 . HG*  1 1 
       3572 1 2 1 1  54 ILE MD   .  54 . HD1* 1 1 
       3573 1 1 1 1  53 LYS H    .  53 . HN   1 1 
       3573 1 2 1 1  53 LYS QB   .  53 . HB*  1 1 
       3574 1 1 1 1  53 LYS H    .  53 . HN   1 1 
       3574 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3575 1 1 1 1  53 LYS H    .  53 . HN   1 1 
       3575 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       3576 1 1 1 1  53 LYS H    .  53 . HN   1 1 
       3576 1 2 1 1  53 LYS QE   .  53 . HE*  1 1 
       3577 1 1 1 1  53 LYS HA   .  53 . HA   1 1 
       3577 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       3578 1 1 1 1  53 LYS HA   .  53 . HA   1 1 
       3578 1 2 1 1  53 LYS QE   .  53 . HE*  1 1 
       3579 1 1 1 1  53 LYS QB   .  53 . HB*  1 1 
       3579 1 2 1 1  53 LYS QD   .  53 . HD*  1 1 
       3580 1 1 1 1  53 LYS QB   .  53 . HB*  1 1 
       3580 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       3581 1 1 1 1  53 LYS QB   .  53 . HB*  1 1 
       3581 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3582 1 1 1 1  53 LYS QB   .  53 . HB*  1 1 
       3582 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       3583 1 1 1 1  53 LYS QD   .  53 . HD*  1 1 
       3583 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3584 1 1 1 1  53 LYS QE   .  53 . HE*  1 1 
       3584 1 2 1 1  53 LYS QG   .  53 . HG*  1 1 
       3585 1 1 1 1  53 LYS QG   .  53 . HG*  1 1 
       3585 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       3586 1 1 1 1  53 LYS QG   .  53 . HG*  1 1 
       3586 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       3587 1 1 1 1  53 LYS QG   .  53 . HG*  1 1 
       3587 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       3588 1 1 1 1  53 LYS QD   .  53 . HD*  1 1 
       3588 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       3589 1 1 1 1  53 LYS QD   .  53 . HD*  1 1 
       3589 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       3590 1 1 1 1  53 LYS QD   .  53 . HD*  1 1 
       3590 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       3591 1 1 1 1  53 LYS QD   .  53 . HD*  1 1 
       3591 1 2 1 1 121 MET HA   . 121 . HA   1 1 
       3592 1 1 1 1  53 LYS QE   .  53 . HE*  1 1 
       3592 1 2 1 1  54 ILE H    .  54 . HN   1 1 
       3593 1 1 1 1  54 ILE H    .  54 . HN   1 1 
       3593 1 2 1 1  54 ILE QG   .  54 . HG1* 1 1 
       3594 1 1 1 1  54 ILE HA   .  54 . HA   1 1 
       3594 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3595 1 1 1 1  54 ILE QG   .  54 . HG1* 1 1 
       3595 1 2 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3596 1 1 1 1  54 ILE MG   .  54 . HG2* 1 1 
       3596 1 2 1 1  56 ILE QG   .  56 . HG1* 1 1 
       3597 1 1 1 1  55 LEU H    .  55 . HN   1 1 
       3597 1 2 1 1  55 LEU QB   .  55 . HB*  1 1 
       3598 1 1 1 1  55 LEU QB   .  55 . HB*  1 1 
       3598 1 2 1 1  56 ILE H    .  56 . HN   1 1 
       3599 1 1 1 1  55 LEU QB   .  55 . HB*  1 1 
       3599 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       3600 1 1 1 1  55 LEU MD1  .  55 . HD1* 1 1 
       3600 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       3601 1 1 1 1  56 ILE H    .  56 . HN   1 1 
       3601 1 2 1 1  56 ILE QG   .  56 . HG1* 1 1 
       3602 1 1 1 1  56 ILE QG   .  56 . HG1* 1 1 
       3602 1 2 1 1  56 ILE MG   .  56 . HG2* 1 1 
       3603 1 1 1 1  57 ILE H    .  57 . HN   1 1 
       3603 1 2 1 1  57 ILE QG   .  57 . HG1* 1 1 
       3604 1 1 1 1  57 ILE HA   .  57 . HA   1 1 
       3604 1 2 1 1  57 ILE QG   .  57 . HG1* 1 1 
       3605 1 1 1 1  57 ILE MG   .  57 . HG2* 1 1 
       3605 1 2 1 1  58 SER QB   .  58 . HB*  1 1 
       3606 1 1 1 1  57 ILE QG   .  57 . HG1* 1 1 
       3606 1 2 1 1  58 SER H    .  58 . HN   1 1 
       3607 1 1 1 1  58 SER H    .  58 . HN   1 1 
       3607 1 2 1 1  58 SER QB   .  58 . HB*  1 1 
       3608 1 1 1 1  58 SER QB   .  58 . HB*  1 1 
       3608 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       3609 1 1 1 1  58 SER QB   .  58 . HB*  1 1 
       3609 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       3610 1 1 1 1  58 SER QB   .  58 . HB*  1 1 
       3610 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3611 1 1 1 1  58 SER QB   .  58 . HB*  1 1 
       3611 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       3612 1 1 1 1  58 SER QB   .  58 . HB*  1 1 
       3612 1 2 1 1  64 LEU MD2  .  64 . HD2* 1 1 
       3613 1 1 1 1  58 SER QB   .  58 . HB*  1 1 
       3613 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       3614 1 1 1 1  58 SER HG   .  58 . HG   1 1 
       3614 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3615 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       3615 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       3616 1 1 1 1  59 ASN H    .  59 . HN   1 1 
       3616 1 2 1 1  60 ASP QB   .  60 . HB*  1 1 
       3617 1 1 1 1  59 ASN QB   .  59 . HB*  1 1 
       3617 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       3618 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       3618 1 2 1 1  61 LYS QB   .  61 . HB*  1 1 
       3619 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       3619 1 2 1 1  62 GLN H    .  62 . HN   1 1 
       3620 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       3620 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       3621 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       3621 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3622 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       3622 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3623 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       3623 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       3624 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       3624 1 2 1 1  61 LYS QG   .  61 . HG*  1 1 
       3625 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       3625 1 2 1 1  61 LYS QD   .  61 . HD*  1 1 
       3626 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       3626 1 2 1 1  62 GLN QB   .  62 . HB*  1 1 
       3627 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       3627 1 2 1 1  61 LYS QG   .  61 . HG*  1 1 
       3628 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       3628 1 2 1 1  61 LYS QD   .  61 . HD*  1 1 
       3629 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       3629 1 2 1 1  61 LYS QE   .  61 . HE*  1 1 
       3630 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       3630 1 2 1 1  64 LEU QB   .  64 . HB*  1 1 
       3631 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       3631 1 2 1 1  61 LYS QD   .  61 . HD*  1 1 
       3632 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       3632 1 2 1 1  61 LYS QE   .  61 . HE*  1 1 
       3633 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       3633 1 2 1 1  62 GLN H    .  62 . HN   1 1 
       3634 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       3634 1 2 1 1  62 GLN QG   .  62 . HG*  1 1 
       3635 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       3635 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       3636 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       3636 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       3637 1 1 1 1  61 LYS QE   .  61 . HE*  1 1 
       3637 1 2 1 1  61 LYS QG   .  61 . HG*  1 1 
       3638 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       3638 1 2 1 1  62 GLN H    .  62 . HN   1 1 
       3639 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       3639 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       3640 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       3640 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       3641 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       3641 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       3642 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       3642 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       3643 1 1 1 1  61 LYS QE   .  61 . HE*  1 1 
       3643 1 2 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3644 1 1 1 1  61 LYS QE   .  61 . HE*  1 1 
       3644 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       3645 1 1 1 1  62 GLN H    .  62 . HN   1 1 
       3645 1 2 1 1  62 GLN QB   .  62 . HB*  1 1 
       3646 1 1 1 1  62 GLN H    .  62 . HN   1 1 
       3646 1 2 1 1  62 GLN QG   .  62 . HG*  1 1 
       3647 1 1 1 1  62 GLN H    .  62 . HN   1 1 
       3647 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3648 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       3648 1 2 1 1  62 GLN QE   .  62 . HE*  1 1 
       3649 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       3649 1 2 1 1  65 LYS QB   .  65 . HB*  1 1 
       3650 1 1 1 1  62 GLN HA   .  62 . HA   1 1 
       3650 1 2 1 1  65 LYS QG   .  65 . HG*  1 1 
       3651 1 1 1 1  62 GLN QB   .  62 . HB*  1 1 
       3651 1 2 1 1  62 GLN QG   .  62 . HG*  1 1 
       3652 1 1 1 1  62 GLN QB   .  62 . HB*  1 1 
       3652 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       3653 1 1 1 1  62 GLN QB   .  62 . HB*  1 1 
       3653 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3654 1 1 1 1  62 GLN QB   .  62 . HB*  1 1 
       3654 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
       3655 1 1 1 1  62 GLN QB   .  62 . HB*  1 1 
       3655 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       3656 1 1 1 1  62 GLN QG   .  62 . HG*  1 1 
       3656 1 2 1 1  63 LEU H    .  63 . HN   1 1 
       3657 1 1 1 1  62 GLN QG   .  62 . HG*  1 1 
       3657 1 2 1 1  63 LEU HG   .  63 . HG   1 1 
       3658 1 1 1 1  63 LEU H    .  63 . HN   1 1 
       3658 1 2 1 1  63 LEU QB   .  63 . HB*  1 1 
       3659 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
       3659 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       3660 1 1 1 1  63 LEU HA   .  63 . HA   1 1 
       3660 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       3661 1 1 1 1  63 LEU QB   .  63 . HB*  1 1 
       3661 1 2 1 1  63 LEU MD1  .  63 . HD1* 1 1 
       3662 1 1 1 1  63 LEU QB   .  63 . HB*  1 1 
       3662 1 2 1 1  63 LEU MD2  .  63 . HD2* 1 1 
       3663 1 1 1 1  63 LEU QB   .  63 . HB*  1 1 
       3663 1 2 1 1  64 LEU H    .  64 . HN   1 1 
       3664 1 1 1 1  63 LEU QB   .  63 . HB*  1 1 
       3664 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       3665 1 1 1 1  63 LEU QB   .  63 . HB*  1 1 
       3665 1 2 1 1  67 MET H    .  67 . HN   1 1 
       3666 1 1 1 1  63 LEU QB   .  63 . HB*  1 1 
       3666 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       3667 1 1 1 1  64 LEU H    .  64 . HN   1 1 
       3667 1 2 1 1  64 LEU QB   .  64 . HB*  1 1 
       3668 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       3668 1 2 1 1  67 MET QB   .  67 . HB*  1 1 
       3669 1 1 1 1  64 LEU HA   .  64 . HA   1 1 
       3669 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3670 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3670 1 2 1 1  64 LEU HG   .  64 . HG   1 1 
       3671 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3671 1 2 1 1  64 LEU MD1  .  64 . HD1* 1 1 
       3672 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3672 1 2 1 1  65 LYS H    .  65 . HN   1 1 
       3673 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3673 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       3674 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3674 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       3675 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3675 1 2 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       3676 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3676 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       3677 1 1 1 1  64 LEU QB   .  64 . HB*  1 1 
       3677 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       3678 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       3678 1 2 1 1  65 LYS QG   .  65 . HG*  1 1 
       3679 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       3679 1 2 1 1  65 LYS QD   .  65 . HD*  1 1 
       3680 1 1 1 1  65 LYS H    .  65 . HN   1 1 
       3680 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       3681 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       3681 1 2 1 1  65 LYS QG   .  65 . HG*  1 1 
       3682 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       3682 1 2 1 1  65 LYS QD   .  65 . HD*  1 1 
       3683 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       3683 1 2 1 1  68 LEU QB   .  68 . HB*  1 1 
       3684 1 1 1 1  65 LYS HA   .  65 . HA   1 1 
       3684 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       3685 1 1 1 1  65 LYS QB   .  65 . HB*  1 1 
       3685 1 2 1 1  65 LYS QD   .  65 . HD*  1 1 
       3686 1 1 1 1  65 LYS QB   .  65 . HB*  1 1 
       3686 1 2 1 1  65 LYS QE   .  65 . HE*  1 1 
       3687 1 1 1 1  65 LYS QB   .  65 . HB*  1 1 
       3687 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       3688 1 1 1 1  65 LYS QB   .  65 . HB*  1 1 
       3688 1 2 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       3689 1 1 1 1  65 LYS QB   .  65 . HB*  1 1 
       3689 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       3690 1 1 1 1  65 LYS QB   .  65 . HB*  1 1 
       3690 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       3691 1 1 1 1  65 LYS QE   .  65 . HE*  1 1 
       3691 1 2 1 1  65 LYS QG   .  65 . HG*  1 1 
       3692 1 1 1 1  65 LYS QG   .  65 . HG*  1 1 
       3692 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       3693 1 1 1 1  65 LYS QG   .  65 . HG*  1 1 
       3693 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       3694 1 1 1 1  65 LYS QG   .  65 . HG*  1 1 
       3694 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       3695 1 1 1 1  65 LYS QG   .  65 . HG*  1 1 
       3695 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       3696 1 1 1 1  65 LYS QD   .  65 . HD*  1 1 
       3696 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       3697 1 1 1 1  65 LYS QD   .  65 . HD*  1 1 
       3697 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       3698 1 1 1 1  65 LYS QD   .  65 . HD*  1 1 
       3698 1 2 1 1  93 PHE HZ   .  93 . HZ   1 1 
       3699 1 1 1 1  65 LYS QD   .  65 . HD*  1 1 
       3699 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       3700 1 1 1 1  65 LYS QD   .  65 . HD*  1 1 
       3700 1 2 1 1 100 GLN QE   . 100 . HE*  1 1 
       3701 1 1 1 1  65 LYS QE   .  65 . HE*  1 1 
       3701 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       3702 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       3702 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       3703 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3703 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       3704 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3704 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       3705 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3705 1 2 1 1  68 LEU QB   .  68 . HB*  1 1 
       3706 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3706 1 2 1 1  69 GLU QB   .  69 . HB*  1 1 
       3707 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3707 1 2 1 1  69 GLU QG   .  69 . HG*  1 1 
       3708 1 1 1 1  66 GLU QB   .  66 . HB*  1 1 
       3708 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       3709 1 1 1 1  66 GLU QB   .  66 . HB*  1 1 
       3709 1 2 1 1  67 MET H    .  67 . HN   1 1 
       3710 1 1 1 1  66 GLU QG   .  66 . HG*  1 1 
       3710 1 2 1 1  67 MET H    .  67 . HN   1 1 
       3711 1 1 1 1  66 GLU QG   .  66 . HG*  1 1 
       3711 1 2 1 1  70 LEU HG   .  70 . HG   1 1 
       3712 1 1 1 1  67 MET H    .  67 . HN   1 1 
       3712 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3713 1 1 1 1  67 MET H    .  67 . HN   1 1 
       3713 1 2 1 1  68 LEU QB   .  68 . HB*  1 1 
       3714 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       3714 1 2 1 1  67 MET QG   .  67 . HG*  1 1 
       3715 1 1 1 1  67 MET HA   .  67 . HA   1 1 
       3715 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3716 1 1 1 1  67 MET QB   .  67 . HB*  1 1 
       3716 1 2 1 1  67 MET ME   .  67 . HE*  1 1 
       3717 1 1 1 1  67 MET QB   .  67 . HB*  1 1 
       3717 1 2 1 1  69 GLU H    .  69 . HN   1 1 
       3718 1 1 1 1  67 MET QB   .  67 . HB*  1 1 
       3718 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3719 1 1 1 1  67 MET QB   .  67 . HB*  1 1 
       3719 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3720 1 1 1 1  67 MET QB   .  67 . HB*  1 1 
       3720 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       3721 1 1 1 1  67 MET QG   .  67 . HG*  1 1 
       3721 1 2 1 1  68 LEU H    .  68 . HN   1 1 
       3722 1 1 1 1  67 MET QG   .  67 . HG*  1 1 
       3722 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       3723 1 1 1 1  67 MET QG   .  67 . HG*  1 1 
       3723 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3724 1 1 1 1  67 MET QG   .  67 . HG*  1 1 
       3724 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       3725 1 1 1 1  68 LEU H    .  68 . HN   1 1 
       3725 1 2 1 1  68 LEU QB   .  68 . HB*  1 1 
       3726 1 1 1 1  68 LEU H    .  68 . HN   1 1 
       3726 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3727 1 1 1 1  68 LEU HA   .  68 . HA   1 1 
       3727 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3728 1 1 1 1  68 LEU QB   .  68 . HB*  1 1 
       3728 1 2 1 1  69 GLU H    .  69 . HN   1 1 
       3729 1 1 1 1  68 LEU QB   .  68 . HB*  1 1 
       3729 1 2 1 1  69 GLU HA   .  69 . HA   1 1 
       3730 1 1 1 1  68 LEU QB   .  68 . HB*  1 1 
       3730 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       3731 1 1 1 1  68 LEU QB   .  68 . HB*  1 1 
       3731 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       3732 1 1 1 1  68 LEU QB   .  68 . HB*  1 1 
       3732 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       3733 1 1 1 1  68 LEU QB   .  68 . HB*  1 1 
       3733 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       3734 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       3734 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3735 1 1 1 1  68 LEU MD1  .  68 . HD1* 1 1 
       3735 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       3736 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       3736 1 2 1 1  69 GLU QG   .  69 . HG*  1 1 
       3737 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       3737 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3738 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       3738 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       3739 1 1 1 1  68 LEU MD2  .  68 . HD2* 1 1 
       3739 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       3740 1 1 1 1  69 GLU H    .  69 . HN   1 1 
       3740 1 2 1 1  69 GLU QB   .  69 . HB*  1 1 
       3741 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
       3741 1 2 1 1  69 GLU QG   .  69 . HG*  1 1 
       3742 1 1 1 1  69 GLU HA   .  69 . HA   1 1 
       3742 1 2 1 1  72 SER QB   .  72 . HB*  1 1 
       3743 1 1 1 1  69 GLU QB   .  69 . HB*  1 1 
       3743 1 2 1 1  69 GLU QG   .  69 . HG*  1 1 
       3744 1 1 1 1  69 GLU QB   .  69 . HB*  1 1 
       3744 1 2 1 1  70 LEU H    .  70 . HN   1 1 
       3745 1 1 1 1  69 GLU QB   .  69 . HB*  1 1 
       3745 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3746 1 1 1 1  69 GLU QB   .  69 . HB*  1 1 
       3746 1 2 1 1  70 LEU HG   .  70 . HG   1 1 
       3747 1 1 1 1  69 GLU QB   .  69 . HB*  1 1 
       3747 1 2 1 1  72 SER QB   .  72 . HB*  1 1 
       3748 1 1 1 1  69 GLU QG   .  69 . HG*  1 1 
       3748 1 2 1 1  70 LEU H    .  70 . HN   1 1 
       3749 1 1 1 1  69 GLU QG   .  69 . HG*  1 1 
       3749 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       3750 1 1 1 1  70 LEU H    .  70 . HN   1 1 
       3750 1 2 1 1  70 LEU QB   .  70 . HB*  1 1 
       3751 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
       3751 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3752 1 1 1 1  70 LEU HA   .  70 . HA   1 1 
       3752 1 2 1 1  73 LYS QD   .  73 . HD*  1 1 
       3753 1 1 1 1  70 LEU QB   .  70 . HB*  1 1 
       3753 1 2 1 1  70 LEU MD1  .  70 . HD1* 1 1 
       3754 1 1 1 1  70 LEU QB   .  70 . HB*  1 1 
       3754 1 2 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       3755 1 1 1 1  70 LEU QB   .  70 . HB*  1 1 
       3755 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       3756 1 1 1 1  70 LEU QB   .  70 . HB*  1 1 
       3756 1 2 1 1  71 ILE HA   .  71 . HA   1 1 
       3757 1 1 1 1  70 LEU QB   .  70 . HB*  1 1 
       3757 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       3758 1 1 1 1  70 LEU QB   .  70 . HB*  1 1 
       3758 1 2 1 1  72 SER H    .  72 . HN   1 1 
       3759 1 1 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       3759 1 2 1 1  73 LYS QD   .  73 . HD*  1 1 
       3760 1 1 1 1  70 LEU MD2  .  70 . HD2* 1 1 
       3760 1 2 1 1  73 LYS QE   .  73 . HE*  1 1 
       3761 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       3761 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3762 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       3762 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3763 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       3763 1 2 1 1  74 LEU QB   .  74 . HB*  1 1 
       3764 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       3764 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       3765 1 1 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3765 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       3766 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       3766 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       3767 1 1 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3767 1 2 1 1  72 SER H    .  72 . HN   1 1 
       3768 1 1 1 1  71 ILE QG   .  71 . HG1* 1 1 
       3768 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       3769 1 1 1 1  72 SER H    .  72 . HN   1 1 
       3769 1 2 1 1  72 SER QB   .  72 . HB*  1 1 
       3770 1 1 1 1  72 SER H    .  72 . HN   1 1 
       3770 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3771 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3771 1 2 1 1  73 LYS H    .  73 . HN   1 1 
       3772 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3772 1 2 1 1  73 LYS QB   .  73 . HB*  1 1 
       3773 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3773 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3774 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3774 1 2 1 1  73 LYS QD   .  73 . HD*  1 1 
       3775 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3775 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       3776 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3776 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       3777 1 1 1 1  72 SER QB   .  72 . HB*  1 1 
       3777 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       3778 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       3778 1 2 1 1  73 LYS QB   .  73 . HB*  1 1 
       3779 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       3779 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3780 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       3780 1 2 1 1  73 LYS QD   .  73 . HD*  1 1 
       3781 1 1 1 1  73 LYS H    .  73 . HN   1 1 
       3781 1 2 1 1  73 LYS QE   .  73 . HE*  1 1 
       3782 1 1 1 1  73 LYS HA   .  73 . HA   1 1 
       3782 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3783 1 1 1 1  73 LYS HA   .  73 . HA   1 1 
       3783 1 2 1 1  73 LYS QD   .  73 . HD*  1 1 
       3784 1 1 1 1  73 LYS HA   .  73 . HA   1 1 
       3784 1 2 1 1  73 LYS QE   .  73 . HE*  1 1 
       3785 1 1 1 1  73 LYS QB   .  73 . HB*  1 1 
       3785 1 2 1 1  73 LYS QD   .  73 . HD*  1 1 
       3786 1 1 1 1  73 LYS QB   .  73 . HB*  1 1 
       3786 1 2 1 1  73 LYS QE   .  73 . HE*  1 1 
       3787 1 1 1 1  73 LYS QB   .  73 . HB*  1 1 
       3787 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       3788 1 1 1 1  73 LYS QD   .  73 . HD*  1 1 
       3788 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3789 1 1 1 1  73 LYS QE   .  73 . HE*  1 1 
       3789 1 2 1 1  73 LYS QG   .  73 . HG*  1 1 
       3790 1 1 1 1  73 LYS QG   .  73 . HG*  1 1 
       3790 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       3791 1 1 1 1  73 LYS QD   .  73 . HD*  1 1 
       3791 1 2 1 1  74 LEU H    .  74 . HN   1 1 
       3792 1 1 1 1  73 LYS QD   .  73 . HD*  1 1 
       3792 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       3793 1 1 1 1  73 LYS QD   .  73 . HD*  1 1 
       3793 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       3794 1 1 1 1  74 LEU H    .  74 . HN   1 1 
       3794 1 2 1 1  74 LEU QB   .  74 . HB*  1 1 
       3795 1 1 1 1  74 LEU H    .  74 . HN   1 1 
       3795 1 2 1 1  75 GLY QA   .  75 . HA*  1 1 
       3796 1 1 1 1  74 LEU QB   .  74 . HB*  1 1 
       3796 1 2 1 1  74 LEU MD1  .  74 . HD1* 1 1 
       3797 1 1 1 1  74 LEU QB   .  74 . HB*  1 1 
       3797 1 2 1 1  74 LEU MD2  .  74 . HD2* 1 1 
       3798 1 1 1 1  74 LEU QB   .  74 . HB*  1 1 
       3798 1 2 1 1  75 GLY H    .  75 . HN   1 1 
       3799 1 1 1 1  74 LEU QB   .  74 . HB*  1 1 
       3799 1 2 1 1  76 TYR H    .  76 . HN   1 1 
       3800 1 1 1 1  74 LEU QB   .  74 . HB*  1 1 
       3800 1 2 1 1  76 TYR QD   .  76 . HD*  1 1 
       3801 1 1 1 1  74 LEU QB   .  74 . HB*  1 1 
       3801 1 2 1 1  76 TYR QE   .  76 . HE*  1 1 
       3802 1 1 1 1  75 GLY H    .  75 . HN   1 1 
       3802 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       3803 1 1 1 1  76 TYR H    .  76 . HN   1 1 
       3803 1 2 1 1  76 TYR QB   .  76 . HB*  1 1 
       3804 1 1 1 1  76 TYR QB   .  76 . HB*  1 1 
       3804 1 2 1 1  77 LYS H    .  77 . HN   1 1 
       3805 1 1 1 1  76 TYR QB   .  76 . HB*  1 1 
       3805 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       3806 1 1 1 1  77 LYS H    .  77 . HN   1 1 
       3806 1 2 1 1  77 LYS QB   .  77 . HB*  1 1 
       3807 1 1 1 1  77 LYS H    .  77 . HN   1 1 
       3807 1 2 1 1  77 LYS QG   .  77 . HG*  1 1 
       3808 1 1 1 1  77 LYS H    .  77 . HN   1 1 
       3808 1 2 1 1  77 LYS QD   .  77 . HD*  1 1 
       3809 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
       3809 1 2 1 1  77 LYS QG   .  77 . HG*  1 1 
       3810 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
       3810 1 2 1 1  77 LYS QD   .  77 . HD*  1 1 
       3811 1 1 1 1  77 LYS HA   .  77 . HA   1 1 
       3811 1 2 1 1  77 LYS QE   .  77 . HE*  1 1 
       3812 1 1 1 1  77 LYS QB   .  77 . HB*  1 1 
       3812 1 2 1 1  77 LYS QD   .  77 . HD*  1 1 
       3813 1 1 1 1  77 LYS QB   .  77 . HB*  1 1 
       3813 1 2 1 1  77 LYS QE   .  77 . HE*  1 1 
       3814 1 1 1 1  77 LYS QB   .  77 . HB*  1 1 
       3814 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       3815 1 1 1 1  77 LYS QE   .  77 . HE*  1 1 
       3815 1 2 1 1  77 LYS QG   .  77 . HG*  1 1 
       3816 1 1 1 1  77 LYS QG   .  77 . HG*  1 1 
       3816 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       3817 1 1 1 1  77 LYS QG   .  77 . HG*  1 1 
       3817 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       3818 1 1 1 1  77 LYS QG   .  77 . HG*  1 1 
       3818 1 2 1 1  79 PHE H    .  79 . HN   1 1 
       3819 1 1 1 1  77 LYS QG   .  77 . HG*  1 1 
       3819 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       3820 1 1 1 1  78 VAL HB   .  78 . HB   1 1 
       3820 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       3821 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       3821 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       3822 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       3822 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3823 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       3823 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       3824 1 1 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       3824 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       3825 1 1 1 1  79 PHE H    .  79 . HN   1 1 
       3825 1 2 1 1  79 PHE QB   .  79 . HB*  1 1 
       3826 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       3826 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3827 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       3827 1 2 1 1 103 GLU QB   . 103 . HB*  1 1 
       3828 1 1 1 1  79 PHE HA   .  79 . HA   1 1 
       3828 1 2 1 1 103 GLU QG   . 103 . HG*  1 1 
       3829 1 1 1 1  79 PHE QB   .  79 . HB*  1 1 
       3829 1 2 1 1  80 LEU H    .  80 . HN   1 1 
       3830 1 1 1 1  79 PHE QB   .  79 . HB*  1 1 
       3830 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       3831 1 1 1 1  79 PHE QB   .  79 . HB*  1 1 
       3831 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       3832 1 1 1 1  79 PHE QB   .  79 . HB*  1 1 
       3832 1 2 1 1 120 PHE HZ   . 120 . HZ   1 1 
       3833 1 1 1 1  79 PHE QB   .  79 . HB*  1 1 
       3833 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       3834 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       3834 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3835 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       3835 1 2 1 1 103 GLU QG   . 103 . HG*  1 1 
       3836 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       3836 1 2 1 1 105 ARG QB   . 105 . HB*  1 1 
       3837 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       3837 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       3838 1 1 1 1  79 PHE QD   .  79 . HD*  1 1 
       3838 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       3839 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       3839 1 2 1 1  81 LEU QB   .  81 . HB*  1 1 
       3840 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       3840 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       3841 1 1 1 1  79 PHE QE   .  79 . HE*  1 1 
       3841 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       3842 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       3842 1 2 1 1 105 ARG QB   . 105 . HB*  1 1 
       3843 1 1 1 1  79 PHE HZ   .  79 . HZ   1 1 
       3843 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       3844 1 1 1 1  80 LEU H    .  80 . HN   1 1 
       3844 1 2 1 1  80 LEU QB   .  80 . HB*  1 1 
       3845 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3845 1 2 1 1  80 LEU MD1  .  80 . HD1* 1 1 
       3846 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3846 1 2 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       3847 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3847 1 2 1 1  81 LEU H    .  81 . HN   1 1 
       3848 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3848 1 2 1 1  82 LEU H    .  82 . HN   1 1 
       3849 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3849 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       3850 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3850 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       3851 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3851 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       3852 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3852 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       3853 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3853 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3854 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3854 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3855 1 1 1 1  80 LEU QB   .  80 . HB*  1 1 
       3855 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       3856 1 1 1 1  80 LEU HG   .  80 . HG   1 1 
       3856 1 2 1 1  82 LEU QB   .  82 . HB*  1 1 
       3857 1 1 1 1  80 LEU MD2  .  80 . HD2* 1 1 
       3857 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       3858 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       3858 1 2 1 1  82 LEU QB   .  82 . HB*  1 1 
       3859 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       3859 1 2 1 1 105 ARG QB   . 105 . HB*  1 1 
       3860 1 1 1 1  81 LEU HA   .  81 . HA   1 1 
       3860 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       3861 1 1 1 1  81 LEU QB   .  81 . HB*  1 1 
       3861 1 2 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       3862 1 1 1 1  81 LEU QB   .  81 . HB*  1 1 
       3862 1 2 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       3863 1 1 1 1  81 LEU QB   .  81 . HB*  1 1 
       3863 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       3864 1 1 1 1  81 LEU MD1  .  81 . HD1* 1 1 
       3864 1 2 1 1 105 ARG QB   . 105 . HB*  1 1 
       3865 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       3865 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3866 1 1 1 1  81 LEU MD2  .  81 . HD2* 1 1 
       3866 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       3867 1 1 1 1  82 LEU H    .  82 . HN   1 1 
       3867 1 2 1 1  82 LEU QB   .  82 . HB*  1 1 
       3868 1 1 1 1  82 LEU HA   .  82 . HA   1 1 
       3868 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3869 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3869 1 2 1 1  83 GLN H    .  83 . HN   1 1 
       3870 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3870 1 2 1 1  83 GLN HA   .  83 . HA   1 1 
       3871 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3871 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3872 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3872 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       3873 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3873 1 2 1 1  93 PHE QE   .  93 . HE*  1 1 
       3874 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3874 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       3875 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3875 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       3876 1 1 1 1  82 LEU QB   .  82 . HB*  1 1 
       3876 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       3877 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3877 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3878 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3878 1 2 1 1  93 PHE QB   .  93 . HB*  1 1 
       3879 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3879 1 2 1 1  94 LYS QG   .  94 . HG*  1 1 
       3880 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3880 1 2 1 1  94 LYS QD   .  94 . HD*  1 1 
       3881 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3881 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       3882 1 1 1 1  82 LEU MD1  .  82 . HD1* 1 1 
       3882 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       3883 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       3883 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       3884 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       3884 1 2 1 1  93 PHE QB   .  93 . HB*  1 1 
       3885 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       3885 1 2 1 1  94 LYS QB   .  94 . HB*  1 1 
       3886 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       3886 1 2 1 1  94 LYS QG   .  94 . HG*  1 1 
       3887 1 1 1 1  82 LEU MD2  .  82 . HD2* 1 1 
       3887 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       3888 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       3888 1 2 1 1  83 GLN QB   .  83 . HB*  1 1 
       3889 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       3889 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3890 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       3890 1 2 1 1  83 GLN QE   .  83 . HE*  1 1 
       3891 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       3891 1 2 1 1  84 ASP QB   .  84 . HB*  1 1 
       3892 1 1 1 1  83 GLN H    .  83 . HN   1 1 
       3892 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3893 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       3893 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3894 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       3894 1 2 1 1  83 GLN QE   .  83 . HE*  1 1 
       3895 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       3895 1 2 1 1  84 ASP QB   .  84 . HB*  1 1 
       3896 1 1 1 1  83 GLN HA   .  83 . HA   1 1 
       3896 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3897 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3897 1 2 1 1  83 GLN QG   .  83 . HG*  1 1 
       3898 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3898 1 2 1 1  83 GLN QE   .  83 . HE*  1 1 
       3899 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3899 1 2 1 1  84 ASP H    .  84 . HN   1 1 
       3900 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3900 1 2 1 1  84 ASP HA   .  84 . HA   1 1 
       3901 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3901 1 2 1 1 107 VAL HB   . 107 . HB   1 1 
       3902 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3902 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       3903 1 1 1 1  83 GLN QB   .  83 . HB*  1 1 
       3903 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       3904 1 1 1 1  83 GLN QG   .  83 . HG*  1 1 
       3904 1 2 1 1  84 ASP H    .  84 . HN   1 1 
       3905 1 1 1 1  83 GLN QG   .  83 . HG*  1 1 
       3905 1 2 1 1  84 ASP HA   .  84 . HA   1 1 
       3906 1 1 1 1  83 GLN QG   .  83 . HG*  1 1 
       3906 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       3907 1 1 1 1  83 GLN QG   .  83 . HG*  1 1 
       3907 1 2 1 1 110 ASP HA   . 110 . HA   1 1 
       3908 1 1 1 1  83 GLN QG   .  83 . HG*  1 1 
       3908 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       3909 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3909 1 2 1 1  84 ASP H    .  84 . HN   1 1 
       3910 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3910 1 2 1 1  84 ASP HA   .  84 . HA   1 1 
       3911 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3911 1 2 1 1  85 GLN H    .  85 . HN   1 1 
       3912 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3912 1 2 1 1  85 GLN HA   .  85 . HA   1 1 
       3913 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3913 1 2 1 1  85 GLN QG   .  85 . HG*  1 1 
       3914 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3914 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       3915 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3915 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       3916 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3916 1 2 1 1 110 ASP HA   . 110 . HA   1 1 
       3917 1 1 1 1  83 GLN QE   .  83 . HE*  1 1 
       3917 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       3918 1 1 1 1  84 ASP H    .  84 . HN   1 1 
       3918 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3919 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       3919 1 2 1 1  85 GLN QG   .  85 . HG*  1 1 
       3920 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       3920 1 2 1 1  85 GLN QE   .  85 . HE*  1 1 
       3921 1 1 1 1  84 ASP HA   .  84 . HA   1 1 
       3921 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3922 1 1 1 1  84 ASP QB   .  84 . HB*  1 1 
       3922 1 2 1 1  86 ASP H    .  86 . HN   1 1 
       3923 1 1 1 1  84 ASP QB   .  84 . HB*  1 1 
       3923 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       3924 1 1 1 1  84 ASP QB   .  84 . HB*  1 1 
       3924 1 2 1 1  90 LEU HA   .  90 . HA   1 1 
       3925 1 1 1 1  84 ASP QB   .  84 . HB*  1 1 
       3925 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       3926 1 1 1 1  84 ASP QB   .  84 . HB*  1 1 
       3926 1 2 1 1  90 LEU HG   .  90 . HG   1 1 
       3927 1 1 1 1  84 ASP QB   .  84 . HB*  1 1 
       3927 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3928 1 1 1 1  85 GLN H    .  85 . HN   1 1 
       3928 1 2 1 1  85 GLN QB   .  85 . HB*  1 1 
       3929 1 1 1 1  85 GLN H    .  85 . HN   1 1 
       3929 1 2 1 1  85 GLN QG   .  85 . HG*  1 1 
       3930 1 1 1 1  85 GLN H    .  85 . HN   1 1 
       3930 1 2 1 1  86 ASP QB   .  86 . HB*  1 1 
       3931 1 1 1 1  85 GLN H    .  85 . HN   1 1 
       3931 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3932 1 1 1 1  85 GLN HA   .  85 . HA   1 1 
       3932 1 2 1 1  85 GLN QG   .  85 . HG*  1 1 
       3933 1 1 1 1  85 GLN HA   .  85 . HA   1 1 
       3933 1 2 1 1  85 GLN QE   .  85 . HE*  1 1 
       3934 1 1 1 1  85 GLN HA   .  85 . HA   1 1 
       3934 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3935 1 1 1 1  85 GLN QB   .  85 . HB*  1 1 
       3935 1 2 1 1  86 ASP H    .  86 . HN   1 1 
       3936 1 1 1 1  85 GLN QB   .  85 . HB*  1 1 
       3936 1 2 1 1  86 ASP QB   .  86 . HB*  1 1 
       3937 1 1 1 1  85 GLN QG   .  85 . HG*  1 1 
       3937 1 2 1 1  86 ASP H    .  86 . HN   1 1 
       3938 1 1 1 1  86 ASP H    .  86 . HN   1 1 
       3938 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       3939 1 1 1 1  86 ASP H    .  86 . HN   1 1 
       3939 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3940 1 1 1 1  86 ASP QB   .  86 . HB*  1 1 
       3940 1 2 1 1  87 GLU H    .  87 . HN   1 1 
       3941 1 1 1 1  86 ASP QB   .  86 . HB*  1 1 
       3941 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       3942 1 1 1 1  86 ASP QB   .  86 . HB*  1 1 
       3942 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       3943 1 1 1 1  86 ASP QB   .  86 . HB*  1 1 
       3943 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       3944 1 1 1 1  86 ASP QB   .  86 . HB*  1 1 
       3944 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3945 1 1 1 1  87 GLU H    .  87 . HN   1 1 
       3945 1 2 1 1  87 GLU QG   .  87 . HG*  1 1 
       3946 1 1 1 1  87 GLU H    .  87 . HN   1 1 
       3946 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       3947 1 1 1 1  87 GLU H    .  87 . HN   1 1 
       3947 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3948 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       3948 1 2 1 1  87 GLU QG   .  87 . HG*  1 1 
       3949 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       3949 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       3950 1 1 1 1  87 GLU HA   .  87 . HA   1 1 
       3950 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3951 1 1 1 1  87 GLU QB   .  87 . HB*  1 1 
       3951 1 2 1 1  87 GLU QG   .  87 . HG*  1 1 
       3952 1 1 1 1  87 GLU QB   .  87 . HB*  1 1 
       3952 1 2 1 1  88 ASN HA   .  88 . HA   1 1 
       3953 1 1 1 1  87 GLU QB   .  87 . HB*  1 1 
       3953 1 2 1 1  88 ASN QB   .  88 . HB*  1 1 
       3954 1 1 1 1  87 GLU QB   .  87 . HB*  1 1 
       3954 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3955 1 1 1 1  87 GLU QB   .  87 . HB*  1 1 
       3955 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       3956 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3956 1 2 1 1  88 ASN H    .  88 . HN   1 1 
       3957 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3957 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       3958 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3958 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3959 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3959 1 2 1 1  91 GLU H    .  91 . HN   1 1 
       3960 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3960 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       3961 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3961 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       3962 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3962 1 2 1 1 108 THR HB   . 108 . HB   1 1 
       3963 1 1 1 1  87 GLU QG   .  87 . HG*  1 1 
       3963 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       3964 1 1 1 1  88 ASN H    .  88 . HN   1 1 
       3964 1 2 1 1  88 ASN QB   .  88 . HB*  1 1 
       3965 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
       3965 1 2 1 1  91 GLU QB   .  91 . HB*  1 1 
       3966 1 1 1 1  88 ASN HA   .  88 . HA   1 1 
       3966 1 2 1 1  91 GLU QG   .  91 . HG*  1 1 
       3967 1 1 1 1  88 ASN QB   .  88 . HB*  1 1 
       3967 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       3968 1 1 1 1  88 ASN QB   .  88 . HB*  1 1 
       3968 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       3969 1 1 1 1  88 ASN QB   .  88 . HB*  1 1 
       3969 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       3970 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       3970 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       3971 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       3971 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       3972 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
       3972 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       3973 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
       3973 1 2 1 1  92 GLU QB   .  92 . HB*  1 1 
       3974 1 1 1 1  89 GLU QB   .  89 . HB*  1 1 
       3974 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       3975 1 1 1 1  89 GLU QB   .  89 . HB*  1 1 
       3975 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3976 1 1 1 1  89 GLU QG   .  89 . HG*  1 1 
       3976 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       3977 1 1 1 1  90 LEU H    .  90 . HN   1 1 
       3977 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       3978 1 1 1 1  90 LEU H    .  90 . HN   1 1 
       3978 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3979 1 1 1 1  90 LEU H    .  90 . HN   1 1 
       3979 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       3980 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
       3980 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3981 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
       3981 1 2 1 1  93 PHE QB   .  93 . HB*  1 1 
       3982 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       3982 1 2 1 1  90 LEU QD   .  90 . HD*  1 1 
       3983 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       3983 1 2 1 1  91 GLU H    .  91 . HN   1 1 
       3984 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       3984 1 2 1 1  92 GLU H    .  92 . HN   1 1 
       3985 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       3985 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       3986 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3986 1 2 1 1  91 GLU H    .  91 . HN   1 1 
       3987 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3987 1 2 1 1  93 PHE QD   .  93 . HD*  1 1 
       3988 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3988 1 2 1 1 106 LYS HA   . 106 . HA   1 1 
       3989 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3989 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       3990 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3990 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       3991 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3991 1 2 1 1 108 THR HA   . 108 . HA   1 1 
       3992 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3992 1 2 1 1 108 THR HB   . 108 . HB   1 1 
       3993 1 1 1 1  90 LEU QD   .  90 . HD*  1 1 
       3993 1 2 1 1 108 THR MG   . 108 . HG2* 1 1 
       3994 1 1 1 1  91 GLU H    .  91 . HN   1 1 
       3994 1 2 1 1  91 GLU QB   .  91 . HB*  1 1 
       3995 1 1 1 1  91 GLU H    .  91 . HN   1 1 
       3995 1 2 1 1  91 GLU QG   .  91 . HG*  1 1 
       3996 1 1 1 1  91 GLU H    .  91 . HN   1 1 
       3996 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       3997 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       3997 1 2 1 1  91 GLU QB   .  91 . HB*  1 1 
       3998 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       3998 1 2 1 1  91 GLU QG   .  91 . HG*  1 1 
       3999 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       3999 1 2 1 1  94 LYS QB   .  94 . HB*  1 1 
       4000 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       4000 1 2 1 1  94 LYS QD   .  94 . HD*  1 1 
       4001 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       4001 1 2 1 1  95 ARG QB   .  95 . HB*  1 1 
       4002 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       4002 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       4003 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       4003 1 2 1 1 106 LYS QD   . 106 . HD*  1 1 
       4004 1 1 1 1  91 GLU HA   .  91 . HA   1 1 
       4004 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       4005 1 1 1 1  91 GLU QB   .  91 . HB*  1 1 
       4005 1 2 1 1  91 GLU QG   .  91 . HG*  1 1 
       4006 1 1 1 1  91 GLU QB   .  91 . HB*  1 1 
       4006 1 2 1 1  92 GLU H    .  92 . HN   1 1 
       4007 1 1 1 1  91 GLU QB   .  91 . HB*  1 1 
       4007 1 2 1 1 106 LYS QD   . 106 . HD*  1 1 
       4008 1 1 1 1  91 GLU QB   .  91 . HB*  1 1 
       4008 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       4009 1 1 1 1  91 GLU QG   .  91 . HG*  1 1 
       4009 1 2 1 1  92 GLU H    .  92 . HN   1 1 
       4010 1 1 1 1  91 GLU QG   .  91 . HG*  1 1 
       4010 1 2 1 1  92 GLU HA   .  92 . HA   1 1 
       4011 1 1 1 1  91 GLU QG   .  91 . HG*  1 1 
       4011 1 2 1 1  95 ARG H    .  95 . HN   1 1 
       4012 1 1 1 1  91 GLU QG   .  91 . HG*  1 1 
       4012 1 2 1 1  95 ARG QD   .  95 . HD*  1 1 
       4013 1 1 1 1  92 GLU H    .  92 . HN   1 1 
       4013 1 2 1 1  92 GLU QB   .  92 . HB*  1 1 
       4014 1 1 1 1  92 GLU H    .  92 . HN   1 1 
       4014 1 2 1 1  92 GLU QG   .  92 . HG*  1 1 
       4015 1 1 1 1  92 GLU H    .  92 . HN   1 1 
       4015 1 2 1 1  93 PHE QB   .  93 . HB*  1 1 
       4016 1 1 1 1  92 GLU HA   .  92 . HA   1 1 
       4016 1 2 1 1  92 GLU QG   .  92 . HG*  1 1 
       4017 1 1 1 1  92 GLU HA   .  92 . HA   1 1 
       4017 1 2 1 1  95 ARG QB   .  95 . HB*  1 1 
       4018 1 1 1 1  92 GLU HA   .  92 . HA   1 1 
       4018 1 2 1 1  95 ARG QG   .  95 . HG*  1 1 
       4019 1 1 1 1  92 GLU HA   .  92 . HA   1 1 
       4019 1 2 1 1  95 ARG QD   .  95 . HD*  1 1 
       4020 1 1 1 1  92 GLU QB   .  92 . HB*  1 1 
       4020 1 2 1 1  92 GLU QG   .  92 . HG*  1 1 
       4021 1 1 1 1  92 GLU QB   .  92 . HB*  1 1 
       4021 1 2 1 1  93 PHE HA   .  93 . HA   1 1 
       4022 1 1 1 1  92 GLU QG   .  92 . HG*  1 1 
       4022 1 2 1 1  93 PHE H    .  93 . HN   1 1 
       4023 1 1 1 1  93 PHE H    .  93 . HN   1 1 
       4023 1 2 1 1  95 ARG QG   .  95 . HG*  1 1 
       4024 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       4024 1 2 1 1  95 ARG QG   .  95 . HG*  1 1 
       4025 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       4025 1 2 1 1  96 LYS QB   .  96 . HB*  1 1 
       4026 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       4026 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
       4027 1 1 1 1  93 PHE HA   .  93 . HA   1 1 
       4027 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4028 1 1 1 1  93 PHE QB   .  93 . HB*  1 1 
       4028 1 2 1 1  94 LYS H    .  94 . HN   1 1 
       4029 1 1 1 1  93 PHE QB   .  93 . HB*  1 1 
       4029 1 2 1 1  94 LYS QB   .  94 . HB*  1 1 
       4030 1 1 1 1  93 PHE QB   .  93 . HB*  1 1 
       4030 1 2 1 1  95 ARG QG   .  95 . HG*  1 1 
       4031 1 1 1 1  93 PHE QE   .  93 . HE*  1 1 
       4031 1 2 1 1  96 LYS QB   .  96 . HB*  1 1 
       4032 1 1 1 1  93 PHE QE   .  93 . HE*  1 1 
       4032 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
       4033 1 1 1 1  93 PHE HZ   .  93 . HZ   1 1 
       4033 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4034 1 1 1 1  94 LYS H    .  94 . HN   1 1 
       4034 1 2 1 1  94 LYS QB   .  94 . HB*  1 1 
       4035 1 1 1 1  94 LYS H    .  94 . HN   1 1 
       4035 1 2 1 1  94 LYS QD   .  94 . HD*  1 1 
       4036 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       4036 1 2 1 1  94 LYS QD   .  94 . HD*  1 1 
       4037 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       4037 1 2 1 1  94 LYS QE   .  94 . HE*  1 1 
       4038 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       4038 1 2 1 1  96 LYS QB   .  96 . HB*  1 1 
       4039 1 1 1 1  94 LYS HA   .  94 . HA   1 1 
       4039 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4040 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4040 1 2 1 1  94 LYS QD   .  94 . HD*  1 1 
       4041 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4041 1 2 1 1  94 LYS QE   .  94 . HE*  1 1 
       4042 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4042 1 2 1 1  95 ARG HA   .  95 . HA   1 1 
       4043 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4043 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4044 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4044 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       4045 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4045 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       4046 1 1 1 1  94 LYS QB   .  94 . HB*  1 1 
       4046 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       4047 1 1 1 1  94 LYS QE   .  94 . HE*  1 1 
       4047 1 2 1 1  94 LYS QG   .  94 . HG*  1 1 
       4048 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4048 1 2 1 1  95 ARG H    .  95 . HN   1 1 
       4049 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4049 1 2 1 1  95 ARG HA   .  95 . HA   1 1 
       4050 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4050 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4051 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4051 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       4052 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4052 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4053 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4053 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       4054 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4054 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       4055 1 1 1 1  94 LYS QG   .  94 . HG*  1 1 
       4055 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       4056 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4056 1 2 1 1  94 LYS QE   .  94 . HE*  1 1 
       4057 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4057 1 2 1 1  95 ARG H    .  95 . HN   1 1 
       4058 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4058 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4059 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4059 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       4060 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4060 1 2 1 1 105 ARG HA   . 105 . HA   1 1 
       4061 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4061 1 2 1 1 106 LYS H    . 106 . HN   1 1 
       4062 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4062 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       4063 1 1 1 1  94 LYS QD   .  94 . HD*  1 1 
       4063 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       4064 1 1 1 1  94 LYS QE   .  94 . HE*  1 1 
       4064 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4065 1 1 1 1  94 LYS QE   .  94 . HE*  1 1 
       4065 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       4066 1 1 1 1  94 LYS QE   .  94 . HE*  1 1 
       4066 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4067 1 1 1 1  94 LYS QE   .  94 . HE*  1 1 
       4067 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       4068 1 1 1 1  95 ARG H    .  95 . HN   1 1 
       4068 1 2 1 1  95 ARG QB   .  95 . HB*  1 1 
       4069 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       4069 1 2 1 1  95 ARG QG   .  95 . HG*  1 1 
       4070 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       4070 1 2 1 1  95 ARG QD   .  95 . HD*  1 1 
       4071 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       4071 1 2 1 1  98 GLU QB   .  98 . HB*  1 1 
       4072 1 1 1 1  95 ARG HA   .  95 . HA   1 1 
       4072 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4073 1 1 1 1  95 ARG QB   .  95 . HB*  1 1 
       4073 1 2 1 1  95 ARG QD   .  95 . HD*  1 1 
       4074 1 1 1 1  95 ARG QB   .  95 . HB*  1 1 
       4074 1 2 1 1  96 LYS HA   .  96 . HA   1 1 
       4075 1 1 1 1  95 ARG QB   .  95 . HB*  1 1 
       4075 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4076 1 1 1 1  95 ARG QG   .  95 . HG*  1 1 
       4076 1 2 1 1  96 LYS H    .  96 . HN   1 1 
       4077 1 1 1 1  95 ARG QG   .  95 . HG*  1 1 
       4077 1 2 1 1  96 LYS HA   .  96 . HA   1 1 
       4078 1 1 1 1  95 ARG QD   .  95 . HD*  1 1 
       4078 1 2 1 1  96 LYS H    .  96 . HN   1 1 
       4079 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       4079 1 2 1 1  96 LYS QB   .  96 . HB*  1 1 
       4080 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       4080 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
       4081 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       4081 1 2 1 1  96 LYS QD   .  96 . HD*  1 1 
       4082 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       4082 1 2 1 1  96 LYS QB   .  96 . HB*  1 1 
       4083 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       4083 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
       4084 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       4084 1 2 1 1  96 LYS QD   .  96 . HD*  1 1 
       4085 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
       4085 1 2 1 1 100 GLN QE   . 100 . HE*  1 1 
       4086 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4086 1 2 1 1  96 LYS QD   .  96 . HD*  1 1 
       4087 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4087 1 2 1 1  96 LYS QE   .  96 . HE*  1 1 
       4088 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4088 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       4089 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4089 1 2 1 1  97 ILE HA   .  97 . HA   1 1 
       4090 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4090 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4091 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4091 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       4092 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       4092 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
       4093 1 1 1 1  96 LYS QG   .  96 . HG*  1 1 
       4093 1 2 1 1  97 ILE H    .  97 . HN   1 1 
       4094 1 1 1 1  96 LYS QG   .  96 . HG*  1 1 
       4094 1 2 1 1  97 ILE MD   .  97 . HD1* 1 1 
       4095 1 1 1 1  96 LYS QD   .  96 . HD*  1 1 
       4095 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
       4096 1 1 1 1  96 LYS QD   .  96 . HD*  1 1 
       4096 1 2 1 1 100 GLN QE   . 100 . HE*  1 1 
       4097 1 1 1 1  97 ILE H    .  97 . HN   1 1 
       4097 1 2 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4098 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       4098 1 2 1 1 100 GLN QB   . 100 . HB*  1 1 
       4099 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       4099 1 2 1 1 100 GLN QG   . 100 . HG*  1 1 
       4100 1 1 1 1  97 ILE HA   .  97 . HA   1 1 
       4100 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4101 1 1 1 1  97 ILE HB   .  97 . HB   1 1 
       4101 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4102 1 1 1 1  97 ILE HB   .  97 . HB   1 1 
       4102 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4103 1 1 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4103 1 2 1 1  97 ILE MG   .  97 . HG2* 1 1 
       4104 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       4104 1 2 1 1 100 GLN QB   . 100 . HB*  1 1 
       4105 1 1 1 1  97 ILE MG   .  97 . HG2* 1 1 
       4105 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4106 1 1 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4106 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       4107 1 1 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4107 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       4108 1 1 1 1  97 ILE QG   .  97 . HG1* 1 1 
       4108 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       4109 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
       4109 1 2 1 1 100 GLN QE   . 100 . HE*  1 1 
       4110 1 1 1 1  97 ILE MD   .  97 . HD1* 1 1 
       4110 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4111 1 1 1 1  98 GLU H    .  98 . HN   1 1 
       4111 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4112 1 1 1 1  98 GLU H    .  98 . HN   1 1 
       4112 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
       4113 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       4113 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4114 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       4114 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4115 1 1 1 1  98 GLU QB   .  98 . HB*  1 1 
       4115 1 2 1 1  99 SER H    .  99 . HN   1 1 
       4116 1 1 1 1  98 GLU QB   .  98 . HB*  1 1 
       4116 1 2 1 1  99 SER HA   .  99 . HA   1 1 
       4117 1 1 1 1  98 GLU QB   .  98 . HB*  1 1 
       4117 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
       4118 1 1 1 1  98 GLU QB   .  98 . HB*  1 1 
       4118 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4119 1 1 1 1  98 GLU QG   .  98 . HG*  1 1 
       4119 1 2 1 1  99 SER H    .  99 . HN   1 1 
       4120 1 1 1 1  98 GLU QG   .  98 . HG*  1 1 
       4120 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       4121 1 1 1 1  98 GLU QG   .  98 . HG*  1 1 
       4121 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4122 1 1 1 1  99 SER H    .  99 . HN   1 1 
       4122 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
       4123 1 1 1 1  99 SER H    .  99 . HN   1 1 
       4123 1 2 1 1 100 GLN QG   . 100 . HG*  1 1 
       4124 1 1 1 1  99 SER QB   .  99 . HB*  1 1 
       4124 1 2 1 1 100 GLN H    . 100 . HN   1 1 
       4125 1 1 1 1  99 SER QB   .  99 . HB*  1 1 
       4125 1 2 1 1 100 GLN QG   . 100 . HG*  1 1 
       4126 1 1 1 1 100 GLN H    . 100 . HN   1 1 
       4126 1 2 1 1 100 GLN QB   . 100 . HB*  1 1 
       4127 1 1 1 1 100 GLN H    . 100 . HN   1 1 
       4127 1 2 1 1 100 GLN QG   . 100 . HG*  1 1 
       4128 1 1 1 1 100 GLN H    . 100 . HN   1 1 
       4128 1 2 1 1 101 GLY QA   . 101 . HA*  1 1 
       4129 1 1 1 1 100 GLN HA   . 100 . HA   1 1 
       4129 1 2 1 1 100 GLN QG   . 100 . HG*  1 1 
       4130 1 1 1 1 100 GLN HA   . 100 . HA   1 1 
       4130 1 2 1 1 100 GLN QE   . 100 . HE*  1 1 
       4131 1 1 1 1 100 GLN HA   . 100 . HA   1 1 
       4131 1 2 1 1 101 GLY QA   . 101 . HA*  1 1 
       4132 1 1 1 1 100 GLN QB   . 100 . HB*  1 1 
       4132 1 2 1 1 101 GLY H    . 101 . HN   1 1 
       4133 1 1 1 1 100 GLN QB   . 100 . HB*  1 1 
       4133 1 2 1 1 101 GLY QA   . 101 . HA*  1 1 
       4134 1 1 1 1 100 GLN QB   . 100 . HB*  1 1 
       4134 1 2 1 1 102 TYR H    . 102 . HN   1 1 
       4135 1 1 1 1 100 GLN QB   . 100 . HB*  1 1 
       4135 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
       4136 1 1 1 1 100 GLN QG   . 100 . HG*  1 1 
       4136 1 2 1 1 101 GLY H    . 101 . HN   1 1 
       4137 1 1 1 1 100 GLN QG   . 100 . HG*  1 1 
       4137 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
       4138 1 1 1 1 101 GLY H    . 101 . HN   1 1 
       4138 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4139 1 1 1 1 102 TYR H    . 102 . HN   1 1 
       4139 1 2 1 1 102 TYR QB   . 102 . HB*  1 1 
       4140 1 1 1 1 102 TYR QB   . 102 . HB*  1 1 
       4140 1 2 1 1 103 GLU H    . 103 . HN   1 1 
       4141 1 1 1 1 102 TYR QB   . 102 . HB*  1 1 
       4141 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4142 1 1 1 1 103 GLU QB   . 103 . HB*  1 1 
       4142 1 2 1 1 103 GLU QG   . 103 . HG*  1 1 
       4143 1 1 1 1 103 GLU QB   . 103 . HB*  1 1 
       4143 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       4144 1 1 1 1 103 GLU QG   . 103 . HG*  1 1 
       4144 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       4145 1 1 1 1 103 GLU QG   . 103 . HG*  1 1 
       4145 1 2 1 1 105 ARG H    . 105 . HN   1 1 
       4146 1 1 1 1 103 GLU QG   . 103 . HG*  1 1 
       4146 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       4147 1 1 1 1 103 GLU QG   . 103 . HG*  1 1 
       4147 1 2 1 1 120 PHE QE   . 120 . HE*  1 1 
       4148 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       4148 1 2 1 1 105 ARG QB   . 105 . HB*  1 1 
       4149 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       4149 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       4150 1 1 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       4150 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       4151 1 1 1 1 105 ARG H    . 105 . HN   1 1 
       4151 1 2 1 1 105 ARG QB   . 105 . HB*  1 1 
       4152 1 1 1 1 105 ARG H    . 105 . HN   1 1 
       4152 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       4153 1 1 1 1 105 ARG H    . 105 . HN   1 1 
       4153 1 2 1 1 105 ARG QD   . 105 . HD*  1 1 
       4154 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
       4154 1 2 1 1 105 ARG QG   . 105 . HG*  1 1 
       4155 1 1 1 1 105 ARG HA   . 105 . HA   1 1 
       4155 1 2 1 1 105 ARG QD   . 105 . HD*  1 1 
       4156 1 1 1 1 105 ARG QB   . 105 . HB*  1 1 
       4156 1 2 1 1 105 ARG QD   . 105 . HD*  1 1 
       4157 1 1 1 1 105 ARG QB   . 105 . HB*  1 1 
       4157 1 2 1 1 105 ARG HE   . 105 . HE   1 1 
       4158 1 1 1 1 105 ARG QB   . 105 . HB*  1 1 
       4158 1 2 1 1 106 LYS H    . 106 . HN   1 1 
       4159 1 1 1 1 105 ARG QB   . 105 . HB*  1 1 
       4159 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       4160 1 1 1 1 105 ARG QB   . 105 . HB*  1 1 
       4160 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       4161 1 1 1 1 105 ARG QB   . 105 . HB*  1 1 
       4161 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       4162 1 1 1 1 105 ARG QG   . 105 . HG*  1 1 
       4162 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       4163 1 1 1 1 105 ARG QG   . 105 . HG*  1 1 
       4163 1 2 1 1 116 ILE MG   . 116 . HG2* 1 1 
       4164 1 1 1 1 105 ARG QG   . 105 . HG*  1 1 
       4164 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       4165 1 1 1 1 105 ARG QD   . 105 . HD*  1 1 
       4165 1 2 1 1 106 LYS H    . 106 . HN   1 1 
       4166 1 1 1 1 105 ARG QD   . 105 . HD*  1 1 
       4166 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       4167 1 1 1 1 106 LYS H    . 106 . HN   1 1 
       4167 1 2 1 1 106 LYS QB   . 106 . HB*  1 1 
       4168 1 1 1 1 106 LYS H    . 106 . HN   1 1 
       4168 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       4169 1 1 1 1 106 LYS H    . 106 . HN   1 1 
       4169 1 2 1 1 106 LYS QD   . 106 . HD*  1 1 
       4170 1 1 1 1 106 LYS H    . 106 . HN   1 1 
       4170 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       4171 1 1 1 1 106 LYS HA   . 106 . HA   1 1 
       4171 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       4172 1 1 1 1 106 LYS QB   . 106 . HB*  1 1 
       4172 1 2 1 1 106 LYS QD   . 106 . HD*  1 1 
       4173 1 1 1 1 106 LYS QB   . 106 . HB*  1 1 
       4173 1 2 1 1 106 LYS QE   . 106 . HE*  1 1 
       4174 1 1 1 1 106 LYS QB   . 106 . HB*  1 1 
       4174 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       4175 1 1 1 1 106 LYS QB   . 106 . HB*  1 1 
       4175 1 2 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       4176 1 1 1 1 106 LYS QB   . 106 . HB*  1 1 
       4176 1 2 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       4177 1 1 1 1 106 LYS QE   . 106 . HE*  1 1 
       4177 1 2 1 1 106 LYS QG   . 106 . HG*  1 1 
       4178 1 1 1 1 106 LYS QD   . 106 . HD*  1 1 
       4178 1 2 1 1 107 VAL H    . 107 . HN   1 1 
       4179 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       4179 1 2 1 1 112 GLU QB   . 112 . HB*  1 1 
       4180 1 1 1 1 107 VAL MG1  . 107 . HG1* 1 1 
       4180 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4181 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       4181 1 2 1 1 109 ASP QB   . 109 . HB*  1 1 
       4182 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       4182 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4183 1 1 1 1 107 VAL MG2  . 107 . HG2* 1 1 
       4183 1 2 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4184 1 1 1 1 108 THR H    . 108 . HN   1 1 
       4184 1 2 1 1 109 ASP QB   . 109 . HB*  1 1 
       4185 1 1 1 1 108 THR H    . 108 . HN   1 1 
       4185 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4186 1 1 1 1 108 THR HB   . 108 . HB   1 1 
       4186 1 2 1 1 112 GLU QB   . 112 . HB*  1 1 
       4187 1 1 1 1 108 THR MG   . 108 . HG2* 1 1 
       4187 1 2 1 1 109 ASP QB   . 109 . HB*  1 1 
       4188 1 1 1 1 108 THR MG   . 108 . HG2* 1 1 
       4188 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4189 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       4189 1 2 1 1 109 ASP QB   . 109 . HB*  1 1 
       4190 1 1 1 1 109 ASP H    . 109 . HN   1 1 
       4190 1 2 1 1 112 GLU QB   . 112 . HB*  1 1 
       4191 1 1 1 1 109 ASP HA   . 109 . HA   1 1 
       4191 1 2 1 1 111 GLU QG   . 111 . HG*  1 1 
       4192 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4192 1 2 1 1 110 ASP H    . 110 . HN   1 1 
       4193 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4193 1 2 1 1 110 ASP HA   . 110 . HA   1 1 
       4194 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4194 1 2 1 1 111 GLU H    . 111 . HN   1 1 
       4195 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4195 1 2 1 1 111 GLU QG   . 111 . HG*  1 1 
       4196 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4196 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       4197 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4197 1 2 1 1 112 GLU HA   . 112 . HA   1 1 
       4198 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4198 1 2 1 1 112 GLU QB   . 112 . HB*  1 1 
       4199 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4199 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4200 1 1 1 1 109 ASP QB   . 109 . HB*  1 1 
       4200 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       4201 1 1 1 1 110 ASP H    . 110 . HN   1 1 
       4201 1 2 1 1 111 GLU QB   . 111 . HB*  1 1 
       4202 1 1 1 1 110 ASP H    . 110 . HN   1 1 
       4202 1 2 1 1 111 GLU QG   . 111 . HG*  1 1 
       4203 1 1 1 1 110 ASP QB   . 110 . HB*  1 1 
       4203 1 2 1 1 111 GLU H    . 111 . HN   1 1 
       4204 1 1 1 1 110 ASP QB   . 110 . HB*  1 1 
       4204 1 2 1 1 111 GLU HA   . 111 . HA   1 1 
       4205 1 1 1 1 110 ASP QB   . 110 . HB*  1 1 
       4205 1 2 1 1 113 ALA MB   . 113 . HB*  1 1 
       4206 1 1 1 1 110 ASP QB   . 110 . HB*  1 1 
       4206 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       4207 1 1 1 1 111 GLU H    . 111 . HN   1 1 
       4207 1 2 1 1 111 GLU QB   . 111 . HB*  1 1 
       4208 1 1 1 1 111 GLU H    . 111 . HN   1 1 
       4208 1 2 1 1 111 GLU QG   . 111 . HG*  1 1 
       4209 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       4209 1 2 1 1 111 GLU QB   . 111 . HB*  1 1 
       4210 1 1 1 1 111 GLU HA   . 111 . HA   1 1 
       4210 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
       4211 1 1 1 1 111 GLU QB   . 111 . HB*  1 1 
       4211 1 2 1 1 111 GLU QG   . 111 . HG*  1 1 
       4212 1 1 1 1 111 GLU QB   . 111 . HB*  1 1 
       4212 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       4213 1 1 1 1 111 GLU QB   . 111 . HB*  1 1 
       4213 1 2 1 1 114 LEU H    . 114 . HN   1 1 
       4214 1 1 1 1 111 GLU QB   . 111 . HB*  1 1 
       4214 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
       4215 1 1 1 1 111 GLU QG   . 111 . HG*  1 1 
       4215 1 2 1 1 112 GLU H    . 112 . HN   1 1 
       4216 1 1 1 1 111 GLU QG   . 111 . HG*  1 1 
       4216 1 2 1 1 112 GLU HA   . 112 . HA   1 1 
       4217 1 1 1 1 112 GLU H    . 112 . HN   1 1 
       4217 1 2 1 1 112 GLU QB   . 112 . HB*  1 1 
       4218 1 1 1 1 112 GLU H    . 112 . HN   1 1 
       4218 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4219 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
       4219 1 2 1 1 112 GLU QB   . 112 . HB*  1 1 
       4220 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
       4220 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4221 1 1 1 1 112 GLU HA   . 112 . HA   1 1 
       4221 1 2 1 1 115 LYS QB   . 115 . HB*  1 1 
       4222 1 1 1 1 112 GLU QB   . 112 . HB*  1 1 
       4222 1 2 1 1 112 GLU QG   . 112 . HG*  1 1 
       4223 1 1 1 1 112 GLU QB   . 112 . HB*  1 1 
       4223 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       4224 1 1 1 1 112 GLU QB   . 112 . HB*  1 1 
       4224 1 2 1 1 113 ALA HA   . 113 . HA   1 1 
       4225 1 1 1 1 112 GLU QB   . 112 . HB*  1 1 
       4225 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       4226 1 1 1 1 112 GLU QG   . 112 . HG*  1 1 
       4226 1 2 1 1 113 ALA H    . 113 . HN   1 1 
       4227 1 1 1 1 113 ALA HA   . 113 . HA   1 1 
       4227 1 2 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4228 1 1 1 1 113 ALA MB   . 113 . HB*  1 1 
       4228 1 2 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4229 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       4229 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
       4230 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       4230 1 2 1 1 115 LYS QB   . 115 . HB*  1 1 
       4231 1 1 1 1 114 LEU QB   . 114 . HB*  1 1 
       4231 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       4232 1 1 1 1 114 LEU QB   . 114 . HB*  1 1 
       4232 1 2 1 1 115 LYS H    . 115 . HN   1 1 
       4233 1 1 1 1 114 LEU QB   . 114 . HB*  1 1 
       4233 1 2 1 1 117 VAL HB   . 117 . HB   1 1 
       4234 1 1 1 1 115 LYS H    . 115 . HN   1 1 
       4234 1 2 1 1 115 LYS QB   . 115 . HB*  1 1 
       4235 1 1 1 1 115 LYS H    . 115 . HN   1 1 
       4235 1 2 1 1 115 LYS QG   . 115 . HG*  1 1 
       4236 1 1 1 1 115 LYS H    . 115 . HN   1 1 
       4236 1 2 1 1 115 LYS QD   . 115 . HD*  1 1 
       4237 1 1 1 1 115 LYS H    . 115 . HN   1 1 
       4237 1 2 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4238 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       4238 1 2 1 1 115 LYS QG   . 115 . HG*  1 1 
       4239 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       4239 1 2 1 1 115 LYS QD   . 115 . HD*  1 1 
       4240 1 1 1 1 115 LYS HA   . 115 . HA   1 1 
       4240 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4241 1 1 1 1 115 LYS QB   . 115 . HB*  1 1 
       4241 1 2 1 1 115 LYS QE   . 115 . HE*  1 1 
       4242 1 1 1 1 115 LYS QB   . 115 . HB*  1 1 
       4242 1 2 1 1 116 ILE H    . 116 . HN   1 1 
       4243 1 1 1 1 115 LYS QE   . 115 . HE*  1 1 
       4243 1 2 1 1 115 LYS QG   . 115 . HG*  1 1 
       4244 1 1 1 1 115 LYS QG   . 115 . HG*  1 1 
       4244 1 2 1 1 116 ILE H    . 116 . HN   1 1 
       4245 1 1 1 1 115 LYS QG   . 115 . HG*  1 1 
       4245 1 2 1 1 116 ILE HA   . 116 . HA   1 1 
       4246 1 1 1 1 116 ILE H    . 116 . HN   1 1 
       4246 1 2 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4247 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       4247 1 2 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4248 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       4248 1 2 1 1 119 GLU QB   . 119 . HB*  1 1 
       4249 1 1 1 1 116 ILE HA   . 116 . HA   1 1 
       4249 1 2 1 1 119 GLU QG   . 119 . HG*  1 1 
       4250 1 1 1 1 116 ILE MG   . 116 . HG2* 1 1 
       4250 1 2 1 1 119 GLU QB   . 119 . HB*  1 1 
       4251 1 1 1 1 116 ILE MG   . 116 . HG2* 1 1 
       4251 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4252 1 1 1 1 116 ILE QG   . 116 . HG1* 1 1 
       4252 1 2 1 1 117 VAL H    . 117 . HN   1 1 
       4253 1 1 1 1 117 VAL HA   . 117 . HA   1 1 
       4253 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4254 1 1 1 1 117 VAL HB   . 117 . HB   1 1 
       4254 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4255 1 1 1 1 117 VAL MG1  . 117 . HG1* 1 1 
       4255 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4256 1 1 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       4256 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4257 1 1 1 1 117 VAL MG2  . 117 . HG2* 1 1 
       4257 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       4258 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4258 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4259 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4259 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4260 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4260 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4261 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4261 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4262 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       4262 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4263 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       4263 1 2 1 1 121 MET QB   . 121 . HB*  1 1 
       4264 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       4264 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       4265 1 1 1 1 118 ARG QB   . 118 . HB*  1 1 
       4265 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4266 1 1 1 1 118 ARG QB   . 118 . HB*  1 1 
       4266 1 2 1 1 119 GLU H    . 119 . HN   1 1 
       4267 1 1 1 1 118 ARG QG   . 118 . HG*  1 1 
       4267 1 2 1 1 119 GLU H    . 119 . HN   1 1 
       4268 1 1 1 1 118 ARG QD   . 118 . HD*  1 1 
       4268 1 2 1 1 119 GLU H    . 119 . HN   1 1 
       4269 1 1 1 1 119 GLU H    . 119 . HN   1 1 
       4269 1 2 1 1 119 GLU QG   . 119 . HG*  1 1 
       4270 1 1 1 1 119 GLU H    . 119 . HN   1 1 
       4270 1 2 1 1 120 PHE QB   . 120 . HB*  1 1 
       4271 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       4271 1 2 1 1 119 GLU QG   . 119 . HG*  1 1 
       4272 1 1 1 1 119 GLU HA   . 119 . HA   1 1 
       4272 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4273 1 1 1 1 119 GLU QB   . 119 . HB*  1 1 
       4273 1 2 1 1 119 GLU QG   . 119 . HG*  1 1 
       4274 1 1 1 1 119 GLU QB   . 119 . HB*  1 1 
       4274 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       4275 1 1 1 1 119 GLU QB   . 119 . HB*  1 1 
       4275 1 2 1 1 120 PHE QD   . 120 . HD*  1 1 
       4276 1 1 1 1 119 GLU QG   . 119 . HG*  1 1 
       4276 1 2 1 1 120 PHE H    . 120 . HN   1 1 
       4277 1 1 1 1 120 PHE QD   . 120 . HD*  1 1 
       4277 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       4278 1 1 1 1 121 MET H    . 121 . HN   1 1 
       4278 1 2 1 1 121 MET QB   . 121 . HB*  1 1 
       4279 1 1 1 1 121 MET H    . 121 . HN   1 1 
       4279 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       4280 1 1 1 1 121 MET QB   . 121 . HB*  1 1 
       4280 1 2 1 1 121 MET ME   . 121 . HE*  1 1 
       4281 1 1 1 1 121 MET QB   . 121 . HB*  1 1 
       4281 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       4282 1 1 1 1 121 MET ME   . 121 . HE*  1 1 
       4282 1 2 1 1 121 MET QG   . 121 . HG*  1 1 
       4283 1 1 1 1 121 MET QG   . 121 . HG*  1 1 
       4283 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       4284 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       4284 1 2 1 1 122 GLN QB   . 122 . HB*  1 1 
       4285 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       4285 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4286 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       4286 1 2 1 1 122 GLN QE   . 122 . HE*  1 1 
       4287 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       4287 1 2 1 1 123 LYS QB   . 123 . HB*  1 1 
       4288 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       4288 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4289 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       4289 1 2 1 1 122 GLN QE   . 122 . HE*  1 1 
       4290 1 1 1 1 122 GLN QB   . 122 . HB*  1 1 
       4290 1 2 1 1 123 LYS H    . 123 . HN   1 1 
       4291 1 1 1 1 122 GLN QG   . 122 . HG*  1 1 
       4291 1 2 1 1 123 LYS HA   . 123 . HA   1 1 
       4292 1 1 1 1 122 GLN QG   . 122 . HG*  1 1 
       4292 1 2 1 1 123 LYS QG   . 123 . HG*  1 1 
       4293 1 1 1 1 123 LYS H    . 123 . HN   1 1 
       4293 1 2 1 1 123 LYS QB   . 123 . HB*  1 1 
       4294 1 1 1 1 123 LYS H    . 123 . HN   1 1 
       4294 1 2 1 1 123 LYS QD   . 123 . HD*  1 1 
       4295 1 1 1 1 123 LYS H    . 123 . HN   1 1 
       4295 1 2 1 1 123 LYS QE   . 123 . HE*  1 1 
       4296 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       4296 1 2 1 1 123 LYS QG   . 123 . HG*  1 1 
       4297 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       4297 1 2 1 1 123 LYS QD   . 123 . HD*  1 1 
       4298 1 1 1 1 123 LYS HA   . 123 . HA   1 1 
       4298 1 2 1 1 123 LYS QE   . 123 . HE*  1 1 
       4299 1 1 1 1 123 LYS QB   . 123 . HB*  1 1 
       4299 1 2 1 1 123 LYS QD   . 123 . HD*  1 1 
       4300 1 1 1 1 123 LYS QB   . 123 . HB*  1 1 
       4300 1 2 1 1 123 LYS QE   . 123 . HE*  1 1 
       4301 1 1 1 1 123 LYS QB   . 123 . HB*  1 1 
       4301 1 2 1 1 124 ALA H    . 124 . HN   1 1 
       4302 1 1 1 1 123 LYS QB   . 123 . HB*  1 1 
       4302 1 2 1 1 124 ALA MB   . 124 . HB*  1 1 
       4303 1 1 1 1 123 LYS QE   . 123 . HE*  1 1 
       4303 1 2 1 1 123 LYS QG   . 123 . HG*  1 1 
       4304 1 1 1 1 123 LYS QG   . 123 . HG*  1 1 
       4304 1 2 1 1 124 ALA H    . 124 . HN   1 1 
       4305 1 1 1 1 126 SER HA   . 126 . HA   1 1 
       4305 1 2 1 1 127 LEU QB   . 127 . HB*  1 1 
       4306 1 1 1 1 126 SER QB   . 126 . HB*  1 1 
       4306 1 2 1 1 127 LEU H    . 127 . HN   1 1 
       4307 1 1 1 1 127 LEU H    . 127 . HN   1 1 
       4307 1 2 1 1 127 LEU QB   . 127 . HB*  1 1 
       4308 1 1 1 1 127 LEU QB   . 127 . HB*  1 1 
       4308 1 2 1 1 128 GLU H    . 128 . HN   1 1 
       4309 1 1 1 1 128 GLU H    . 128 . HN   1 1 
       4309 1 2 1 1 128 GLU QB   . 128 . HB*  1 1 
       4310 1 1 1 1 128 GLU HA   . 128 . HA   1 1 
       4310 1 2 1 1 128 GLU QG   . 128 . HG*  1 1 
       4311 1 1 1 1 128 GLU QB   . 128 . HB*  1 1 
       4311 1 2 1 1 129 HIS H    . 129 . HN   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 3.14 1.8 3.61 1 1 
          2 1 . . . . . 4.15 1.8 4.77 1 1 
          3 1 . . . . . 4.15 1.8 4.77 1 1 
          4 1 . . . . . 4.59 1.8 5.28 1 1 
          5 1 . . . . . 4.59 1.8 5.28 1 1 
          6 1 . . . . . 4.73 1.8 5.44 1 1 
          7 1 . . . . . 2.98 1.8 3.43 1 1 
          8 1 . . . . . 4.16 1.8 4.78 1 1 
          9 1 . . . . . 4.16 1.8 4.78 1 1 
         10 1 . . . . . 4.07 1.8 4.68 1 1 
         11 1 . . . . .  3.0 1.8 3.45 1 1 
         12 1 . . . . . 3.36 1.8 3.86 1 1 
         13 1 . . . . . 3.32 1.8 3.82 1 1 
         14 1 . . . . . 4.86 1.8 5.59 1 1 
         15 1 . . . . . 4.61 1.8  5.3 1 1 
         16 1 . . . . . 4.61 1.8  5.3 1 1 
         17 1 . . . . . 4.64 1.8 5.34 1 1 
         18 1 . . . . . 4.66 1.8 5.36 1 1 
         19 1 . . . . . 2.98 1.8 3.43 1 1 
         20 1 . . . . . 4.12 1.8 4.74 1 1 
         21 1 . . . . . 3.68 1.8 4.23 1 1 
         22 1 . . . . . 4.47 1.8 5.14 1 1 
         23 1 . . . . . 2.98 1.8 3.43 1 1 
         24 1 . . . . . 4.44 1.8 5.11 1 1 
         25 1 . . . . . 3.27 1.8 3.76 1 1 
         26 1 . . . . .  4.2 1.8 4.83 1 1 
         27 1 . . . . . 2.83 1.8 3.25 1 1 
         28 1 . . . . . 4.45 1.8 5.12 1 1 
         29 1 . . . . . 4.45 1.8 5.12 1 1 
         30 1 . . . . . 4.33 1.8 4.98 1 1 
         31 1 . . . . . 4.33 1.8 4.98 1 1 
         32 1 . . . . . 4.46 1.8 5.13 1 1 
         33 1 . . . . . 2.94 1.8 3.38 1 1 
         34 1 . . . . . 3.92 1.8 4.51 1 1 
         35 1 . . . . . 4.19 1.8 4.82 1 1 
         36 1 . . . . . 3.69 1.8 4.24 1 1 
         37 1 . . . . . 4.41 1.8 5.07 1 1 
         38 1 . . . . . 2.96 1.8  3.4 1 1 
         39 1 . . . . . 4.78 1.8  5.5 1 1 
         40 1 . . . . . 4.78 1.8  5.5 1 1 
         41 1 . . . . . 3.96 1.8 4.55 1 1 
         42 1 . . . . . 3.11 1.8 3.58 1 1 
         43 1 . . . . . 4.17 1.8  4.8 1 1 
         44 1 . . . . . 4.75 1.8 5.46 1 1 
         45 1 . . . . . 4.15 1.8 4.77 1 1 
         46 1 . . . . . 4.15 1.8 4.77 1 1 
         47 1 . . . . . 4.17 1.8  4.8 1 1 
         48 1 . . . . . 3.54 1.8 4.07 1 1 
         49 1 . . . . . 4.31 1.8 4.96 1 1 
         50 1 . . . . . 3.67 1.8 4.22 1 1 
         51 1 . . . . . 4.65 1.8 5.35 1 1 
         52 1 . . . . . 4.65 1.8 5.35 1 1 
         53 1 . . . . . 4.69 1.8 5.39 1 1 
         54 1 . . . . . 3.31 1.8 3.81 1 1 
         55 1 . . . . . 4.01 1.8 4.61 1 1 
         56 1 . . . . . 4.01 1.8 4.61 1 1 
         57 1 . . . . . 4.19 1.8 4.82 1 1 
         58 1 . . . . . 4.49 1.8 5.16 1 1 
         59 1 . . . . .  3.4 1.8 3.91 1 1 
         60 1 . . . . . 5.03 1.8 5.78 1 1 
         61 1 . . . . . 5.03 1.8 5.78 1 1 
         62 1 . . . . . 4.73 1.8 5.44 1 1 
         63 1 . . . . .  6.2 1.8 7.13 1 1 
         64 1 . . . . .  6.2 1.8 7.13 1 1 
         65 1 . . . . .  4.0 1.8  4.6 1 1 
         66 1 . . . . . 3.73 1.8 4.29 1 1 
         67 1 . . . . .  4.2 1.8 4.83 1 1 
         68 1 . . . . . 3.94 1.8 4.53 1 1 
         69 1 . . . . . 4.46 1.8 5.13 1 1 
         70 1 . . . . .  4.2 1.8 4.83 1 1 
         71 1 . . . . . 4.14 1.8 4.76 1 1 
         72 1 . . . . . 4.14 1.8 4.76 1 1 
         73 1 . . . . . 3.59 1.8 4.13 1 1 
         74 1 . . . . . 4.68 1.8 5.38 1 1 
         75 1 . . . . .  3.0 1.8 3.45 1 1 
         76 1 . . . . . 4.17 1.8  4.8 1 1 
         77 1 . . . . . 2.98 1.8 3.43 1 1 
         78 1 . . . . . 4.51 1.8 5.19 1 1 
         79 1 . . . . . 4.43 1.8 5.09 1 1 
         80 1 . . . . . 3.16 1.8 3.63 1 1 
         81 1 . . . . . 4.66 1.8 5.36 1 1 
         82 1 . . . . . 3.57 1.8 4.11 1 1 
         83 1 . . . . . 4.78 1.8  5.5 1 1 
         84 1 . . . . . 3.07 1.8 3.53 1 1 
         85 1 . . . . .  6.2 1.8 7.13 1 1 
         86 1 . . . . .  6.2 1.8 7.13 1 1 
         87 1 . . . . . 2.85 1.8 3.28 1 1 
         88 1 . . . . . 3.12 1.8 3.59 1 1 
         89 1 . . . . . 4.68 1.8 5.38 1 1 
         90 1 . . . . .  3.9 1.8 4.49 1 1 
         91 1 . . . . . 4.46 1.8 5.13 1 1 
         92 1 . . . . . 4.75 1.8 5.46 1 1 
         93 1 . . . . . 3.05 1.8 3.51 1 1 
         94 1 . . . . . 4.78 1.8  5.5 1 1 
         95 1 . . . . . 4.11 1.8 4.73 1 1 
         96 1 . . . . . 4.37 1.8 5.03 1 1 
         97 1 . . . . . 4.37 1.8 5.03 1 1 
         98 1 . . . . . 4.44 1.8 5.11 1 1 
         99 1 . . . . . 4.56 1.8 5.24 1 1 
        100 1 . . . . . 3.81 1.8 4.38 1 1 
        101 1 . . . . . 3.81 1.8 4.38 1 1 
        102 1 . . . . . 4.06 1.8 4.67 1 1 
        103 1 . . . . . 4.06 1.8 4.67 1 1 
        104 1 . . . . . 5.05 1.8 5.81 1 1 
        105 1 . . . . . 5.05 1.8 5.81 1 1 
        106 1 . . . . . 3.76 1.8 4.32 1 1 
        107 1 . . . . . 4.49 1.8 5.16 1 1 
        108 1 . . . . . 4.18 1.8 4.81 1 1 
        109 1 . . . . . 4.18 1.8 4.81 1 1 
        110 1 . . . . . 5.21 1.8 5.99 1 1 
        111 1 . . . . . 4.58 1.8 5.27 1 1 
        112 1 . . . . . 3.83 1.8  4.4 1 1 
        113 1 . . . . .  5.0 1.8 5.75 1 1 
        114 1 . . . . .  5.0 1.8 5.75 1 1 
        115 1 . . . . . 3.11 1.8 3.58 1 1 
        116 1 . . . . . 3.32 1.8 3.82 1 1 
        117 1 . . . . . 4.39 1.8 5.05 1 1 
        118 1 . . . . . 4.59 1.8 5.28 1 1 
        119 1 . . . . . 3.45 1.8 3.97 1 1 
        120 1 . . . . . 3.22 1.8  3.7 1 1 
        121 1 . . . . .  3.3 1.8  3.8 1 1 
        122 1 . . . . . 4.85 1.8 5.58 1 1 
        123 1 . . . . . 4.85 1.8 5.58 1 1 
        124 1 . . . . . 5.08 1.8 5.84 1 1 
        125 1 . . . . . 5.08 1.8 5.84 1 1 
        126 1 . . . . . 4.87 1.8  5.6 1 1 
        127 1 . . . . . 3.24 1.8 3.73 1 1 
        128 1 . . . . .  4.0 1.8  4.6 1 1 
        129 1 . . . . .  4.0 1.8  4.6 1 1 
        130 1 . . . . . 5.03 1.8 5.78 1 1 
        131 1 . . . . . 5.03 1.8 5.78 1 1 
        132 1 . . . . . 4.66 1.8 5.36 1 1 
        133 1 . . . . . 3.81 1.8 4.38 1 1 
        134 1 . . . . . 3.81 1.8 4.38 1 1 
        135 1 . . . . . 4.57 1.8 5.26 1 1 
        136 1 . . . . . 4.57 1.8 5.26 1 1 
        137 1 . . . . . 4.53 1.8 5.21 1 1 
        138 1 . . . . . 3.14 1.8 3.61 1 1 
        139 1 . . . . . 4.51 1.8 5.19 1 1 
        140 1 . . . . . 3.19 1.8 3.67 1 1 
        141 1 . . . . . 4.84 1.8 5.57 1 1 
        142 1 . . . . . 4.84 1.8 5.57 1 1 
        143 1 . . . . . 4.16 1.8 4.78 1 1 
        144 1 . . . . . 4.52 1.8  5.2 1 1 
        145 1 . . . . .  3.2 1.8 3.68 1 1 
        146 1 . . . . . 5.03 1.8 5.78 1 1 
        147 1 . . . . . 5.03 1.8 5.78 1 1 
        148 1 . . . . . 3.69 1.8 4.24 1 1 
        149 1 . . . . . 3.93 1.8 4.52 1 1 
        150 1 . . . . . 3.04 1.8  3.5 1 1 
        151 1 . . . . . 4.22 1.8 4.85 1 1 
        152 1 . . . . . 4.07 1.8 4.68 1 1 
        153 1 . . . . . 4.39 1.8 5.05 1 1 
        154 1 . . . . . 4.32 1.8 4.97 1 1 
        155 1 . . . . . 3.11 1.8 3.58 1 1 
        156 1 . . . . . 3.55 1.8 4.08 1 1 
        157 1 . . . . . 2.95 1.8 3.39 1 1 
        158 1 . . . . . 4.38 1.8 5.04 1 1 
        159 1 . . . . . 4.38 1.8 5.04 1 1 
        160 1 . . . . . 3.46 1.8 3.98 1 1 
        161 1 . . . . .  3.3 1.8  3.8 1 1 
        162 1 . . . . . 5.28 1.8 6.07 1 1 
        163 1 . . . . . 5.28 1.8 6.07 1 1 
        164 1 . . . . . 5.89 1.8 6.77 1 1 
        165 1 . . . . .  3.5 1.8 4.03 1 1 
        166 1 . . . . . 4.09 1.8  4.7 1 1 
        167 1 . . . . . 4.49 1.8 5.16 1 1 
        168 1 . . . . . 4.49 1.8 5.16 1 1 
        169 1 . . . . . 4.91 1.8 5.65 1 1 
        170 1 . . . . . 4.91 1.8 5.65 1 1 
        171 1 . . . . .  6.2 1.8 7.13 1 1 
        172 1 . . . . .  6.2 1.8 7.13 1 1 
        173 1 . . . . . 4.68 1.8 5.38 1 1 
        174 1 . . . . . 3.92 1.8 4.51 1 1 
        175 1 . . . . . 4.55 1.8 5.23 1 1 
        176 1 . . . . . 4.55 1.8 5.23 1 1 
        177 1 . . . . . 3.46 1.8 3.98 1 1 
        178 1 . . . . . 3.97 1.8 4.57 1 1 
        179 1 . . . . . 4.01 1.8 4.61 1 1 
        180 1 . . . . . 5.36 1.8 6.16 1 1 
        181 1 . . . . . 6.08 1.8 6.99 1 1 
        182 1 . . . . . 5.99 1.8 6.89 1 1 
        183 1 . . . . . 4.29 1.8 4.93 1 1 
        184 1 . . . . . 4.69 1.8 5.39 1 1 
        185 1 . . . . . 3.92 1.8 4.51 1 1 
        186 1 . . . . .  3.3 1.8  3.8 1 1 
        187 1 . . . . . 3.58 1.8 4.12 1 1 
        188 1 . . . . . 3.58 1.8 4.12 1 1 
        189 1 . . . . . 5.28 1.8 6.07 1 1 
        190 1 . . . . . 5.28 1.8 6.07 1 1 
        191 1 . . . . . 4.01 1.8 4.61 1 1 
        192 1 . . . . . 4.01 1.8 4.61 1 1 
        193 1 . . . . . 4.54 1.8 5.22 1 1 
        194 1 . . . . .  4.9 1.8 5.64 1 1 
        195 1 . . . . . 4.71 1.8 5.42 1 1 
        196 1 . . . . . 3.95 1.8 4.54 1 1 
        197 1 . . . . . 3.95 1.8 4.54 1 1 
        198 1 . . . . . 4.75 1.8 5.46 1 1 
        199 1 . . . . . 3.45 1.8 3.97 1 1 
        200 1 . . . . . 3.78 1.8 4.35 1 1 
        201 1 . . . . . 3.78 1.8 4.35 1 1 
        202 1 . . . . . 5.03 1.8 5.78 1 1 
        203 1 . . . . . 3.43 1.8 3.94 1 1 
        204 1 . . . . . 3.47 1.8 3.99 1 1 
        205 1 . . . . . 4.15 1.8 4.77 1 1 
        206 1 . . . . .  4.9 1.8 5.64 1 1 
        207 1 . . . . . 3.58 1.8 4.12 1 1 
        208 1 . . . . . 5.13 1.8  5.9 1 1 
        209 1 . . . . . 5.13 1.8  5.9 1 1 
        210 1 . . . . . 4.55 1.8 5.23 1 1 
        211 1 . . . . . 4.55 1.8 5.23 1 1 
        212 1 . . . . .  5.0 1.8 5.75 1 1 
        213 1 . . . . .  5.0 1.8 5.75 1 1 
        214 1 . . . . . 4.81 1.8 5.53 1 1 
        215 1 . . . . . 4.66 1.8 5.36 1 1 
        216 1 . . . . . 4.94 1.8 5.68 1 1 
        217 1 . . . . . 3.45 1.8 3.97 1 1 
        218 1 . . . . . 3.43 1.8 3.94 1 1 
        219 1 . . . . . 4.28 1.8 4.92 1 1 
        220 1 . . . . . 4.28 1.8 4.92 1 1 
        221 1 . . . . . 4.39 1.8 5.05 1 1 
        222 1 . . . . . 4.74 1.8 5.45 1 1 
        223 1 . . . . . 2.96 1.8  3.4 1 1 
        224 1 . . . . . 5.04 1.8  5.8 1 1 
        225 1 . . . . . 5.04 1.8  5.8 1 1 
        226 1 . . . . . 4.56 1.8 5.24 1 1 
        227 1 . . . . . 4.56 1.8 5.24 1 1 
        228 1 . . . . . 3.09 1.8 3.55 1 1 
        229 1 . . . . . 4.55 1.8 5.23 1 1 
        230 1 . . . . . 3.31 1.8 3.81 1 1 
        231 1 . . . . . 4.18 1.8 4.81 1 1 
        232 1 . . . . . 3.13 1.8  3.6 1 1 
        233 1 . . . . . 4.42 1.8 5.08 1 1 
        234 1 . . . . . 4.42 1.8 5.08 1 1 
        235 1 . . . . . 4.88 1.8 5.61 1 1 
        236 1 . . . . . 3.02 1.8 3.47 1 1 
        237 1 . . . . . 4.19 1.8 4.82 1 1 
        238 1 . . . . . 4.19 1.8 4.82 1 1 
        239 1 . . . . . 3.85 1.8 4.43 1 1 
        240 1 . . . . . 3.17 1.8 3.65 1 1 
        241 1 . . . . .  3.1 1.8 3.57 1 1 
        242 1 . . . . . 4.51 1.8 5.19 1 1 
        243 1 . . . . . 4.51 1.8 5.19 1 1 
        244 1 . . . . . 4.17 1.8  4.8 1 1 
        245 1 . . . . . 3.35 1.8 3.85 1 1 
        246 1 . . . . . 4.86 1.8 5.59 1 1 
        247 1 . . . . .  4.7 1.8  5.4 1 1 
        248 1 . . . . . 2.86 1.8 3.29 1 1 
        249 1 . . . . . 4.96 1.8  5.7 1 1 
        250 1 . . . . . 3.84 1.8 4.42 1 1 
        251 1 . . . . . 3.41 1.8 3.92 1 1 
        252 1 . . . . . 4.43 1.8 5.09 1 1 
        253 1 . . . . . 4.43 1.8 5.09 1 1 
        254 1 . . . . . 5.26 1.8 6.05 1 1 
        255 1 . . . . . 5.26 1.8 6.05 1 1 
        256 1 . . . . . 3.26 1.8 3.75 1 1 
        257 1 . . . . . 4.42 1.8 5.08 1 1 
        258 1 . . . . . 4.42 1.8 5.08 1 1 
        259 1 . . . . . 4.36 1.8 5.01 1 1 
        260 1 . . . . . 4.37 1.8 5.03 1 1 
        261 1 . . . . . 3.05 1.8 3.51 1 1 
        262 1 . . . . . 4.74 1.8 5.45 1 1 
        263 1 . . . . . 4.74 1.8 5.45 1 1 
        264 1 . . . . . 4.28 1.8 4.92 1 1 
        265 1 . . . . . 4.28 1.8 4.92 1 1 
        266 1 . . . . . 4.23 1.8 4.86 1 1 
        267 1 . . . . . 4.12 1.8 4.74 1 1 
        268 1 . . . . . 4.12 1.8 4.74 1 1 
        269 1 . . . . . 3.42 1.8 3.93 1 1 
        270 1 . . . . . 3.86 1.8 4.44 1 1 
        271 1 . . . . . 3.86 1.8 4.44 1 1 
        272 1 . . . . . 4.72 1.8 5.43 1 1 
        273 1 . . . . . 3.64 1.8 4.19 1 1 
        274 1 . . . . . 3.64 1.8 4.19 1 1 
        275 1 . . . . . 3.94 1.8 4.53 1 1 
        276 1 . . . . . 3.94 1.8 4.53 1 1 
        277 1 . . . . . 3.83 1.8  4.4 1 1 
        278 1 . . . . . 3.83 1.8  4.4 1 1 
        279 1 . . . . .  4.3 1.8 4.95 1 1 
        280 1 . . . . . 3.49 1.8 4.01 1 1 
        281 1 . . . . . 3.49 1.8 4.01 1 1 
        282 1 . . . . .  5.0 1.8 5.75 1 1 
        283 1 . . . . .  5.0 1.8 5.75 1 1 
        284 1 . . . . . 3.24 1.8 3.73 1 1 
        285 1 . . . . . 3.49 1.8 4.01 1 1 
        286 1 . . . . . 3.49 1.8 4.01 1 1 
        287 1 . . . . . 4.92 1.8 5.66 1 1 
        288 1 . . . . . 3.52 1.8 4.05 1 1 
        289 1 . . . . . 3.78 1.8 4.35 1 1 
        290 1 . . . . . 4.12 1.8 4.74 1 1 
        291 1 . . . . . 3.63 1.8 4.17 1 1 
        292 1 . . . . .  5.0 1.8 5.75 1 1 
        293 1 . . . . . 3.93 1.8 4.52 1 1 
        294 1 . . . . . 4.05 1.8 4.66 1 1 
        295 1 . . . . . 5.17 1.8 5.95 1 1 
        296 1 . . . . . 5.17 1.8 5.95 1 1 
        297 1 . . . . . 3.97 1.8 4.57 1 1 
        298 1 . . . . . 4.37 1.8 5.03 1 1 
        299 1 . . . . . 5.39 1.8  6.2 1 1 
        300 1 . . . . . 4.64 1.8 5.34 1 1 
        301 1 . . . . . 4.64 1.8 5.34 1 1 
        302 1 . . . . . 2.73 1.8 3.14 1 1 
        303 1 . . . . . 4.56 1.8 5.24 1 1 
        304 1 . . . . . 4.56 1.8 5.24 1 1 
        305 1 . . . . . 2.97 1.8 3.42 1 1 
        306 1 . . . . . 4.44 1.8 5.11 1 1 
        307 1 . . . . . 3.18 1.8 3.66 1 1 
        308 1 . . . . . 2.85 1.8 3.28 1 1 
        309 1 . . . . .  4.3 1.8 4.95 1 1 
        310 1 . . . . .  4.3 1.8 4.95 1 1 
        311 1 . . . . .  3.7 1.8 4.26 1 1 
        312 1 . . . . . 2.88 1.8 3.31 1 1 
        313 1 . . . . . 4.38 1.8 5.04 1 1 
        314 1 . . . . . 4.38 1.8 5.04 1 1 
        315 1 . . . . . 4.02 1.8 4.62 1 1 
        316 1 . . . . . 4.02 1.8 4.62 1 1 
        317 1 . . . . . 5.36 1.8 6.16 1 1 
        318 1 . . . . .  6.2 1.8 7.13 1 1 
        319 1 . . . . .  6.2 1.8 7.13 1 1 
        320 1 . . . . . 4.91 1.8 5.65 1 1 
        321 1 . . . . . 3.33 1.8 3.83 1 1 
        322 1 . . . . . 3.81 1.8 4.38 1 1 
        323 1 . . . . . 4.05 1.8 4.66 1 1 
        324 1 . . . . . 4.37 1.8 5.03 1 1 
        325 1 . . . . . 4.43 1.8 5.09 1 1 
        326 1 . . . . . 2.78 1.8  3.2 1 1 
        327 1 . . . . . 3.45 1.8 3.97 1 1 
        328 1 . . . . . 4.06 1.8 4.67 1 1 
        329 1 . . . . . 4.01 1.8 4.61 1 1 
        330 1 . . . . . 4.01 1.8 4.61 1 1 
        331 1 . . . . . 4.69 1.8 5.39 1 1 
        332 1 . . . . . 4.69 1.8 5.39 1 1 
        333 1 . . . . . 3.12 1.8 3.59 1 1 
        334 1 . . . . . 5.33 1.8 6.13 1 1 
        335 1 . . . . . 5.33 1.8 6.13 1 1 
        336 1 . . . . .  3.2 1.8 3.68 1 1 
        337 1 . . . . . 3.13 1.8  3.6 1 1 
        338 1 . . . . . 3.16 1.8 3.63 1 1 
        339 1 . . . . . 4.11 1.8 4.73 1 1 
        340 1 . . . . . 4.79 1.8 5.51 1 1 
        341 1 . . . . . 5.66 1.8 6.51 1 1 
        342 1 . . . . .  5.2 1.8 5.98 1 1 
        343 1 . . . . . 4.89 1.8 5.62 1 1 
        344 1 . . . . .  4.1 1.8 4.72 1 1 
        345 1 . . . . .  3.3 1.8  3.8 1 1 
        346 1 . . . . . 3.32 1.8 3.82 1 1 
        347 1 . . . . . 4.01 1.8 4.61 1 1 
        348 1 . . . . . 3.53 1.8 4.06 1 1 
        349 1 . . . . . 4.27 1.8 4.91 1 1 
        350 1 . . . . . 3.21 1.8 3.69 1 1 
        351 1 . . . . . 3.79 1.8 4.36 1 1 
        352 1 . . . . . 3.79 1.8 4.36 1 1 
        353 1 . . . . . 3.82 1.8 4.39 1 1 
        354 1 . . . . . 3.82 1.8 4.39 1 1 
        355 1 . . . . . 4.31 1.8 4.96 1 1 
        356 1 . . . . . 4.62 1.8 5.31 1 1 
        357 1 . . . . . 3.16 1.8 3.63 1 1 
        358 1 . . . . . 4.21 1.8 4.84 1 1 
        359 1 . . . . . 4.84 1.8 5.57 1 1 
        360 1 . . . . . 4.84 1.8 5.57 1 1 
        361 1 . . . . . 4.65 1.8 5.35 1 1 
        362 1 . . . . . 4.65 1.8 5.35 1 1 
        363 1 . . . . . 4.78 1.8  5.5 1 1 
        364 1 . . . . . 4.78 1.8  5.5 1 1 
        365 1 . . . . . 4.76 1.8 5.47 1 1 
        366 1 . . . . . 4.76 1.8 5.47 1 1 
        367 1 . . . . . 5.22 1.8  6.0 1 1 
        368 1 . . . . . 5.22 1.8  6.0 1 1 
        369 1 . . . . . 4.47 1.8 5.14 1 1 
        370 1 . . . . . 4.69 1.8 5.39 1 1 
        371 1 . . . . . 4.01 1.8 4.61 1 1 
        372 1 . . . . . 4.01 1.8 4.61 1 1 
        373 1 . . . . . 4.79 1.8 5.51 1 1 
        374 1 . . . . . 4.57 1.8 5.26 1 1 
        375 1 . . . . .  4.7 1.8  5.4 1 1 
        376 1 . . . . . 4.57 1.8 5.26 1 1 
        377 1 . . . . .  4.7 1.8  5.4 1 1 
        378 1 . . . . .  5.1 1.8 5.87 1 1 
        379 1 . . . . . 4.94 1.8 5.68 1 1 
        380 1 . . . . . 4.94 1.8 5.68 1 1 
        381 1 . . . . . 5.26 1.8 6.05 1 1 
        382 1 . . . . . 4.06 1.8 4.67 1 1 
        383 1 . . . . . 4.06 1.8 4.67 1 1 
        384 1 . . . . . 5.05 1.8 5.81 1 1 
        385 1 . . . . . 5.05 1.8 5.81 1 1 
        386 1 . . . . .  5.6 1.8 6.44 1 1 
        387 1 . . . . .  5.6 1.8 6.44 1 1 
        388 1 . . . . . 5.22 1.8  6.0 1 1 
        389 1 . . . . . 5.22 1.8  6.0 1 1 
        390 1 . . . . .  4.0 1.8  4.6 1 1 
        391 1 . . . . .  4.0 1.8  4.6 1 1 
        392 1 . . . . . 3.59 1.8 4.13 1 1 
        393 1 . . . . . 3.86 1.8 4.44 1 1 
        394 1 . . . . . 3.24 1.8 3.73 1 1 
        395 1 . . . . . 4.88 1.8 5.61 1 1 
        396 1 . . . . . 4.88 1.8 5.61 1 1 
        397 1 . . . . . 4.83 1.8 5.55 1 1 
        398 1 . . . . . 3.93 1.8 4.52 1 1 
        399 1 . . . . . 3.93 1.8 4.52 1 1 
        400 1 . . . . . 4.21 1.8 4.84 1 1 
        401 1 . . . . . 3.86 1.8 4.44 1 1 
        402 1 . . . . . 3.45 1.8 3.97 1 1 
        403 1 . . . . .  3.1 1.8 3.57 1 1 
        404 1 . . . . . 3.76 1.8 4.32 1 1 
        405 1 . . . . . 3.76 1.8 4.32 1 1 
        406 1 . . . . . 3.72 1.8 4.28 1 1 
        407 1 . . . . . 4.07 1.8 4.68 1 1 
        408 1 . . . . . 3.08 1.8 3.54 1 1 
        409 1 . . . . . 4.77 1.8 5.49 1 1 
        410 1 . . . . . 3.79 1.8 4.36 1 1 
        411 1 . . . . . 3.79 1.8 4.36 1 1 
        412 1 . . . . . 3.34 1.8 3.84 1 1 
        413 1 . . . . . 3.34 1.8 3.84 1 1 
        414 1 . . . . . 3.66 1.8 4.21 1 1 
        415 1 . . . . . 3.69 1.8 4.24 1 1 
        416 1 . . . . . 3.69 1.8 4.24 1 1 
        417 1 . . . . . 3.36 1.8 3.86 1 1 
        418 1 . . . . . 3.36 1.8 3.86 1 1 
        419 1 . . . . . 3.23 1.8 3.71 1 1 
        420 1 . . . . . 3.23 1.8 3.71 1 1 
        421 1 . . . . . 4.48 1.8 5.15 1 1 
        422 1 . . . . . 4.42 1.8 5.08 1 1 
        423 1 . . . . . 4.32 1.8 4.97 1 1 
        424 1 . . . . . 3.19 1.8 3.67 1 1 
        425 1 . . . . .  3.9 1.8 4.49 1 1 
        426 1 . . . . . 3.53 1.8 4.06 1 1 
        427 1 . . . . . 3.53 1.8 4.06 1 1 
        428 1 . . . . . 3.74 1.8  4.3 1 1 
        429 1 . . . . . 2.87 1.8  3.3 1 1 
        430 1 . . . . . 3.63 1.8 4.17 1 1 
        431 1 . . . . . 3.63 1.8 4.17 1 1 
        432 1 . . . . . 6.08 1.8 6.99 1 1 
        433 1 . . . . . 6.08 1.8 6.99 1 1 
        434 1 . . . . . 3.51 1.8 4.04 1 1 
        435 1 . . . . . 3.51 1.8 4.04 1 1 
        436 1 . . . . . 4.48 1.8 5.15 1 1 
        437 1 . . . . . 4.48 1.8 5.15 1 1 
        438 1 . . . . . 5.23 1.8 6.01 1 1 
        439 1 . . . . .  3.0 1.8 3.45 1 1 
        440 1 . . . . . 3.22 1.8  3.7 1 1 
        441 1 . . . . . 3.22 1.8  3.7 1 1 
        442 1 . . . . . 3.77 1.8 4.34 1 1 
        443 1 . . . . .  3.1 1.8 3.57 1 1 
        444 1 . . . . . 3.92 1.8 4.51 1 1 
        445 1 . . . . . 3.92 1.8 4.51 1 1 
        446 1 . . . . . 5.01 1.8 5.76 1 1 
        447 1 . . . . . 3.73 1.8 4.29 1 1 
        448 1 . . . . . 3.73 1.8 4.29 1 1 
        449 1 . . . . . 5.26 1.8 6.05 1 1 
        450 1 . . . . . 5.26 1.8 6.05 1 1 
        451 1 . . . . . 3.76 1.8 4.32 1 1 
        452 1 . . . . . 3.89 1.8 4.47 1 1 
        453 1 . . . . . 4.17 1.8  4.8 1 1 
        454 1 . . . . . 4.46 1.8 5.13 1 1 
        455 1 . . . . . 3.71 1.8 4.27 1 1 
        456 1 . . . . . 3.86 1.8 4.44 1 1 
        457 1 . . . . . 3.86 1.8 4.44 1 1 
        458 1 . . . . . 3.51 1.8 4.04 1 1 
        459 1 . . . . . 5.15 1.8 5.92 1 1 
        460 1 . . . . . 3.79 1.8 4.36 1 1 
        461 1 . . . . . 3.79 1.8 4.36 1 1 
        462 1 . . . . . 5.52 1.8 6.35 1 1 
        463 1 . . . . . 5.52 1.8 6.35 1 1 
        464 1 . . . . .  3.3 1.8  3.8 1 1 
        465 1 . . . . . 3.92 1.8 4.51 1 1 
        466 1 . . . . . 3.21 1.8 3.69 1 1 
        467 1 . . . . . 4.04 1.8 4.65 1 1 
        468 1 . . . . . 4.33 1.8 4.98 1 1 
        469 1 . . . . . 3.67 1.8 4.22 1 1 
        470 1 . . . . . 3.81 1.8 4.38 1 1 
        471 1 . . . . . 3.81 1.8 4.38 1 1 
        472 1 . . . . .  3.7 1.8 4.26 1 1 
        473 1 . . . . .  3.7 1.8 4.26 1 1 
        474 1 . . . . . 3.87 1.8 4.45 1 1 
        475 1 . . . . . 3.87 1.8 4.45 1 1 
        476 1 . . . . . 3.48 1.8  4.0 1 1 
        477 1 . . . . . 4.31 1.8 4.96 1 1 
        478 1 . . . . . 3.18 1.8 3.66 1 1 
        479 1 . . . . . 3.72 1.8 4.28 1 1 
        480 1 . . . . . 3.38 1.8 3.89 1 1 
        481 1 . . . . . 3.38 1.8 3.89 1 1 
        482 1 . . . . . 4.09 1.8  4.7 1 1 
        483 1 . . . . . 4.33 1.8 4.98 1 1 
        484 1 . . . . . 3.59 1.8 4.13 1 1 
        485 1 . . . . . 3.59 1.8 4.13 1 1 
        486 1 . . . . . 4.15 1.8 4.77 1 1 
        487 1 . . . . . 4.15 1.8 4.77 1 1 
        488 1 . . . . . 3.48 1.8  4.0 1 1 
        489 1 . . . . . 3.48 1.8  4.0 1 1 
        490 1 . . . . . 3.89 1.8 4.47 1 1 
        491 1 . . . . . 4.01 1.8 4.61 1 1 
        492 1 . . . . . 4.01 1.8 4.61 1 1 
        493 1 . . . . .  6.2 1.8 7.13 1 1 
        494 1 . . . . .  6.2 1.8 7.13 1 1 
        495 1 . . . . . 3.71 1.8 4.27 1 1 
        496 1 . . . . . 3.71 1.8 4.27 1 1 
        497 1 . . . . . 5.85 1.8 6.73 1 1 
        498 1 . . . . . 5.85 1.8 6.73 1 1 
        499 1 . . . . . 3.83 1.8  4.4 1 1 
        500 1 . . . . . 2.81 1.8 3.23 1 1 
        501 1 . . . . . 3.91 1.8  4.5 1 1 
        502 1 . . . . . 3.37 1.8 3.88 1 1 
        503 1 . . . . . 2.62 1.8 3.01 1 1 
        504 1 . . . . . 3.74 1.8  4.3 1 1 
        505 1 . . . . . 3.74 1.8  4.3 1 1 
        506 1 . . . . . 4.06 1.8 4.67 1 1 
        507 1 . . . . . 4.06 1.8 4.67 1 1 
        508 1 . . . . .  3.3 1.8  3.8 1 1 
        509 1 . . . . . 3.62 1.8 4.16 1 1 
        510 1 . . . . . 5.13 1.8  5.9 1 1 
        511 1 . . . . . 4.11 1.8 4.73 1 1 
        512 1 . . . . . 4.11 1.8 4.73 1 1 
        513 1 . . . . . 4.12 1.8 4.74 1 1 
        514 1 . . . . . 4.12 1.8 4.74 1 1 
        515 1 . . . . . 5.37 1.8 6.18 1 1 
        516 1 . . . . . 5.37 1.8 6.18 1 1 
        517 1 . . . . . 3.21 1.8 3.69 1 1 
        518 1 . . . . . 3.62 1.8 4.16 1 1 
        519 1 . . . . . 3.88 1.8 4.46 1 1 
        520 1 . . . . . 3.69 1.8 4.24 1 1 
        521 1 . . . . . 4.14 1.8 4.76 1 1 
        522 1 . . . . . 4.14 1.8 4.76 1 1 
        523 1 . . . . . 4.68 1.8 5.38 1 1 
        524 1 . . . . .  4.1 1.8 4.72 1 1 
        525 1 . . . . . 3.42 1.8 3.93 1 1 
        526 1 . . . . .  3.5 1.8 4.03 1 1 
        527 1 . . . . . 4.17 1.8  4.8 1 1 
        528 1 . . . . . 4.17 1.8  4.8 1 1 
        529 1 . . . . . 3.35 1.8 3.85 1 1 
        530 1 . . . . . 3.48 1.8  4.0 1 1 
        531 1 . . . . . 4.01 1.8 4.61 1 1 
        532 1 . . . . . 4.01 1.8 4.61 1 1 
        533 1 . . . . .  3.1 1.8 3.57 1 1 
        534 1 . . . . . 2.97 1.8 3.42 1 1 
        535 1 . . . . . 4.32 1.8 4.97 1 1 
        536 1 . . . . . 4.08 1.8 4.69 1 1 
        537 1 . . . . . 4.08 1.8 4.69 1 1 
        538 1 . . . . . 3.71 1.8 4.27 1 1 
        539 1 . . . . . 3.71 1.8 4.27 1 1 
        540 1 . . . . . 4.45 1.8 5.12 1 1 
        541 1 . . . . . 3.53 1.8 4.06 1 1 
        542 1 . . . . . 3.53 1.8 4.06 1 1 
        543 1 . . . . . 3.69 1.8 4.24 1 1 
        544 1 . . . . . 3.69 1.8 4.24 1 1 
        545 1 . . . . . 3.18 1.8 3.66 1 1 
        546 1 . . . . . 3.79 1.8 4.36 1 1 
        547 1 . . . . . 3.36 1.8 3.86 1 1 
        548 1 . . . . . 3.66 1.8 4.21 1 1 
        549 1 . . . . . 3.66 1.8 4.21 1 1 
        550 1 . . . . . 3.18 1.8 3.66 1 1 
        551 1 . . . . . 3.52 1.8 4.05 1 1 
        552 1 . . . . . 3.58 1.8 4.12 1 1 
        553 1 . . . . . 3.01 1.8 3.46 1 1 
        554 1 . . . . . 3.01 1.8 3.46 1 1 
        555 1 . . . . . 3.97 1.8 4.57 1 1 
        556 1 . . . . . 4.66 1.8 5.36 1 1 
        557 1 . . . . .  4.4 1.8 5.06 1 1 
        558 1 . . . . .  3.5 1.8 4.03 1 1 
        559 1 . . . . .  3.5 1.8 4.03 1 1 
        560 1 . . . . .  3.6 1.8 4.14 1 1 
        561 1 . . . . .  3.6 1.8 4.14 1 1 
        562 1 . . . . . 4.21 1.8 4.84 1 1 
        563 1 . . . . . 3.73 1.8 4.29 1 1 
        564 1 . . . . . 3.73 1.8 4.29 1 1 
        565 1 . . . . . 3.15 1.8 3.62 1 1 
        566 1 . . . . . 3.98 1.8 4.58 1 1 
        567 1 . . . . . 3.65 1.8  4.2 1 1 
        568 1 . . . . .  3.7 1.8 4.26 1 1 
        569 1 . . . . .  3.7 1.8 4.26 1 1 
        570 1 . . . . . 3.59 1.8 4.13 1 1 
        571 1 . . . . . 3.59 1.8 4.13 1 1 
        572 1 . . . . . 2.87 1.8  3.3 1 1 
        573 1 . . . . . 3.49 1.8 4.01 1 1 
        574 1 . . . . . 3.26 1.8 3.75 1 1 
        575 1 . . . . . 3.03 1.8 3.48 1 1 
        576 1 . . . . .  4.2 1.8 4.83 1 1 
        577 1 . . . . . 4.57 1.8 5.26 1 1 
        578 1 . . . . . 3.53 1.8 4.06 1 1 
        579 1 . . . . . 3.53 1.8 4.06 1 1 
        580 1 . . . . . 3.46 1.8 3.98 1 1 
        581 1 . . . . . 3.72 1.8 4.28 1 1 
        582 1 . . . . . 3.72 1.8 4.28 1 1 
        583 1 . . . . . 4.12 1.8 4.74 1 1 
        584 1 . . . . . 4.12 1.8 4.74 1 1 
        585 1 . . . . .  4.6 1.8 5.29 1 1 
        586 1 . . . . .  4.6 1.8 5.29 1 1 
        587 1 . . . . .  6.2 1.8 7.13 1 1 
        588 1 . . . . .  6.2 1.8 7.13 1 1 
        589 1 . . . . . 3.77 1.8 4.34 1 1 
        590 1 . . . . . 3.77 1.8 4.34 1 1 
        591 1 . . . . . 3.14 1.8 3.61 1 1 
        592 1 . . . . .  4.5 1.8 5.18 1 1 
        593 1 . . . . . 3.89 1.8 4.47 1 1 
        594 1 . . . . . 3.98 1.8 4.58 1 1 
        595 1 . . . . . 3.98 1.8 4.58 1 1 
        596 1 . . . . . 3.57 1.8 4.11 1 1 
        597 1 . . . . . 4.05 1.8 4.66 1 1 
        598 1 . . . . . 4.05 1.8 4.66 1 1 
        599 1 . . . . . 4.82 1.8 5.54 1 1 
        600 1 . . . . . 4.82 1.8 5.54 1 1 
        601 1 . . . . . 3.51 1.8 4.04 1 1 
        602 1 . . . . . 3.81 1.8 4.38 1 1 
        603 1 . . . . . 3.46 1.8 3.98 1 1 
        604 1 . . . . . 3.97 1.8 4.57 1 1 
        605 1 . . . . . 4.41 1.8 5.07 1 1 
        606 1 . . . . . 3.67 1.8 4.22 1 1 
        607 1 . . . . . 3.67 1.8 4.22 1 1 
        608 1 . . . . . 4.69 1.8 5.39 1 1 
        609 1 . . . . .  4.4 1.8 5.06 1 1 
        610 1 . . . . . 3.61 1.8 4.15 1 1 
        611 1 . . . . . 3.61 1.8 4.15 1 1 
        612 1 . . . . . 4.68 1.8 5.38 1 1 
        613 1 . . . . . 4.15 1.8 4.77 1 1 
        614 1 . . . . . 3.65 1.8  4.2 1 1 
        615 1 . . . . . 3.53 1.8 4.06 1 1 
        616 1 . . . . . 3.58 1.8 4.12 1 1 
        617 1 . . . . . 4.04 1.8 4.65 1 1 
        618 1 . . . . . 4.04 1.8 4.65 1 1 
        619 1 . . . . . 4.17 1.8  4.8 1 1 
        620 1 . . . . . 4.17 1.8  4.8 1 1 
        621 1 . . . . . 3.75 1.8 4.31 1 1 
        622 1 . . . . . 3.75 1.8 4.31 1 1 
        623 1 . . . . . 3.59 1.8 4.13 1 1 
        624 1 . . . . . 3.59 1.8 4.13 1 1 
        625 1 . . . . .  3.3 1.8  3.8 1 1 
        626 1 . . . . .  3.3 1.8  3.8 1 1 
        627 1 . . . . . 5.09 1.8 5.85 1 1 
        628 1 . . . . . 5.09 1.8 5.85 1 1 
        629 1 . . . . . 4.03 1.8 4.63 1 1 
        630 1 . . . . . 4.03 1.8 4.63 1 1 
        631 1 . . . . . 4.52 1.8  5.2 1 1 
        632 1 . . . . . 4.52 1.8  5.2 1 1 
        633 1 . . . . .  3.8 1.8 4.37 1 1 
        634 1 . . . . .  3.8 1.8 4.37 1 1 
        635 1 . . . . . 3.45 1.8 3.97 1 1 
        636 1 . . . . . 3.73 1.8 4.29 1 1 
        637 1 . . . . . 3.73 1.8 4.29 1 1 
        638 1 . . . . . 4.36 1.8 5.01 1 1 
        639 1 . . . . . 3.64 1.8 4.19 1 1 
        640 1 . . . . . 3.64 1.8 4.19 1 1 
        641 1 . . . . . 3.26 1.8 3.75 1 1 
        642 1 . . . . . 3.26 1.8 3.75 1 1 
        643 1 . . . . . 4.29 1.8 4.93 1 1 
        644 1 . . . . . 3.26 1.8 3.75 1 1 
        645 1 . . . . . 3.26 1.8 3.75 1 1 
        646 1 . . . . . 4.48 1.8 5.15 1 1 
        647 1 . . . . . 4.48 1.8 5.15 1 1 
        648 1 . . . . . 3.49 1.8 4.01 1 1 
        649 1 . . . . . 3.83 1.8  4.4 1 1 
        650 1 . . . . . 3.56 1.8 4.09 1 1 
        651 1 . . . . .  4.1 1.8 4.72 1 1 
        652 1 . . . . . 3.49 1.8 4.01 1 1 
        653 1 . . . . . 3.34 1.8 3.84 1 1 
        654 1 . . . . . 3.87 1.8 4.45 1 1 
        655 1 . . . . . 3.93 1.8 4.52 1 1 
        656 1 . . . . . 3.93 1.8 4.52 1 1 
        657 1 . . . . . 4.35 1.8  5.0 1 1 
        658 1 . . . . . 3.72 1.8 4.28 1 1 
        659 1 . . . . . 3.72 1.8 4.28 1 1 
        660 1 . . . . . 3.81 1.8 4.38 1 1 
        661 1 . . . . . 3.81 1.8 4.38 1 1 
        662 1 . . . . . 4.05 1.8 4.66 1 1 
        663 1 . . . . . 4.05 1.8 4.66 1 1 
        664 1 . . . . . 4.13 1.8 4.75 1 1 
        665 1 . . . . . 4.13 1.8 4.75 1 1 
        666 1 . . . . . 4.03 1.8 4.63 1 1 
        667 1 . . . . . 3.94 1.8 4.53 1 1 
        668 1 . . . . . 3.94 1.8 4.53 1 1 
        669 1 . . . . . 3.43 1.8 3.94 1 1 
        670 1 . . . . . 3.04 1.8  3.5 1 1 
        671 1 . . . . . 3.92 1.8 4.51 1 1 
        672 1 . . . . . 3.92 1.8 4.51 1 1 
        673 1 . . . . . 4.76 1.8 5.47 1 1 
        674 1 . . . . .  3.7 1.8 4.26 1 1 
        675 1 . . . . . 4.89 1.8 5.62 1 1 
        676 1 . . . . . 3.94 1.8 4.53 1 1 
        677 1 . . . . . 2.91 1.8 3.35 1 1 
        678 1 . . . . . 4.02 1.8 4.62 1 1 
        679 1 . . . . . 3.84 1.8 4.42 1 1 
        680 1 . . . . . 3.63 1.8 4.17 1 1 
        681 1 . . . . . 3.63 1.8 4.17 1 1 
        682 1 . . . . . 3.61 1.8 4.15 1 1 
        683 1 . . . . . 3.61 1.8 4.15 1 1 
        684 1 . . . . . 3.94 1.8 4.53 1 1 
        685 1 . . . . . 3.94 1.8 4.53 1 1 
        686 1 . . . . . 2.86 1.8 3.29 1 1 
        687 1 . . . . . 3.68 1.8 4.23 1 1 
        688 1 . . . . . 3.32 1.8 3.82 1 1 
        689 1 . . . . . 3.66 1.8 4.21 1 1 
        690 1 . . . . . 3.87 1.8 4.45 1 1 
        691 1 . . . . . 4.64 1.8 5.34 1 1 
        692 1 . . . . . 5.66 1.8 6.51 1 1 
        693 1 . . . . . 2.97 1.8 3.42 1 1 
        694 1 . . . . . 3.86 1.8 4.44 1 1 
        695 1 . . . . .  3.8 1.8 4.37 1 1 
        696 1 . . . . .  3.8 1.8 4.37 1 1 
        697 1 . . . . . 3.79 1.8 4.36 1 1 
        698 1 . . . . . 3.02 1.8 3.47 1 1 
        699 1 . . . . . 3.87 1.8 4.45 1 1 
        700 1 . . . . . 2.93 1.8 3.37 1 1 
        701 1 . . . . . 3.72 1.8 4.28 1 1 
        702 1 . . . . . 3.72 1.8 4.28 1 1 
        703 1 . . . . . 4.07 1.8 4.68 1 1 
        704 1 . . . . . 4.07 1.8 4.68 1 1 
        705 1 . . . . . 3.72 1.8 4.28 1 1 
        706 1 . . . . . 4.17 1.8  4.8 1 1 
        707 1 . . . . . 3.72 1.8 4.28 1 1 
        708 1 . . . . . 4.17 1.8  4.8 1 1 
        709 1 . . . . . 3.72 1.8 4.28 1 1 
        710 1 . . . . . 3.72 1.8 4.28 1 1 
        711 1 . . . . . 4.22 1.8 4.85 1 1 
        712 1 . . . . . 3.82 1.8 4.39 1 1 
        713 1 . . . . . 3.82 1.8 4.39 1 1 
        714 1 . . . . . 3.68 1.8 4.23 1 1 
        715 1 . . . . . 3.68 1.8 4.23 1 1 
        716 1 . . . . . 3.78 1.8 4.35 1 1 
        717 1 . . . . . 3.78 1.8 4.35 1 1 
        718 1 . . . . . 4.54 1.8 5.22 1 1 
        719 1 . . . . . 5.92 1.8 6.81 1 1 
        720 1 . . . . . 5.92 1.8 6.81 1 1 
        721 1 . . . . . 5.13 1.8  5.9 1 1 
        722 1 . . . . .  4.0 1.8  4.6 1 1 
        723 1 . . . . .  4.0 1.8  4.6 1 1 
        724 1 . . . . . 4.24 1.8 4.88 1 1 
        725 1 . . . . . 4.24 1.8 4.88 1 1 
        726 1 . . . . .  4.3 1.8 4.95 1 1 
        727 1 . . . . .  4.7 1.8  5.4 1 1 
        728 1 . . . . .  4.2 1.8 4.83 1 1 
        729 1 . . . . . 3.57 1.8 4.11 1 1 
        730 1 . . . . . 3.29 1.8 3.78 1 1 
        731 1 . . . . .  3.4 1.8 3.91 1 1 
        732 1 . . . . .  3.0 1.8 3.45 1 1 
        733 1 . . . . . 3.42 1.8 3.93 1 1 
        734 1 . . . . . 3.13 1.8  3.6 1 1 
        735 1 . . . . . 3.64 1.8 4.19 1 1 
        736 1 . . . . . 4.56 1.8 5.24 1 1 
        737 1 . . . . . 4.54 1.8 5.22 1 1 
        738 1 . . . . . 5.55 1.8 6.38 1 1 
        739 1 . . . . . 3.07 1.8 3.53 1 1 
        740 1 . . . . . 3.42 1.8 3.93 1 1 
        741 1 . . . . . 3.33 1.8 3.83 1 1 
        742 1 . . . . . 3.15 1.8 3.62 1 1 
        743 1 . . . . . 2.69 1.8 3.09 1 1 
        744 1 . . . . . 3.31 1.8 3.81 1 1 
        745 1 . . . . . 3.21 1.8 3.69 1 1 
        746 1 . . . . .  5.9 1.8 6.79 1 1 
        747 1 . . . . . 4.68 1.8 5.38 1 1 
        748 1 . . . . . 4.67 1.8 5.37 1 1 
        749 1 . . . . .  2.9 1.8 3.34 1 1 
        750 1 . . . . . 3.16 1.8 3.63 1 1 
        751 1 . . . . . 3.16 1.8 3.63 1 1 
        752 1 . . . . . 3.39 1.8  3.9 1 1 
        753 1 . . . . . 3.34 1.8 3.84 1 1 
        754 1 . . . . . 3.42 1.8 3.93 1 1 
        755 1 . . . . . 3.34 1.8 3.84 1 1 
        756 1 . . . . . 4.56 1.8 5.24 1 1 
        757 1 . . . . . 4.41 1.8 5.07 1 1 
        758 1 . . . . . 4.71 1.8 5.42 1 1 
        759 1 . . . . . 4.68 1.8 5.38 1 1 
        760 1 . . . . . 4.77 1.8 5.49 1 1 
        761 1 . . . . .  4.4 1.8 5.06 1 1 
        762 1 . . . . . 3.62 1.8 4.16 1 1 
        763 1 . . . . . 4.45 1.8 5.12 1 1 
        764 1 . . . . .  3.4 1.8 3.91 1 1 
        765 1 . . . . . 3.31 1.8 3.81 1 1 
        766 1 . . . . . 3.46 1.8 3.98 1 1 
        767 1 . . . . . 3.23 1.8 3.71 1 1 
        768 1 . . . . . 3.03 1.8 3.48 1 1 
        769 1 . . . . . 4.17 1.8  4.8 1 1 
        770 1 . . . . . 3.85 1.8 4.43 1 1 
        771 1 . . . . . 5.21 1.8 5.99 1 1 
        772 1 . . . . . 4.66 1.8 5.36 1 1 
        773 1 . . . . . 4.59 1.8 5.28 1 1 
        774 1 . . . . . 3.34 1.8 3.84 1 1 
        775 1 . . . . . 3.01 1.8 3.46 1 1 
        776 1 . . . . . 2.68 1.8 3.08 1 1 
        777 1 . . . . . 3.35 1.8 3.85 1 1 
        778 1 . . . . . 3.32 1.8 3.82 1 1 
        779 1 . . . . . 3.61 1.8 4.15 1 1 
        780 1 . . . . . 3.32 1.8 3.82 1 1 
        781 1 . . . . . 4.44 1.8 5.11 1 1 
        782 1 . . . . . 4.88 1.8 5.61 1 1 
        783 1 . . . . . 4.85 1.8 5.58 1 1 
        784 1 . . . . . 4.73 1.8 5.44 1 1 
        785 1 . . . . . 4.47 1.8 5.14 1 1 
        786 1 . . . . . 3.88 1.8 4.46 1 1 
        787 1 . . . . . 4.59 1.8 5.28 1 1 
        788 1 . . . . . 4.68 1.8 5.38 1 1 
        789 1 . . . . . 4.48 1.8 5.15 1 1 
        790 1 . . . . . 3.52 1.8 4.05 1 1 
        791 1 . . . . . 4.56 1.8 5.24 1 1 
        792 1 . . . . .  4.9 1.8 5.64 1 1 
        793 1 . . . . . 4.04 1.8 4.65 1 1 
        794 1 . . . . . 4.95 1.8 5.69 1 1 
        795 1 . . . . . 3.93 1.8 4.52 1 1 
        796 1 . . . . . 4.48 1.8 5.15 1 1 
        797 1 . . . . . 4.99 1.8 5.74 1 1 
        798 1 . . . . . 4.69 1.8 5.39 1 1 
        799 1 . . . . . 3.97 1.8 4.57 1 1 
        800 1 . . . . . 4.49 1.8 5.16 1 1 
        801 1 . . . . . 5.06 1.8 5.82 1 1 
        802 1 . . . . . 4.57 1.8 5.26 1 1 
        803 1 . . . . . 3.87 1.8 4.45 1 1 
        804 1 . . . . . 3.27 1.8 3.76 1 1 
        805 1 . . . . . 5.63 1.8 6.47 1 1 
        806 1 . . . . . 5.19 1.8 5.97 1 1 
        807 1 . . . . . 4.07 1.8 4.68 1 1 
        808 1 . . . . . 4.98 1.8 5.73 1 1 
        809 1 . . . . . 4.39 1.8 5.05 1 1 
        810 1 . . . . . 4.81 1.8 5.53 1 1 
        811 1 . . . . . 3.71 1.8 4.27 1 1 
        812 1 . . . . . 3.83 1.8  4.4 1 1 
        813 1 . . . . . 5.05 1.8 5.81 1 1 
        814 1 . . . . . 4.74 1.8 5.45 1 1 
        815 1 . . . . . 3.85 1.8 4.43 1 1 
        816 1 . . . . . 4.49 1.8 5.16 1 1 
        817 1 . . . . . 4.11 1.8 4.73 1 1 
        818 1 . . . . . 4.08 1.8 4.69 1 1 
        819 1 . . . . . 4.64 1.8 5.34 1 1 
        820 1 . . . . . 4.46 1.8 5.13 1 1 
        821 1 . . . . . 4.58 1.8 5.27 1 1 
        822 1 . . . . . 4.38 1.8 5.04 1 1 
        823 1 . . . . . 3.91 1.8  4.5 1 1 
        824 1 . . . . .  4.5 1.8 5.18 1 1 
        825 1 . . . . . 4.79 1.8 5.51 1 1 
        826 1 . . . . . 3.72 1.8 4.28 1 1 
        827 1 . . . . . 4.24 1.8 4.88 1 1 
        828 1 . . . . .  3.8 1.8 4.37 1 1 
        829 1 . . . . . 4.51 1.8 5.19 1 1 
        830 1 . . . . .  3.6 1.8 4.14 1 1 
        831 1 . . . . .  5.0 1.8 5.75 1 1 
        832 1 . . . . . 5.05 1.8 5.81 1 1 
        833 1 . . . . . 4.57 1.8 5.26 1 1 
        834 1 . . . . . 4.55 1.8 5.23 1 1 
        835 1 . . . . . 4.72 1.8 5.43 1 1 
        836 1 . . . . .  4.4 1.8 5.06 1 1 
        837 1 . . . . . 4.28 1.8 4.92 1 1 
        838 1 . . . . . 4.88 1.8 5.61 1 1 
        839 1 . . . . . 4.78 1.8  5.5 1 1 
        840 1 . . . . .  4.2 1.8 4.83 1 1 
        841 1 . . . . . 4.17 1.8  4.8 1 1 
        842 1 . . . . . 4.63 1.8 5.32 1 1 
        843 1 . . . . . 4.91 1.8 5.65 1 1 
        844 1 . . . . . 5.24 1.8 6.03 1 1 
        845 1 . . . . . 3.95 1.8 4.54 1 1 
        846 1 . . . . . 4.64 1.8 5.34 1 1 
        847 1 . . . . . 4.49 1.8 5.16 1 1 
        848 1 . . . . . 5.15 1.8 5.92 1 1 
        849 1 . . . . .  4.3 1.8 4.95 1 1 
        850 1 . . . . . 4.65 1.8 5.35 1 1 
        851 1 . . . . . 4.76 1.8 5.47 1 1 
        852 1 . . . . .  3.8 1.8 4.37 1 1 
        853 1 . . . . . 4.36 1.8 5.01 1 1 
        854 1 . . . . . 4.62 1.8 5.31 1 1 
        855 1 . . . . . 4.64 1.8 5.34 1 1 
        856 1 . . . . . 5.17 1.8 5.95 1 1 
        857 1 . . . . . 4.92 1.8 5.66 1 1 
        858 1 . . . . . 4.76 1.8 5.47 1 1 
        859 1 . . . . . 3.99 1.8 4.59 1 1 
        860 1 . . . . . 4.84 1.8 5.57 1 1 
        861 1 . . . . . 4.68 1.8 5.38 1 1 
        862 1 . . . . . 4.12 1.8 4.74 1 1 
        863 1 . . . . . 4.49 1.8 5.16 1 1 
        864 1 . . . . . 4.94 1.8 5.68 1 1 
        865 1 . . . . .  4.2 1.8 4.83 1 1 
        866 1 . . . . . 4.71 1.8 5.42 1 1 
        867 1 . . . . . 3.87 1.8 4.45 1 1 
        868 1 . . . . . 4.72 1.8 5.43 1 1 
        869 1 . . . . . 4.87 1.8  5.6 1 1 
        870 1 . . . . . 3.89 1.8 4.47 1 1 
        871 1 . . . . . 5.01 1.8 5.76 1 1 
        872 1 . . . . .  5.4 1.8 6.21 1 1 
        873 1 . . . . . 3.96 1.8 4.55 1 1 
        874 1 . . . . . 3.98 1.8 4.58 1 1 
        875 1 . . . . . 4.18 1.8 4.81 1 1 
        876 1 . . . . . 4.88 1.8 5.61 1 1 
        877 1 . . . . .  4.0 1.8  4.6 1 1 
        878 1 . . . . . 4.84 1.8 5.57 1 1 
        879 1 . . . . .  4.6 1.8 5.29 1 1 
        880 1 . . . . . 4.17 1.8  4.8 1 1 
        881 1 . . . . . 4.92 1.8 5.66 1 1 
        882 1 . . . . . 4.58 1.8 5.27 1 1 
        883 1 . . . . . 3.83 1.8  4.4 1 1 
        884 1 . . . . . 4.65 1.8 5.35 1 1 
        885 1 . . . . . 4.88 1.8 5.61 1 1 
        886 1 . . . . . 3.58 1.8 4.12 1 1 
        887 1 . . . . . 4.89 1.8 5.62 1 1 
        888 1 . . . . .  4.7 1.8  5.4 1 1 
        889 1 . . . . . 4.09 1.8  4.7 1 1 
        890 1 . . . . . 4.64 1.8 5.34 1 1 
        891 1 . . . . . 4.78 1.8  5.5 1 1 
        892 1 . . . . . 4.35 1.8  5.0 1 1 
        893 1 . . . . . 5.04 1.8  5.8 1 1 
        894 1 . . . . . 4.65 1.8 5.35 1 1 
        895 1 . . . . . 4.74 1.8 5.45 1 1 
        896 1 . . . . . 4.58 1.8 5.27 1 1 
        897 1 . . . . . 4.41 1.8 5.07 1 1 
        898 1 . . . . . 4.37 1.8 5.03 1 1 
        899 1 . . . . . 3.94 1.8 4.53 1 1 
        900 1 . . . . . 4.32 1.8 4.97 1 1 
        901 1 . . . . . 3.88 1.8 4.46 1 1 
        902 1 . . . . . 4.46 1.8 5.13 1 1 
        903 1 . . . . . 4.29 1.8 4.93 1 1 
        904 1 . . . . . 4.66 1.8 5.36 1 1 
        905 1 . . . . . 3.76 1.8 4.32 1 1 
        906 1 . . . . . 4.78 1.8  5.5 1 1 
        907 1 . . . . . 4.55 1.8 5.23 1 1 
        908 1 . . . . . 4.16 1.8 4.78 1 1 
        909 1 . . . . . 3.85 1.8 4.43 1 1 
        910 1 . . . . . 4.83 1.8 5.55 1 1 
        911 1 . . . . . 5.01 1.8 5.76 1 1 
        912 1 . . . . . 3.99 1.8 4.59 1 1 
        913 1 . . . . . 4.22 1.8 4.85 1 1 
        914 1 . . . . . 4.03 1.8 4.63 1 1 
        915 1 . . . . . 5.14 1.8 5.91 1 1 
        916 1 . . . . . 4.35 1.8  5.0 1 1 
        917 1 . . . . . 4.53 1.8 5.21 1 1 
        918 1 . . . . . 3.69 1.8 4.24 1 1 
        919 1 . . . . . 5.32 1.8 6.12 1 1 
        920 1 . . . . . 4.33 1.8 4.98 1 1 
        921 1 . . . . . 3.59 1.8 4.13 1 1 
        922 1 . . . . . 4.78 1.8  5.5 1 1 
        923 1 . . . . . 4.34 1.8 4.99 1 1 
        924 1 . . . . .  4.4 1.8 5.06 1 1 
        925 1 . . . . . 5.31 1.8 6.11 1 1 
        926 1 . . . . . 5.35 1.8 6.15 1 1 
        927 1 . . . . . 4.22 1.8 4.85 1 1 
        928 1 . . . . . 5.11 1.8 5.88 1 1 
        929 1 . . . . . 5.11 1.8 5.88 1 1 
        930 1 . . . . . 4.06 1.8 4.67 1 1 
        931 1 . . . . . 6.11 1.8 7.03 1 1 
        932 1 . . . . . 4.82 1.8 5.54 1 1 
        933 1 . . . . . 4.35 1.8  5.0 1 1 
        934 1 . . . . . 4.42 1.8 5.08 1 1 
        935 1 . . . . . 3.66 1.8 4.21 1 1 
        936 1 . . . . .  3.6 1.8 4.14 1 1 
        937 1 . . . . . 5.28 1.8 6.07 1 1 
        938 1 . . . . . 4.48 1.8 5.15 1 1 
        939 1 . . . . . 4.48 1.8 5.15 1 1 
        940 1 . . . . . 4.88 1.8 5.61 1 1 
        941 1 . . . . . 5.24 1.8 6.03 1 1 
        942 1 . . . . . 4.19 1.8 4.82 1 1 
        943 1 . . . . .  6.2 1.8 7.13 1 1 
        944 1 . . . . .  6.2 1.8 7.13 1 1 
        945 1 . . . . . 4.74 1.8 5.45 1 1 
        946 1 . . . . . 4.68 1.8 5.38 1 1 
        947 1 . . . . . 4.95 1.8 5.69 1 1 
        948 1 . . . . . 3.87 1.8 4.45 1 1 
        949 1 . . . . . 5.11 1.8 5.88 1 1 
        950 1 . . . . . 5.11 1.8 5.88 1 1 
        951 1 . . . . . 6.19 1.8 7.12 1 1 
        952 1 . . . . . 6.19 1.8 7.12 1 1 
        953 1 . . . . . 4.09 1.8  4.7 1 1 
        954 1 . . . . . 3.44 1.8 3.96 1 1 
        955 1 . . . . . 4.26 1.8  4.9 1 1 
        956 1 . . . . . 5.31 1.8 6.11 1 1 
        957 1 . . . . . 4.55 1.8 5.23 1 1 
        958 1 . . . . . 4.55 1.8 5.23 1 1 
        959 1 . . . . . 5.41 1.8 6.22 1 1 
        960 1 . . . . . 3.69 1.8 4.24 1 1 
        961 1 . . . . . 4.98 1.8 5.73 1 1 
        962 1 . . . . . 5.27 1.8 6.06 1 1 
        963 1 . . . . . 4.31 1.8 4.96 1 1 
        964 1 . . . . . 4.78 1.8  5.5 1 1 
        965 1 . . . . . 4.19 1.8 4.82 1 1 
        966 1 . . . . . 4.19 1.8 4.82 1 1 
        967 1 . . . . .  5.1 1.8 5.87 1 1 
        968 1 . . . . .  5.1 1.8 5.87 1 1 
        969 1 . . . . . 4.67 1.8 5.37 1 1 
        970 1 . . . . . 5.07 1.8 5.83 1 1 
        971 1 . . . . . 5.28 1.8 6.07 1 1 
        972 1 . . . . . 4.25 1.8 4.89 1 1 
        973 1 . . . . . 5.28 1.8 6.07 1 1 
        974 1 . . . . . 5.88 1.8 6.76 1 1 
        975 1 . . . . . 5.12 1.8 5.89 1 1 
        976 1 . . . . .  4.2 1.8 4.83 1 1 
        977 1 . . . . . 4.16 1.8 4.78 1 1 
        978 1 . . . . . 5.07 1.8 5.83 1 1 
        979 1 . . . . . 3.93 1.8 4.52 1 1 
        980 1 . . . . .  5.8 1.8 6.67 1 1 
        981 1 . . . . .  5.8 1.8 6.67 1 1 
        982 1 . . . . .  5.8 1.8 6.67 1 1 
        983 1 . . . . .  5.8 1.8 6.67 1 1 
        984 1 . . . . . 4.93 1.8 5.67 1 1 
        985 1 . . . . . 3.86 1.8 4.44 1 1 
        986 1 . . . . . 5.03 1.8 5.78 1 1 
        987 1 . . . . . 5.14 1.8 5.91 1 1 
        988 1 . . . . . 5.42 1.8 6.23 1 1 
        989 1 . . . . . 4.04 1.8 4.65 1 1 
        990 1 . . . . . 4.66 1.8 5.36 1 1 
        991 1 . . . . . 3.96 1.8 4.55 1 1 
        992 1 . . . . . 4.95 1.8 5.69 1 1 
        993 1 . . . . . 4.37 1.8 5.03 1 1 
        994 1 . . . . . 5.16 1.8 5.93 1 1 
        995 1 . . . . .  5.3 1.8  6.1 1 1 
        996 1 . . . . . 3.59 1.8 4.13 1 1 
        997 1 . . . . . 4.06 1.8 4.67 1 1 
        998 1 . . . . . 4.06 1.8 4.67 1 1 
        999 1 . . . . . 4.33 1.8 4.98 1 1 
       1000 1 . . . . . 5.88 1.8 6.76 1 1 
       1001 1 . . . . . 5.84 1.8 6.72 1 1 
       1002 1 . . . . . 5.17 1.8 5.95 1 1 
       1003 1 . . . . . 3.97 1.8 4.57 1 1 
       1004 1 . . . . .  5.5 1.8 6.33 1 1 
       1005 1 . . . . .  6.2 1.8 7.13 1 1 
       1006 1 . . . . .  6.2 1.8 7.13 1 1 
       1007 1 . . . . .  6.2 1.8 7.13 1 1 
       1008 1 . . . . .  6.2 1.8 7.13 1 1 
       1009 1 . . . . . 6.09 1.8  7.0 1 1 
       1010 1 . . . . . 5.08 1.8 5.84 1 1 
       1011 1 . . . . . 4.11 1.8 4.73 1 1 
       1012 1 . . . . . 4.85 1.8 5.58 1 1 
       1013 1 . . . . . 3.51 1.8 4.04 1 1 
       1014 1 . . . . . 3.28 1.8 3.77 1 1 
       1015 1 . . . . . 4.51 1.8 5.19 1 1 
       1016 1 . . . . . 4.69 1.8 5.39 1 1 
       1017 1 . . . . . 6.07 1.8 6.98 1 1 
       1018 1 . . . . . 5.12 1.8 5.89 1 1 
       1019 1 . . . . .  5.2 1.8 5.98 1 1 
       1020 1 . . . . . 4.33 1.8 4.98 1 1 
       1021 1 . . . . . 5.16 1.8 5.93 1 1 
       1022 1 . . . . . 5.65 1.8  6.5 1 1 
       1023 1 . . . . . 5.47 1.8 6.29 1 1 
       1024 1 . . . . . 3.83 1.8  4.4 1 1 
       1025 1 . . . . . 5.42 1.8 6.23 1 1 
       1026 1 . . . . . 5.54 1.8 6.37 1 1 
       1027 1 . . . . . 5.64 1.8 6.49 1 1 
       1028 1 . . . . . 4.32 1.8 4.97 1 1 
       1029 1 . . . . . 4.98 1.8 5.73 1 1 
       1030 1 . . . . . 4.57 1.8 5.26 1 1 
       1031 1 . . . . . 4.32 1.8 4.97 1 1 
       1032 1 . . . . . 3.98 1.8 4.58 1 1 
       1033 1 . . . . .  4.7 1.8  5.4 1 1 
       1034 1 . . . . . 4.61 1.8  5.3 1 1 
       1035 1 . . . . . 4.74 1.8 5.45 1 1 
       1036 1 . . . . . 3.76 1.8 4.32 1 1 
       1037 1 . . . . . 4.06 1.8 4.67 1 1 
       1038 1 . . . . . 4.23 1.8 4.86 1 1 
       1039 1 . . . . .  3.7 1.8 4.26 1 1 
       1040 1 . . . . . 3.93 1.8 4.52 1 1 
       1041 1 . . . . . 4.35 1.8  5.0 1 1 
       1042 1 . . . . . 5.17 1.8 5.95 1 1 
       1043 1 . . . . . 5.61 1.8 6.45 1 1 
       1044 1 . . . . . 5.02 1.8 5.77 1 1 
       1045 1 . . . . . 4.29 1.8 4.93 1 1 
       1046 1 . . . . . 4.29 1.8 4.93 1 1 
       1047 1 . . . . . 5.39 1.8  6.2 1 1 
       1048 1 . . . . . 5.39 1.8  6.2 1 1 
       1049 1 . . . . . 5.39 1.8  6.2 1 1 
       1050 1 . . . . . 5.39 1.8  6.2 1 1 
       1051 1 . . . . . 5.52 1.8 6.35 1 1 
       1052 1 . . . . . 5.52 1.8 6.35 1 1 
       1053 1 . . . . . 5.23 1.8 6.01 1 1 
       1054 1 . . . . . 5.12 1.8 5.89 1 1 
       1055 1 . . . . . 5.12 1.8 5.89 1 1 
       1056 1 . . . . . 5.42 1.8 6.23 1 1 
       1057 1 . . . . . 5.96 1.8 6.85 1 1 
       1058 1 . . . . . 4.45 1.8 5.12 1 1 
       1059 1 . . . . . 5.04 1.8  5.8 1 1 
       1060 1 . . . . . 5.04 1.8  5.8 1 1 
       1061 1 . . . . . 5.27 1.8 6.06 1 1 
       1062 1 . . . . . 4.85 1.8 5.58 1 1 
       1063 1 . . . . . 4.61 1.8  5.3 1 1 
       1064 1 . . . . . 4.48 1.8 5.15 1 1 
       1065 1 . . . . . 4.48 1.8 5.15 1 1 
       1066 1 . . . . . 4.73 1.8 5.44 1 1 
       1067 1 . . . . .  5.9 1.8 6.79 1 1 
       1068 1 . . . . . 5.02 1.8 5.77 1 1 
       1069 1 . . . . . 5.01 1.8 5.76 1 1 
       1070 1 . . . . . 4.88 1.8 5.61 1 1 
       1071 1 . . . . . 4.71 1.8 5.42 1 1 
       1072 1 . . . . .  5.6 1.8 6.44 1 1 
       1073 1 . . . . . 3.78 1.8 4.35 1 1 
       1074 1 . . . . .  6.2 1.8 7.13 1 1 
       1075 1 . . . . .  6.2 1.8 7.13 1 1 
       1076 1 . . . . . 5.62 1.8 6.46 1 1 
       1077 1 . . . . . 4.88 1.8 5.61 1 1 
       1078 1 . . . . . 4.22 1.8 4.85 1 1 
       1079 1 . . . . . 3.76 1.8 4.32 1 1 
       1080 1 . . . . . 4.92 1.8 5.66 1 1 
       1081 1 . . . . . 5.73 1.8 6.59 1 1 
       1082 1 . . . . . 4.62 1.8 5.31 1 1 
       1083 1 . . . . . 5.56 1.8 6.39 1 1 
       1084 1 . . . . . 4.66 1.8 5.36 1 1 
       1085 1 . . . . . 4.62 1.8 5.31 1 1 
       1086 1 . . . . . 4.57 1.8 5.26 1 1 
       1087 1 . . . . . 5.44 1.8 6.26 1 1 
       1088 1 . . . . . 4.04 1.8 4.65 1 1 
       1089 1 . . . . . 4.56 1.8 5.24 1 1 
       1090 1 . . . . .  6.2 1.8 7.13 1 1 
       1091 1 . . . . .  6.2 1.8 7.13 1 1 
       1092 1 . . . . . 4.85 1.8 5.58 1 1 
       1093 1 . . . . .  5.5 1.8 6.33 1 1 
       1094 1 . . . . . 3.62 1.8 4.16 1 1 
       1095 1 . . . . . 5.25 1.8 6.04 1 1 
       1096 1 . . . . .  5.1 1.8 5.87 1 1 
       1097 1 . . . . . 4.69 1.8 5.39 1 1 
       1098 1 . . . . . 5.61 1.8 6.45 1 1 
       1099 1 . . . . . 4.91 1.8 5.65 1 1 
       1100 1 . . . . . 4.49 1.8 5.16 1 1 
       1101 1 . . . . .  4.3 1.8 4.95 1 1 
       1102 1 . . . . . 4.87 1.8  5.6 1 1 
       1103 1 . . . . . 4.49 1.8 5.16 1 1 
       1104 1 . . . . . 3.76 1.8 4.32 1 1 
       1105 1 . . . . . 4.01 1.8 4.61 1 1 
       1106 1 . . . . . 4.75 1.8 5.46 1 1 
       1107 1 . . . . . 4.96 1.8  5.7 1 1 
       1108 1 . . . . . 4.14 1.8 4.76 1 1 
       1109 1 . . . . . 3.76 1.8 4.32 1 1 
       1110 1 . . . . . 4.49 1.8 5.16 1 1 
       1111 1 . . . . . 3.98 1.8 4.58 1 1 
       1112 1 . . . . . 4.95 1.8 5.69 1 1 
       1113 1 . . . . .  6.2 1.8 7.13 1 1 
       1114 1 . . . . .  6.2 1.8 7.13 1 1 
       1115 1 . . . . . 5.81 1.8 6.68 1 1 
       1116 1 . . . . . 4.95 1.8 5.69 1 1 
       1117 1 . . . . . 5.12 1.8 5.89 1 1 
       1118 1 . . . . . 5.12 1.8 5.89 1 1 
       1119 1 . . . . . 4.49 1.8 5.16 1 1 
       1120 1 . . . . . 4.49 1.8 5.16 1 1 
       1121 1 . . . . . 5.03 1.8 5.78 1 1 
       1122 1 . . . . . 4.35 1.8  5.0 1 1 
       1123 1 . . . . . 4.35 1.8  5.0 1 1 
       1124 1 . . . . . 4.25 1.8 4.89 1 1 
       1125 1 . . . . . 4.23 1.8 4.86 1 1 
       1126 1 . . . . . 4.64 1.8 5.34 1 1 
       1127 1 . . . . . 5.41 1.8 6.22 1 1 
       1128 1 . . . . . 4.46 1.8 5.13 1 1 
       1129 1 . . . . . 5.89 1.8 6.77 1 1 
       1130 1 . . . . . 4.79 1.8 5.51 1 1 
       1131 1 . . . . . 5.12 1.8 5.89 1 1 
       1132 1 . . . . .  6.2 1.8 7.13 1 1 
       1133 1 . . . . . 3.68 1.8 4.23 1 1 
       1134 1 . . . . . 4.92 1.8 5.66 1 1 
       1135 1 . . . . . 5.13 1.8  5.9 1 1 
       1136 1 . . . . . 5.21 1.8 5.99 1 1 
       1137 1 . . . . . 4.89 1.8 5.62 1 1 
       1138 1 . . . . . 5.36 1.8 6.16 1 1 
       1139 1 . . . . .  6.0 1.8  6.9 1 1 
       1140 1 . . . . . 5.36 1.8 6.16 1 1 
       1141 1 . . . . .  6.0 1.8  6.9 1 1 
       1142 1 . . . . . 4.99 1.8 5.74 1 1 
       1143 1 . . . . . 4.41 1.8 5.07 1 1 
       1144 1 . . . . . 4.67 1.8 5.37 1 1 
       1145 1 . . . . . 5.45 1.8 6.27 1 1 
       1146 1 . . . . . 5.25 1.8 6.04 1 1 
       1147 1 . . . . .  5.4 1.8 6.21 1 1 
       1148 1 . . . . . 5.17 1.8 5.95 1 1 
       1149 1 . . . . . 4.51 1.8 5.19 1 1 
       1150 1 . . . . . 4.61 1.8  5.3 1 1 
       1151 1 . . . . . 4.85 1.8 5.58 1 1 
       1152 1 . . . . . 3.75 1.8 4.31 1 1 
       1153 1 . . . . .  4.1 1.8 4.72 1 1 
       1154 1 . . . . . 4.83 1.8 5.55 1 1 
       1155 1 . . . . . 4.83 1.8 5.55 1 1 
       1156 1 . . . . . 3.66 1.8 4.21 1 1 
       1157 1 . . . . . 5.27 1.8 6.06 1 1 
       1158 1 . . . . . 3.43 1.8 3.94 1 1 
       1159 1 . . . . . 5.49 1.8 6.31 1 1 
       1160 1 . . . . . 5.49 1.8 6.31 1 1 
       1161 1 . . . . . 5.72 1.8 6.58 1 1 
       1162 1 . . . . . 5.24 1.8 6.03 1 1 
       1163 1 . . . . . 5.19 1.8 5.97 1 1 
       1164 1 . . . . .  4.5 1.8 5.18 1 1 
       1165 1 . . . . .  4.2 1.8 4.83 1 1 
       1166 1 . . . . . 5.64 1.8 6.49 1 1 
       1167 1 . . . . . 4.58 1.8 5.27 1 1 
       1168 1 . . . . . 5.08 1.8 5.84 1 1 
       1169 1 . . . . . 3.61 1.8 4.15 1 1 
       1170 1 . . . . . 3.75 1.8 4.31 1 1 
       1171 1 . . . . . 4.05 1.8 4.66 1 1 
       1172 1 . . . . .  5.5 1.8 6.33 1 1 
       1173 1 . . . . . 5.23 1.8 6.01 1 1 
       1174 1 . . . . . 4.75 1.8 5.46 1 1 
       1175 1 . . . . . 4.86 1.8 5.59 1 1 
       1176 1 . . . . . 5.08 1.8 5.84 1 1 
       1177 1 . . . . . 5.08 1.8 5.84 1 1 
       1178 1 . . . . . 5.33 1.8 6.13 1 1 
       1179 1 . . . . . 5.33 1.8 6.13 1 1 
       1180 1 . . . . . 4.56 1.8 5.24 1 1 
       1181 1 . . . . . 4.31 1.8 4.96 1 1 
       1182 1 . . . . . 5.13 1.8  5.9 1 1 
       1183 1 . . . . . 5.71 1.8 6.57 1 1 
       1184 1 . . . . . 5.58 1.8 6.42 1 1 
       1185 1 . . . . . 3.76 1.8 4.32 1 1 
       1186 1 . . . . . 3.63 1.8 4.17 1 1 
       1187 1 . . . . . 5.43 1.8 6.24 1 1 
       1188 1 . . . . . 5.99 1.8 6.89 1 1 
       1189 1 . . . . . 5.99 1.8 6.89 1 1 
       1190 1 . . . . .  5.7 1.8 6.56 1 1 
       1191 1 . . . . .  5.7 1.8 6.56 1 1 
       1192 1 . . . . . 3.76 1.8 4.32 1 1 
       1193 1 . . . . . 4.94 1.8 5.68 1 1 
       1194 1 . . . . . 4.35 1.8  5.0 1 1 
       1195 1 . . . . .  5.0 1.8 5.75 1 1 
       1196 1 . . . . .  5.3 1.8  6.1 1 1 
       1197 1 . . . . . 5.82 1.8 6.69 1 1 
       1198 1 . . . . . 5.97 1.8 6.87 1 1 
       1199 1 . . . . . 4.99 1.8 5.74 1 1 
       1200 1 . . . . .  4.9 1.8 5.64 1 1 
       1201 1 . . . . . 5.51 1.8 6.34 1 1 
       1202 1 . . . . . 5.48 1.8  6.3 1 1 
       1203 1 . . . . . 5.54 1.8 6.37 1 1 
       1204 1 . . . . . 5.79 1.8 6.66 1 1 
       1205 1 . . . . . 6.08 1.8 6.99 1 1 
       1206 1 . . . . . 4.96 1.8  5.7 1 1 
       1207 1 . . . . . 4.72 1.8 5.43 1 1 
       1208 1 . . . . . 4.25 1.8 4.89 1 1 
       1209 1 . . . . . 5.34 1.8 6.14 1 1 
       1210 1 . . . . . 4.96 1.8  5.7 1 1 
       1211 1 . . . . . 5.43 1.8 6.24 1 1 
       1212 1 . . . . . 5.27 1.8 6.06 1 1 
       1213 1 . . . . . 5.56 1.8 6.39 1 1 
       1214 1 . . . . .  6.0 1.8  6.9 1 1 
       1215 1 . . . . . 5.23 1.8 6.01 1 1 
       1216 1 . . . . . 5.35 1.8 6.15 1 1 
       1217 1 . . . . . 5.87 1.8 6.75 1 1 
       1218 1 . . . . .  5.0 1.8 5.75 1 1 
       1219 1 . . . . . 5.41 1.8 6.22 1 1 
       1220 1 . . . . .  6.2 1.8 7.13 1 1 
       1221 1 . . . . . 4.44 1.8 5.11 1 1 
       1222 1 . . . . . 4.81 1.8 5.53 1 1 
       1223 1 . . . . . 5.14 1.8 5.91 1 1 
       1224 1 . . . . . 4.55 1.8 5.23 1 1 
       1225 1 . . . . .  6.2 1.8 7.13 1 1 
       1226 1 . . . . .  6.2 1.8 7.13 1 1 
       1227 1 . . . . . 5.29 1.8 6.08 1 1 
       1228 1 . . . . . 5.39 1.8  6.2 1 1 
       1229 1 . . . . . 5.02 1.8 5.77 1 1 
       1230 1 . . . . . 4.91 1.8 5.65 1 1 
       1231 1 . . . . . 5.96 1.8 6.85 1 1 
       1232 1 . . . . .  6.2 1.8 7.13 1 1 
       1233 1 . . . . .  6.2 1.8 7.13 1 1 
       1234 1 . . . . .  5.5 1.8 6.33 1 1 
       1235 1 . . . . . 4.78 1.8  5.5 1 1 
       1236 1 . . . . . 4.14 1.8 4.76 1 1 
       1237 1 . . . . . 5.34 1.8 6.14 1 1 
       1238 1 . . . . . 5.05 1.8 5.81 1 1 
       1239 1 . . . . . 5.08 1.8 5.84 1 1 
       1240 1 . . . . . 5.75 1.8 6.61 1 1 
       1241 1 . . . . . 5.34 1.8 6.14 1 1 
       1242 1 . . . . . 3.83 1.8  4.4 1 1 
       1243 1 . . . . . 5.03 1.8 5.78 1 1 
       1244 1 . . . . . 4.48 1.8 5.15 1 1 
       1245 1 . . . . . 4.38 1.8 5.04 1 1 
       1246 1 . . . . . 4.93 1.8 5.67 1 1 
       1247 1 . . . . .  5.5 1.8 6.33 1 1 
       1248 1 . . . . . 4.87 1.8  5.6 1 1 
       1249 1 . . . . . 4.69 1.8 5.39 1 1 
       1250 1 . . . . .  5.6 1.8 6.44 1 1 
       1251 1 . . . . . 4.23 1.8 4.86 1 1 
       1252 1 . . . . . 5.32 1.8 6.12 1 1 
       1253 1 . . . . . 3.66 1.8 4.21 1 1 
       1254 1 . . . . . 5.03 1.8 5.78 1 1 
       1255 1 . . . . . 5.31 1.8 6.11 1 1 
       1256 1 . . . . . 4.71 1.8 5.42 1 1 
       1257 1 . . . . . 4.08 1.8 4.69 1 1 
       1258 1 . . . . . 4.33 1.8 4.98 1 1 
       1259 1 . . . . . 4.31 1.8 4.96 1 1 
       1260 1 . . . . . 4.87 1.8  5.6 1 1 
       1261 1 . . . . . 4.87 1.8  5.6 1 1 
       1262 1 . . . . . 3.96 1.8 4.55 1 1 
       1263 1 . . . . . 3.96 1.8 4.55 1 1 
       1264 1 . . . . . 3.96 1.8 4.55 1 1 
       1265 1 . . . . . 3.96 1.8 4.55 1 1 
       1266 1 . . . . . 4.87 1.8  5.6 1 1 
       1267 1 . . . . . 4.87 1.8  5.6 1 1 
       1268 1 . . . . . 3.76 1.8 4.32 1 1 
       1269 1 . . . . . 4.29 1.8 4.93 1 1 
       1270 1 . . . . . 4.26 1.8  4.9 1 1 
       1271 1 . . . . . 3.78 1.8 4.35 1 1 
       1272 1 . . . . . 4.13 1.8 4.75 1 1 
       1273 1 . . . . . 4.28 1.8 4.92 1 1 
       1274 1 . . . . . 3.12 1.8 3.59 1 1 
       1275 1 . . . . . 3.95 1.8 4.54 1 1 
       1276 1 . . . . . 3.65 1.8  4.2 1 1 
       1277 1 . . . . . 4.06 1.8 4.67 1 1 
       1278 1 . . . . . 3.15 1.8 3.62 1 1 
       1279 1 . . . . . 3.15 1.8 3.62 1 1 
       1280 1 . . . . . 3.17 1.8 3.65 1 1 
       1281 1 . . . . . 3.65 1.8  4.2 1 1 
       1282 1 . . . . . 3.18 1.8 3.66 1 1 
       1283 1 . . . . . 4.02 1.8 4.62 1 1 
       1284 1 . . . . . 3.19 1.8 3.67 1 1 
       1285 1 . . . . . 3.19 1.8 3.67 1 1 
       1286 1 . . . . .  3.0 1.8 3.45 1 1 
       1287 1 . . . . . 5.21 1.8 5.99 1 1 
       1288 1 . . . . . 3.66 1.8 4.21 1 1 
       1289 1 . . . . . 4.11 1.8 4.73 1 1 
       1290 1 . . . . .  3.6 1.8 4.14 1 1 
       1291 1 . . . . .  3.6 1.8 4.14 1 1 
       1292 1 . . . . . 4.03 1.8 4.63 1 1 
       1293 1 . . . . . 4.11 1.8 4.73 1 1 
       1294 1 . . . . . 4.98 1.8 5.73 1 1 
       1295 1 . . . . . 3.17 1.8 3.65 1 1 
       1296 1 . . . . . 3.23 1.8 3.71 1 1 
       1297 1 . . . . . 3.23 1.8 3.71 1 1 
       1298 1 . . . . . 3.38 1.8 3.89 1 1 
       1299 1 . . . . . 3.38 1.8 3.89 1 1 
       1300 1 . . . . . 3.29 1.8 3.78 1 1 
       1301 1 . . . . . 3.86 1.8 4.44 1 1 
       1302 1 . . . . . 3.86 1.8 4.44 1 1 
       1303 1 . . . . . 3.87 1.8 4.45 1 1 
       1304 1 . . . . . 3.41 1.8 3.92 1 1 
       1305 1 . . . . . 2.49 1.8 2.86 1 1 
       1306 1 . . . . .  4.0 1.8  4.6 1 1 
       1307 1 . . . . .  4.0 1.8  4.6 1 1 
       1308 1 . . . . . 5.22 1.8  6.0 1 1 
       1309 1 . . . . . 5.22 1.8  6.0 1 1 
       1310 1 . . . . . 3.67 1.8 4.22 1 1 
       1311 1 . . . . . 3.67 1.8 4.22 1 1 
       1312 1 . . . . . 4.63 1.8 5.32 1 1 
       1313 1 . . . . . 4.07 1.8 4.68 1 1 
       1314 1 . . . . . 3.97 1.8 4.57 1 1 
       1315 1 . . . . . 4.07 1.8 4.68 1 1 
       1316 1 . . . . . 4.07 1.8 4.68 1 1 
       1317 1 . . . . . 3.97 1.8 4.57 1 1 
       1318 1 . . . . . 4.07 1.8 4.68 1 1 
       1319 1 . . . . . 4.88 1.8 5.61 1 1 
       1320 1 . . . . . 4.71 1.8 5.42 1 1 
       1321 1 . . . . . 4.71 1.8 5.42 1 1 
       1322 1 . . . . . 3.93 1.8 4.52 1 1 
       1323 1 . . . . . 3.93 1.8 4.52 1 1 
       1324 1 . . . . . 5.23 1.8 6.01 1 1 
       1325 1 . . . . . 4.88 1.8 5.61 1 1 
       1326 1 . . . . . 4.71 1.8 5.42 1 1 
       1327 1 . . . . . 4.71 1.8 5.42 1 1 
       1328 1 . . . . . 3.93 1.8 4.52 1 1 
       1329 1 . . . . .  3.7 1.8 4.26 1 1 
       1330 1 . . . . . 3.27 1.8 3.76 1 1 
       1331 1 . . . . .  3.7 1.8 4.26 1 1 
       1332 1 . . . . . 3.83 1.8  4.4 1 1 
       1333 1 . . . . .  4.0 1.8  4.6 1 1 
       1334 1 . . . . . 2.61 1.8  3.0 1 1 
       1335 1 . . . . . 3.15 1.8 3.62 1 1 
       1336 1 . . . . . 3.85 1.8 4.43 1 1 
       1337 1 . . . . . 3.85 1.8 4.43 1 1 
       1338 1 . . . . . 5.21 1.8 5.99 1 1 
       1339 1 . . . . . 5.21 1.8 5.99 1 1 
       1340 1 . . . . . 5.01 1.8 5.76 1 1 
       1341 1 . . . . . 5.21 1.8 5.99 1 1 
       1342 1 . . . . . 5.21 1.8 5.99 1 1 
       1343 1 . . . . . 5.21 1.8 5.99 1 1 
       1344 1 . . . . . 5.21 1.8 5.99 1 1 
       1345 1 . . . . . 5.07 1.8 5.83 1 1 
       1346 1 . . . . . 5.07 1.8 5.83 1 1 
       1347 1 . . . . . 3.85 1.8 4.43 1 1 
       1348 1 . . . . . 3.85 1.8 4.43 1 1 
       1349 1 . . . . . 3.76 1.8 4.32 1 1 
       1350 1 . . . . . 3.33 1.8 3.83 1 1 
       1351 1 . . . . . 3.23 1.8 3.71 1 1 
       1352 1 . . . . . 3.56 1.8 4.09 1 1 
       1353 1 . . . . . 3.09 1.8 3.55 1 1 
       1354 1 . . . . . 3.63 1.8 4.17 1 1 
       1355 1 . . . . . 3.63 1.8 4.17 1 1 
       1356 1 . . . . .  4.2 1.8 4.83 1 1 
       1357 1 . . . . .  4.2 1.8 4.83 1 1 
       1358 1 . . . . . 4.03 1.8 4.63 1 1 
       1359 1 . . . . . 4.03 1.8 4.63 1 1 
       1360 1 . . . . .  5.7 1.8 6.56 1 1 
       1361 1 . . . . . 5.26 1.8 6.05 1 1 
       1362 1 . . . . . 3.71 1.8 4.27 1 1 
       1363 1 . . . . . 4.97 1.8 5.72 1 1 
       1364 1 . . . . . 4.97 1.8 5.72 1 1 
       1365 1 . . . . . 3.92 1.8 4.51 1 1 
       1366 1 . . . . . 3.51 1.8 4.04 1 1 
       1367 1 . . . . . 3.31 1.8 3.81 1 1 
       1368 1 . . . . . 3.49 1.8 4.01 1 1 
       1369 1 . . . . . 4.71 1.8 5.42 1 1 
       1370 1 . . . . . 5.08 1.8 5.84 1 1 
       1371 1 . . . . . 5.08 1.8 5.84 1 1 
       1372 1 . . . . . 4.71 1.8 5.42 1 1 
       1373 1 . . . . . 5.29 1.8 6.08 1 1 
       1374 1 . . . . . 3.49 1.8 4.01 1 1 
       1375 1 . . . . . 4.04 1.8 4.65 1 1 
       1376 1 . . . . . 3.67 1.8 4.22 1 1 
       1377 1 . . . . . 4.08 1.8 4.69 1 1 
       1378 1 . . . . . 3.97 1.8 4.57 1 1 
       1379 1 . . . . . 3.61 1.8 4.15 1 1 
       1380 1 . . . . . 4.23 1.8 4.86 1 1 
       1381 1 . . . . . 3.99 1.8 4.59 1 1 
       1382 1 . . . . . 3.29 1.8 3.78 1 1 
       1383 1 . . . . . 3.29 1.8 3.78 1 1 
       1384 1 . . . . . 3.36 1.8 3.86 1 1 
       1385 1 . . . . . 3.36 1.8 3.86 1 1 
       1386 1 . . . . . 5.89 1.8 6.77 1 1 
       1387 1 . . . . . 5.89 1.8 6.77 1 1 
       1388 1 . . . . . 4.17 1.8  4.8 1 1 
       1389 1 . . . . . 4.17 1.8  4.8 1 1 
       1390 1 . . . . .  4.0 1.8  4.6 1 1 
       1391 1 . . . . .  4.0 1.8  4.6 1 1 
       1392 1 . . . . . 4.09 1.8  4.7 1 1 
       1393 1 . . . . .  6.2 1.8 7.13 1 1 
       1394 1 . . . . .  6.2 1.8 7.13 1 1 
       1395 1 . . . . . 4.17 1.8  4.8 1 1 
       1396 1 . . . . . 4.17 1.8  4.8 1 1 
       1397 1 . . . . . 3.29 1.8 3.78 1 1 
       1398 1 . . . . . 3.56 1.8 4.09 1 1 
       1399 1 . . . . . 3.56 1.8 4.09 1 1 
       1400 1 . . . . . 3.98 1.8 4.58 1 1 
       1401 1 . . . . . 3.98 1.8 4.58 1 1 
       1402 1 . . . . . 4.01 1.8 4.61 1 1 
       1403 1 . . . . . 4.89 1.8 5.62 1 1 
       1404 1 . . . . . 4.89 1.8 5.62 1 1 
       1405 1 . . . . . 4.01 1.8 4.61 1 1 
       1406 1 . . . . . 3.78 1.8 4.35 1 1 
       1407 1 . . . . . 3.78 1.8 4.35 1 1 
       1408 1 . . . . . 4.05 1.8 4.66 1 1 
       1409 1 . . . . . 3.14 1.8 3.61 1 1 
       1410 1 . . . . . 3.83 1.8  4.4 1 1 
       1411 1 . . . . . 3.38 1.8 3.89 1 1 
       1412 1 . . . . . 3.38 1.8 3.89 1 1 
       1413 1 . . . . . 4.06 1.8 4.67 1 1 
       1414 1 . . . . . 3.39 1.8  3.9 1 1 
       1415 1 . . . . . 3.39 1.8  3.9 1 1 
       1416 1 . . . . . 3.24 1.8 3.73 1 1 
       1417 1 . . . . . 3.82 1.8 4.39 1 1 
       1418 1 . . . . . 3.82 1.8 4.39 1 1 
       1419 1 . . . . . 3.82 1.8 4.39 1 1 
       1420 1 . . . . . 3.82 1.8 4.39 1 1 
       1421 1 . . . . . 5.45 1.8 6.27 1 1 
       1422 1 . . . . . 5.45 1.8 6.27 1 1 
       1423 1 . . . . . 4.07 1.8 4.68 1 1 
       1424 1 . . . . . 5.46 1.8 6.28 1 1 
       1425 1 . . . . . 5.31 1.8 6.11 1 1 
       1426 1 . . . . . 4.87 1.8  5.6 1 1 
       1427 1 . . . . . 3.94 1.8 4.53 1 1 
       1428 1 . . . . . 3.94 1.8 4.53 1 1 
       1429 1 . . . . . 5.46 1.8 6.28 1 1 
       1430 1 . . . . . 5.31 1.8 6.11 1 1 
       1431 1 . . . . . 4.87 1.8  5.6 1 1 
       1432 1 . . . . . 3.94 1.8 4.53 1 1 
       1433 1 . . . . . 3.94 1.8 4.53 1 1 
       1434 1 . . . . . 4.42 1.8 5.08 1 1 
       1435 1 . . . . . 3.48 1.8  4.0 1 1 
       1436 1 . . . . . 2.51 1.8 2.89 1 1 
       1437 1 . . . . . 3.54 1.8 4.07 1 1 
       1438 1 . . . . . 3.54 1.8 4.07 1 1 
       1439 1 . . . . . 4.09 1.8  4.7 1 1 
       1440 1 . . . . . 3.22 1.8  3.7 1 1 
       1441 1 . . . . . 3.64 1.8 4.19 1 1 
       1442 1 . . . . . 3.83 1.8  4.4 1 1 
       1443 1 . . . . . 4.12 1.8 4.74 1 1 
       1444 1 . . . . . 3.72 1.8 4.28 1 1 
       1445 1 . . . . . 3.86 1.8 4.44 1 1 
       1446 1 . . . . . 4.77 1.8 5.49 1 1 
       1447 1 . . . . . 2.64 1.8 3.04 1 1 
       1448 1 . . . . . 3.24 1.8 3.73 1 1 
       1449 1 . . . . . 4.11 1.8 4.73 1 1 
       1450 1 . . . . . 4.11 1.8 4.73 1 1 
       1451 1 . . . . . 3.63 1.8 4.17 1 1 
       1452 1 . . . . . 3.69 1.8 4.24 1 1 
       1453 1 . . . . . 4.41 1.8 5.07 1 1 
       1454 1 . . . . . 4.06 1.8 4.67 1 1 
       1455 1 . . . . . 3.71 1.8 4.27 1 1 
       1456 1 . . . . . 3.76 1.8 4.32 1 1 
       1457 1 . . . . .  2.4 1.8 2.76 1 1 
       1458 1 . . . . . 3.58 1.8 4.12 1 1 
       1459 1 . . . . . 4.11 1.8 4.73 1 1 
       1460 1 . . . . . 3.37 1.8 3.88 1 1 
       1461 1 . . . . . 2.75 1.8 3.16 1 1 
       1462 1 . . . . . 4.16 1.8 4.78 1 1 
       1463 1 . . . . . 3.95 1.8 4.54 1 1 
       1464 1 . . . . . 3.31 1.8 3.81 1 1 
       1465 1 . . . . . 2.73 1.8 3.14 1 1 
       1466 1 . . . . . 2.63 1.8 3.02 1 1 
       1467 1 . . . . . 3.68 1.8 4.23 1 1 
       1468 1 . . . . . 4.17 1.8  4.8 1 1 
       1469 1 . . . . . 4.45 1.8 5.12 1 1 
       1470 1 . . . . . 5.21 1.8 5.99 1 1 
       1471 1 . . . . . 5.21 1.8 5.99 1 1 
       1472 1 . . . . . 5.21 1.8 5.99 1 1 
       1473 1 . . . . . 5.21 1.8 5.99 1 1 
       1474 1 . . . . . 3.75 1.8 4.31 1 1 
       1475 1 . . . . . 3.75 1.8 4.31 1 1 
       1476 1 . . . . . 4.03 1.8 4.63 1 1 
       1477 1 . . . . . 4.07 1.8 4.68 1 1 
       1478 1 . . . . . 3.08 1.8 3.54 1 1 
       1479 1 . . . . . 3.41 1.8 3.92 1 1 
       1480 1 . . . . . 3.21 1.8 3.69 1 1 
       1481 1 . . . . . 3.41 1.8 3.92 1 1 
       1482 1 . . . . . 4.11 1.8 4.73 1 1 
       1483 1 . . . . . 4.02 1.8 4.62 1 1 
       1484 1 . . . . . 3.37 1.8 3.88 1 1 
       1485 1 . . . . . 3.41 1.8 3.92 1 1 
       1486 1 . . . . . 3.41 1.8 3.92 1 1 
       1487 1 . . . . . 2.95 1.8 3.39 1 1 
       1488 1 . . . . . 3.45 1.8 3.97 1 1 
       1489 1 . . . . . 3.45 1.8 3.97 1 1 
       1490 1 . . . . . 3.91 1.8  4.5 1 1 
       1491 1 . . . . . 3.91 1.8  4.5 1 1 
       1492 1 . . . . . 4.66 1.8 5.36 1 1 
       1493 1 . . . . . 3.62 1.8 4.16 1 1 
       1494 1 . . . . . 3.62 1.8 4.16 1 1 
       1495 1 . . . . . 4.12 1.8 4.74 1 1 
       1496 1 . . . . . 3.61 1.8 4.15 1 1 
       1497 1 . . . . . 3.72 1.8 4.28 1 1 
       1498 1 . . . . . 4.21 1.8 4.84 1 1 
       1499 1 . . . . . 4.12 1.8 4.74 1 1 
       1500 1 . . . . . 4.04 1.8 4.65 1 1 
       1501 1 . . . . . 4.58 1.8 5.27 1 1 
       1502 1 . . . . . 3.72 1.8 4.28 1 1 
       1503 1 . . . . . 3.62 1.8 4.16 1 1 
       1504 1 . . . . . 3.62 1.8 4.16 1 1 
       1505 1 . . . . . 4.27 1.8 4.91 1 1 
       1506 1 . . . . . 3.21 1.8 3.69 1 1 
       1507 1 . . . . . 3.51 1.8 4.04 1 1 
       1508 1 . . . . .  2.9 1.8 3.34 1 1 
       1509 1 . . . . . 3.36 1.8 3.86 1 1 
       1510 1 . . . . . 3.36 1.8 3.86 1 1 
       1511 1 . . . . . 4.22 1.8 4.85 1 1 
       1512 1 . . . . . 4.02 1.8 4.62 1 1 
       1513 1 . . . . . 3.32 1.8 3.82 1 1 
       1514 1 . . . . . 3.32 1.8 3.82 1 1 
       1515 1 . . . . . 3.97 1.8 4.57 1 1 
       1516 1 . . . . . 3.44 1.8 3.96 1 1 
       1517 1 . . . . . 3.65 1.8  4.2 1 1 
       1518 1 . . . . . 3.65 1.8  4.2 1 1 
       1519 1 . . . . . 3.65 1.8  4.2 1 1 
       1520 1 . . . . . 4.01 1.8 4.61 1 1 
       1521 1 . . . . . 3.54 1.8 4.07 1 1 
       1522 1 . . . . . 4.41 1.8 5.07 1 1 
       1523 1 . . . . . 2.77 1.8 3.19 1 1 
       1524 1 . . . . . 2.77 1.8 3.19 1 1 
       1525 1 . . . . . 3.31 1.8 3.81 1 1 
       1526 1 . . . . .  3.7 1.8 4.26 1 1 
       1527 1 . . . . . 4.16 1.8 4.78 1 1 
       1528 1 . . . . . 3.87 1.8 4.45 1 1 
       1529 1 . . . . . 3.43 1.8 3.94 1 1 
       1530 1 . . . . .  3.0 1.8 3.45 1 1 
       1531 1 . . . . .  3.6 1.8 4.14 1 1 
       1532 1 . . . . . 4.76 1.8 5.47 1 1 
       1533 1 . . . . . 4.72 1.8 5.43 1 1 
       1534 1 . . . . . 3.93 1.8 4.52 1 1 
       1535 1 . . . . . 3.43 1.8 3.94 1 1 
       1536 1 . . . . . 3.28 1.8 3.77 1 1 
       1537 1 . . . . . 3.59 1.8 4.13 1 1 
       1538 1 . . . . . 4.95 1.8 5.69 1 1 
       1539 1 . . . . . 4.14 1.8 4.76 1 1 
       1540 1 . . . . .  4.5 1.8 5.18 1 1 
       1541 1 . . . . . 3.22 1.8  3.7 1 1 
       1542 1 . . . . . 3.31 1.8 3.81 1 1 
       1543 1 . . . . .  3.2 1.8 3.68 1 1 
       1544 1 . . . . . 3.31 1.8 3.81 1 1 
       1545 1 . . . . . 4.89 1.8 5.62 1 1 
       1546 1 . . . . . 4.04 1.8 4.65 1 1 
       1547 1 . . . . .  4.1 1.8 4.72 1 1 
       1548 1 . . . . . 4.14 1.8 4.76 1 1 
       1549 1 . . . . . 3.99 1.8 4.59 1 1 
       1550 1 . . . . . 4.14 1.8 4.76 1 1 
       1551 1 . . . . . 3.76 1.8 4.32 1 1 
       1552 1 . . . . . 4.36 1.8 5.01 1 1 
       1553 1 . . . . . 3.53 1.8 4.06 1 1 
       1554 1 . . . . . 4.03 1.8 4.63 1 1 
       1555 1 . . . . . 4.03 1.8 4.63 1 1 
       1556 1 . . . . . 3.94 1.8 4.53 1 1 
       1557 1 . . . . . 3.94 1.8 4.53 1 1 
       1558 1 . . . . . 3.83 1.8  4.4 1 1 
       1559 1 . . . . . 3.96 1.8 4.55 1 1 
       1560 1 . . . . . 3.96 1.8 4.55 1 1 
       1561 1 . . . . . 4.97 1.8 5.72 1 1 
       1562 1 . . . . . 3.94 1.8 4.53 1 1 
       1563 1 . . . . . 4.97 1.8 5.72 1 1 
       1564 1 . . . . . 3.94 1.8 4.53 1 1 
       1565 1 . . . . . 3.77 1.8 4.34 1 1 
       1566 1 . . . . . 3.56 1.8 4.09 1 1 
       1567 1 . . . . . 3.77 1.8 4.34 1 1 
       1568 1 . . . . . 5.92 1.8 6.81 1 1 
       1569 1 . . . . . 5.92 1.8 6.81 1 1 
       1570 1 . . . . . 4.09 1.8  4.7 1 1 
       1571 1 . . . . . 4.09 1.8  4.7 1 1 
       1572 1 . . . . . 3.96 1.8 4.55 1 1 
       1573 1 . . . . . 3.96 1.8 4.55 1 1 
       1574 1 . . . . . 3.88 1.8 4.46 1 1 
       1575 1 . . . . . 3.49 1.8 4.01 1 1 
       1576 1 . . . . . 3.44 1.8 3.96 1 1 
       1577 1 . . . . . 3.79 1.8 4.36 1 1 
       1578 1 . . . . . 3.44 1.8 3.96 1 1 
       1579 1 . . . . . 3.04 1.8  3.5 1 1 
       1580 1 . . . . . 4.15 1.8 4.77 1 1 
       1581 1 . . . . . 3.48 1.8  4.0 1 1 
       1582 1 . . . . .  3.8 1.8 4.37 1 1 
       1583 1 . . . . .  3.8 1.8 4.37 1 1 
       1584 1 . . . . . 3.94 1.8 4.53 1 1 
       1585 1 . . . . . 3.94 1.8 4.53 1 1 
       1586 1 . . . . . 4.62 1.8 5.31 1 1 
       1587 1 . . . . . 5.74 1.8  6.6 1 1 
       1588 1 . . . . .  3.9 1.8 4.49 1 1 
       1589 1 . . . . .  3.9 1.8 4.49 1 1 
       1590 1 . . . . . 4.74 1.8 5.45 1 1 
       1591 1 . . . . . 4.74 1.8 5.45 1 1 
       1592 1 . . . . .  3.5 1.8 4.03 1 1 
       1593 1 . . . . . 4.01 1.8 4.61 1 1 
       1594 1 . . . . . 3.45 1.8 3.97 1 1 
       1595 1 . . . . . 4.62 1.8 5.31 1 1 
       1596 1 . . . . . 4.25 1.8 4.89 1 1 
       1597 1 . . . . . 4.89 1.8 5.62 1 1 
       1598 1 . . . . .  6.2 1.8 7.13 1 1 
       1599 1 . . . . .  6.2 1.8 7.13 1 1 
       1600 1 . . . . .  3.2 1.8 3.68 1 1 
       1601 1 . . . . . 4.04 1.8 4.65 1 1 
       1602 1 . . . . . 3.28 1.8 3.77 1 1 
       1603 1 . . . . . 4.11 1.8 4.73 1 1 
       1604 1 . . . . . 3.42 1.8 3.93 1 1 
       1605 1 . . . . . 3.84 1.8 4.42 1 1 
       1606 1 . . . . . 4.11 1.8 4.73 1 1 
       1607 1 . . . . . 3.91 1.8  4.5 1 1 
       1608 1 . . . . . 4.02 1.8 4.62 1 1 
       1609 1 . . . . .  3.3 1.8  3.8 1 1 
       1610 1 . . . . . 3.68 1.8 4.23 1 1 
       1611 1 . . . . .  3.2 1.8 3.68 1 1 
       1612 1 . . . . . 3.42 1.8 3.93 1 1 
       1613 1 . . . . . 3.42 1.8 3.93 1 1 
       1614 1 . . . . . 3.92 1.8 4.51 1 1 
       1615 1 . . . . .  6.2 1.8 7.13 1 1 
       1616 1 . . . . .  6.2 1.8 7.13 1 1 
       1617 1 . . . . . 4.64 1.8 5.34 1 1 
       1618 1 . . . . . 3.92 1.8 4.51 1 1 
       1619 1 . . . . .  6.2 1.8 7.13 1 1 
       1620 1 . . . . .  6.2 1.8 7.13 1 1 
       1621 1 . . . . .  4.0 1.8  4.6 1 1 
       1622 1 . . . . .  4.0 1.8  4.6 1 1 
       1623 1 . . . . . 3.89 1.8 4.47 1 1 
       1624 1 . . . . . 3.33 1.8 3.83 1 1 
       1625 1 . . . . . 3.09 1.8 3.55 1 1 
       1626 1 . . . . . 3.32 1.8 3.82 1 1 
       1627 1 . . . . . 2.85 1.8 3.28 1 1 
       1628 1 . . . . . 3.18 1.8 3.66 1 1 
       1629 1 . . . . . 3.09 1.8 3.55 1 1 
       1630 1 . . . . . 4.75 1.8 5.46 1 1 
       1631 1 . . . . . 4.05 1.8 4.66 1 1 
       1632 1 . . . . . 4.05 1.8 4.66 1 1 
       1633 1 . . . . . 4.75 1.8 5.46 1 1 
       1634 1 . . . . . 4.05 1.8 4.66 1 1 
       1635 1 . . . . . 4.05 1.8 4.66 1 1 
       1636 1 . . . . . 3.77 1.8 4.34 1 1 
       1637 1 . . . . . 3.77 1.8 4.34 1 1 
       1638 1 . . . . . 3.65 1.8  4.2 1 1 
       1639 1 . . . . .  4.7 1.8  5.4 1 1 
       1640 1 . . . . . 4.27 1.8 4.91 1 1 
       1641 1 . . . . . 4.24 1.8 4.88 1 1 
       1642 1 . . . . . 4.24 1.8 4.88 1 1 
       1643 1 . . . . . 4.06 1.8 4.67 1 1 
       1644 1 . . . . . 3.33 1.8 3.83 1 1 
       1645 1 . . . . . 3.33 1.8 3.83 1 1 
       1646 1 . . . . . 4.15 1.8 4.77 1 1 
       1647 1 . . . . . 4.15 1.8 4.77 1 1 
       1648 1 . . . . . 3.88 1.8 4.46 1 1 
       1649 1 . . . . . 4.54 1.8 5.22 1 1 
       1650 1 . . . . . 3.88 1.8 4.46 1 1 
       1651 1 . . . . . 5.27 1.8 6.06 1 1 
       1652 1 . . . . . 5.27 1.8 6.06 1 1 
       1653 1 . . . . . 3.76 1.8 4.32 1 1 
       1654 1 . . . . . 3.64 1.8 4.19 1 1 
       1655 1 . . . . . 3.48 1.8  4.0 1 1 
       1656 1 . . . . . 4.83 1.8 5.55 1 1 
       1657 1 . . . . . 3.48 1.8  4.0 1 1 
       1658 1 . . . . . 4.93 1.8 5.67 1 1 
       1659 1 . . . . . 3.97 1.8 4.57 1 1 
       1660 1 . . . . . 2.99 1.8 3.44 1 1 
       1661 1 . . . . . 2.99 1.8 3.44 1 1 
       1662 1 . . . . . 4.49 1.8 5.16 1 1 
       1663 1 . . . . . 4.49 1.8 5.16 1 1 
       1664 1 . . . . . 4.24 1.8 4.88 1 1 
       1665 1 . . . . . 4.41 1.8 5.07 1 1 
       1666 1 . . . . . 4.57 1.8 5.26 1 1 
       1667 1 . . . . . 4.41 1.8 5.07 1 1 
       1668 1 . . . . . 3.96 1.8 4.55 1 1 
       1669 1 . . . . . 4.17 1.8  4.8 1 1 
       1670 1 . . . . . 4.75 1.8 5.46 1 1 
       1671 1 . . . . . 5.12 1.8 5.89 1 1 
       1672 1 . . . . . 4.61 1.8  5.3 1 1 
       1673 1 . . . . . 3.56 1.8 4.09 1 1 
       1674 1 . . . . . 4.69 1.8 5.39 1 1 
       1675 1 . . . . . 3.77 1.8 4.34 1 1 
       1676 1 . . . . . 4.73 1.8 5.44 1 1 
       1677 1 . . . . .  4.0 1.8  4.6 1 1 
       1678 1 . . . . .  5.1 1.8 5.87 1 1 
       1679 1 . . . . .  5.1 1.8 5.87 1 1 
       1680 1 . . . . . 3.24 1.8 3.73 1 1 
       1681 1 . . . . . 4.51 1.8 5.19 1 1 
       1682 1 . . . . . 4.42 1.8 5.08 1 1 
       1683 1 . . . . .  5.5 1.8 6.33 1 1 
       1684 1 . . . . .  5.5 1.8 6.33 1 1 
       1685 1 . . . . . 4.78 1.8  5.5 1 1 
       1686 1 . . . . . 4.56 1.8 5.24 1 1 
       1687 1 . . . . . 4.08 1.8 4.69 1 1 
       1688 1 . . . . . 3.72 1.8 4.28 1 1 
       1689 1 . . . . . 3.27 1.8 3.76 1 1 
       1690 1 . . . . . 5.21 1.8 5.99 1 1 
       1691 1 . . . . . 5.95 1.8 6.84 1 1 
       1692 1 . . . . . 5.95 1.8 6.84 1 1 
       1693 1 . . . . . 4.58 1.8 5.27 1 1 
       1694 1 . . . . . 3.83 1.8  4.4 1 1 
       1695 1 . . . . . 5.23 1.8 6.01 1 1 
       1696 1 . . . . . 4.52 1.8  5.2 1 1 
       1697 1 . . . . . 4.59 1.8 5.28 1 1 
       1698 1 . . . . . 4.67 1.8 5.37 1 1 
       1699 1 . . . . . 5.75 1.8 6.61 1 1 
       1700 1 . . . . . 5.75 1.8 6.61 1 1 
       1701 1 . . . . . 5.53 1.8 6.36 1 1 
       1702 1 . . . . . 5.53 1.8 6.36 1 1 
       1703 1 . . . . .  6.2 1.8 7.13 1 1 
       1704 1 . . . . .  6.2 1.8 7.13 1 1 
       1705 1 . . . . . 4.88 1.8 5.61 1 1 
       1706 1 . . . . . 4.69 1.8 5.39 1 1 
       1707 1 . . . . .  5.3 1.8  6.1 1 1 
       1708 1 . . . . .  5.3 1.8  6.1 1 1 
       1709 1 . . . . .  5.2 1.8 5.98 1 1 
       1710 1 . . . . .  5.2 1.8 5.98 1 1 
       1711 1 . . . . . 5.81 1.8 6.68 1 1 
       1712 1 . . . . . 6.14 1.8 7.06 1 1 
       1713 1 . . . . . 4.68 1.8 5.38 1 1 
       1714 1 . . . . . 4.29 1.8 4.93 1 1 
       1715 1 . . . . . 3.92 1.8 4.51 1 1 
       1716 1 . . . . .  4.8 1.8 5.52 1 1 
       1717 1 . . . . .  4.8 1.8 5.52 1 1 
       1718 1 . . . . . 4.88 1.8 5.61 1 1 
       1719 1 . . . . . 4.92 1.8 5.66 1 1 
       1720 1 . . . . .  4.7 1.8  5.4 1 1 
       1721 1 . . . . . 6.07 1.8 6.98 1 1 
       1722 1 . . . . .  6.2 1.8 7.13 1 1 
       1723 1 . . . . .  6.2 1.8 7.13 1 1 
       1724 1 . . . . .  6.2 1.8 7.13 1 1 
       1725 1 . . . . .  6.2 1.8 7.13 1 1 
       1726 1 . . . . . 3.67 1.8 4.22 1 1 
       1727 1 . . . . . 5.32 1.8 6.12 1 1 
       1728 1 . . . . . 5.17 1.8 5.95 1 1 
       1729 1 . . . . . 4.36 1.8 5.01 1 1 
       1730 1 . . . . . 5.99 1.8 6.89 1 1 
       1731 1 . . . . . 5.99 1.8 6.89 1 1 
       1732 1 . . . . . 4.24 1.8 4.88 1 1 
       1733 1 . . . . . 4.24 1.8 4.88 1 1 
       1734 1 . . . . . 4.24 1.8 4.88 1 1 
       1735 1 . . . . . 4.24 1.8 4.88 1 1 
       1736 1 . . . . . 4.92 1.8 5.66 1 1 
       1737 1 . . . . .  6.2 1.8 7.13 1 1 
       1738 1 . . . . .  6.2 1.8 7.13 1 1 
       1739 1 . . . . . 4.05 1.8 4.66 1 1 
       1740 1 . . . . . 5.39 1.8  6.2 1 1 
       1741 1 . . . . . 4.08 1.8 4.69 1 1 
       1742 1 . . . . . 3.98 1.8 4.58 1 1 
       1743 1 . . . . . 3.98 1.8 4.58 1 1 
       1744 1 . . . . . 4.06 1.8 4.67 1 1 
       1745 1 . . . . . 3.62 1.8 4.16 1 1 
       1746 1 . . . . . 4.75 1.8 5.46 1 1 
       1747 1 . . . . . 4.11 1.8 4.73 1 1 
       1748 1 . . . . . 4.88 1.8 5.61 1 1 
       1749 1 . . . . .  4.8 1.8 5.52 1 1 
       1750 1 . . . . . 3.79 1.8 4.36 1 1 
       1751 1 . . . . . 5.21 1.8 5.99 1 1 
       1752 1 . . . . . 5.21 1.8 5.99 1 1 
       1753 1 . . . . . 4.31 1.8 4.96 1 1 
       1754 1 . . . . . 4.21 1.8 4.84 1 1 
       1755 1 . . . . .  6.2 1.8 7.13 1 1 
       1756 1 . . . . .  6.2 1.8 7.13 1 1 
       1757 1 . . . . . 4.91 1.8 5.65 1 1 
       1758 1 . . . . . 4.47 1.8 5.14 1 1 
       1759 1 . . . . . 4.83 1.8 5.55 1 1 
       1760 1 . . . . . 4.93 1.8 5.67 1 1 
       1761 1 . . . . . 4.79 1.8 5.51 1 1 
       1762 1 . . . . .  4.1 1.8 4.72 1 1 
       1763 1 . . . . . 4.73 1.8 5.44 1 1 
       1764 1 . . . . . 5.42 1.8 6.23 1 1 
       1765 1 . . . . . 4.61 1.8  5.3 1 1 
       1766 1 . . . . . 3.66 1.8 4.21 1 1 
       1767 1 . . . . . 4.66 1.8 5.36 1 1 
       1768 1 . . . . . 4.66 1.8 5.36 1 1 
       1769 1 . . . . . 5.17 1.8 5.95 1 1 
       1770 1 . . . . . 4.17 1.8  4.8 1 1 
       1771 1 . . . . .  4.6 1.8 5.29 1 1 
       1772 1 . . . . . 5.05 1.8 5.81 1 1 
       1773 1 . . . . . 4.25 1.8 4.89 1 1 
       1774 1 . . . . . 3.85 1.8 4.43 1 1 
       1775 1 . . . . . 3.85 1.8 4.43 1 1 
       1776 1 . . . . . 6.08 1.8 6.99 1 1 
       1777 1 . . . . . 5.62 1.8 6.46 1 1 
       1778 1 . . . . . 4.53 1.8 5.21 1 1 
       1779 1 . . . . . 4.98 1.8 5.73 1 1 
       1780 1 . . . . . 4.98 1.8 5.73 1 1 
       1781 1 . . . . . 4.77 1.8 5.49 1 1 
       1782 1 . . . . . 4.43 1.8 5.09 1 1 
       1783 1 . . . . . 4.43 1.8 5.09 1 1 
       1784 1 . . . . . 4.69 1.8 5.39 1 1 
       1785 1 . . . . . 5.16 1.8 5.93 1 1 
       1786 1 . . . . . 3.72 1.8 4.28 1 1 
       1787 1 . . . . . 5.24 1.8 6.03 1 1 
       1788 1 . . . . .  3.3 1.8  3.8 1 1 
       1789 1 . . . . . 4.25 1.8 4.89 1 1 
       1790 1 . . . . . 3.15 1.8 3.62 1 1 
       1791 1 . . . . . 3.72 1.8 4.28 1 1 
       1792 1 . . . . . 3.88 1.8 4.46 1 1 
       1793 1 . . . . . 4.13 1.8 4.75 1 1 
       1794 1 . . . . . 4.13 1.8 4.75 1 1 
       1795 1 . . . . . 3.89 1.8 4.47 1 1 
       1796 1 . . . . . 4.06 1.8 4.67 1 1 
       1797 1 . . . . . 4.06 1.8 4.67 1 1 
       1798 1 . . . . . 3.97 1.8 4.57 1 1 
       1799 1 . . . . .  3.6 1.8 4.14 1 1 
       1800 1 . . . . .  3.6 1.8 4.14 1 1 
       1801 1 . . . . .  4.9 1.8 5.64 1 1 
       1802 1 . . . . . 3.88 1.8 4.46 1 1 
       1803 1 . . . . . 5.11 1.8 5.88 1 1 
       1804 1 . . . . . 4.43 1.8 5.09 1 1 
       1805 1 . . . . . 4.94 1.8 5.68 1 1 
       1806 1 . . . . . 5.31 1.8 6.11 1 1 
       1807 1 . . . . . 4.47 1.8 5.14 1 1 
       1808 1 . . . . . 4.59 1.8 5.28 1 1 
       1809 1 . . . . . 4.59 1.8 5.28 1 1 
       1810 1 . . . . . 4.46 1.8 5.13 1 1 
       1811 1 . . . . . 4.46 1.8 5.13 1 1 
       1812 1 . . . . . 4.29 1.8 4.93 1 1 
       1813 1 . . . . . 4.29 1.8 4.93 1 1 
       1814 1 . . . . . 4.88 1.8 5.61 1 1 
       1815 1 . . . . . 5.45 1.8 6.27 1 1 
       1816 1 . . . . .  4.2 1.8 4.83 1 1 
       1817 1 . . . . . 4.89 1.8 5.62 1 1 
       1818 1 . . . . . 4.13 1.8 4.75 1 1 
       1819 1 . . . . . 4.13 1.8 4.75 1 1 
       1820 1 . . . . . 4.83 1.8 5.55 1 1 
       1821 1 . . . . . 4.84 1.8 5.57 1 1 
       1822 1 . . . . . 3.96 1.8 4.55 1 1 
       1823 1 . . . . .  4.9 1.8 5.64 1 1 
       1824 1 . . . . . 3.35 1.8 3.85 1 1 
       1825 1 . . . . . 5.79 1.8 6.66 1 1 
       1826 1 . . . . . 4.57 1.8 5.26 1 1 
       1827 1 . . . . . 4.88 1.8 5.61 1 1 
       1828 1 . . . . .  3.5 1.8 4.03 1 1 
       1829 1 . . . . . 4.11 1.8 4.73 1 1 
       1830 1 . . . . . 3.81 1.8 4.38 1 1 
       1831 1 . . . . . 4.93 1.8 5.67 1 1 
       1832 1 . . . . . 5.09 1.8 5.85 1 1 
       1833 1 . . . . . 4.05 1.8 4.66 1 1 
       1834 1 . . . . . 4.89 1.8 5.62 1 1 
       1835 1 . . . . . 4.05 1.8 4.66 1 1 
       1836 1 . . . . . 5.16 1.8 5.93 1 1 
       1837 1 . . . . . 4.41 1.8 5.07 1 1 
       1838 1 . . . . . 4.41 1.8 5.07 1 1 
       1839 1 . . . . . 4.54 1.8 5.22 1 1 
       1840 1 . . . . . 5.47 1.8 6.29 1 1 
       1841 1 . . . . . 4.54 1.8 5.22 1 1 
       1842 1 . . . . . 4.04 1.8 4.65 1 1 
       1843 1 . . . . . 4.04 1.8 4.65 1 1 
       1844 1 . . . . .  6.2 1.8 7.13 1 1 
       1845 1 . . . . .  6.2 1.8 7.13 1 1 
       1846 1 . . . . . 4.57 1.8 5.26 1 1 
       1847 1 . . . . .  4.6 1.8 5.29 1 1 
       1848 1 . . . . . 4.75 1.8 5.46 1 1 
       1849 1 . . . . . 3.78 1.8 4.35 1 1 
       1850 1 . . . . .  6.2 1.8 7.13 1 1 
       1851 1 . . . . . 5.57 1.8 6.41 1 1 
       1852 1 . . . . .  5.0 1.8 5.75 1 1 
       1853 1 . . . . .  5.4 1.8 6.21 1 1 
       1854 1 . . . . .  5.2 1.8 5.98 1 1 
       1855 1 . . . . .  5.2 1.8 5.98 1 1 
       1856 1 . . . . . 4.49 1.8 5.16 1 1 
       1857 1 . . . . .  3.3 1.8  3.8 1 1 
       1858 1 . . . . . 3.29 1.8 3.78 1 1 
       1859 1 . . . . . 5.13 1.8  5.9 1 1 
       1860 1 . . . . . 4.34 1.8 4.99 1 1 
       1861 1 . . . . . 4.34 1.8 4.99 1 1 
       1862 1 . . . . . 5.85 1.8 6.73 1 1 
       1863 1 . . . . . 5.85 1.8 6.73 1 1 
       1864 1 . . . . .  5.7 1.8 6.56 1 1 
       1865 1 . . . . . 5.13 1.8  5.9 1 1 
       1866 1 . . . . . 4.91 1.8 5.65 1 1 
       1867 1 . . . . .  6.2 1.8 7.13 1 1 
       1868 1 . . . . . 5.02 1.8 5.77 1 1 
       1869 1 . . . . .  6.2 1.8 7.13 1 1 
       1870 1 . . . . .  6.2 1.8 7.13 1 1 
       1871 1 . . . . . 4.38 1.8 5.04 1 1 
       1872 1 . . . . .  3.9 1.8 4.49 1 1 
       1873 1 . . . . . 4.32 1.8 4.97 1 1 
       1874 1 . . . . . 4.71 1.8 5.42 1 1 
       1875 1 . . . . . 5.25 1.8 6.04 1 1 
       1876 1 . . . . . 4.31 1.8 4.96 1 1 
       1877 1 . . . . . 5.29 1.8 6.08 1 1 
       1878 1 . . . . . 4.94 1.8 5.68 1 1 
       1879 1 . . . . . 5.38 1.8 6.19 1 1 
       1880 1 . . . . . 4.59 1.8 5.28 1 1 
       1881 1 . . . . . 4.59 1.8 5.28 1 1 
       1882 1 . . . . . 4.12 1.8 4.74 1 1 
       1883 1 . . . . . 3.64 1.8 4.19 1 1 
       1884 1 . . . . . 4.62 1.8 5.31 1 1 
       1885 1 . . . . . 4.58 1.8 5.27 1 1 
       1886 1 . . . . . 4.58 1.8 5.27 1 1 
       1887 1 . . . . . 5.19 1.8 5.97 1 1 
       1888 1 . . . . . 4.28 1.8 4.92 1 1 
       1889 1 . . . . . 4.42 1.8 5.08 1 1 
       1890 1 . . . . . 4.47 1.8 5.14 1 1 
       1891 1 . . . . . 4.67 1.8 5.37 1 1 
       1892 1 . . . . . 5.52 1.8 6.35 1 1 
       1893 1 . . . . . 2.86 1.8 3.29 1 1 
       1894 1 . . . . . 4.91 1.8 5.65 1 1 
       1895 1 . . . . . 4.98 1.8 5.73 1 1 
       1896 1 . . . . . 5.77 1.8 6.64 1 1 
       1897 1 . . . . .  4.9 1.8 5.64 1 1 
       1898 1 . . . . .  4.9 1.8 5.64 1 1 
       1899 1 . . . . .  4.9 1.8 5.64 1 1 
       1900 1 . . . . . 4.79 1.8 5.51 1 1 
       1901 1 . . . . . 4.79 1.8 5.51 1 1 
       1902 1 . . . . .  4.6 1.8 5.29 1 1 
       1903 1 . . . . .  4.6 1.8 5.29 1 1 
       1904 1 . . . . .  6.2 1.8 7.13 1 1 
       1905 1 . . . . .  6.2 1.8 7.13 1 1 
       1906 1 . . . . . 4.23 1.8 4.86 1 1 
       1907 1 . . . . . 4.44 1.8 5.11 1 1 
       1908 1 . . . . . 4.37 1.8 5.03 1 1 
       1909 1 . . . . .  3.4 1.8 3.91 1 1 
       1910 1 . . . . . 4.23 1.8 4.86 1 1 
       1911 1 . . . . .  4.9 1.8 5.64 1 1 
       1912 1 . . . . . 5.87 1.8 6.75 1 1 
       1913 1 . . . . . 4.24 1.8 4.88 1 1 
       1914 1 . . . . . 4.02 1.8 4.62 1 1 
       1915 1 . . . . . 4.02 1.8 4.62 1 1 
       1916 1 . . . . . 4.66 1.8 5.36 1 1 
       1917 1 . . . . . 4.85 1.8 5.58 1 1 
       1918 1 . . . . . 4.12 1.8 4.74 1 1 
       1919 1 . . . . . 4.12 1.8 4.74 1 1 
       1920 1 . . . . . 4.22 1.8 4.85 1 1 
       1921 1 . . . . .  5.5 1.8 6.33 1 1 
       1922 1 . . . . .  5.5 1.8 6.33 1 1 
       1923 1 . . . . . 4.58 1.8 5.27 1 1 
       1924 1 . . . . . 5.37 1.8 6.18 1 1 
       1925 1 . . . . . 5.65 1.8  6.5 1 1 
       1926 1 . . . . . 4.73 1.8 5.44 1 1 
       1927 1 . . . . . 5.57 1.8 6.41 1 1 
       1928 1 . . . . . 5.24 1.8 6.03 1 1 
       1929 1 . . . . . 4.73 1.8 5.44 1 1 
       1930 1 . . . . . 3.87 1.8 4.45 1 1 
       1931 1 . . . . . 4.84 1.8 5.57 1 1 
       1932 1 . . . . . 5.17 1.8 5.95 1 1 
       1933 1 . . . . . 4.44 1.8 5.11 1 1 
       1934 1 . . . . . 4.75 1.8 5.46 1 1 
       1935 1 . . . . . 5.57 1.8 6.41 1 1 
       1936 1 . . . . . 5.91 1.8  6.8 1 1 
       1937 1 . . . . . 5.27 1.8 6.06 1 1 
       1938 1 . . . . .  5.8 1.8 6.67 1 1 
       1939 1 . . . . . 4.33 1.8 4.98 1 1 
       1940 1 . . . . . 3.32 1.8 3.82 1 1 
       1941 1 . . . . . 5.02 1.8 5.77 1 1 
       1942 1 . . . . . 5.67 1.8 6.52 1 1 
       1943 1 . . . . . 4.77 1.8 5.49 1 1 
       1944 1 . . . . . 3.79 1.8 4.36 1 1 
       1945 1 . . . . . 4.92 1.8 5.66 1 1 
       1946 1 . . . . . 5.27 1.8 6.06 1 1 
       1947 1 . . . . . 5.27 1.8 6.06 1 1 
       1948 1 . . . . . 3.62 1.8 4.16 1 1 
       1949 1 . . . . . 3.99 1.8 4.59 1 1 
       1950 1 . . . . .  6.2 1.8 7.13 1 1 
       1951 1 . . . . . 4.51 1.8 5.19 1 1 
       1952 1 . . . . . 4.03 1.8 4.63 1 1 
       1953 1 . . . . . 4.03 1.8 4.63 1 1 
       1954 1 . . . . . 5.22 1.8  6.0 1 1 
       1955 1 . . . . . 5.22 1.8  6.0 1 1 
       1956 1 . . . . . 3.98 1.8 4.58 1 1 
       1957 1 . . . . . 3.98 1.8 4.58 1 1 
       1958 1 . . . . . 4.63 1.8 5.32 1 1 
       1959 1 . . . . . 4.82 1.8 5.54 1 1 
       1960 1 . . . . . 4.95 1.8 5.69 1 1 
       1961 1 . . . . . 4.55 1.8 5.23 1 1 
       1962 1 . . . . . 4.92 1.8 5.66 1 1 
       1963 1 . . . . .  6.2 1.8 7.13 1 1 
       1964 1 . . . . .  6.2 1.8 7.13 1 1 
       1965 1 . . . . .  6.2 1.8 7.13 1 1 
       1966 1 . . . . .  6.2 1.8 7.13 1 1 
       1967 1 . . . . .  4.9 1.8 5.64 1 1 
       1968 1 . . . . . 4.38 1.8 5.04 1 1 
       1969 1 . . . . . 4.63 1.8 5.32 1 1 
       1970 1 . . . . .  6.2 1.8 7.13 1 1 
       1971 1 . . . . . 5.05 1.8 5.81 1 1 
       1972 1 . . . . . 4.29 1.8 4.93 1 1 
       1973 1 . . . . . 4.86 1.8 5.59 1 1 
       1974 1 . . . . . 4.36 1.8 5.01 1 1 
       1975 1 . . . . . 4.77 1.8 5.49 1 1 
       1976 1 . . . . . 4.36 1.8 5.01 1 1 
       1977 1 . . . . . 4.77 1.8 5.49 1 1 
       1978 1 . . . . .  6.2 1.8 7.13 1 1 
       1979 1 . . . . .  6.2 1.8 7.13 1 1 
       1980 1 . . . . . 3.82 1.8 4.39 1 1 
       1981 1 . . . . .  4.3 1.8 4.95 1 1 
       1982 1 . . . . . 5.65 1.8  6.5 1 1 
       1983 1 . . . . . 5.65 1.8  6.5 1 1 
       1984 1 . . . . . 6.16 1.8 7.08 1 1 
       1985 1 . . . . . 6.16 1.8 7.08 1 1 
       1986 1 . . . . .  4.3 1.8 4.95 1 1 
       1987 1 . . . . . 4.57 1.8 5.26 1 1 
       1988 1 . . . . .  5.1 1.8 5.87 1 1 
       1989 1 . . . . . 5.72 1.8 6.58 1 1 
       1990 1 . . . . . 5.06 1.8 5.82 1 1 
       1991 1 . . . . . 4.61 1.8  5.3 1 1 
       1992 1 . . . . .  4.6 1.8 5.29 1 1 
       1993 1 . . . . . 4.95 1.8 5.69 1 1 
       1994 1 . . . . . 4.93 1.8 5.67 1 1 
       1995 1 . . . . . 5.68 1.8 6.53 1 1 
       1996 1 . . . . . 4.67 1.8 5.37 1 1 
       1997 1 . . . . .  4.5 1.8 5.18 1 1 
       1998 1 . . . . . 5.05 1.8 5.81 1 1 
       1999 1 . . . . . 5.05 1.8 5.81 1 1 
       2000 1 . . . . . 4.11 1.8 4.73 1 1 
       2001 1 . . . . . 3.84 1.8 4.42 1 1 
       2002 1 . . . . . 5.33 1.8 6.13 1 1 
       2003 1 . . . . . 3.81 1.8 4.38 1 1 
       2004 1 . . . . . 5.45 1.8 6.27 1 1 
       2005 1 . . . . . 5.27 1.8 6.06 1 1 
       2006 1 . . . . . 5.27 1.8 6.06 1 1 
       2007 1 . . . . . 5.45 1.8 6.27 1 1 
       2008 1 . . . . . 3.74 1.8  4.3 1 1 
       2009 1 . . . . . 3.96 1.8 4.55 1 1 
       2010 1 . . . . . 5.08 1.8 5.84 1 1 
       2011 1 . . . . . 5.08 1.8 5.84 1 1 
       2012 1 . . . . . 4.09 1.8  4.7 1 1 
       2013 1 . . . . . 4.09 1.8  4.7 1 1 
       2014 1 . . . . .  6.2 1.8 7.13 1 1 
       2015 1 . . . . .  6.2 1.8 7.13 1 1 
       2016 1 . . . . . 5.23 1.8 6.01 1 1 
       2017 1 . . . . . 4.11 1.8 4.73 1 1 
       2018 1 . . . . . 4.84 1.8 5.57 1 1 
       2019 1 . . . . . 4.54 1.8 5.22 1 1 
       2020 1 . . . . .  4.5 1.8 5.18 1 1 
       2021 1 . . . . . 4.44 1.8 5.11 1 1 
       2022 1 . . . . . 4.64 1.8 5.34 1 1 
       2023 1 . . . . . 5.88 1.8 6.76 1 1 
       2024 1 . . . . . 5.07 1.8 5.83 1 1 
       2025 1 . . . . . 5.39 1.8  6.2 1 1 
       2026 1 . . . . . 3.99 1.8 4.59 1 1 
       2027 1 . . . . . 3.83 1.8  4.4 1 1 
       2028 1 . . . . . 4.29 1.8 4.93 1 1 
       2029 1 . . . . . 4.01 1.8 4.61 1 1 
       2030 1 . . . . . 4.91 1.8 5.65 1 1 
       2031 1 . . . . . 2.95 1.8 3.39 1 1 
       2032 1 . . . . . 5.43 1.8 6.24 1 1 
       2033 1 . . . . . 5.49 1.8 6.31 1 1 
       2034 1 . . . . . 5.84 1.8 6.72 1 1 
       2035 1 . . . . . 5.91 1.8  6.8 1 1 
       2036 1 . . . . . 5.28 1.8 6.07 1 1 
       2037 1 . . . . . 5.28 1.8 6.07 1 1 
       2038 1 . . . . . 5.03 1.8 5.78 1 1 
       2039 1 . . . . . 6.08 1.8 6.99 1 1 
       2040 1 . . . . . 4.35 1.8  5.0 1 1 
       2041 1 . . . . . 6.12 1.8 7.04 1 1 
       2042 1 . . . . . 5.06 1.8 5.82 1 1 
       2043 1 . . . . . 5.87 1.8 6.75 1 1 
       2044 1 . . . . . 3.68 1.8 4.23 1 1 
       2045 1 . . . . .  5.3 1.8  6.1 1 1 
       2046 1 . . . . . 5.01 1.8 5.76 1 1 
       2047 1 . . . . . 4.28 1.8 4.92 1 1 
       2048 1 . . . . . 5.01 1.8 5.76 1 1 
       2049 1 . . . . . 3.75 1.8 4.31 1 1 
       2050 1 . . . . . 5.01 1.8 5.76 1 1 
       2051 1 . . . . . 4.28 1.8 4.92 1 1 
       2052 1 . . . . . 4.68 1.8 5.38 1 1 
       2053 1 . . . . . 4.51 1.8 5.19 1 1 
       2054 1 . . . . . 4.48 1.8 5.15 1 1 
       2055 1 . . . . . 5.52 1.8 6.35 1 1 
       2056 1 . . . . .  5.1 1.8 5.87 1 1 
       2057 1 . . . . . 4.34 1.8 4.99 1 1 
       2058 1 . . . . . 5.28 1.8 6.07 1 1 
       2059 1 . . . . . 5.71 1.8 6.57 1 1 
       2060 1 . . . . . 4.85 1.8 5.58 1 1 
       2061 1 . . . . . 3.71 1.8 4.27 1 1 
       2062 1 . . . . . 5.91 1.8  6.8 1 1 
       2063 1 . . . . . 4.88 1.8 5.61 1 1 
       2064 1 . . . . . 3.59 1.8 4.13 1 1 
       2065 1 . . . . . 5.65 1.8  6.5 1 1 
       2066 1 . . . . . 4.74 1.8 5.45 1 1 
       2067 1 . . . . . 4.74 1.8 5.45 1 1 
       2068 1 . . . . .  6.2 1.8 7.13 1 1 
       2069 1 . . . . .  6.2 1.8 7.13 1 1 
       2070 1 . . . . . 5.65 1.8  6.5 1 1 
       2071 1 . . . . . 5.65 1.8  6.5 1 1 
       2072 1 . . . . . 5.05 1.8 5.81 1 1 
       2073 1 . . . . . 5.27 1.8 6.06 1 1 
       2074 1 . . . . . 5.77 1.8 6.64 1 1 
       2075 1 . . . . .  6.2 1.8 7.13 1 1 
       2076 1 . . . . . 5.44 1.8 6.26 1 1 
       2077 1 . . . . .  6.2 1.8 7.13 1 1 
       2078 1 . . . . . 5.14 1.8 5.91 1 1 
       2079 1 . . . . . 5.65 1.8  6.5 1 1 
       2080 1 . . . . . 5.14 1.8 5.91 1 1 
       2081 1 . . . . . 4.82 1.8 5.54 1 1 
       2082 1 . . . . . 4.88 1.8 5.61 1 1 
       2083 1 . . . . .  5.5 1.8 6.33 1 1 
       2084 1 . . . . . 4.57 1.8 5.26 1 1 
       2085 1 . . . . . 5.66 1.8 6.51 1 1 
       2086 1 . . . . . 4.79 1.8 5.51 1 1 
       2087 1 . . . . . 4.88 1.8 5.61 1 1 
       2088 1 . . . . . 5.07 1.8 5.83 1 1 
       2089 1 . . . . . 4.47 1.8 5.14 1 1 
       2090 1 . . . . . 4.47 1.8 5.14 1 1 
       2091 1 . . . . . 4.29 1.8 4.93 1 1 
       2092 1 . . . . . 4.93 1.8 5.67 1 1 
       2093 1 . . . . . 4.61 1.8  5.3 1 1 
       2094 1 . . . . . 5.24 1.8 6.03 1 1 
       2095 1 . . . . . 5.24 1.8 6.03 1 1 
       2096 1 . . . . . 3.93 1.8 4.52 1 1 
       2097 1 . . . . . 4.11 1.8 4.73 1 1 
       2098 1 . . . . .  6.2 1.8 7.13 1 1 
       2099 1 . . . . .  6.2 1.8 7.13 1 1 
       2100 1 . . . . .  6.2 1.8 7.13 1 1 
       2101 1 . . . . .  6.2 1.8 7.13 1 1 
       2102 1 . . . . . 4.62 1.8 5.31 1 1 
       2103 1 . . . . . 4.62 1.8 5.31 1 1 
       2104 1 . . . . . 4.27 1.8 4.91 1 1 
       2105 1 . . . . . 5.28 1.8 6.07 1 1 
       2106 1 . . . . . 4.91 1.8 5.65 1 1 
       2107 1 . . . . . 5.91 1.8  6.8 1 1 
       2108 1 . . . . . 5.68 1.8 6.53 1 1 
       2109 1 . . . . . 5.91 1.8  6.8 1 1 
       2110 1 . . . . . 5.68 1.8 6.53 1 1 
       2111 1 . . . . . 4.17 1.8  4.8 1 1 
       2112 1 . . . . . 5.02 1.8 5.77 1 1 
       2113 1 . . . . . 4.65 1.8 5.35 1 1 
       2114 1 . . . . . 4.27 1.8 4.91 1 1 
       2115 1 . . . . . 3.61 1.8 4.15 1 1 
       2116 1 . . . . . 5.14 1.8 5.91 1 1 
       2117 1 . . . . .  5.2 1.8 5.98 1 1 
       2118 1 . . . . . 4.34 1.8 4.99 1 1 
       2119 1 . . . . . 4.21 1.8 4.84 1 1 
       2120 1 . . . . . 4.64 1.8 5.34 1 1 
       2121 1 . . . . . 5.85 1.8 6.73 1 1 
       2122 1 . . . . .  6.2 1.8 7.13 1 1 
       2123 1 . . . . . 3.82 1.8 4.39 1 1 
       2124 1 . . . . . 4.32 1.8 4.97 1 1 
       2125 1 . . . . . 5.44 1.8 6.26 1 1 
       2126 1 . . . . . 5.38 1.8 6.19 1 1 
       2127 1 . . . . . 3.79 1.8 4.36 1 1 
       2128 1 . . . . . 3.79 1.8 4.36 1 1 
       2129 1 . . . . . 3.26 1.8 3.75 1 1 
       2130 1 . . . . . 5.31 1.8 6.11 1 1 
       2131 1 . . . . . 5.31 1.8 6.11 1 1 
       2132 1 . . . . . 3.88 1.8 4.46 1 1 
       2133 1 . . . . . 4.71 1.8 5.42 1 1 
       2134 1 . . . . . 4.29 1.8 4.93 1 1 
       2135 1 . . . . . 4.01 1.8 4.61 1 1 
       2136 1 . . . . . 4.29 1.8 4.93 1 1 
       2137 1 . . . . . 4.09 1.8  4.7 1 1 
       2138 1 . . . . . 4.09 1.8  4.7 1 1 
       2139 1 . . . . . 3.55 1.8 4.08 1 1 
       2140 1 . . . . . 3.36 1.8 3.86 1 1 
       2141 1 . . . . . 3.53 1.8 4.06 1 1 
       2142 1 . . . . . 2.94 1.8 3.38 1 1 
       2143 1 . . . . .  2.6 1.8 2.99 1 1 
       2144 1 . . . . . 5.23 1.8 6.01 1 1 
       2145 1 . . . . . 5.91 1.8  6.8 1 1 
       2146 1 . . . . . 5.69 1.8 6.54 1 1 
       2147 1 . . . . . 5.24 1.8 6.03 1 1 
       2148 1 . . . . . 4.22 1.8 4.85 1 1 
       2149 1 . . . . . 5.35 1.8 6.15 1 1 
       2150 1 . . . . . 2.94 1.8 3.38 1 1 
       2151 1 . . . . . 3.16 1.8 3.63 1 1 
       2152 1 . . . . . 3.42 1.8 3.93 1 1 
       2153 1 . . . . . 3.23 1.8 3.71 1 1 
       2154 1 . . . . . 5.52 1.8 6.35 1 1 
       2155 1 . . . . . 4.94 1.8 5.68 1 1 
       2156 1 . . . . . 4.99 1.8 5.74 1 1 
       2157 1 . . . . .  6.2 1.8 7.13 1 1 
       2158 1 . . . . . 4.17 1.8  4.8 1 1 
       2159 1 . . . . .  5.5 1.8 6.33 1 1 
       2160 1 . . . . . 5.44 1.8 6.26 1 1 
       2161 1 . . . . . 5.27 1.8 6.06 1 1 
       2162 1 . . . . . 4.57 1.8 5.26 1 1 
       2163 1 . . . . . 4.21 1.8 4.84 1 1 
       2164 1 . . . . . 5.38 1.8 6.19 1 1 
       2165 1 . . . . . 5.55 1.8 6.38 1 1 
       2166 1 . . . . . 3.95 1.8 4.54 1 1 
       2167 1 . . . . . 4.43 1.8 5.09 1 1 
       2168 1 . . . . .  5.7 1.8 6.56 1 1 
       2169 1 . . . . . 5.33 1.8 6.13 1 1 
       2170 1 . . . . . 5.12 1.8 5.89 1 1 
       2171 1 . . . . . 5.23 1.8 6.01 1 1 
       2172 1 . . . . . 4.94 1.8 5.68 1 1 
       2173 1 . . . . . 5.32 1.8 6.12 1 1 
       2174 1 . . . . . 3.94 1.8 4.53 1 1 
       2175 1 . . . . .  4.5 1.8 5.18 1 1 
       2176 1 . . . . .  4.9 1.8 5.64 1 1 
       2177 1 . . . . . 3.89 1.8 4.47 1 1 
       2178 1 . . . . . 5.68 1.8 6.53 1 1 
       2179 1 . . . . . 5.68 1.8 6.53 1 1 
       2180 1 . . . . . 4.35 1.8  5.0 1 1 
       2181 1 . . . . .  6.2 1.8 7.13 1 1 
       2182 1 . . . . .  6.2 1.8 7.13 1 1 
       2183 1 . . . . . 5.18 1.8 5.96 1 1 
       2184 1 . . . . . 5.56 1.8 6.39 1 1 
       2185 1 . . . . . 5.38 1.8 6.19 1 1 
       2186 1 . . . . . 5.14 1.8 5.91 1 1 
       2187 1 . . . . . 5.77 1.8 6.64 1 1 
       2188 1 . . . . . 5.28 1.8 6.07 1 1 
       2189 1 . . . . . 6.13 1.8 7.05 1 1 
       2190 1 . . . . .  6.2 1.8 7.13 1 1 
       2191 1 . . . . .  6.2 1.8 7.13 1 1 
       2192 1 . . . . .  6.2 1.8 7.13 1 1 
       2193 1 . . . . .  6.2 1.8 7.13 1 1 
       2194 1 . . . . .  6.2 1.8 7.13 1 1 
       2195 1 . . . . .  6.2 1.8 7.13 1 1 
       2196 1 . . . . .  6.2 1.8 7.13 1 1 
       2197 1 . . . . .  6.2 1.8 7.13 1 1 
       2198 1 . . . . . 4.62 1.8 5.31 1 1 
       2199 1 . . . . . 5.56 1.8 6.39 1 1 
       2200 1 . . . . .  5.6 1.8 6.44 1 1 
       2201 1 . . . . . 5.63 1.8 6.47 1 1 
       2202 1 . . . . . 5.54 1.8 6.37 1 1 
       2203 1 . . . . . 4.88 1.8 5.61 1 1 
       2204 1 . . . . . 5.04 1.8  5.8 1 1 
       2205 1 . . . . . 5.12 1.8 5.89 1 1 
       2206 1 . . . . . 5.36 1.8 6.16 1 1 
       2207 1 . . . . .  6.2 1.8 7.13 1 1 
       2208 1 . . . . .  6.2 1.8 7.13 1 1 
       2209 1 . . . . . 5.72 1.8 6.58 1 1 
       2210 1 . . . . . 5.72 1.8 6.58 1 1 
       2211 1 . . . . . 4.42 1.8 5.08 1 1 
       2212 1 . . . . . 4.61 1.8  5.3 1 1 
       2213 1 . . . . . 3.89 1.8 4.47 1 1 
       2214 1 . . . . . 4.42 1.8 5.08 1 1 
       2215 1 . . . . . 4.49 1.8 5.16 1 1 
       2216 1 . . . . .  5.1 1.8 5.87 1 1 
       2217 1 . . . . . 4.87 1.8  5.6 1 1 
       2218 1 . . . . . 3.07 1.8 3.53 1 1 
       2219 1 . . . . . 3.36 1.8 3.86 1 1 
       2220 1 . . . . . 3.78 1.8 4.35 1 1 
       2221 1 . . . . . 5.07 1.8 5.83 1 1 
       2222 1 . . . . . 4.31 1.8 4.96 1 1 
       2223 1 . . . . . 5.58 1.8 6.42 1 1 
       2224 1 . . . . . 5.37 1.8 6.18 1 1 
       2225 1 . . . . . 5.37 1.8 6.18 1 1 
       2226 1 . . . . . 5.11 1.8 5.88 1 1 
       2227 1 . . . . . 4.61 1.8  5.3 1 1 
       2228 1 . . . . . 5.48 1.8  6.3 1 1 
       2229 1 . . . . . 5.73 1.8 6.59 1 1 
       2230 1 . . . . . 5.28 1.8 6.07 1 1 
       2231 1 . . . . . 5.61 1.8 6.45 1 1 
       2232 1 . . . . . 4.47 1.8 5.14 1 1 
       2233 1 . . . . . 5.16 1.8 5.93 1 1 
       2234 1 . . . . . 5.07 1.8 5.83 1 1 
       2235 1 . . . . . 4.56 1.8 5.24 1 1 
       2236 1 . . . . . 4.55 1.8 5.23 1 1 
       2237 1 . . . . . 4.55 1.8 5.23 1 1 
       2238 1 . . . . . 4.99 1.8 5.74 1 1 
       2239 1 . . . . . 4.94 1.8 5.68 1 1 
       2240 1 . . . . .  6.2 1.8 7.13 1 1 
       2241 1 . . . . . 5.26 1.8 6.05 1 1 
       2242 1 . . . . . 5.21 1.8 5.99 1 1 
       2243 1 . . . . . 5.64 1.8 6.49 1 1 
       2244 1 . . . . . 4.04 1.8 4.65 1 1 
       2245 1 . . . . . 4.09 1.8  4.7 1 1 
       2246 1 . . . . .  6.2 1.8 7.13 1 1 
       2247 1 . . . . . 5.11 1.8 5.88 1 1 
       2248 1 . . . . . 5.11 1.8 5.88 1 1 
       2249 1 . . . . . 4.36 1.8 5.01 1 1 
       2250 1 . . . . .  4.6 1.8 5.29 1 1 
       2251 1 . . . . . 5.36 1.8 6.16 1 1 
       2252 1 . . . . . 3.77 1.8 4.34 1 1 
       2253 1 . . . . . 4.49 1.8 5.16 1 1 
       2254 1 . . . . . 4.49 1.8 5.16 1 1 
       2255 1 . . . . . 4.74 1.8 5.45 1 1 
       2256 1 . . . . . 4.93 1.8 5.67 1 1 
       2257 1 . . . . . 4.63 1.8 5.32 1 1 
       2258 1 . . . . . 4.01 1.8 4.61 1 1 
       2259 1 . . . . . 5.58 1.8 6.42 1 1 
       2260 1 . . . . .  4.0 1.8  4.6 1 1 
       2261 1 . . . . . 3.95 1.8 4.54 1 1 
       2262 1 . . . . . 3.99 1.8 4.59 1 1 
       2263 1 . . . . . 4.65 1.8 5.35 1 1 
       2264 1 . . . . . 4.65 1.8 5.35 1 1 
       2265 1 . . . . . 5.43 1.8 6.24 1 1 
       2266 1 . . . . . 5.43 1.8 6.24 1 1 
       2267 1 . . . . . 5.56 1.8 6.39 1 1 
       2268 1 . . . . . 5.56 1.8 6.39 1 1 
       2269 1 . . . . . 5.47 1.8 6.29 1 1 
       2270 1 . . . . . 5.47 1.8 6.29 1 1 
       2271 1 . . . . . 5.91 1.8  6.8 1 1 
       2272 1 . . . . .  6.2 1.8 7.13 1 1 
       2273 1 . . . . . 4.92 1.8 5.66 1 1 
       2274 1 . . . . . 4.92 1.8 5.66 1 1 
       2275 1 . . . . . 4.78 1.8  5.5 1 1 
       2276 1 . . . . . 4.78 1.8  5.5 1 1 
       2277 1 . . . . . 5.15 1.8 5.92 1 1 
       2278 1 . . . . . 5.87 1.8 6.75 1 1 
       2279 1 . . . . .  6.2 1.8 7.13 1 1 
       2280 1 . . . . . 5.16 1.8 5.93 1 1 
       2281 1 . . . . . 5.16 1.8 5.93 1 1 
       2282 1 . . . . . 4.81 1.8 5.53 1 1 
       2283 1 . . . . . 4.98 1.8 5.73 1 1 
       2284 1 . . . . . 4.63 1.8 5.32 1 1 
       2285 1 . . . . . 4.88 1.8 5.61 1 1 
       2286 1 . . . . . 5.16 1.8 5.93 1 1 
       2287 1 . . . . .  6.2 1.8 7.13 1 1 
       2288 1 . . . . .  6.2 1.8 7.13 1 1 
       2289 1 . . . . . 4.66 1.8 5.36 1 1 
       2290 1 . . . . .  5.4 1.8 6.21 1 1 
       2291 1 . . . . . 4.66 1.8 5.36 1 1 
       2292 1 . . . . .  5.4 1.8 6.21 1 1 
       2293 1 . . . . . 3.43 1.8 3.94 1 1 
       2294 1 . . . . . 4.66 1.8 5.36 1 1 
       2295 1 . . . . . 4.95 1.8 5.69 1 1 
       2296 1 . . . . . 4.84 1.8 5.57 1 1 
       2297 1 . . . . . 4.44 1.8 5.11 1 1 
       2298 1 . . . . . 4.44 1.8 5.11 1 1 
       2299 1 . . . . . 3.87 1.8 4.45 1 1 
       2300 1 . . . . . 4.48 1.8 5.15 1 1 
       2301 1 . . . . . 4.48 1.8 5.15 1 1 
       2302 1 . . . . . 4.55 1.8 5.23 1 1 
       2303 1 . . . . .  6.2 1.8 7.13 1 1 
       2304 1 . . . . .  6.2 1.8 7.13 1 1 
       2305 1 . . . . . 5.33 1.8 6.13 1 1 
       2306 1 . . . . . 5.33 1.8 6.13 1 1 
       2307 1 . . . . . 5.22 1.8  6.0 1 1 
       2308 1 . . . . . 4.64 1.8 5.34 1 1 
       2309 1 . . . . . 5.51 1.8 6.34 1 1 
       2310 1 . . . . . 3.33 1.8 3.83 1 1 
       2311 1 . . . . . 3.84 1.8 4.42 1 1 
       2312 1 . . . . . 4.72 1.8 5.43 1 1 
       2313 1 . . . . . 4.72 1.8 5.43 1 1 
       2314 1 . . . . . 4.26 1.8  4.9 1 1 
       2315 1 . . . . . 3.84 1.8 4.42 1 1 
       2316 1 . . . . . 4.97 1.8 5.72 1 1 
       2317 1 . . . . . 5.29 1.8 6.08 1 1 
       2318 1 . . . . .  5.5 1.8 6.33 1 1 
       2319 1 . . . . . 5.29 1.8 6.08 1 1 
       2320 1 . . . . . 4.78 1.8  5.5 1 1 
       2321 1 . . . . . 5.72 1.8 6.58 1 1 
       2322 1 . . . . . 5.82 1.8 6.69 1 1 
       2323 1 . . . . . 5.34 1.8 6.14 1 1 
       2324 1 . . . . . 5.53 1.8 6.36 1 1 
       2325 1 . . . . . 4.88 1.8 5.61 1 1 
       2326 1 . . . . . 3.96 1.8 4.55 1 1 
       2327 1 . . . . . 5.36 1.8 6.16 1 1 
       2328 1 . . . . . 5.22 1.8  6.0 1 1 
       2329 1 . . . . . 5.13 1.8  5.9 1 1 
       2330 1 . . . . . 5.13 1.8  5.9 1 1 
       2331 1 . . . . . 5.23 1.8 6.01 1 1 
       2332 1 . . . . . 5.23 1.8 6.01 1 1 
       2333 1 . . . . .  5.6 1.8 6.44 1 1 
       2334 1 . . . . . 5.58 1.8 6.42 1 1 
       2335 1 . . . . . 3.84 1.8 4.42 1 1 
       2336 1 . . . . . 5.58 1.8 6.42 1 1 
       2337 1 . . . . . 4.57 1.8 5.26 1 1 
       2338 1 . . . . . 4.54 1.8 5.22 1 1 
       2339 1 . . . . . 4.97 1.8 5.72 1 1 
       2340 1 . . . . .  6.2 1.8 7.13 1 1 
       2341 1 . . . . . 4.02 1.8 4.62 1 1 
       2342 1 . . . . . 4.94 1.8 5.68 1 1 
       2343 1 . . . . . 5.47 1.8 6.29 1 1 
       2344 1 . . . . . 4.03 1.8 4.63 1 1 
       2345 1 . . . . . 4.53 1.8 5.21 1 1 
       2346 1 . . . . . 3.87 1.8 4.45 1 1 
       2347 1 . . . . . 4.08 1.8 4.69 1 1 
       2348 1 . . . . . 4.95 1.8 5.69 1 1 
       2349 1 . . . . . 4.95 1.8 5.69 1 1 
       2350 1 . . . . .  6.2 1.8 7.13 1 1 
       2351 1 . . . . .  6.2 1.8 7.13 1 1 
       2352 1 . . . . .  6.2 1.8 7.13 1 1 
       2353 1 . . . . .  6.2 1.8 7.13 1 1 
       2354 1 . . . . . 5.16 1.8 5.93 1 1 
       2355 1 . . . . . 5.87 1.8 6.75 1 1 
       2356 1 . . . . . 3.86 1.8 4.44 1 1 
       2357 1 . . . . . 4.89 1.8 5.62 1 1 
       2358 1 . . . . . 4.89 1.8 5.62 1 1 
       2359 1 . . . . . 5.07 1.8 5.83 1 1 
       2360 1 . . . . . 3.34 1.8 3.84 1 1 
       2361 1 . . . . . 3.28 1.8 3.77 1 1 
       2362 1 . . . . . 3.59 1.8 4.13 1 1 
       2363 1 . . . . . 5.55 1.8 6.38 1 1 
       2364 1 . . . . . 4.88 1.8 5.61 1 1 
       2365 1 . . . . . 5.01 1.8 5.76 1 1 
       2366 1 . . . . . 5.13 1.8  5.9 1 1 
       2367 1 . . . . . 5.79 1.8 6.66 1 1 
       2368 1 . . . . . 4.67 1.8 5.37 1 1 
       2369 1 . . . . . 4.55 1.8 5.23 1 1 
       2370 1 . . . . . 4.61 1.8  5.3 1 1 
       2371 1 . . . . . 4.84 1.8 5.57 1 1 
       2372 1 . . . . . 4.53 1.8 5.21 1 1 
       2373 1 . . . . . 5.33 1.8 6.13 1 1 
       2374 1 . . . . . 4.98 1.8 5.73 1 1 
       2375 1 . . . . . 4.85 1.8 5.58 1 1 
       2376 1 . . . . . 4.97 1.8 5.72 1 1 
       2377 1 . . . . . 5.83 1.8  6.7 1 1 
       2378 1 . . . . . 5.55 1.8 6.38 1 1 
       2379 1 . . . . . 5.55 1.8 6.38 1 1 
       2380 1 . . . . .  4.2 1.8 4.83 1 1 
       2381 1 . . . . . 5.28 1.8 6.07 1 1 
       2382 1 . . . . . 5.28 1.8 6.07 1 1 
       2383 1 . . . . . 3.02 1.8 3.47 1 1 
       2384 1 . . . . . 3.25 1.8 3.74 1 1 
       2385 1 . . . . . 3.96 1.8 4.55 1 1 
       2386 1 . . . . . 3.46 1.8 3.98 1 1 
       2387 1 . . . . . 4.22 1.8 4.85 1 1 
       2388 1 . . . . . 4.86 1.8 5.59 1 1 
       2389 1 . . . . . 4.86 1.8 5.59 1 1 
       2390 1 . . . . . 3.29 1.8 3.78 1 1 
       2391 1 . . . . . 4.73 1.8 5.44 1 1 
       2392 1 . . . . . 4.86 1.8 5.59 1 1 
       2393 1 . . . . . 4.95 1.8 5.69 1 1 
       2394 1 . . . . . 5.96 1.8 6.85 1 1 
       2395 1 . . . . . 3.81 1.8 4.38 1 1 
       2396 1 . . . . . 3.61 1.8 4.15 1 1 
       2397 1 . . . . . 3.81 1.8 4.38 1 1 
       2398 1 . . . . . 3.49 1.8 4.01 1 1 
       2399 1 . . . . . 4.32 1.8 4.97 1 1 
       2400 1 . . . . . 5.22 1.8  6.0 1 1 
       2401 1 . . . . . 4.71 1.8 5.42 1 1 
       2402 1 . . . . . 4.03 1.8 4.63 1 1 
       2403 1 . . . . . 4.89 1.8 5.62 1 1 
       2404 1 . . . . . 5.49 1.8 6.31 1 1 
       2405 1 . . . . . 5.19 1.8 5.97 1 1 
       2406 1 . . . . . 4.01 1.8 4.61 1 1 
       2407 1 . . . . . 5.25 1.8 6.04 1 1 
       2408 1 . . . . . 5.82 1.8 6.69 1 1 
       2409 1 . . . . . 4.81 1.8 5.53 1 1 
       2410 1 . . . . . 5.43 1.8 6.24 1 1 
       2411 1 . . . . . 4.58 1.8 5.27 1 1 
       2412 1 . . . . . 5.49 1.8 6.31 1 1 
       2413 1 . . . . . 5.22 1.8  6.0 1 1 
       2414 1 . . . . . 4.31 1.8 4.96 1 1 
       2415 1 . . . . . 4.32 1.8 4.97 1 1 
       2416 1 . . . . . 3.78 1.8 4.35 1 1 
       2417 1 . . . . . 4.47 1.8 5.14 1 1 
       2418 1 . . . . . 5.99 1.8 6.89 1 1 
       2419 1 . . . . . 5.19 1.8 5.97 1 1 
       2420 1 . . . . . 5.18 1.8 5.96 1 1 
       2421 1 . . . . . 5.18 1.8 5.96 1 1 
       2422 1 . . . . . 3.98 1.8 4.58 1 1 
       2423 1 . . . . . 5.11 1.8 5.88 1 1 
       2424 1 . . . . . 5.08 1.8 5.84 1 1 
       2425 1 . . . . . 4.01 1.8 4.61 1 1 
       2426 1 . . . . . 4.01 1.8 4.61 1 1 
       2427 1 . . . . .  5.7 1.8 6.56 1 1 
       2428 1 . . . . . 4.32 1.8 4.97 1 1 
       2429 1 . . . . . 4.32 1.8 4.97 1 1 
       2430 1 . . . . . 4.29 1.8 4.93 1 1 
       2431 1 . . . . . 3.19 1.8 3.67 1 1 
       2432 1 . . . . .  3.4 1.8 3.91 1 1 
       2433 1 . . . . . 4.32 1.8 4.97 1 1 
       2434 1 . . . . . 4.68 1.8 5.38 1 1 
       2435 1 . . . . . 4.71 1.8 5.42 1 1 
       2436 1 . . . . . 5.89 1.8 6.77 1 1 
       2437 1 . . . . . 5.89 1.8 6.77 1 1 
       2438 1 . . . . . 5.97 1.8 6.87 1 1 
       2439 1 . . . . . 5.81 1.8 6.68 1 1 
       2440 1 . . . . . 4.78 1.8  5.5 1 1 
       2441 1 . . . . . 5.79 1.8 6.66 1 1 
       2442 1 . . . . . 4.62 1.8 5.31 1 1 
       2443 1 . . . . . 5.05 1.8 5.81 1 1 
       2444 1 . . . . . 5.05 1.8 5.81 1 1 
       2445 1 . . . . . 5.95 1.8 6.84 1 1 
       2446 1 . . . . . 5.95 1.8 6.84 1 1 
       2447 1 . . . . .  4.7 1.8  5.4 1 1 
       2448 1 . . . . .  4.7 1.8  5.4 1 1 
       2449 1 . . . . . 5.12 1.8 5.89 1 1 
       2450 1 . . . . . 6.14 1.8 7.06 1 1 
       2451 1 . . . . . 4.63 1.8 5.32 1 1 
       2452 1 . . . . . 4.89 1.8 5.62 1 1 
       2453 1 . . . . . 5.74 1.8  6.6 1 1 
       2454 1 . . . . . 5.74 1.8  6.6 1 1 
       2455 1 . . . . . 5.24 1.8 6.03 1 1 
       2456 1 . . . . .  6.2 1.8 7.13 1 1 
       2457 1 . . . . . 5.61 1.8 6.45 1 1 
       2458 1 . . . . . 5.63 1.8 6.47 1 1 
       2459 1 . . . . .  6.2 1.8 7.13 1 1 
       2460 1 . . . . .  6.2 1.8 7.13 1 1 
       2461 1 . . . . .  5.2 1.8 5.98 1 1 
       2462 1 . . . . . 5.96 1.8 6.85 1 1 
       2463 1 . . . . . 5.84 1.8 6.72 1 1 
       2464 1 . . . . .  6.2 1.8 7.13 1 1 
       2465 1 . . . . . 6.14 1.8 7.06 1 1 
       2466 1 . . . . . 5.16 1.8 5.93 1 1 
       2467 1 . . . . . 5.16 1.8 5.93 1 1 
       2468 1 . . . . . 5.79 1.8 6.66 1 1 
       2469 1 . . . . . 5.79 1.8 6.66 1 1 
       2470 1 . . . . . 4.69 1.8 5.39 1 1 
       2471 1 . . . . . 5.48 1.8  6.3 1 1 
       2472 1 . . . . . 5.96 1.8 6.85 1 1 
       2473 1 . . . . . 4.74 1.8 5.45 1 1 
       2474 1 . . . . . 4.22 1.8 4.85 1 1 
       2475 1 . . . . . 5.33 1.8 6.13 1 1 
       2476 1 . . . . . 4.04 1.8 4.65 1 1 
       2477 1 . . . . . 4.11 1.8 4.73 1 1 
       2478 1 . . . . . 4.26 1.8  4.9 1 1 
       2479 1 . . . . . 5.88 1.8 6.76 1 1 
       2480 1 . . . . . 4.25 1.8 4.89 1 1 
       2481 1 . . . . . 5.09 1.8 5.85 1 1 
       2482 1 . . . . . 6.08 1.8 6.99 1 1 
       2483 1 . . . . .  6.2 1.8 7.13 1 1 
       2484 1 . . . . . 5.49 1.8 6.31 1 1 
       2485 1 . . . . . 5.55 1.8 6.38 1 1 
       2486 1 . . . . . 5.99 1.8 6.89 1 1 
       2487 1 . . . . . 5.99 1.8 6.89 1 1 
       2488 1 . . . . . 5.16 1.8 5.93 1 1 
       2489 1 . . . . . 5.72 1.8 6.58 1 1 
       2490 1 . . . . . 5.51 1.8 6.34 1 1 
       2491 1 . . . . . 4.92 1.8 5.66 1 1 
       2492 1 . . . . . 5.33 1.8 6.13 1 1 
       2493 1 . . . . .  4.5 1.8 5.18 1 1 
       2494 1 . . . . . 5.87 1.8 6.75 1 1 
       2495 1 . . . . .  4.5 1.8 5.18 1 1 
       2496 1 . . . . . 5.82 1.8 6.69 1 1 
       2497 1 . . . . . 5.82 1.8 6.69 1 1 
       2498 1 . . . . . 6.19 1.8 7.12 1 1 
       2499 1 . . . . . 6.19 1.8 7.12 1 1 
       2500 1 . . . . .  5.4 1.8 6.21 1 1 
       2501 1 . . . . . 5.75 1.8 6.61 1 1 
       2502 1 . . . . . 5.62 1.8 6.46 1 1 
       2503 1 . . . . . 4.11 1.8 4.73 1 1 
       2504 1 . . . . . 4.41 1.8 5.07 1 1 
       2505 1 . . . . . 4.67 1.8 5.37 1 1 
       2506 1 . . . . . 5.78 1.8 6.65 1 1 
       2507 1 . . . . . 5.51 1.8 6.34 1 1 
       2508 1 . . . . .  6.2 1.8 7.13 1 1 
       2509 1 . . . . . 5.56 1.8 6.39 1 1 
       2510 1 . . . . . 5.31 1.8 6.11 1 1 
       2511 1 . . . . . 4.61 1.8  5.3 1 1 
       2512 1 . . . . . 4.95 1.8 5.69 1 1 
       2513 1 . . . . . 5.46 1.8 6.28 1 1 
       2514 1 . . . . . 6.18 1.8 7.11 1 1 
       2515 1 . . . . .  6.2 1.8 7.13 1 1 
       2516 1 . . . . . 4.86 1.8 5.59 1 1 
       2517 1 . . . . . 5.02 1.8 5.77 1 1 
       2518 1 . . . . . 5.37 1.8 6.18 1 1 
       2519 1 . . . . .  6.2 1.8 7.13 1 1 
       2520 1 . . . . .  3.0 1.8 3.45 1 1 
       2521 1 . . . . .  3.4 1.8 3.91 1 1 
       2522 1 . . . . . 3.86 1.8 4.44 1 1 
       2523 1 . . . . . 4.17 1.8  4.8 1 1 
       2524 1 . . . . . 5.55 1.8 6.38 1 1 
       2525 1 . . . . . 5.55 1.8 6.38 1 1 
       2526 1 . . . . . 4.86 1.8 5.59 1 1 
       2527 1 . . . . . 4.86 1.8 5.59 1 1 
       2528 1 . . . . .  5.4 1.8 6.21 1 1 
       2529 1 . . . . .  5.8 1.8 6.67 1 1 
       2530 1 . . . . . 4.26 1.8  4.9 1 1 
       2531 1 . . . . . 4.93 1.8 5.67 1 1 
       2532 1 . . . . . 5.18 1.8 5.96 1 1 
       2533 1 . . . . . 6.19 1.8 7.12 1 1 
       2534 1 . . . . . 4.55 1.8 5.23 1 1 
       2535 1 . . . . . 4.21 1.8 4.84 1 1 
       2536 1 . . . . .  6.2 1.8 7.13 1 1 
       2537 1 . . . . .  6.2 1.8 7.13 1 1 
       2538 1 . . . . .  6.2 1.8 7.13 1 1 
       2539 1 . . . . .  6.2 1.8 7.13 1 1 
       2540 1 . . . . .  3.8 1.8 4.37 1 1 
       2541 1 . . . . .  3.3 1.8  3.8 1 1 
       2542 1 . . . . . 5.64 1.8 6.49 1 1 
       2543 1 . . . . . 4.46 1.8 5.13 1 1 
       2544 1 . . . . . 4.47 1.8 5.14 1 1 
       2545 1 . . . . . 5.16 1.8 5.93 1 1 
       2546 1 . . . . . 5.37 1.8 6.18 1 1 
       2547 1 . . . . . 3.54 1.8 4.07 1 1 
       2548 1 . . . . . 5.31 1.8 6.11 1 1 
       2549 1 . . . . . 5.08 1.8 5.84 1 1 
       2550 1 . . . . . 4.45 1.8 5.12 1 1 
       2551 1 . . . . . 5.04 1.8  5.8 1 1 
       2552 1 . . . . . 5.87 1.8 6.75 1 1 
       2553 1 . . . . . 4.69 1.8 5.39 1 1 
       2554 1 . . . . . 5.89 1.8 6.77 1 1 
       2555 1 . . . . .  5.7 1.8 6.56 1 1 
       2556 1 . . . . .  5.7 1.8 6.56 1 1 
       2557 1 . . . . . 4.63 1.8 5.32 1 1 
       2558 1 . . . . . 5.77 1.8 6.64 1 1 
       2559 1 . . . . . 5.76 1.8 6.62 1 1 
       2560 1 . . . . . 5.45 1.8 6.27 1 1 
       2561 1 . . . . . 5.69 1.8 6.54 1 1 
       2562 1 . . . . . 5.18 1.8 5.96 1 1 
       2563 1 . . . . . 3.94 1.8 4.53 1 1 
       2564 1 . . . . . 5.05 1.8 5.81 1 1 
       2565 1 . . . . . 4.76 1.8 5.47 1 1 
       2566 1 . . . . . 5.71 1.8 6.57 1 1 
       2567 1 . . . . . 5.12 1.8 5.89 1 1 
       2568 1 . . . . . 3.71 1.8 4.27 1 1 
       2569 1 . . . . . 3.29 1.8 3.78 1 1 
       2570 1 . . . . .  6.2 1.8 7.13 1 1 
       2571 1 . . . . .  5.0 1.8 5.75 1 1 
       2572 1 . . . . .  5.5 1.8 6.33 1 1 
       2573 1 . . . . . 5.18 1.8 5.96 1 1 
       2574 1 . . . . . 5.18 1.8 5.96 1 1 
       2575 1 . . . . . 4.15 1.8 4.77 1 1 
       2576 1 . . . . . 4.85 1.8 5.58 1 1 
       2577 1 . . . . . 5.87 1.8 6.75 1 1 
       2578 1 . . . . . 5.08 1.8 5.84 1 1 
       2579 1 . . . . . 5.39 1.8  6.2 1 1 
       2580 1 . . . . . 5.39 1.8  6.2 1 1 
       2581 1 . . . . . 5.23 1.8 6.01 1 1 
       2582 1 . . . . .  6.2 1.8 7.13 1 1 
       2583 1 . . . . .  6.2 1.8 7.13 1 1 
       2584 1 . . . . . 5.49 1.8 6.31 1 1 
       2585 1 . . . . . 5.53 1.8 6.36 1 1 
       2586 1 . . . . . 5.53 1.8 6.36 1 1 
       2587 1 . . . . . 4.69 1.8 5.39 1 1 
       2588 1 . . . . . 4.69 1.8 5.39 1 1 
       2589 1 . . . . . 5.43 1.8 6.24 1 1 
       2590 1 . . . . . 4.22 1.8 4.85 1 1 
       2591 1 . . . . . 4.72 1.8 5.43 1 1 
       2592 1 . . . . .  6.2 1.8 7.13 1 1 
       2593 1 . . . . .  6.2 1.8 7.13 1 1 
       2594 1 . . . . . 5.08 1.8 5.84 1 1 
       2595 1 . . . . . 5.08 1.8 5.84 1 1 
       2596 1 . . . . . 5.39 1.8  6.2 1 1 
       2597 1 . . . . .  6.2 1.8 7.13 1 1 
       2598 1 . . . . .  4.9 1.8 5.64 1 1 
       2599 1 . . . . . 5.66 1.8 6.51 1 1 
       2600 1 . . . . . 5.66 1.8 6.51 1 1 
       2601 1 . . . . .  6.2 1.8 7.13 1 1 
       2602 1 . . . . .  6.2 1.8 7.13 1 1 
       2603 1 . . . . .  5.0 1.8 5.75 1 1 
       2604 1 . . . . . 5.84 1.8 6.72 1 1 
       2605 1 . . . . . 5.84 1.8 6.72 1 1 
       2606 1 . . . . . 5.91 1.8  6.8 1 1 
       2607 1 . . . . . 4.94 1.8 5.68 1 1 
       2608 1 . . . . . 5.71 1.8 6.57 1 1 
       2609 1 . . . . . 5.18 1.8 5.96 1 1 
       2610 1 . . . . . 3.84 1.8 4.42 1 1 
       2611 1 . . . . . 4.45 1.8 5.12 1 1 
       2612 1 . . . . .  6.2 1.8 7.13 1 1 
       2613 1 . . . . .  5.4 1.8 6.21 1 1 
       2614 1 . . . . .  5.4 1.8 6.21 1 1 
       2615 1 . . . . . 3.32 1.8 3.82 1 1 
       2616 1 . . . . . 4.58 1.8 5.27 1 1 
       2617 1 . . . . . 5.01 1.8 5.76 1 1 
       2618 1 . . . . . 4.74 1.8 5.45 1 1 
       2619 1 . . . . .  4.8 1.8 5.52 1 1 
       2620 1 . . . . . 4.98 1.8 5.73 1 1 
       2621 1 . . . . . 5.16 1.8 5.93 1 1 
       2622 1 . . . . . 5.16 1.8 5.93 1 1 
       2623 1 . . . . . 4.83 1.8 5.55 1 1 
       2624 1 . . . . . 4.87 1.8  5.6 1 1 
       2625 1 . . . . . 5.76 1.8 6.62 1 1 
       2626 1 . . . . . 5.76 1.8 6.62 1 1 
       2627 1 . . . . . 4.77 1.8 5.49 1 1 
       2628 1 . . . . . 5.05 1.8 5.81 1 1 
       2629 1 . . . . . 5.97 1.8 6.87 1 1 
       2630 1 . . . . .  5.0 1.8 5.75 1 1 
       2631 1 . . . . . 5.55 1.8 6.38 1 1 
       2632 1 . . . . . 4.98 1.8 5.73 1 1 
       2633 1 . . . . . 4.98 1.8 5.73 1 1 
       2634 1 . . . . . 3.79 1.8 4.36 1 1 
       2635 1 . . . . . 3.49 1.8 4.01 1 1 
       2636 1 . . . . . 4.01 1.8 4.61 1 1 
       2637 1 . . . . . 4.11 1.8 4.73 1 1 
       2638 1 . . . . . 3.38 1.8 3.89 1 1 
       2639 1 . . . . . 4.94 1.8 5.68 1 1 
       2640 1 . . . . . 4.02 1.8 4.62 1 1 
       2641 1 . . . . . 3.03 1.8 3.48 1 1 
       2642 1 . . . . .  3.1 1.8 3.57 1 1 
       2643 1 . . . . . 4.06 1.8 4.67 1 1 
       2644 1 . . . . . 4.79 1.8 5.51 1 1 
       2645 1 . . . . . 4.79 1.8 5.51 1 1 
       2646 1 . . . . . 4.63 1.8 5.32 1 1 
       2647 1 . . . . . 4.02 1.8 4.62 1 1 
       2648 1 . . . . . 4.02 1.8 4.62 1 1 
       2649 1 . . . . . 4.21 1.8 4.84 1 1 
       2650 1 . . . . . 5.84 1.8 6.72 1 1 
       2651 1 . . . . . 5.84 1.8 6.72 1 1 
       2652 1 . . . . . 5.49 1.8 6.31 1 1 
       2653 1 . . . . . 4.53 1.8 5.21 1 1 
       2654 1 . . . . . 4.53 1.8 5.21 1 1 
       2655 1 . . . . . 4.33 1.8 4.98 1 1 
       2656 1 . . . . . 4.33 1.8 4.98 1 1 
       2657 1 . . . . . 3.52 1.8 4.05 1 1 
       2658 1 . . . . .  3.1 1.8 3.57 1 1 
       2659 1 . . . . . 3.95 1.8 4.54 1 1 
       2660 1 . . . . . 4.65 1.8 5.35 1 1 
       2661 1 . . . . . 5.21 1.8 5.99 1 1 
       2662 1 . . . . . 4.91 1.8 5.65 1 1 
       2663 1 . . . . . 5.17 1.8 5.95 1 1 
       2664 1 . . . . . 5.89 1.8 6.77 1 1 
       2665 1 . . . . . 5.89 1.8 6.77 1 1 
       2666 1 . . . . . 5.27 1.8 6.06 1 1 
       2667 1 . . . . . 5.19 1.8 5.97 1 1 
       2668 1 . . . . . 4.28 1.8 4.92 1 1 
       2669 1 . . . . .  3.8 1.8 4.37 1 1 
       2670 1 . . . . . 4.21 1.8 4.84 1 1 
       2671 1 . . . . . 3.28 1.8 3.77 1 1 
       2672 1 . . . . . 5.86 1.8 6.74 1 1 
       2673 1 . . . . . 5.86 1.8 6.74 1 1 
       2674 1 . . . . . 4.91 1.8 5.65 1 1 
       2675 1 . . . . . 5.77 1.8 6.64 1 1 
       2676 1 . . . . . 5.77 1.8 6.64 1 1 
       2677 1 . . . . . 4.87 1.8  5.6 1 1 
       2678 1 . . . . .  6.2 1.8 7.13 1 1 
       2679 1 . . . . . 4.99 1.8 5.74 1 1 
       2680 1 . . . . . 5.36 1.8 6.16 1 1 
       2681 1 . . . . . 4.88 1.8 5.61 1 1 
       2682 1 . . . . . 4.88 1.8 5.61 1 1 
       2683 1 . . . . . 5.71 1.8 6.57 1 1 
       2684 1 . . . . . 5.71 1.8 6.57 1 1 
       2685 1 . . . . .  6.2 1.8 7.13 1 1 
       2686 1 . . . . .  6.2 1.8 7.13 1 1 
       2687 1 . . . . . 5.09 1.8 5.85 1 1 
       2688 1 . . . . . 5.09 1.8 5.85 1 1 
       2689 1 . . . . .  6.2 1.8 7.13 1 1 
       2690 1 . . . . .  6.2 1.8 7.13 1 1 
       2691 1 . . . . . 3.72 1.8 4.28 1 1 
       2692 1 . . . . . 3.72 1.8 4.28 1 1 
       2693 1 . . . . . 4.86 1.8 5.59 1 1 
       2694 1 . . . . . 5.04 1.8  5.8 1 1 
       2695 1 . . . . . 4.99 1.8 5.74 1 1 
       2696 1 . . . . . 4.39 1.8 5.05 1 1 
       2697 1 . . . . . 4.59 1.8 5.28 1 1 
       2698 1 . . . . . 5.06 1.8 5.82 1 1 
       2699 1 . . . . . 4.73 1.8 5.44 1 1 
       2700 1 . . . . .  5.0 1.8 5.75 1 1 
       2701 1 . . . . . 4.83 1.8 5.55 1 1 
       2702 1 . . . . .  5.7 1.8 6.56 1 1 
       2703 1 . . . . . 4.83 1.8 5.55 1 1 
       2704 1 . . . . . 3.43 1.8 3.94 1 1 
       2705 1 . . . . . 5.21 1.8 5.99 1 1 
       2706 1 . . . . . 5.75 1.8 6.61 1 1 
       2707 1 . . . . . 2.95 1.8 3.39 1 1 
       2708 1 . . . . . 5.65 1.8  6.5 1 1 
       2709 1 . . . . . 5.65 1.8  6.5 1 1 
       2710 1 . . . . . 3.97 1.8 4.57 1 1 
       2711 1 . . . . . 3.33 1.8 3.83 1 1 
       2712 1 . . . . . 3.05 1.8 3.51 1 1 
       2713 1 . . . . . 3.44 1.8 3.96 1 1 
       2714 1 . . . . . 5.21 1.8 5.99 1 1 
       2715 1 . . . . . 5.21 1.8 5.99 1 1 
       2716 1 . . . . . 4.44 1.8 5.11 1 1 
       2717 1 . . . . .  6.2 1.8 7.13 1 1 
       2718 1 . . . . .  6.2 1.8 7.13 1 1 
       2719 1 . . . . .  6.2 1.8 7.13 1 1 
       2720 1 . . . . .  6.2 1.8 7.13 1 1 
       2721 1 . . . . . 5.07 1.8 5.83 1 1 
       2722 1 . . . . .  6.1 1.8 7.02 1 1 
       2723 1 . . . . . 4.86 1.8 5.59 1 1 
       2724 1 . . . . . 3.83 1.8  4.4 1 1 
       2725 1 . . . . . 4.17 1.8  4.8 1 1 
       2726 1 . . . . . 5.79 1.8 6.66 1 1 
       2727 1 . . . . . 5.79 1.8 6.66 1 1 
       2728 1 . . . . .  6.2 1.8 7.13 1 1 
       2729 1 . . . . .  6.2 1.8 7.13 1 1 
       2730 1 . . . . . 4.66 1.8 5.36 1 1 
       2731 1 . . . . .  4.9 1.8 5.64 1 1 
       2732 1 . . . . . 5.48 1.8  6.3 1 1 
       2733 1 . . . . . 4.71 1.8 5.42 1 1 
       2734 1 . . . . .  5.6 1.8 6.44 1 1 
       2735 1 . . . . . 5.78 1.8 6.65 1 1 
       2736 1 . . . . . 5.45 1.8 6.27 1 1 
       2737 1 . . . . . 5.34 1.8 6.14 1 1 
       2738 1 . . . . . 5.59 1.8 6.43 1 1 
       2739 1 . . . . . 4.56 1.8 5.24 1 1 
       2740 1 . . . . . 4.56 1.8 5.24 1 1 
       2741 1 . . . . . 4.84 1.8 5.57 1 1 
       2742 1 . . . . . 4.55 1.8 5.23 1 1 
       2743 1 . . . . . 5.67 1.8 6.52 1 1 
       2744 1 . . . . . 5.67 1.8 6.52 1 1 
       2745 1 . . . . . 5.26 1.8 6.05 1 1 
       2746 1 . . . . . 5.26 1.8 6.05 1 1 
       2747 1 . . . . . 5.82 1.8 6.69 1 1 
       2748 1 . . . . . 4.51 1.8 5.19 1 1 
       2749 1 . . . . . 5.77 1.8 6.64 1 1 
       2750 1 . . . . . 5.82 1.8 6.69 1 1 
       2751 1 . . . . . 5.82 1.8 6.69 1 1 
       2752 1 . . . . . 5.82 1.8 6.69 1 1 
       2753 1 . . . . . 5.08 1.8 5.84 1 1 
       2754 1 . . . . . 4.35 1.8  5.0 1 1 
       2755 1 . . . . . 4.84 1.8 5.57 1 1 
       2756 1 . . . . .  4.2 1.8 4.83 1 1 
       2757 1 . . . . . 5.72 1.8 6.58 1 1 
       2758 1 . . . . . 4.68 1.8 5.38 1 1 
       2759 1 . . . . . 4.68 1.8 5.38 1 1 
       2760 1 . . . . . 4.78 1.8  5.5 1 1 
       2761 1 . . . . . 4.02 1.8 4.62 1 1 
       2762 1 . . . . . 3.95 1.8 4.54 1 1 
       2763 1 . . . . .  4.9 1.8 5.64 1 1 
       2764 1 . . . . . 5.21 1.8 5.99 1 1 
       2765 1 . . . . . 5.66 1.8 6.51 1 1 
       2766 1 . . . . .  5.2 1.8 5.98 1 1 
       2767 1 . . . . .  6.2 1.8 7.13 1 1 
       2768 1 . . . . . 3.38 1.8 3.89 1 1 
       2769 1 . . . . . 5.17 1.8 5.95 1 1 
       2770 1 . . . . . 5.17 1.8 5.95 1 1 
       2771 1 . . . . .  4.8 1.8 5.52 1 1 
       2772 1 . . . . .  4.8 1.8 5.52 1 1 
       2773 1 . . . . . 5.35 1.8 6.15 1 1 
       2774 1 . . . . . 5.92 1.8 6.81 1 1 
       2775 1 . . . . . 5.92 1.8 6.81 1 1 
       2776 1 . . . . . 6.16 1.8 7.08 1 1 
       2777 1 . . . . . 5.77 1.8 6.64 1 1 
       2778 1 . . . . .  4.2 1.8 4.83 1 1 
       2779 1 . . . . . 4.56 1.8 5.24 1 1 
       2780 1 . . . . . 6.02 1.8 6.92 1 1 
       2781 1 . . . . . 6.02 1.8 6.92 1 1 
       2782 1 . . . . . 4.65 1.8 5.35 1 1 
       2783 1 . . . . . 4.86 1.8 5.59 1 1 
       2784 1 . . . . .  4.1 1.8 4.72 1 1 
       2785 1 . . . . .  4.2 1.8 4.83 1 1 
       2786 1 . . . . . 3.55 1.8 4.08 1 1 
       2787 1 . . . . . 5.35 1.8 6.15 1 1 
       2788 1 . . . . . 3.78 1.8 4.35 1 1 
       2789 1 . . . . . 4.02 1.8 4.62 1 1 
       2790 1 . . . . . 2.94 1.8 3.38 1 1 
       2791 1 . . . . . 3.01 1.8 3.46 1 1 
       2792 1 . . . . . 4.45 1.8 5.12 1 1 
       2793 1 . . . . . 4.37 1.8 5.03 1 1 
       2794 1 . . . . . 3.99 1.8 4.59 1 1 
       2795 1 . . . . . 3.59 1.8 4.13 1 1 
       2796 1 . . . . . 3.47 1.8 3.99 1 1 
       2797 1 . . . . . 2.64 1.8 3.04 1 1 
       2798 1 . . . . . 4.41 1.8 5.07 1 1 
       2799 1 . . . . . 3.64 1.8 4.19 1 1 
       2800 1 . . . . . 3.81 1.8 4.38 1 1 
       2801 1 . . . . . 4.76 1.8 5.47 1 1 
       2802 1 . . . . .  5.2 1.8 5.98 1 1 
       2803 1 . . . . . 5.19 1.8 5.97 1 1 
       2804 1 . . . . .  6.2 1.8 7.13 1 1 
       2805 1 . . . . .  6.2 1.8 7.13 1 1 
       2806 1 . . . . . 3.76 1.8 4.32 1 1 
       2807 1 . . . . . 5.43 1.8 6.24 1 1 
       2808 1 . . . . . 3.75 1.8 4.31 1 1 
       2809 1 . . . . . 3.38 1.8 3.89 1 1 
       2810 1 . . . . . 4.09 1.8  4.7 1 1 
       2811 1 . . . . . 5.33 1.8 6.13 1 1 
       2812 1 . . . . . 5.22 1.8  6.0 1 1 
       2813 1 . . . . .  6.2 1.8 7.13 1 1 
       2814 1 . . . . .  6.2 1.8 7.13 1 1 
       2815 1 . . . . . 5.82 1.8 6.69 1 1 
       2816 1 . . . . . 3.64 1.8 4.19 1 1 
       2817 1 . . . . .  4.7 1.8  5.4 1 1 
       2818 1 . . . . . 3.18 1.8 3.66 1 1 
       2819 1 . . . . .  6.1 1.8 7.02 1 1 
       2820 1 . . . . . 5.48 1.8  6.3 1 1 
       2821 1 . . . . . 5.61 1.8 6.45 1 1 
       2822 1 . . . . . 5.83 1.8  6.7 1 1 
       2823 1 . . . . . 3.59 1.8 4.13 1 1 
       2824 1 . . . . . 3.28 1.8 3.77 1 1 
       2825 1 . . . . . 3.49 1.8 4.01 1 1 
       2826 1 . . . . . 3.76 1.8 4.32 1 1 
       2827 1 . . . . . 3.54 1.8 4.07 1 1 
       2828 1 . . . . .  4.3 1.8 4.95 1 1 
       2829 1 . . . . .  4.4 1.8 5.06 1 1 
       2830 1 . . . . . 4.43 1.8 5.09 1 1 
       2831 1 . . . . . 4.38 1.8 5.04 1 1 
       2832 1 . . . . . 4.12 1.8 4.74 1 1 
       2833 1 . . . . .  3.5 1.8 4.03 1 1 
       2834 1 . . . . . 5.11 1.8 5.88 1 1 
       2835 1 . . . . . 4.48 1.8 5.15 1 1 
       2836 1 . . . . . 4.37 1.8 5.03 1 1 
       2837 1 . . . . . 4.37 1.8 5.03 1 1 
       2838 1 . . . . .  4.4 1.8 5.06 1 1 
       2839 1 . . . . .  4.4 1.8 5.06 1 1 
       2840 1 . . . . . 4.47 1.8 5.14 1 1 
       2841 1 . . . . . 4.54 1.8 5.22 1 1 
       2842 1 . . . . . 4.25 1.8 4.89 1 1 
       2843 1 . . . . . 5.87 1.8 6.75 1 1 
       2844 1 . . . . . 5.87 1.8 6.75 1 1 
       2845 1 . . . . .  3.2 1.8 3.68 1 1 
       2846 1 . . . . . 3.07 1.8 3.53 1 1 
       2847 1 . . . . .  6.2 1.8 7.13 1 1 
       2848 1 . . . . . 4.04 1.8 4.65 1 1 
       2849 1 . . . . . 4.96 1.8  5.7 1 1 
       2850 1 . . . . . 5.51 1.8 6.34 1 1 
       2851 1 . . . . . 4.62 1.8 5.31 1 1 
       2852 1 . . . . . 4.29 1.8 4.93 1 1 
       2853 1 . . . . . 4.65 1.8 5.35 1 1 
       2854 1 . . . . . 4.65 1.8 5.35 1 1 
       2855 1 . . . . . 4.33 1.8 4.98 1 1 
       2856 1 . . . . . 4.14 1.8 4.76 1 1 
       2857 1 . . . . . 4.08 1.8 4.69 1 1 
       2858 1 . . . . . 4.76 1.8 5.47 1 1 
       2859 1 . . . . . 3.85 1.8 4.43 1 1 
       2860 1 . . . . . 4.42 1.8 5.08 1 1 
       2861 1 . . . . . 3.67 1.8 4.22 1 1 
       2862 1 . . . . . 5.54 1.8 6.37 1 1 
       2863 1 . . . . . 5.88 1.8 6.76 1 1 
       2864 1 . . . . . 3.54 1.8 4.07 1 1 
       2865 1 . . . . . 4.64 1.8 5.34 1 1 
       2866 1 . . . . . 3.85 1.8 4.43 1 1 
       2867 1 . . . . . 3.85 1.8 4.43 1 1 
       2868 1 . . . . .  3.7 1.8 4.26 1 1 
       2869 1 . . . . . 3.37 1.8 3.88 1 1 
       2870 1 . . . . . 3.25 1.8 3.74 1 1 
       2871 1 . . . . . 3.66 1.8 4.21 1 1 
       2872 1 . . . . . 4.25 1.8 4.89 1 1 
       2873 1 . . . . . 3.67 1.8 4.22 1 1 
       2874 1 . . . . . 3.67 1.8 4.22 1 1 
       2875 1 . . . . . 3.91 1.8  4.5 1 1 
       2876 1 . . . . . 4.26 1.8  4.9 1 1 
       2877 1 . . . . . 3.79 1.8 4.36 1 1 
       2878 1 . . . . .  4.0 1.8  4.6 1 1 
       2879 1 . . . . . 3.86 1.8 4.44 1 1 
       2880 1 . . . . . 4.28 1.8 4.92 1 1 
       2881 1 . . . . . 3.77 1.8 4.34 1 1 
       2882 1 . . . . . 4.57 1.8 5.26 1 1 
       2883 1 . . . . . 5.79 1.8 6.66 1 1 
       2884 1 . . . . . 4.24 1.8 4.88 1 1 
       2885 1 . . . . . 4.24 1.8 4.88 1 1 
       2886 1 . . . . . 4.63 1.8 5.32 1 1 
       2887 1 . . . . . 6.12 1.8 7.04 1 1 
       2888 1 . . . . .  6.2 1.8 7.13 1 1 
       2889 1 . . . . . 6.12 1.8 7.04 1 1 
       2890 1 . . . . .  4.8 1.8 5.52 1 1 
       2891 1 . . . . . 4.62 1.8 5.31 1 1 
       2892 1 . . . . . 4.89 1.8 5.62 1 1 
       2893 1 . . . . .  4.5 1.8 5.18 1 1 
       2894 1 . . . . . 4.58 1.8 5.27 1 1 
       2895 1 . . . . . 4.62 1.8 5.31 1 1 
       2896 1 . . . . .  3.8 1.8 4.37 1 1 
       2897 1 . . . . . 4.46 1.8 5.13 1 1 
       2898 1 . . . . . 3.52 1.8 4.05 1 1 
       2899 1 . . . . . 4.22 1.8 4.85 1 1 
       2900 1 . . . . . 4.72 1.8 5.43 1 1 
       2901 1 . . . . . 2.59 1.8 2.98 1 1 
       2902 1 . . . . . 3.14 1.8 3.61 1 1 
       2903 1 . . . . . 4.99 1.8 5.74 1 1 
       2904 1 . . . . . 3.79 1.8 4.36 1 1 
       2905 1 . . . . . 4.74 1.8 5.45 1 1 
       2906 1 . . . . . 3.16 1.8 3.63 1 1 
       2907 1 . . . . . 3.87 1.8 4.45 1 1 
       2908 1 . . . . . 5.15 1.8 5.92 1 1 
       2909 1 . . . . . 5.37 1.8 6.18 1 1 
       2910 1 . . . . . 5.13 1.8  5.9 1 1 
       2911 1 . . . . . 3.82 1.8 4.39 1 1 
       2912 1 . . . . . 4.47 1.8 5.14 1 1 
       2913 1 . . . . . 4.25 1.8 4.89 1 1 
       2914 1 . . . . . 5.86 1.8 6.74 1 1 
       2915 1 . . . . . 4.76 1.8 5.47 1 1 
       2916 1 . . . . . 4.07 1.8 4.68 1 1 
       2917 1 . . . . . 5.06 1.8 5.82 1 1 
       2918 1 . . . . . 5.53 1.8 6.36 1 1 
       2919 1 . . . . . 4.53 1.8 5.21 1 1 
       2920 1 . . . . . 4.89 1.8 5.62 1 1 
       2921 1 . . . . . 4.42 1.8 5.08 1 1 
       2922 1 . . . . . 4.75 1.8 5.46 1 1 
       2923 1 . . . . . 5.28 1.8 6.07 1 1 
       2924 1 . . . . . 5.07 1.8 5.83 1 1 
       2925 1 . . . . . 5.64 1.8 6.49 1 1 
       2926 1 . . . . . 4.69 1.8 5.39 1 1 
       2927 1 . . . . . 3.47 1.8 3.99 1 1 
       2928 1 . . . . . 4.45 1.8 5.12 1 1 
       2929 1 . . . . . 4.39 1.8 5.05 1 1 
       2930 1 . . . . .  5.5 1.8 6.33 1 1 
       2931 1 . . . . . 3.61 1.8 4.15 1 1 
       2932 1 . . . . . 4.49 1.8 5.16 1 1 
       2933 1 . . . . . 4.15 1.8 4.77 1 1 
       2934 1 . . . . . 5.13 1.8  5.9 1 1 
       2935 1 . . . . . 5.25 1.8 6.04 1 1 
       2936 1 . . . . . 2.31 1.8 2.66 1 1 
       2937 1 . . . . . 3.57 1.8 4.11 1 1 
       2938 1 . . . . . 5.99 1.8 6.89 1 1 
       2939 1 . . . . .  4.0 1.8  4.6 1 1 
       2940 1 . . . . . 4.07 1.8 4.68 1 1 
       2941 1 . . . . . 4.72 1.8 5.43 1 1 
       2942 1 . . . . . 5.75 1.8 6.61 1 1 
       2943 1 . . . . . 4.95 1.8 5.69 1 1 
       2944 1 . . . . . 4.03 1.8 4.63 1 1 
       2945 1 . . . . . 4.25 1.8 4.89 1 1 
       2946 1 . . . . . 5.46 1.8 6.28 1 1 
       2947 1 . . . . . 4.35 1.8  5.0 1 1 
       2948 1 . . . . . 4.39 1.8 5.05 1 1 
       2949 1 . . . . . 5.79 1.8 6.66 1 1 
       2950 1 . . . . . 5.29 1.8 6.08 1 1 
       2951 1 . . . . . 4.66 1.8 5.36 1 1 
       2952 1 . . . . . 3.47 1.8 3.99 1 1 
       2953 1 . . . . . 4.66 1.8 5.36 1 1 
       2954 1 . . . . . 3.93 1.8 4.52 1 1 
       2955 1 . . . . . 4.59 1.8 5.28 1 1 
       2956 1 . . . . . 4.65 1.8 5.35 1 1 
       2957 1 . . . . .  4.1 1.8 4.72 1 1 
       2958 1 . . . . . 3.26 1.8 3.75 1 1 
       2959 1 . . . . . 4.48 1.8 5.15 1 1 
       2960 1 . . . . . 4.25 1.8 4.89 1 1 
       2961 1 . . . . . 2.56 1.8 2.94 1 1 
       2962 1 . . . . . 2.91 1.8 3.35 1 1 
       2963 1 . . . . . 3.61 1.8 4.15 1 1 
       2964 1 . . . . . 5.53 1.8 6.36 1 1 
       2965 1 . . . . . 5.29 1.8 6.08 1 1 
       2966 1 . . . . . 4.24 1.8 4.88 1 1 
       2967 1 . . . . . 3.55 1.8 4.08 1 1 
       2968 1 . . . . . 4.94 1.8 5.68 1 1 
       2969 1 . . . . . 4.08 1.8 4.69 1 1 
       2970 1 . . . . . 5.04 1.8  5.8 1 1 
       2971 1 . . . . . 4.05 1.8 4.66 1 1 
       2972 1 . . . . . 5.12 1.8 5.89 1 1 
       2973 1 . . . . . 3.51 1.8 4.04 1 1 
       2974 1 . . . . . 4.05 1.8 4.66 1 1 
       2975 1 . . . . . 4.34 1.8 4.99 1 1 
       2976 1 . . . . . 3.82 1.8 4.39 1 1 
       2977 1 . . . . . 4.14 1.8 4.76 1 1 
       2978 1 . . . . .  6.0 1.8  6.9 1 1 
       2979 1 . . . . . 3.88 1.8 4.46 1 1 
       2980 1 . . . . . 5.07 1.8 5.83 1 1 
       2981 1 . . . . . 3.82 1.8 4.39 1 1 
       2982 1 . . . . . 5.04 1.8  5.8 1 1 
       2983 1 . . . . .  6.0 1.8  6.9 1 1 
       2984 1 . . . . . 4.04 1.8 4.65 1 1 
       2985 1 . . . . . 5.79 1.8 6.66 1 1 
       2986 1 . . . . . 4.05 1.8 4.66 1 1 
       2987 1 . . . . . 5.79 1.8 6.66 1 1 
       2988 1 . . . . . 5.22 1.8  6.0 1 1 
       2989 1 . . . . . 3.72 1.8 4.28 1 1 
       2990 1 . . . . . 5.48 1.8  6.3 1 1 
       2991 1 . . . . . 5.38 1.8 6.19 1 1 
       2992 1 . . . . . 4.74 1.8 5.45 1 1 
       2993 1 . . . . . 4.48 1.8 5.15 1 1 
       2994 1 . . . . . 4.76 1.8 5.47 1 1 
       2995 1 . . . . . 3.41 1.8 3.92 1 1 
       2996 1 . . . . . 5.18 1.8 5.96 1 1 
       2997 1 . . . . .  5.5 1.8 6.33 1 1 
       2998 1 . . . . . 2.58 1.8 2.97 1 1 
       2999 1 . . . . . 2.84 1.8 3.27 1 1 
       3000 1 . . . . . 3.54 1.8 4.07 1 1 
       3001 1 . . . . . 5.09 1.8 5.85 1 1 
       3002 1 . . . . . 5.97 1.8 6.87 1 1 
       3003 1 . . . . . 4.57 1.8 5.26 1 1 
       3004 1 . . . . . 4.05 1.8 4.66 1 1 
       3005 1 . . . . . 3.57 1.8 4.11 1 1 
       3006 1 . . . . . 5.25 1.8 6.04 1 1 
       3007 1 . . . . . 4.58 1.8 5.27 1 1 
       3008 1 . . . . . 5.17 1.8 5.95 1 1 
       3009 1 . . . . . 2.85 1.8 3.28 1 1 
       3010 1 . . . . . 4.83 1.8 5.55 1 1 
       3011 1 . . . . . 5.17 1.8 5.95 1 1 
       3012 1 . . . . . 4.18 1.8 4.81 1 1 
       3013 1 . . . . . 3.64 1.8 4.19 1 1 
       3014 1 . . . . .  5.9 1.8 6.79 1 1 
       3015 1 . . . . . 4.56 1.8 5.24 1 1 
       3016 1 . . . . . 3.82 1.8 4.39 1 1 
       3017 1 . . . . . 3.66 1.8 4.21 1 1 
       3018 1 . . . . . 5.38 1.8 6.19 1 1 
       3019 1 . . . . . 4.39 1.8 5.05 1 1 
       3020 1 . . . . . 4.21 1.8 4.84 1 1 
       3021 1 . . . . . 4.36 1.8 5.01 1 1 
       3022 1 . . . . . 4.13 1.8 4.75 1 1 
       3023 1 . . . . . 3.71 1.8 4.27 1 1 
       3024 1 . . . . . 5.46 1.8 6.28 1 1 
       3025 1 . . . . . 4.07 1.8 4.68 1 1 
       3026 1 . . . . . 3.66 1.8 4.21 1 1 
       3027 1 . . . . . 3.83 1.8  4.4 1 1 
       3028 1 . . . . . 3.27 1.8 3.76 1 1 
       3029 1 . . . . . 4.56 1.8 5.24 1 1 
       3030 1 . . . . . 4.71 1.8 5.42 1 1 
       3031 1 . . . . . 5.15 1.8 5.92 1 1 
       3032 1 . . . . .  4.9 1.8 5.64 1 1 
       3033 1 . . . . . 5.21 1.8 5.99 1 1 
       3034 1 . . . . .  5.4 1.8 6.21 1 1 
       3035 1 . . . . .  6.0 1.8  6.9 1 1 
       3036 1 . . . . . 3.31 1.8 3.81 1 1 
       3037 1 . . . . . 3.65 1.8  4.2 1 1 
       3038 1 . . . . .  4.9 1.8 5.64 1 1 
       3039 1 . . . . . 4.76 1.8 5.47 1 1 
       3040 1 . . . . . 3.92 1.8 4.51 1 1 
       3041 1 . . . . . 4.15 1.8 4.77 1 1 
       3042 1 . . . . . 5.46 1.8 6.28 1 1 
       3043 1 . . . . . 4.39 1.8 5.05 1 1 
       3044 1 . . . . .  5.8 1.8 6.67 1 1 
       3045 1 . . . . . 4.12 1.8 4.74 1 1 
       3046 1 . . . . . 4.58 1.8 5.27 1 1 
       3047 1 . . . . . 4.39 1.8 5.05 1 1 
       3048 1 . . . . . 4.26 1.8  4.9 1 1 
       3049 1 . . . . . 3.61 1.8 4.15 1 1 
       3050 1 . . . . . 3.88 1.8 4.46 1 1 
       3051 1 . . . . . 5.32 1.8 6.12 1 1 
       3052 1 . . . . . 4.38 1.8 5.04 1 1 
       3053 1 . . . . . 4.74 1.8 5.45 1 1 
       3054 1 . . . . . 5.42 1.8 6.23 1 1 
       3055 1 . . . . . 4.81 1.8 5.53 1 1 
       3056 1 . . . . . 4.54 1.8 5.22 1 1 
       3057 1 . . . . . 4.31 1.8 4.96 1 1 
       3058 1 . . . . . 5.35 1.8 6.15 1 1 
       3059 1 . . . . . 5.23 1.8 6.01 1 1 
       3060 1 . . . . . 5.78 1.8 6.65 1 1 
       3061 1 . . . . . 3.84 1.8 4.42 1 1 
       3062 1 . . . . . 3.76 1.8 4.32 1 1 
       3063 1 . . . . . 5.05 1.8 5.81 1 1 
       3064 1 . . . . . 5.95 1.8 6.84 1 1 
       3065 1 . . . . . 5.04 1.8  5.8 1 1 
       3066 1 . . . . . 5.17 1.8 5.95 1 1 
       3067 1 . . . . . 3.01 1.8 3.46 1 1 
       3068 1 . . . . . 5.99 1.8 6.89 1 1 
       3069 1 . . . . . 4.89 1.8 5.62 1 1 
       3070 1 . . . . .  3.5 1.8 4.03 1 1 
       3071 1 . . . . . 5.22 1.8  6.0 1 1 
       3072 1 . . . . . 3.35 1.8 3.85 1 1 
       3073 1 . . . . . 4.89 1.8 5.62 1 1 
       3074 1 . . . . . 5.08 1.8 5.84 1 1 
       3075 1 . . . . .  5.7 1.8 6.56 1 1 
       3076 1 . . . . . 4.87 1.8  5.6 1 1 
       3077 1 . . . . . 5.21 1.8 5.99 1 1 
       3078 1 . . . . . 4.45 1.8 5.12 1 1 
       3079 1 . . . . . 2.59 1.8 2.98 1 1 
       3080 1 . . . . . 3.55 1.8 4.08 1 1 
       3081 1 . . . . .  3.9 1.8 4.49 1 1 
       3082 1 . . . . . 3.51 1.8 4.04 1 1 
       3083 1 . . . . . 5.07 1.8 5.83 1 1 
       3084 1 . . . . . 2.23 1.8 2.56 1 1 
       3085 1 . . . . . 3.48 1.8  4.0 1 1 
       3086 1 . . . . . 4.04 1.8 4.65 1 1 
       3087 1 . . . . . 4.85 1.8 5.58 1 1 
       3088 1 . . . . .  3.9 1.8 4.49 1 1 
       3089 1 . . . . . 3.99 1.8 4.59 1 1 
       3090 1 . . . . . 5.13 1.8  5.9 1 1 
       3091 1 . . . . . 4.36 1.8 5.01 1 1 
       3092 1 . . . . . 2.73 1.8 3.14 1 1 
       3093 1 . . . . . 3.36 1.8 3.86 1 1 
       3094 1 . . . . . 5.09 1.8 5.85 1 1 
       3095 1 . . . . . 4.59 1.8 5.28 1 1 
       3096 1 . . . . .  6.0 1.8  6.9 1 1 
       3097 1 . . . . .  4.4 1.8 5.06 1 1 
       3098 1 . . . . . 5.28 1.8 6.07 1 1 
       3099 1 . . . . . 5.89 1.8 6.77 1 1 
       3100 1 . . . . . 3.35 1.8 3.85 1 1 
       3101 1 . . . . . 4.04 1.8 4.65 1 1 
       3102 1 . . . . . 3.76 1.8 4.32 1 1 
       3103 1 . . . . . 3.05 1.8 3.51 1 1 
       3104 1 . . . . . 3.21 1.8 3.69 1 1 
       3105 1 . . . . . 4.43 1.8 5.09 1 1 
       3106 1 . . . . . 4.64 1.8 5.34 1 1 
       3107 1 . . . . . 5.42 1.8 6.23 1 1 
       3108 1 . . . . . 4.68 1.8 5.38 1 1 
       3109 1 . . . . . 4.14 1.8 4.76 1 1 
       3110 1 . . . . . 2.88 1.8 3.31 1 1 
       3111 1 . . . . . 4.51 1.8 5.19 1 1 
       3112 1 . . . . . 4.24 1.8 4.88 1 1 
       3113 1 . . . . . 3.24 1.8 3.73 1 1 
       3114 1 . . . . . 4.08 1.8 4.69 1 1 
       3115 1 . . . . . 3.28 1.8 3.77 1 1 
       3116 1 . . . . . 4.76 1.8 5.47 1 1 
       3117 1 . . . . . 3.77 1.8 4.34 1 1 
       3118 1 . . . . . 4.72 1.8 5.43 1 1 
       3119 1 . . . . . 3.07 1.8 3.53 1 1 
       3120 1 . . . . . 2.88 1.8 3.31 1 1 
       3121 1 . . . . . 4.49 1.8 5.16 1 1 
       3122 1 . . . . . 5.22 1.8  6.0 1 1 
       3123 1 . . . . . 2.55 1.8 2.93 1 1 
       3124 1 . . . . . 3.32 1.8 3.82 1 1 
       3125 1 . . . . .  4.0 1.8  4.6 1 1 
       3126 1 . . . . . 3.11 1.8 3.58 1 1 
       3127 1 . . . . . 3.33 1.8 3.83 1 1 
       3128 1 . . . . . 4.36 1.8 5.01 1 1 
       3129 1 . . . . . 2.61 1.8  3.0 1 1 
       3130 1 . . . . . 3.79 1.8 4.36 1 1 
       3131 1 . . . . . 2.89 1.8 3.32 1 1 
       3132 1 . . . . . 4.29 1.8 4.93 1 1 
       3133 1 . . . . .  2.7 1.8 3.11 1 1 
       3134 1 . . . . .  3.1 1.8 3.57 1 1 
       3135 1 . . . . . 2.97 1.8 3.42 1 1 
       3136 1 . . . . . 3.18 1.8 3.66 1 1 
       3137 1 . . . . . 4.67 1.8 5.37 1 1 
       3138 1 . . . . .  4.1 1.8 4.72 1 1 
       3139 1 . . . . . 3.81 1.8 4.38 1 1 
       3140 1 . . . . . 3.83 1.8  4.4 1 1 
       3141 1 . . . . . 2.85 1.8 3.28 1 1 
       3142 1 . . . . . 3.38 1.8 3.89 1 1 
       3143 1 . . . . . 3.39 1.8  3.9 1 1 
       3144 1 . . . . . 3.61 1.8 4.15 1 1 
       3145 1 . . . . . 2.91 1.8 3.35 1 1 
       3146 1 . . . . . 3.99 1.8 4.59 1 1 
       3147 1 . . . . . 4.19 1.8 4.82 1 1 
       3148 1 . . . . . 4.89 1.8 5.62 1 1 
       3149 1 . . . . . 4.99 1.8 5.74 1 1 
       3150 1 . . . . . 4.94 1.8 5.68 1 1 
       3151 1 . . . . . 3.55 1.8 4.08 1 1 
       3152 1 . . . . . 3.79 1.8 4.36 1 1 
       3153 1 . . . . . 5.93 1.8 6.82 1 1 
       3154 1 . . . . . 2.79 1.8 3.21 1 1 
       3155 1 . . . . . 5.27 1.8 6.06 1 1 
       3156 1 . . . . . 4.95 1.8 5.69 1 1 
       3157 1 . . . . . 3.84 1.8 4.42 1 1 
       3158 1 . . . . . 3.95 1.8 4.54 1 1 
       3159 1 . . . . .  6.0 1.8  6.9 1 1 
       3160 1 . . . . . 3.13 1.8  3.6 1 1 
       3161 1 . . . . . 3.73 1.8 4.29 1 1 
       3162 1 . . . . . 4.36 1.8 5.01 1 1 
       3163 1 . . . . . 3.99 1.8 4.59 1 1 
       3164 1 . . . . . 4.64 1.8 5.34 1 1 
       3165 1 . . . . . 3.27 1.8 3.76 1 1 
       3166 1 . . . . . 3.06 1.8 3.52 1 1 
       3167 1 . . . . . 4.51 1.8 5.19 1 1 
       3168 1 . . . . . 4.37 1.8 5.03 1 1 
       3169 1 . . . . . 3.34 1.8 3.84 1 1 
       3170 1 . . . . . 4.52 1.8  5.2 1 1 
       3171 1 . . . . . 5.52 1.8 6.35 1 1 
       3172 1 . . . . . 4.93 1.8 5.67 1 1 
       3173 1 . . . . . 2.99 1.8 3.44 1 1 
       3174 1 . . . . . 4.02 1.8 4.62 1 1 
       3175 1 . . . . . 2.82 1.8 3.24 1 1 
       3176 1 . . . . . 3.95 1.8 4.54 1 1 
       3177 1 . . . . . 4.44 1.8 5.11 1 1 
       3178 1 . . . . . 3.27 1.8 3.76 1 1 
       3179 1 . . . . . 4.19 1.8 4.82 1 1 
       3180 1 . . . . . 4.53 1.8 5.21 1 1 
       3181 1 . . . . . 3.84 1.8 4.42 1 1 
       3182 1 . . . . . 3.41 1.8 3.92 1 1 
       3183 1 . . . . . 5.25 1.8 6.04 1 1 
       3184 1 . . . . . 4.26 1.8  4.9 1 1 
       3185 1 . . . . . 4.84 1.8 5.57 1 1 
       3186 1 . . . . . 4.18 1.8 4.81 1 1 
       3187 1 . . . . . 3.91 1.8  4.5 1 1 
       3188 1 . . . . . 2.68 1.8 3.08 1 1 
       3189 1 . . . . . 3.26 1.8 3.75 1 1 
       3190 1 . . . . . 4.61 1.8  5.3 1 1 
       3191 1 . . . . . 4.96 1.8  5.7 1 1 
       3192 1 . . . . . 4.38 1.8 5.04 1 1 
       3193 1 . . . . . 2.62 1.8 3.01 1 1 
       3194 1 . . . . . 3.19 1.8 3.67 1 1 
       3195 1 . . . . . 3.33 1.8 3.83 1 1 
       3196 1 . . . . . 4.37 1.8 5.03 1 1 
       3197 1 . . . . . 3.12 1.8 3.59 1 1 
       3198 1 . . . . . 2.96 1.8  3.4 1 1 
       3199 1 . . . . .  3.5 1.8 4.03 1 1 
       3200 1 . . . . . 3.09 1.8 3.55 1 1 
       3201 1 . . . . . 4.57 1.8 5.26 1 1 
       3202 1 . . . . . 2.35 1.8  2.7 1 1 
       3203 1 . . . . . 3.24 1.8 3.73 1 1 
       3204 1 . . . . . 3.98 1.8 4.58 1 1 
       3205 1 . . . . . 4.89 1.8 5.62 1 1 
       3206 1 . . . . . 5.11 1.8 5.88 1 1 
       3207 1 . . . . . 2.99 1.8 3.44 1 1 
       3208 1 . . . . . 2.81 1.8 3.23 1 1 
       3209 1 . . . . . 2.61 1.8  3.0 1 1 
       3210 1 . . . . .  3.1 1.8 3.57 1 1 
       3211 1 . . . . .  3.8 1.8 4.37 1 1 
       3212 1 . . . . . 4.53 1.8 5.21 1 1 
       3213 1 . . . . . 5.67 1.8 6.52 1 1 
       3214 1 . . . . . 3.82 1.8 4.39 1 1 
       3215 1 . . . . . 4.79 1.8 5.51 1 1 
       3216 1 . . . . . 5.21 1.8 5.99 1 1 
       3217 1 . . . . . 5.27 1.8 6.06 1 1 
       3218 1 . . . . . 4.33 1.8 4.98 1 1 
       3219 1 . . . . . 3.72 1.8 4.28 1 1 
       3220 1 . . . . . 3.37 1.8 3.88 1 1 
       3221 1 . . . . . 5.81 1.8 6.68 1 1 
       3222 1 . . . . . 5.54 1.8 6.37 1 1 
       3223 1 . . . . . 5.13 1.8  5.9 1 1 
       3224 1 . . . . .  5.7 1.8 6.56 1 1 
       3225 1 . . . . . 4.45 1.8 5.12 1 1 
       3226 1 . . . . . 4.08 1.8 4.69 1 1 
       3227 1 . . . . . 4.94 1.8 5.68 1 1 
       3228 1 . . . . . 4.19 1.8 4.82 1 1 
       3229 1 . . . . . 5.37 1.8 6.18 1 1 
       3230 1 . . . . . 3.33 1.8 3.83 1 1 
       3231 1 . . . . . 3.53 1.8 4.06 1 1 
       3232 1 . . . . . 5.13 1.8  5.9 1 1 
       3233 1 . . . . . 5.61 1.8 6.45 1 1 
       3234 1 . . . . . 5.31 1.8 6.11 1 1 
       3235 1 . . . . . 4.45 1.8 5.12 1 1 
       3236 1 . . . . . 3.91 1.8  4.5 1 1 
       3237 1 . . . . . 3.13 1.8  3.6 1 1 
       3238 1 . . . . . 3.51 1.8 4.04 1 1 
       3239 1 . . . . . 3.42 1.8 3.93 1 1 
       3240 1 . . . . .  4.8 1.8 5.52 1 1 
       3241 1 . . . . . 3.47 1.8 3.99 1 1 
       3242 1 . . . . . 4.73 1.8 5.44 1 1 
       3243 1 . . . . . 3.62 1.8 4.16 1 1 
       3244 1 . . . . . 5.79 1.8 6.66 1 1 
       3245 1 . . . . . 4.22 1.8 4.85 1 1 
       3246 1 . . . . . 3.15 1.8 3.62 1 1 
       3247 1 . . . . . 3.34 1.8 3.84 1 1 
       3248 1 . . . . . 5.37 1.8 6.18 1 1 
       3249 1 . . . . . 4.53 1.8 5.21 1 1 
       3250 1 . . . . . 3.42 1.8 3.93 1 1 
       3251 1 . . . . . 4.51 1.8 5.19 1 1 
       3252 1 . . . . . 3.84 1.8 4.42 1 1 
       3253 1 . . . . . 3.74 1.8  4.3 1 1 
       3254 1 . . . . . 5.51 1.8 6.34 1 1 
       3255 1 . . . . . 4.42 1.8 5.08 1 1 
       3256 1 . . . . . 3.77 1.8 4.34 1 1 
       3257 1 . . . . .  6.0 1.8  6.9 1 1 
       3258 1 . . . . . 4.85 1.8 5.58 1 1 
       3259 1 . . . . . 5.15 1.8 5.92 1 1 
       3260 1 . . . . . 4.82 1.8 5.54 1 1 
       3261 1 . . . . . 2.94 1.8 3.38 1 1 
       3262 1 . . . . . 4.81 1.8 5.53 1 1 
       3263 1 . . . . . 5.35 1.8 6.15 1 1 
       3264 1 . . . . .  5.5 1.8 6.33 1 1 
       3265 1 . . . . .  6.0 1.8  6.9 1 1 
       3266 1 . . . . .  6.0 1.8  6.9 1 1 
       3267 1 . . . . .  4.5 1.8 5.18 1 1 
       3268 1 . . . . . 3.34 1.8 3.84 1 1 
       3269 1 . . . . . 4.75 1.8 5.46 1 1 
       3270 1 . . . . . 5.78 1.8 6.65 1 1 
       3271 1 . . . . . 4.12 1.8 4.74 1 1 
       3272 1 . . . . . 4.65 1.8 5.35 1 1 
       3273 1 . . . . . 4.91 1.8 5.65 1 1 
       3274 1 . . . . . 4.12 1.8 4.74 1 1 
       3275 1 . . . . . 5.34 1.8 6.14 1 1 
       3276 1 . . . . . 5.01 1.8 5.76 1 1 
       3277 1 . . . . . 3.16 1.8 3.63 1 1 
       3278 1 . . . . . 3.38 1.8 3.89 1 1 
       3279 1 . . . . . 5.68 1.8 6.53 1 1 
       3280 1 . . . . . 5.13 1.8  5.9 1 1 
       3281 1 . . . . . 5.13 1.8  5.9 1 1 
       3282 1 . . . . . 4.45 1.8 5.12 1 1 
       3283 1 . . . . . 4.69 1.8 5.39 1 1 
       3284 1 . . . . . 4.78 1.8  5.5 1 1 
       3285 1 . . . . . 4.22 1.8 4.85 1 1 
       3286 1 . . . . . 3.74 1.8  4.3 1 1 
       3287 1 . . . . . 5.49 1.8 6.31 1 1 
       3288 1 . . . . . 3.58 1.8 4.12 1 1 
       3289 1 . . . . . 4.51 1.8 5.19 1 1 
       3290 1 . . . . . 4.13 1.8 4.75 1 1 
       3291 1 . . . . . 4.28 1.8 4.92 1 1 
       3292 1 . . . . . 4.25 1.8 4.89 1 1 
       3293 1 . . . . .  4.7 1.8  5.4 1 1 
       3294 1 . . . . . 3.25 1.8 3.74 1 1 
       3295 1 . . . . . 4.25 1.8 4.89 1 1 
       3296 1 . . . . . 4.79 1.8 5.51 1 1 
       3297 1 . . . . . 3.42 1.8 3.93 1 1 
       3298 1 . . . . . 3.69 1.8 4.24 1 1 
       3299 1 . . . . . 4.31 1.8 4.96 1 1 
       3300 1 . . . . . 3.42 1.8 3.93 1 1 
       3301 1 . . . . . 4.16 1.8 4.78 1 1 
       3302 1 . . . . . 4.25 1.8 4.89 1 1 
       3303 1 . . . . . 5.46 1.8 6.28 1 1 
       3304 1 . . . . . 2.92 1.8 3.36 1 1 
       3305 1 . . . . . 4.25 1.8 4.89 1 1 
       3306 1 . . . . . 5.79 1.8 6.66 1 1 
       3307 1 . . . . . 5.13 1.8  5.9 1 1 
       3308 1 . . . . . 4.53 1.8 5.21 1 1 
       3309 1 . . . . . 4.45 1.8 5.12 1 1 
       3310 1 . . . . . 5.01 1.8 5.76 1 1 
       3311 1 . . . . . 4.25 1.8 4.89 1 1 
       3312 1 . . . . . 5.56 1.8 6.39 1 1 
       3313 1 . . . . . 5.77 1.8 6.64 1 1 
       3314 1 . . . . . 4.44 1.8 5.11 1 1 
       3315 1 . . . . .  6.0 1.8  6.9 1 1 
       3316 1 . . . . . 5.41 1.8 6.22 1 1 
       3317 1 . . . . . 4.24 1.8 4.88 1 1 
       3318 1 . . . . .  6.0 1.8  6.9 1 1 
       3319 1 . . . . . 4.19 1.8 4.82 1 1 
       3320 1 . . . . .  3.5 1.8 4.03 1 1 
       3321 1 . . . . . 4.28 1.8 4.92 1 1 
       3322 1 . . . . . 4.06 1.8 4.67 1 1 
       3323 1 . . . . . 4.91 1.8 5.65 1 1 
       3324 1 . . . . . 3.33 1.8 3.83 1 1 
       3325 1 . . . . . 3.74 1.8  4.3 1 1 
       3326 1 . . . . . 5.72 1.8 6.58 1 1 
       3327 1 . . . . . 4.49 1.8 5.16 1 1 
       3328 1 . . . . . 4.65 1.8 5.35 1 1 
       3329 1 . . . . . 3.42 1.8 3.93 1 1 
       3330 1 . . . . . 5.18 1.8 5.96 1 1 
       3331 1 . . . . . 4.77 1.8 5.49 1 1 
       3332 1 . . . . . 3.45 1.8 3.97 1 1 
       3333 1 . . . . . 3.84 1.8 4.42 1 1 
       3334 1 . . . . . 3.81 1.8 4.38 1 1 
       3335 1 . . . . .  6.0 1.8  6.9 1 1 
       3336 1 . . . . . 5.79 1.8 6.66 1 1 
       3337 1 . . . . .  3.2 1.8 3.68 1 1 
       3338 1 . . . . . 3.59 1.8 4.13 1 1 
       3339 1 . . . . .  5.3 1.8  6.1 1 1 
       3340 1 . . . . . 4.82 1.8 5.54 1 1 
       3341 1 . . . . . 4.63 1.8 5.32 1 1 
       3342 1 . . . . . 5.34 1.8 6.14 1 1 
       3343 1 . . . . . 5.99 1.8 6.89 1 1 
       3344 1 . . . . . 5.04 1.8  5.8 1 1 
       3345 1 . . . . . 5.75 1.8 6.61 1 1 
       3346 1 . . . . .  6.0 1.8  6.9 1 1 
       3347 1 . . . . . 4.34 1.8 4.99 1 1 
       3348 1 . . . . . 3.52 1.8 4.05 1 1 
       3349 1 . . . . . 3.98 1.8 4.58 1 1 
       3350 1 . . . . . 3.54 1.8 4.07 1 1 
       3351 1 . . . . . 5.77 1.8 6.64 1 1 
       3352 1 . . . . . 5.12 1.8 5.89 1 1 
       3353 1 . . . . . 3.69 1.8 4.24 1 1 
       3354 1 . . . . . 4.55 1.8 5.23 1 1 
       3355 1 . . . . . 4.76 1.8 5.47 1 1 
       3356 1 . . . . . 4.04 1.8 4.65 1 1 
       3357 1 . . . . . 3.53 1.8 4.06 1 1 
       3358 1 . . . . . 3.56 1.8 4.09 1 1 
       3359 1 . . . . .  3.8 1.8 4.37 1 1 
       3360 1 . . . . . 5.34 1.8 6.14 1 1 
       3361 1 . . . . . 4.02 1.8 4.62 1 1 
       3362 1 . . . . . 4.55 1.8 5.23 1 1 
       3363 1 . . . . . 3.49 1.8 4.01 1 1 
       3364 1 . . . . . 3.14 1.8 3.61 1 1 
       3365 1 . . . . . 3.42 1.8 3.93 1 1 
       3366 1 . . . . .  6.0 1.8  6.9 1 1 
       3367 1 . . . . . 3.83 1.8  4.4 1 1 
       3368 1 . . . . . 4.31 1.8 4.96 1 1 
       3369 1 . . . . . 5.87 1.8 6.75 1 1 
       3370 1 . . . . . 4.29 1.8 4.93 1 1 
       3371 1 . . . . . 5.32 1.8 6.12 1 1 
       3372 1 . . . . . 3.51 1.8 4.04 1 1 
       3373 1 . . . . .  3.8 1.8 4.37 1 1 
       3374 1 . . . . . 5.68 1.8 6.53 1 1 
       3375 1 . . . . . 3.39 1.8  3.9 1 1 
       3376 1 . . . . . 5.36 1.8 6.16 1 1 
       3377 1 . . . . . 5.58 1.8 6.42 1 1 
       3378 1 . . . . . 5.79 1.8 6.66 1 1 
       3379 1 . . . . . 5.39 1.8  6.2 1 1 
       3380 1 . . . . . 3.51 1.8 4.04 1 1 
       3381 1 . . . . . 5.79 1.8 6.66 1 1 
       3382 1 . . . . . 2.87 1.8  3.3 1 1 
       3383 1 . . . . . 4.68 1.8 5.38 1 1 
       3384 1 . . . . . 4.72 1.8 5.43 1 1 
       3385 1 . . . . .  6.0 1.8  6.9 1 1 
       3386 1 . . . . .  6.0 1.8  6.9 1 1 
       3387 1 . . . . . 4.12 1.8 4.74 1 1 
       3388 1 . . . . . 4.79 1.8 5.51 1 1 
       3389 1 . . . . . 4.09 1.8  4.7 1 1 
       3390 1 . . . . .  4.2 1.8 4.83 1 1 
       3391 1 . . . . . 5.87 1.8 6.75 1 1 
       3392 1 . . . . .  6.0 1.8  6.9 1 1 
       3393 1 . . . . . 3.14 1.8 3.61 1 1 
       3394 1 . . . . . 3.22 1.8  3.7 1 1 
       3395 1 . . . . . 4.37 1.8 5.03 1 1 
       3396 1 . . . . . 3.11 1.8 3.58 1 1 
       3397 1 . . . . . 3.32 1.8 3.82 1 1 
       3398 1 . . . . . 3.69 1.8 4.24 1 1 
       3399 1 . . . . .  3.2 1.8 3.68 1 1 
       3400 1 . . . . . 5.06 1.8 5.82 1 1 
       3401 1 . . . . . 3.31 1.8 3.81 1 1 
       3402 1 . . . . . 5.79 1.8 6.66 1 1 
       3403 1 . . . . . 4.76 1.8 5.47 1 1 
       3404 1 . . . . . 4.56 1.8 5.24 1 1 
       3405 1 . . . . . 4.32 1.8 4.97 1 1 
       3406 1 . . . . . 5.79 1.8 6.66 1 1 
       3407 1 . . . . . 4.56 1.8 5.24 1 1 
       3408 1 . . . . . 3.07 1.8 3.53 1 1 
       3409 1 . . . . .  4.1 1.8 4.72 1 1 
       3410 1 . . . . . 4.27 1.8 4.91 1 1 
       3411 1 . . . . . 5.04 1.8  5.8 1 1 
       3412 1 . . . . . 4.98 1.8 5.73 1 1 
       3413 1 . . . . . 2.86 1.8 3.29 1 1 
       3414 1 . . . . . 3.69 1.8 4.24 1 1 
       3415 1 . . . . . 4.39 1.8 5.05 1 1 
       3416 1 . . . . . 4.23 1.8 4.86 1 1 
       3417 1 . . . . . 4.07 1.8 4.68 1 1 
       3418 1 . . . . . 4.47 1.8 5.14 1 1 
       3419 1 . . . . . 4.41 1.8 5.07 1 1 
       3420 1 . . . . . 3.99 1.8 4.59 1 1 
       3421 1 . . . . . 3.97 1.8 4.57 1 1 
       3422 1 . . . . . 4.29 1.8 4.93 1 1 
       3423 1 . . . . . 4.39 1.8 5.05 1 1 
       3424 1 . . . . .  4.5 1.8 5.18 1 1 
       3425 1 . . . . . 4.55 1.8 5.23 1 1 
       3426 1 . . . . . 3.43 1.8 3.94 1 1 
       3427 1 . . . . . 4.53 1.8 5.21 1 1 
       3428 1 . . . . . 4.81 1.8 5.53 1 1 
       3429 1 . . . . . 4.08 1.8 4.69 1 1 
       3430 1 . . . . . 3.56 1.8 4.09 1 1 
       3431 1 . . . . .  4.2 1.8 4.83 1 1 
       3432 1 . . . . . 3.75 1.8 4.31 1 1 
       3433 1 . . . . . 2.87 1.8  3.3 1 1 
       3434 1 . . . . . 2.96 1.8  3.4 1 1 
       3435 1 . . . . . 4.81 1.8 5.53 1 1 
       3436 1 . . . . . 3.96 1.8 4.55 1 1 
       3437 1 . . . . . 5.29 1.8 6.08 1 1 
       3438 1 . . . . . 3.56 1.8 4.09 1 1 
       3439 1 . . . . . 5.13 1.8  5.9 1 1 
       3440 1 . . . . . 3.69 1.8 4.24 1 1 
       3441 1 . . . . . 4.65 1.8 5.35 1 1 
       3442 1 . . . . . 2.37 1.8 2.73 1 1 
       3443 1 . . . . . 2.63 1.8 3.02 1 1 
       3444 1 . . . . . 3.37 1.8 3.88 1 1 
       3445 1 . . . . . 2.28 1.8 2.62 1 1 
       3446 1 . . . . . 2.73 1.8 3.14 1 1 
       3447 1 . . . . . 3.32 1.8 3.82 1 1 
       3448 1 . . . . . 3.99 1.8 4.59 1 1 
       3449 1 . . . . . 3.92 1.8 4.51 1 1 
       3450 1 . . . . . 5.33 1.8 6.13 1 1 
       3451 1 . . . . .  6.0 1.8  6.9 1 1 
       3452 1 . . . . .  5.1 1.8 5.87 1 1 
       3453 1 . . . . .  5.7 1.8 6.56 1 1 
       3454 1 . . . . . 2.55 1.8 2.93 1 1 
       3455 1 . . . . . 3.44 1.8 3.96 1 1 
       3456 1 . . . . . 3.92 1.8 4.51 1 1 
       3457 1 . . . . .  6.0 1.8  6.9 1 1 
       3458 1 . . . . . 5.66 1.8 6.51 1 1 
       3459 1 . . . . . 2.61 1.8  3.0 1 1 
       3460 1 . . . . . 3.42 1.8 3.93 1 1 
       3461 1 . . . . . 5.53 1.8 6.36 1 1 
       3462 1 . . . . . 3.69 1.8 4.24 1 1 
       3463 1 . . . . . 4.34 1.8 4.99 1 1 
       3464 1 . . . . . 3.41 1.8 3.92 1 1 
       3465 1 . . . . . 2.57 1.8 2.96 1 1 
       3466 1 . . . . . 3.15 1.8 3.62 1 1 
       3467 1 . . . . . 3.65 1.8  4.2 1 1 
       3468 1 . . . . . 2.28 1.8 2.62 1 1 
       3469 1 . . . . . 2.94 1.8 3.38 1 1 
       3470 1 . . . . . 4.34 1.8 4.99 1 1 
       3471 1 . . . . . 5.17 1.8 5.95 1 1 
       3472 1 . . . . . 5.23 1.8 6.01 1 1 
       3473 1 . . . . . 2.88 1.8 3.31 1 1 
       3474 1 . . . . . 3.13 1.8  3.6 1 1 
       3475 1 . . . . . 4.61 1.8  5.3 1 1 
       3476 1 . . . . . 3.98 1.8 4.58 1 1 
       3477 1 . . . . . 3.89 1.8 4.47 1 1 
       3478 1 . . . . . 4.43 1.8 5.09 1 1 
       3479 1 . . . . . 5.37 1.8 6.18 1 1 
       3480 1 . . . . . 3.65 1.8  4.2 1 1 
       3481 1 . . . . . 5.14 1.8 5.91 1 1 
       3482 1 . . . . . 4.86 1.8 5.59 1 1 
       3483 1 . . . . . 3.87 1.8 4.45 1 1 
       3484 1 . . . . . 4.18 1.8 4.81 1 1 
       3485 1 . . . . . 4.72 1.8 5.43 1 1 
       3486 1 . . . . . 3.29 1.8 3.78 1 1 
       3487 1 . . . . .  6.0 1.8  6.9 1 1 
       3488 1 . . . . . 3.93 1.8 4.52 1 1 
       3489 1 . . . . . 3.35 1.8 3.85 1 1 
       3490 1 . . . . . 4.93 1.8 5.67 1 1 
       3491 1 . . . . . 5.03 1.8 5.78 1 1 
       3492 1 . . . . . 4.96 1.8  5.7 1 1 
       3493 1 . . . . . 3.71 1.8 4.27 1 1 
       3494 1 . . . . . 4.31 1.8 4.96 1 1 
       3495 1 . . . . . 5.31 1.8 6.11 1 1 
       3496 1 . . . . . 3.62 1.8 4.16 1 1 
       3497 1 . . . . . 4.83 1.8 5.55 1 1 
       3498 1 . . . . . 4.47 1.8 5.14 1 1 
       3499 1 . . . . . 4.45 1.8 5.12 1 1 
       3500 1 . . . . . 4.79 1.8 5.51 1 1 
       3501 1 . . . . . 3.75 1.8 4.31 1 1 
       3502 1 . . . . .  2.7 1.8 3.11 1 1 
       3503 1 . . . . . 3.51 1.8 4.04 1 1 
       3504 1 . . . . . 4.89 1.8 5.62 1 1 
       3505 1 . . . . . 5.32 1.8 6.12 1 1 
       3506 1 . . . . . 2.55 1.8 2.93 1 1 
       3507 1 . . . . .  3.2 1.8 3.68 1 1 
       3508 1 . . . . .  2.7 1.8 3.11 1 1 
       3509 1 . . . . . 2.72 1.8 3.13 1 1 
       3510 1 . . . . . 5.27 1.8 6.06 1 1 
       3511 1 . . . . . 2.25 1.8 2.59 1 1 
       3512 1 . . . . . 3.09 1.8 3.55 1 1 
       3513 1 . . . . . 4.21 1.8 4.84 1 1 
       3514 1 . . . . . 5.79 1.8 6.66 1 1 
       3515 1 . . . . . 2.88 1.8 3.31 1 1 
       3516 1 . . . . . 3.69 1.8 4.24 1 1 
       3517 1 . . . . . 4.98 1.8 5.73 1 1 
       3518 1 . . . . . 2.56 1.8 2.94 1 1 
       3519 1 . . . . . 3.34 1.8 3.84 1 1 
       3520 1 . . . . . 3.09 1.8 3.55 1 1 
       3521 1 . . . . .  5.5 1.8 6.33 1 1 
       3522 1 . . . . . 2.84 1.8 3.27 1 1 
       3523 1 . . . . . 4.42 1.8 5.08 1 1 
       3524 1 . . . . . 2.57 1.8 2.96 1 1 
       3525 1 . . . . . 3.28 1.8 3.77 1 1 
       3526 1 . . . . . 3.11 1.8 3.58 1 1 
       3527 1 . . . . . 2.21 1.8 2.54 1 1 
       3528 1 . . . . . 4.24 1.8 4.88 1 1 
       3529 1 . . . . .  4.8 1.8 5.52 1 1 
       3530 1 . . . . . 3.19 1.8 3.67 1 1 
       3531 1 . . . . . 3.18 1.8 3.66 1 1 
       3532 1 . . . . . 4.83 1.8 5.55 1 1 
       3533 1 . . . . . 3.54 1.8 4.07 1 1 
       3534 1 . . . . . 3.49 1.8 4.01 1 1 
       3535 1 . . . . . 4.92 1.8 5.66 1 1 
       3536 1 . . . . . 3.95 1.8 4.54 1 1 
       3537 1 . . . . . 3.14 1.8 3.61 1 1 
       3538 1 . . . . . 3.39 1.8  3.9 1 1 
       3539 1 . . . . . 3.24 1.8 3.73 1 1 
       3540 1 . . . . . 2.35 1.8  2.7 1 1 
       3541 1 . . . . . 4.53 1.8 5.21 1 1 
       3542 1 . . . . . 3.02 1.8 3.47 1 1 
       3543 1 . . . . . 3.26 1.8 3.75 1 1 
       3544 1 . . . . . 2.17 1.8  2.5 1 1 
       3545 1 . . . . . 5.11 1.8 5.88 1 1 
       3546 1 . . . . . 4.91 1.8 5.65 1 1 
       3547 1 . . . . . 5.79 1.8 6.66 1 1 
       3548 1 . . . . . 4.86 1.8 5.59 1 1 
       3549 1 . . . . .  5.0 1.8 5.75 1 1 
       3550 1 . . . . . 5.76 1.8 6.62 1 1 
       3551 1 . . . . . 4.67 1.8 5.37 1 1 
       3552 1 . . . . . 5.44 1.8 6.26 1 1 
       3553 1 . . . . . 2.36 1.8 2.71 1 1 
       3554 1 . . . . . 4.11 1.8 4.73 1 1 
       3555 1 . . . . . 4.17 1.8  4.8 1 1 
       3556 1 . . . . . 2.35 1.8  2.7 1 1 
       3557 1 . . . . . 3.33 1.8 3.83 1 1 
       3558 1 . . . . . 4.93 1.8 5.67 1 1 
       3559 1 . . . . . 4.33 1.8 4.98 1 1 
       3560 1 . . . . . 4.32 1.8 4.97 1 1 
       3561 1 . . . . . 3.11 1.8 3.58 1 1 
       3562 1 . . . . . 3.66 1.8 4.21 1 1 
       3563 1 . . . . . 4.99 1.8 5.74 1 1 
       3564 1 . . . . . 3.48 1.8  4.0 1 1 
       3565 1 . . . . . 5.42 1.8 6.23 1 1 
       3566 1 . . . . . 4.97 1.8 5.72 1 1 
       3567 1 . . . . . 4.93 1.8 5.67 1 1 
       3568 1 . . . . . 5.99 1.8 6.89 1 1 
       3569 1 . . . . . 4.31 1.8 4.96 1 1 
       3570 1 . . . . . 4.97 1.8 5.72 1 1 
       3571 1 . . . . . 4.81 1.8 5.53 1 1 
       3572 1 . . . . . 4.52 1.8  5.2 1 1 
       3573 1 . . . . . 3.45 1.8 3.97 1 1 
       3574 1 . . . . . 3.47 1.8 3.99 1 1 
       3575 1 . . . . . 3.92 1.8 4.51 1 1 
       3576 1 . . . . . 4.69 1.8 5.39 1 1 
       3577 1 . . . . . 4.39 1.8 5.05 1 1 
       3578 1 . . . . . 5.94 1.8 6.83 1 1 
       3579 1 . . . . .  3.3 1.8  3.8 1 1 
       3580 1 . . . . . 3.34 1.8 3.84 1 1 
       3581 1 . . . . . 5.59 1.8 6.43 1 1 
       3582 1 . . . . . 4.53 1.8 5.21 1 1 
       3583 1 . . . . . 2.31 1.8 2.66 1 1 
       3584 1 . . . . . 2.73 1.8 3.14 1 1 
       3585 1 . . . . . 3.99 1.8 4.59 1 1 
       3586 1 . . . . . 5.63 1.8 6.47 1 1 
       3587 1 . . . . .  4.8 1.8 5.52 1 1 
       3588 1 . . . . .  5.3 1.8  6.1 1 1 
       3589 1 . . . . . 5.03 1.8 5.78 1 1 
       3590 1 . . . . .  5.2 1.8 5.98 1 1 
       3591 1 . . . . . 5.06 1.8 5.82 1 1 
       3592 1 . . . . .  6.0 1.8  6.9 1 1 
       3593 1 . . . . . 3.76 1.8 4.32 1 1 
       3594 1 . . . . . 4.95 1.8 5.69 1 1 
       3595 1 . . . . . 3.01 1.8 3.46 1 1 
       3596 1 . . . . . 3.63 1.8 4.17 1 1 
       3597 1 . . . . . 3.63 1.8 4.17 1 1 
       3598 1 . . . . . 4.31 1.8 4.96 1 1 
       3599 1 . . . . .  3.7 1.8 4.26 1 1 
       3600 1 . . . . . 5.42 1.8 6.23 1 1 
       3601 1 . . . . . 3.47 1.8 3.99 1 1 
       3602 1 . . . . . 3.16 1.8 3.63 1 1 
       3603 1 . . . . . 3.27 1.8 3.76 1 1 
       3604 1 . . . . . 3.72 1.8 4.28 1 1 
       3605 1 . . . . .  5.3 1.8  6.1 1 1 
       3606 1 . . . . . 4.37 1.8 5.03 1 1 
       3607 1 . . . . . 3.56 1.8 4.09 1 1 
       3608 1 . . . . . 3.76 1.8 4.32 1 1 
       3609 1 . . . . . 4.71 1.8 5.42 1 1 
       3610 1 . . . . . 4.41 1.8 5.07 1 1 
       3611 1 . . . . . 3.84 1.8 4.42 1 1 
       3612 1 . . . . . 3.69 1.8 4.24 1 1 
       3613 1 . . . . . 3.28 1.8 3.77 1 1 
       3614 1 . . . . . 4.94 1.8 5.68 1 1 
       3615 1 . . . . . 3.52 1.8 4.05 1 1 
       3616 1 . . . . . 4.68 1.8 5.38 1 1 
       3617 1 . . . . . 4.44 1.8 5.11 1 1 
       3618 1 . . . . . 5.79 1.8 6.66 1 1 
       3619 1 . . . . . 5.44 1.8 6.26 1 1 
       3620 1 . . . . . 3.82 1.8 4.39 1 1 
       3621 1 . . . . . 4.12 1.8 4.74 1 1 
       3622 1 . . . . . 3.55 1.8 4.08 1 1 
       3623 1 . . . . . 4.49 1.8 5.16 1 1 
       3624 1 . . . . . 3.84 1.8 4.42 1 1 
       3625 1 . . . . . 4.78 1.8  5.5 1 1 
       3626 1 . . . . . 5.32 1.8 6.12 1 1 
       3627 1 . . . . . 3.62 1.8 4.16 1 1 
       3628 1 . . . . . 4.34 1.8 4.99 1 1 
       3629 1 . . . . . 5.84 1.8 6.72 1 1 
       3630 1 . . . . . 3.78 1.8 4.35 1 1 
       3631 1 . . . . . 3.32 1.8 3.82 1 1 
       3632 1 . . . . . 4.02 1.8 4.62 1 1 
       3633 1 . . . . . 3.67 1.8 4.22 1 1 
       3634 1 . . . . . 5.17 1.8 5.95 1 1 
       3635 1 . . . . . 5.07 1.8 5.83 1 1 
       3636 1 . . . . . 5.04 1.8  5.8 1 1 
       3637 1 . . . . . 3.12 1.8 3.59 1 1 
       3638 1 . . . . . 4.06 1.8 4.67 1 1 
       3639 1 . . . . . 4.57 1.8 5.26 1 1 
       3640 1 . . . . . 4.52 1.8  5.2 1 1 
       3641 1 . . . . . 4.11 1.8 4.73 1 1 
       3642 1 . . . . . 4.67 1.8 5.37 1 1 
       3643 1 . . . . . 4.85 1.8 5.58 1 1 
       3644 1 . . . . .  4.8 1.8 5.52 1 1 
       3645 1 . . . . . 2.77 1.8 3.19 1 1 
       3646 1 . . . . . 3.02 1.8 3.47 1 1 
       3647 1 . . . . . 5.21 1.8 5.99 1 1 
       3648 1 . . . . . 4.88 1.8 5.61 1 1 
       3649 1 . . . . . 3.28 1.8 3.77 1 1 
       3650 1 . . . . . 4.94 1.8 5.68 1 1 
       3651 1 . . . . . 2.24 1.8 2.58 1 1 
       3652 1 . . . . . 3.29 1.8 3.78 1 1 
       3653 1 . . . . . 5.23 1.8 6.01 1 1 
       3654 1 . . . . . 5.29 1.8 6.08 1 1 
       3655 1 . . . . . 5.09 1.8 5.85 1 1 
       3656 1 . . . . . 3.97 1.8 4.57 1 1 
       3657 1 . . . . . 4.91 1.8 5.65 1 1 
       3658 1 . . . . . 3.03 1.8 3.48 1 1 
       3659 1 . . . . . 4.01 1.8 4.61 1 1 
       3660 1 . . . . . 3.71 1.8 4.27 1 1 
       3661 1 . . . . .  3.0 1.8 3.45 1 1 
       3662 1 . . . . . 2.95 1.8 3.39 1 1 
       3663 1 . . . . . 3.16 1.8 3.63 1 1 
       3664 1 . . . . . 4.69 1.8 5.39 1 1 
       3665 1 . . . . .  6.0 1.8  6.9 1 1 
       3666 1 . . . . .  2.9 1.8 3.34 1 1 
       3667 1 . . . . . 3.12 1.8 3.59 1 1 
       3668 1 . . . . . 3.53 1.8 4.06 1 1 
       3669 1 . . . . . 4.63 1.8 5.32 1 1 
       3670 1 . . . . . 2.56 1.8 2.94 1 1 
       3671 1 . . . . .  2.8 1.8 3.22 1 1 
       3672 1 . . . . .  3.1 1.8 3.57 1 1 
       3673 1 . . . . . 4.97 1.8 5.72 1 1 
       3674 1 . . . . . 5.14 1.8 5.91 1 1 
       3675 1 . . . . . 4.21 1.8 4.84 1 1 
       3676 1 . . . . .  3.1 1.8 3.57 1 1 
       3677 1 . . . . . 3.95 1.8 4.54 1 1 
       3678 1 . . . . . 4.06 1.8 4.67 1 1 
       3679 1 . . . . . 4.49 1.8 5.16 1 1 
       3680 1 . . . . . 4.69 1.8 5.39 1 1 
       3681 1 . . . . . 3.43 1.8 3.94 1 1 
       3682 1 . . . . . 3.97 1.8 4.57 1 1 
       3683 1 . . . . . 3.66 1.8 4.21 1 1 
       3684 1 . . . . . 5.87 1.8 6.75 1 1 
       3685 1 . . . . . 2.68 1.8 3.08 1 1 
       3686 1 . . . . . 3.42 1.8 3.93 1 1 
       3687 1 . . . . . 2.65 1.8 3.05 1 1 
       3688 1 . . . . . 5.83 1.8  6.7 1 1 
       3689 1 . . . . . 5.48 1.8  6.3 1 1 
       3690 1 . . . . . 4.89 1.8 5.62 1 1 
       3691 1 . . . . . 3.29 1.8 3.78 1 1 
       3692 1 . . . . . 3.72 1.8 4.28 1 1 
       3693 1 . . . . . 5.27 1.8 6.06 1 1 
       3694 1 . . . . .  6.0 1.8  6.9 1 1 
       3695 1 . . . . . 4.46 1.8 5.13 1 1 
       3696 1 . . . . . 5.61 1.8 6.45 1 1 
       3697 1 . . . . . 4.35 1.8  5.0 1 1 
       3698 1 . . . . .  4.3 1.8 4.95 1 1 
       3699 1 . . . . . 4.13 1.8 4.75 1 1 
       3700 1 . . . . . 5.34 1.8 6.14 1 1 
       3701 1 . . . . . 5.12 1.8 5.89 1 1 
       3702 1 . . . . . 2.75 1.8 3.16 1 1 
       3703 1 . . . . . 2.58 1.8 2.97 1 1 
       3704 1 . . . . . 2.97 1.8 3.42 1 1 
       3705 1 . . . . . 5.97 1.8 6.87 1 1 
       3706 1 . . . . . 4.02 1.8 4.62 1 1 
       3707 1 . . . . . 3.83 1.8  4.4 1 1 
       3708 1 . . . . .  2.3 1.8 2.64 1 1 
       3709 1 . . . . .  3.4 1.8 3.91 1 1 
       3710 1 . . . . . 4.16 1.8 4.78 1 1 
       3711 1 . . . . . 5.85 1.8 6.73 1 1 
       3712 1 . . . . . 3.69 1.8 4.24 1 1 
       3713 1 . . . . . 5.15 1.8 5.92 1 1 
       3714 1 . . . . . 3.51 1.8 4.04 1 1 
       3715 1 . . . . . 3.26 1.8 3.75 1 1 
       3716 1 . . . . . 3.04 1.8  3.5 1 1 
       3717 1 . . . . .  5.1 1.8 5.87 1 1 
       3718 1 . . . . . 5.32 1.8 6.12 1 1 
       3719 1 . . . . . 4.04 1.8 4.65 1 1 
       3720 1 . . . . .  3.9 1.8 4.49 1 1 
       3721 1 . . . . . 4.54 1.8 5.22 1 1 
       3722 1 . . . . . 4.31 1.8 4.96 1 1 
       3723 1 . . . . . 4.07 1.8 4.68 1 1 
       3724 1 . . . . . 4.08 1.8 4.69 1 1 
       3725 1 . . . . . 3.06 1.8 3.52 1 1 
       3726 1 . . . . . 5.49 1.8 6.31 1 1 
       3727 1 . . . . .  5.0 1.8 5.75 1 1 
       3728 1 . . . . . 3.42 1.8 3.93 1 1 
       3729 1 . . . . .  6.0 1.8  6.9 1 1 
       3730 1 . . . . . 4.64 1.8 5.34 1 1 
       3731 1 . . . . . 4.94 1.8 5.68 1 1 
       3732 1 . . . . . 5.71 1.8 6.57 1 1 
       3733 1 . . . . . 3.93 1.8 4.52 1 1 
       3734 1 . . . . .  4.3 1.8 4.95 1 1 
       3735 1 . . . . . 4.91 1.8 5.65 1 1 
       3736 1 . . . . . 5.55 1.8 6.38 1 1 
       3737 1 . . . . . 4.19 1.8 4.82 1 1 
       3738 1 . . . . . 4.58 1.8 5.27 1 1 
       3739 1 . . . . . 5.05 1.8 5.81 1 1 
       3740 1 . . . . . 2.95 1.8 3.39 1 1 
       3741 1 . . . . . 3.15 1.8 3.62 1 1 
       3742 1 . . . . . 3.15 1.8 3.62 1 1 
       3743 1 . . . . . 2.18 1.8 2.51 1 1 
       3744 1 . . . . . 3.36 1.8 3.86 1 1 
       3745 1 . . . . . 5.79 1.8 6.66 1 1 
       3746 1 . . . . . 4.28 1.8 4.92 1 1 
       3747 1 . . . . . 4.14 1.8 4.76 1 1 
       3748 1 . . . . . 4.18 1.8 4.81 1 1 
       3749 1 . . . . . 5.01 1.8 5.76 1 1 
       3750 1 . . . . . 2.56 1.8 2.94 1 1 
       3751 1 . . . . .  4.0 1.8  4.6 1 1 
       3752 1 . . . . .  3.7 1.8 4.26 1 1 
       3753 1 . . . . . 2.89 1.8 3.32 1 1 
       3754 1 . . . . . 2.83 1.8 3.25 1 1 
       3755 1 . . . . .  3.2 1.8 3.68 1 1 
       3756 1 . . . . .  5.5 1.8 6.33 1 1 
       3757 1 . . . . . 5.27 1.8 6.06 1 1 
       3758 1 . . . . . 5.47 1.8 6.29 1 1 
       3759 1 . . . . . 4.02 1.8 4.62 1 1 
       3760 1 . . . . . 4.08 1.8 4.69 1 1 
       3761 1 . . . . . 2.95 1.8 3.39 1 1 
       3762 1 . . . . . 3.09 1.8 3.55 1 1 
       3763 1 . . . . . 4.48 1.8 5.15 1 1 
       3764 1 . . . . . 5.31 1.8 6.11 1 1 
       3765 1 . . . . . 2.57 1.8 2.96 1 1 
       3766 1 . . . . . 3.39 1.8  3.9 1 1 
       3767 1 . . . . . 4.18 1.8 4.81 1 1 
       3768 1 . . . . . 3.74 1.8  4.3 1 1 
       3769 1 . . . . . 3.25 1.8 3.74 1 1 
       3770 1 . . . . . 5.15 1.8 5.92 1 1 
       3771 1 . . . . . 3.56 1.8 4.09 1 1 
       3772 1 . . . . . 5.43 1.8 6.24 1 1 
       3773 1 . . . . . 5.24 1.8 6.03 1 1 
       3774 1 . . . . . 5.79 1.8 6.66 1 1 
       3775 1 . . . . .  5.9 1.8 6.79 1 1 
       3776 1 . . . . . 4.87 1.8  5.6 1 1 
       3777 1 . . . . . 4.14 1.8 4.76 1 1 
       3778 1 . . . . .  2.9 1.8 3.34 1 1 
       3779 1 . . . . . 3.25 1.8 3.74 1 1 
       3780 1 . . . . . 3.82 1.8 4.39 1 1 
       3781 1 . . . . .  5.4 1.8 6.21 1 1 
       3782 1 . . . . . 3.55 1.8 4.08 1 1 
       3783 1 . . . . . 4.05 1.8 4.66 1 1 
       3784 1 . . . . .  4.9 1.8 5.64 1 1 
       3785 1 . . . . . 2.91 1.8 3.35 1 1 
       3786 1 . . . . . 3.31 1.8 3.81 1 1 
       3787 1 . . . . . 4.37 1.8 5.03 1 1 
       3788 1 . . . . . 2.14 1.8 2.46 1 1 
       3789 1 . . . . .  2.9 1.8 3.34 1 1 
       3790 1 . . . . . 3.92 1.8 4.51 1 1 
       3791 1 . . . . . 3.76 1.8 4.32 1 1 
       3792 1 . . . . . 5.11 1.8 5.88 1 1 
       3793 1 . . . . .  4.4 1.8 5.06 1 1 
       3794 1 . . . . . 2.99 1.8 3.44 1 1 
       3795 1 . . . . . 4.68 1.8 5.38 1 1 
       3796 1 . . . . . 2.98 1.8 3.43 1 1 
       3797 1 . . . . . 3.11 1.8 3.58 1 1 
       3798 1 . . . . . 4.15 1.8 4.77 1 1 
       3799 1 . . . . . 4.63 1.8 5.32 1 1 
       3800 1 . . . . .  3.6 1.8 4.14 1 1 
       3801 1 . . . . . 3.47 1.8 3.99 1 1 
       3802 1 . . . . . 5.15 1.8 5.92 1 1 
       3803 1 . . . . . 3.27 1.8 3.76 1 1 
       3804 1 . . . . . 3.66 1.8 4.21 1 1 
       3805 1 . . . . . 4.65 1.8 5.35 1 1 
       3806 1 . . . . . 3.51 1.8 4.04 1 1 
       3807 1 . . . . . 4.22 1.8 4.85 1 1 
       3808 1 . . . . . 4.83 1.8 5.55 1 1 
       3809 1 . . . . . 3.61 1.8 4.15 1 1 
       3810 1 . . . . . 4.37 1.8 5.03 1 1 
       3811 1 . . . . . 4.21 1.8 4.84 1 1 
       3812 1 . . . . . 2.61 1.8  3.0 1 1 
       3813 1 . . . . .  3.5 1.8 4.03 1 1 
       3814 1 . . . . .  4.3 1.8 4.95 1 1 
       3815 1 . . . . . 3.15 1.8 3.62 1 1 
       3816 1 . . . . . 3.91 1.8  4.5 1 1 
       3817 1 . . . . . 4.69 1.8 5.39 1 1 
       3818 1 . . . . . 5.35 1.8 6.15 1 1 
       3819 1 . . . . . 4.92 1.8 5.66 1 1 
       3820 1 . . . . . 4.88 1.8 5.61 1 1 
       3821 1 . . . . . 5.29 1.8 6.08 1 1 
       3822 1 . . . . . 3.83 1.8  4.4 1 1 
       3823 1 . . . . . 3.89 1.8 4.47 1 1 
       3824 1 . . . . . 4.69 1.8 5.39 1 1 
       3825 1 . . . . . 3.68 1.8 4.23 1 1 
       3826 1 . . . . . 4.51 1.8 5.19 1 1 
       3827 1 . . . . . 4.17 1.8  4.8 1 1 
       3828 1 . . . . .  4.4 1.8 5.06 1 1 
       3829 1 . . . . . 3.82 1.8 4.39 1 1 
       3830 1 . . . . . 4.41 1.8 5.07 1 1 
       3831 1 . . . . . 3.99 1.8 4.59 1 1 
       3832 1 . . . . . 4.75 1.8 5.46 1 1 
       3833 1 . . . . . 4.72 1.8 5.43 1 1 
       3834 1 . . . . . 5.29 1.8 6.08 1 1 
       3835 1 . . . . . 4.13 1.8 4.75 1 1 
       3836 1 . . . . . 5.72 1.8 6.58 1 1 
       3837 1 . . . . .  4.4 1.8 5.06 1 1 
       3838 1 . . . . . 4.37 1.8 5.03 1 1 
       3839 1 . . . . . 4.39 1.8 5.05 1 1 
       3840 1 . . . . . 3.96 1.8 4.55 1 1 
       3841 1 . . . . . 4.52 1.8  5.2 1 1 
       3842 1 . . . . . 3.87 1.8 4.45 1 1 
       3843 1 . . . . .  3.8 1.8 4.37 1 1 
       3844 1 . . . . .  3.2 1.8 3.68 1 1 
       3845 1 . . . . . 3.04 1.8  3.5 1 1 
       3846 1 . . . . . 3.05 1.8 3.51 1 1 
       3847 1 . . . . . 3.54 1.8 4.07 1 1 
       3848 1 . . . . .  5.3 1.8  6.1 1 1 
       3849 1 . . . . . 3.89 1.8 4.47 1 1 
       3850 1 . . . . . 4.18 1.8 4.81 1 1 
       3851 1 . . . . .  6.0 1.8  6.9 1 1 
       3852 1 . . . . . 3.82 1.8 4.39 1 1 
       3853 1 . . . . . 3.88 1.8 4.46 1 1 
       3854 1 . . . . . 3.59 1.8 4.13 1 1 
       3855 1 . . . . . 4.73 1.8 5.44 1 1 
       3856 1 . . . . .  4.5 1.8 5.18 1 1 
       3857 1 . . . . . 2.89 1.8 3.32 1 1 
       3858 1 . . . . . 5.54 1.8 6.37 1 1 
       3859 1 . . . . . 4.44 1.8 5.11 1 1 
       3860 1 . . . . . 5.34 1.8 6.14 1 1 
       3861 1 . . . . . 2.74 1.8 3.15 1 1 
       3862 1 . . . . . 3.08 1.8 3.54 1 1 
       3863 1 . . . . . 4.06 1.8 4.67 1 1 
       3864 1 . . . . . 3.14 1.8 3.61 1 1 
       3865 1 . . . . . 4.87 1.8  5.6 1 1 
       3866 1 . . . . . 5.36 1.8 6.16 1 1 
       3867 1 . . . . . 3.32 1.8 3.82 1 1 
       3868 1 . . . . . 5.56 1.8 6.39 1 1 
       3869 1 . . . . . 3.54 1.8 4.07 1 1 
       3870 1 . . . . .  5.7 1.8 6.56 1 1 
       3871 1 . . . . . 3.93 1.8 4.52 1 1 
       3872 1 . . . . . 4.72 1.8 5.43 1 1 
       3873 1 . . . . . 4.97 1.8 5.72 1 1 
       3874 1 . . . . . 4.85 1.8 5.58 1 1 
       3875 1 . . . . . 5.16 1.8 5.93 1 1 
       3876 1 . . . . . 5.47 1.8 6.29 1 1 
       3877 1 . . . . . 3.15 1.8 3.62 1 1 
       3878 1 . . . . . 4.56 1.8 5.24 1 1 
       3879 1 . . . . .  3.9 1.8 4.49 1 1 
       3880 1 . . . . . 4.57 1.8 5.26 1 1 
       3881 1 . . . . . 4.19 1.8 4.82 1 1 
       3882 1 . . . . .  4.1 1.8 4.72 1 1 
       3883 1 . . . . . 4.28 1.8 4.92 1 1 
       3884 1 . . . . . 4.06 1.8 4.67 1 1 
       3885 1 . . . . . 4.52 1.8  5.2 1 1 
       3886 1 . . . . . 3.97 1.8 4.57 1 1 
       3887 1 . . . . . 4.61 1.8  5.3 1 1 
       3888 1 . . . . . 3.31 1.8 3.81 1 1 
       3889 1 . . . . . 3.33 1.8 3.83 1 1 
       3890 1 . . . . . 5.43 1.8 6.24 1 1 
       3891 1 . . . . . 5.35 1.8 6.15 1 1 
       3892 1 . . . . . 3.32 1.8 3.82 1 1 
       3893 1 . . . . . 3.55 1.8 4.08 1 1 
       3894 1 . . . . . 4.93 1.8 5.67 1 1 
       3895 1 . . . . .  5.5 1.8 6.33 1 1 
       3896 1 . . . . . 4.33 1.8 4.98 1 1 
       3897 1 . . . . . 2.28 1.8 2.62 1 1 
       3898 1 . . . . . 3.54 1.8 4.07 1 1 
       3899 1 . . . . . 3.85 1.8 4.43 1 1 
       3900 1 . . . . . 5.78 1.8 6.65 1 1 
       3901 1 . . . . . 4.78 1.8  5.5 1 1 
       3902 1 . . . . . 4.03 1.8 4.63 1 1 
       3903 1 . . . . .  5.6 1.8 6.44 1 1 
       3904 1 . . . . . 4.44 1.8 5.11 1 1 
       3905 1 . . . . . 5.35 1.8 6.15 1 1 
       3906 1 . . . . . 3.94 1.8 4.53 1 1 
       3907 1 . . . . . 4.68 1.8 5.38 1 1 
       3908 1 . . . . .  4.2 1.8 4.83 1 1 
       3909 1 . . . . . 4.55 1.8 5.23 1 1 
       3910 1 . . . . . 4.48 1.8 5.15 1 1 
       3911 1 . . . . . 5.28 1.8 6.07 1 1 
       3912 1 . . . . . 5.99 1.8 6.89 1 1 
       3913 1 . . . . . 4.53 1.8 5.21 1 1 
       3914 1 . . . . . 4.61 1.8  5.3 1 1 
       3915 1 . . . . .  4.7 1.8  5.4 1 1 
       3916 1 . . . . . 4.53 1.8 5.21 1 1 
       3917 1 . . . . .  5.3 1.8  6.1 1 1 
       3918 1 . . . . . 3.79 1.8 4.36 1 1 
       3919 1 . . . . .  4.5 1.8 5.18 1 1 
       3920 1 . . . . . 5.99 1.8 6.89 1 1 
       3921 1 . . . . . 4.08 1.8 4.69 1 1 
       3922 1 . . . . . 4.21 1.8 4.84 1 1 
       3923 1 . . . . . 4.52 1.8  5.2 1 1 
       3924 1 . . . . . 5.02 1.8 5.77 1 1 
       3925 1 . . . . . 4.28 1.8 4.92 1 1 
       3926 1 . . . . . 4.26 1.8  4.9 1 1 
       3927 1 . . . . .  3.4 1.8 3.91 1 1 
       3928 1 . . . . . 3.21 1.8 3.69 1 1 
       3929 1 . . . . . 3.71 1.8 4.27 1 1 
       3930 1 . . . . . 5.03 1.8 5.78 1 1 
       3931 1 . . . . . 4.97 1.8 5.72 1 1 
       3932 1 . . . . . 3.38 1.8 3.89 1 1 
       3933 1 . . . . . 4.88 1.8 5.61 1 1 
       3934 1 . . . . . 6.11 1.8 7.03 1 1 
       3935 1 . . . . . 3.71 1.8 4.27 1 1 
       3936 1 . . . . . 4.52 1.8  5.2 1 1 
       3937 1 . . . . . 4.56 1.8 5.24 1 1 
       3938 1 . . . . . 4.55 1.8 5.23 1 1 
       3939 1 . . . . . 4.92 1.8 5.66 1 1 
       3940 1 . . . . . 3.95 1.8 4.54 1 1 
       3941 1 . . . . . 5.49 1.8 6.31 1 1 
       3942 1 . . . . . 3.55 1.8 4.08 1 1 
       3943 1 . . . . .  3.8 1.8 4.37 1 1 
       3944 1 . . . . . 5.35 1.8 6.15 1 1 
       3945 1 . . . . . 4.39 1.8 5.05 1 1 
       3946 1 . . . . . 5.55 1.8 6.38 1 1 
       3947 1 . . . . . 4.45 1.8 5.12 1 1 
       3948 1 . . . . . 3.03 1.8 3.48 1 1 
       3949 1 . . . . . 3.31 1.8 3.81 1 1 
       3950 1 . . . . . 3.65 1.8  4.2 1 1 
       3951 1 . . . . . 2.18 1.8 2.51 1 1 
       3952 1 . . . . .  4.2 1.8 4.83 1 1 
       3953 1 . . . . . 4.99 1.8 5.74 1 1 
       3954 1 . . . . . 4.37 1.8 5.03 1 1 
       3955 1 . . . . . 4.47 1.8 5.14 1 1 
       3956 1 . . . . . 4.85 1.8 5.58 1 1 
       3957 1 . . . . . 5.18 1.8 5.96 1 1 
       3958 1 . . . . . 4.02 1.8 4.62 1 1 
       3959 1 . . . . . 4.29 1.8 4.93 1 1 
       3960 1 . . . . . 5.55 1.8 6.38 1 1 
       3961 1 . . . . . 3.66 1.8 4.21 1 1 
       3962 1 . . . . .  6.0 1.8  6.9 1 1 
       3963 1 . . . . . 4.03 1.8 4.63 1 1 
       3964 1 . . . . . 3.46 1.8 3.98 1 1 
       3965 1 . . . . . 3.79 1.8 4.36 1 1 
       3966 1 . . . . . 3.92 1.8 4.51 1 1 
       3967 1 . . . . . 3.59 1.8 4.13 1 1 
       3968 1 . . . . . 4.73 1.8 5.44 1 1 
       3969 1 . . . . .  4.7 1.8  5.4 1 1 
       3970 1 . . . . . 3.22 1.8  3.7 1 1 
       3971 1 . . . . . 3.85 1.8 4.43 1 1 
       3972 1 . . . . . 3.36 1.8 3.86 1 1 
       3973 1 . . . . . 3.99 1.8 4.59 1 1 
       3974 1 . . . . .  3.3 1.8  3.8 1 1 
       3975 1 . . . . . 4.43 1.8 5.09 1 1 
       3976 1 . . . . . 5.11 1.8 5.88 1 1 
       3977 1 . . . . . 2.94 1.8 3.38 1 1 
       3978 1 . . . . . 3.48 1.8  4.0 1 1 
       3979 1 . . . . .  6.0 1.8  6.9 1 1 
       3980 1 . . . . .  3.2 1.8 3.68 1 1 
       3981 1 . . . . . 3.97 1.8 4.57 1 1 
       3982 1 . . . . . 2.62 1.8 3.01 1 1 
       3983 1 . . . . . 3.21 1.8 3.69 1 1 
       3984 1 . . . . . 5.02 1.8 5.77 1 1 
       3985 1 . . . . . 4.77 1.8 5.49 1 1 
       3986 1 . . . . .  4.2 1.8 4.83 1 1 
       3987 1 . . . . . 5.01 1.8 5.76 1 1 
       3988 1 . . . . . 4.71 1.8 5.42 1 1 
       3989 1 . . . . . 4.85 1.8 5.58 1 1 
       3990 1 . . . . . 4.94 1.8 5.68 1 1 
       3991 1 . . . . . 5.05 1.8 5.81 1 1 
       3992 1 . . . . . 6.09 1.8  7.0 1 1 
       3993 1 . . . . . 4.11 1.8 4.73 1 1 
       3994 1 . . . . . 2.92 1.8 3.36 1 1 
       3995 1 . . . . . 3.55 1.8 4.08 1 1 
       3996 1 . . . . . 5.26 1.8 6.05 1 1 
       3997 1 . . . . . 2.62 1.8 3.01 1 1 
       3998 1 . . . . . 3.69 1.8 4.24 1 1 
       3999 1 . . . . . 3.77 1.8 4.34 1 1 
       4000 1 . . . . . 4.89 1.8 5.62 1 1 
       4001 1 . . . . .  4.5 1.8 5.18 1 1 
       4002 1 . . . . .  6.0 1.8  6.9 1 1 
       4003 1 . . . . . 4.38 1.8 5.04 1 1 
       4004 1 . . . . . 4.29 1.8 4.93 1 1 
       4005 1 . . . . . 2.33 1.8 2.68 1 1 
       4006 1 . . . . . 3.62 1.8 4.16 1 1 
       4007 1 . . . . . 5.34 1.8 6.14 1 1 
       4008 1 . . . . . 4.56 1.8 5.24 1 1 
       4009 1 . . . . . 3.32 1.8 3.82 1 1 
       4010 1 . . . . . 4.82 1.8 5.54 1 1 
       4011 1 . . . . . 5.36 1.8 6.16 1 1 
       4012 1 . . . . . 4.69 1.8 5.39 1 1 
       4013 1 . . . . . 2.91 1.8 3.35 1 1 
       4014 1 . . . . . 3.17 1.8 3.65 1 1 
       4015 1 . . . . . 5.09 1.8 5.85 1 1 
       4016 1 . . . . . 3.63 1.8 4.17 1 1 
       4017 1 . . . . . 4.57 1.8 5.26 1 1 
       4018 1 . . . . . 3.19 1.8 3.67 1 1 
       4019 1 . . . . . 3.98 1.8 4.58 1 1 
       4020 1 . . . . . 2.18 1.8 2.51 1 1 
       4021 1 . . . . . 5.02 1.8 5.77 1 1 
       4022 1 . . . . . 3.65 1.8  4.2 1 1 
       4023 1 . . . . . 4.37 1.8 5.03 1 1 
       4024 1 . . . . . 4.65 1.8 5.35 1 1 
       4025 1 . . . . .  3.6 1.8 4.14 1 1 
       4026 1 . . . . .  4.6 1.8 5.29 1 1 
       4027 1 . . . . . 5.35 1.8 6.15 1 1 
       4028 1 . . . . . 3.29 1.8 3.78 1 1 
       4029 1 . . . . . 5.18 1.8 5.96 1 1 
       4030 1 . . . . . 5.79 1.8 6.66 1 1 
       4031 1 . . . . . 5.03 1.8 5.78 1 1 
       4032 1 . . . . .  6.0 1.8  6.9 1 1 
       4033 1 . . . . . 5.03 1.8 5.78 1 1 
       4034 1 . . . . . 2.84 1.8 3.27 1 1 
       4035 1 . . . . . 4.83 1.8 5.55 1 1 
       4036 1 . . . . . 4.34 1.8 4.99 1 1 
       4037 1 . . . . . 5.95 1.8 6.84 1 1 
       4038 1 . . . . . 4.93 1.8 5.67 1 1 
       4039 1 . . . . . 4.55 1.8 5.23 1 1 
       4040 1 . . . . . 2.75 1.8 3.16 1 1 
       4041 1 . . . . . 2.89 1.8 3.32 1 1 
       4042 1 . . . . . 4.18 1.8 4.81 1 1 
       4043 1 . . . . . 4.21 1.8 4.84 1 1 
       4044 1 . . . . . 4.33 1.8 4.98 1 1 
       4045 1 . . . . . 4.13 1.8 4.75 1 1 
       4046 1 . . . . . 3.92 1.8 4.51 1 1 
       4047 1 . . . . .  3.1 1.8 3.57 1 1 
       4048 1 . . . . . 4.19 1.8 4.82 1 1 
       4049 1 . . . . . 4.64 1.8 5.34 1 1 
       4050 1 . . . . . 4.35 1.8  5.0 1 1 
       4051 1 . . . . . 4.25 1.8 4.89 1 1 
       4052 1 . . . . . 3.28 1.8 3.77 1 1 
       4053 1 . . . . .  3.4 1.8 3.91 1 1 
       4054 1 . . . . . 5.15 1.8 5.92 1 1 
       4055 1 . . . . . 4.82 1.8 5.54 1 1 
       4056 1 . . . . . 2.32 1.8 2.67 1 1 
       4057 1 . . . . . 4.86 1.8 5.59 1 1 
       4058 1 . . . . . 3.78 1.8 4.35 1 1 
       4059 1 . . . . . 5.63 1.8 6.47 1 1 
       4060 1 . . . . . 4.48 1.8 5.15 1 1 
       4061 1 . . . . . 3.33 1.8 3.83 1 1 
       4062 1 . . . . . 3.59 1.8 4.13 1 1 
       4063 1 . . . . . 3.05 1.8 3.51 1 1 
       4064 1 . . . . . 4.24 1.8 4.88 1 1 
       4065 1 . . . . . 5.83 1.8  6.7 1 1 
       4066 1 . . . . .  4.1 1.8 4.72 1 1 
       4067 1 . . . . . 5.02 1.8 5.77 1 1 
       4068 1 . . . . . 2.96 1.8  3.4 1 1 
       4069 1 . . . . . 3.44 1.8 3.96 1 1 
       4070 1 . . . . . 4.48 1.8 5.15 1 1 
       4071 1 . . . . . 3.27 1.8 3.76 1 1 
       4072 1 . . . . . 4.06 1.8 4.67 1 1 
       4073 1 . . . . .  3.0 1.8 3.45 1 1 
       4074 1 . . . . . 5.67 1.8 6.52 1 1 
       4075 1 . . . . . 4.75 1.8 5.46 1 1 
       4076 1 . . . . . 2.95 1.8 3.39 1 1 
       4077 1 . . . . . 3.39 1.8  3.9 1 1 
       4078 1 . . . . .  5.6 1.8 6.44 1 1 
       4079 1 . . . . . 2.98 1.8 3.43 1 1 
       4080 1 . . . . . 3.25 1.8 3.74 1 1 
       4081 1 . . . . . 5.12 1.8 5.89 1 1 
       4082 1 . . . . . 2.56 1.8 2.94 1 1 
       4083 1 . . . . . 3.11 1.8 3.58 1 1 
       4084 1 . . . . . 3.56 1.8 4.09 1 1 
       4085 1 . . . . . 5.16 1.8 5.93 1 1 
       4086 1 . . . . . 2.52 1.8  2.9 1 1 
       4087 1 . . . . . 3.86 1.8 4.44 1 1 
       4088 1 . . . . . 3.06 1.8 3.52 1 1 
       4089 1 . . . . . 4.66 1.8 5.36 1 1 
       4090 1 . . . . . 3.91 1.8  4.5 1 1 
       4091 1 . . . . . 4.92 1.8 5.66 1 1 
       4092 1 . . . . . 5.79 1.8 6.66 1 1 
       4093 1 . . . . .  4.3 1.8 4.95 1 1 
       4094 1 . . . . . 5.08 1.8 5.84 1 1 
       4095 1 . . . . . 5.34 1.8 6.14 1 1 
       4096 1 . . . . . 5.78 1.8 6.65 1 1 
       4097 1 . . . . . 3.17 1.8 3.65 1 1 
       4098 1 . . . . .  4.4 1.8 5.06 1 1 
       4099 1 . . . . . 4.41 1.8 5.07 1 1 
       4100 1 . . . . . 5.43 1.8 6.24 1 1 
       4101 1 . . . . . 5.71 1.8 6.57 1 1 
       4102 1 . . . . .  6.0 1.8  6.9 1 1 
       4103 1 . . . . . 2.73 1.8 3.14 1 1 
       4104 1 . . . . . 5.12 1.8 5.89 1 1 
       4105 1 . . . . . 3.28 1.8 3.77 1 1 
       4106 1 . . . . . 5.05 1.8 5.81 1 1 
       4107 1 . . . . . 5.74 1.8  6.6 1 1 
       4108 1 . . . . . 4.91 1.8 5.65 1 1 
       4109 1 . . . . . 5.34 1.8 6.14 1 1 
       4110 1 . . . . . 4.88 1.8 5.61 1 1 
       4111 1 . . . . .  3.3 1.8  3.8 1 1 
       4112 1 . . . . . 5.26 1.8 6.05 1 1 
       4113 1 . . . . . 3.24 1.8 3.73 1 1 
       4114 1 . . . . . 5.83 1.8  6.7 1 1 
       4115 1 . . . . . 3.53 1.8 4.06 1 1 
       4116 1 . . . . . 5.27 1.8 6.06 1 1 
       4117 1 . . . . . 5.28 1.8 6.07 1 1 
       4118 1 . . . . . 4.68 1.8 5.38 1 1 
       4119 1 . . . . . 4.52 1.8  5.2 1 1 
       4120 1 . . . . . 5.78 1.8 6.65 1 1 
       4121 1 . . . . . 3.83 1.8  4.4 1 1 
       4122 1 . . . . .  3.2 1.8 3.68 1 1 
       4123 1 . . . . .  5.1 1.8 5.87 1 1 
       4124 1 . . . . . 4.43 1.8 5.09 1 1 
       4125 1 . . . . . 4.83 1.8 5.55 1 1 
       4126 1 . . . . . 3.46 1.8 3.98 1 1 
       4127 1 . . . . . 3.61 1.8 4.15 1 1 
       4128 1 . . . . . 5.48 1.8  6.3 1 1 
       4129 1 . . . . . 3.23 1.8 3.71 1 1 
       4130 1 . . . . .  5.3 1.8  6.1 1 1 
       4131 1 . . . . . 5.23 1.8 6.01 1 1 
       4132 1 . . . . . 3.89 1.8 4.47 1 1 
       4133 1 . . . . . 5.36 1.8 6.16 1 1 
       4134 1 . . . . . 5.24 1.8 6.03 1 1 
       4135 1 . . . . . 3.34 1.8 3.84 1 1 
       4136 1 . . . . . 4.67 1.8 5.37 1 1 
       4137 1 . . . . . 3.71 1.8 4.27 1 1 
       4138 1 . . . . . 4.76 1.8 5.47 1 1 
       4139 1 . . . . . 3.68 1.8 4.23 1 1 
       4140 1 . . . . . 3.89 1.8 4.47 1 1 
       4141 1 . . . . .  4.5 1.8 5.18 1 1 
       4142 1 . . . . . 2.36 1.8 2.71 1 1 
       4143 1 . . . . . 5.99 1.8 6.89 1 1 
       4144 1 . . . . . 3.67 1.8 4.22 1 1 
       4145 1 . . . . .  6.0 1.8  6.9 1 1 
       4146 1 . . . . . 4.91 1.8 5.65 1 1 
       4147 1 . . . . .  6.0 1.8  6.9 1 1 
       4148 1 . . . . . 5.42 1.8 6.23 1 1 
       4149 1 . . . . . 5.32 1.8 6.12 1 1 
       4150 1 . . . . . 4.88 1.8 5.61 1 1 
       4151 1 . . . . . 3.32 1.8 3.82 1 1 
       4152 1 . . . . . 3.69 1.8 4.24 1 1 
       4153 1 . . . . . 4.76 1.8 5.47 1 1 
       4154 1 . . . . .  3.6 1.8 4.14 1 1 
       4155 1 . . . . . 3.23 1.8 3.71 1 1 
       4156 1 . . . . . 3.21 1.8 3.69 1 1 
       4157 1 . . . . . 4.56 1.8 5.24 1 1 
       4158 1 . . . . . 3.43 1.8 3.94 1 1 
       4159 1 . . . . . 3.82 1.8 4.39 1 1 
       4160 1 . . . . . 5.73 1.8 6.59 1 1 
       4161 1 . . . . . 4.87 1.8  5.6 1 1 
       4162 1 . . . . . 5.78 1.8 6.65 1 1 
       4163 1 . . . . . 4.21 1.8 4.84 1 1 
       4164 1 . . . . . 3.54 1.8 4.07 1 1 
       4165 1 . . . . .  4.2 1.8 4.83 1 1 
       4166 1 . . . . .  4.1 1.8 4.72 1 1 
       4167 1 . . . . . 3.08 1.8 3.54 1 1 
       4168 1 . . . . . 4.12 1.8 4.74 1 1 
       4169 1 . . . . . 5.28 1.8 6.07 1 1 
       4170 1 . . . . . 5.56 1.8 6.39 1 1 
       4171 1 . . . . . 3.45 1.8 3.97 1 1 
       4172 1 . . . . . 2.44 1.8 2.81 1 1 
       4173 1 . . . . . 2.52 1.8  2.9 1 1 
       4174 1 . . . . . 3.83 1.8  4.4 1 1 
       4175 1 . . . . .  6.0 1.8  6.9 1 1 
       4176 1 . . . . .  6.0 1.8  6.9 1 1 
       4177 1 . . . . . 3.23 1.8 3.71 1 1 
       4178 1 . . . . . 5.25 1.8 6.04 1 1 
       4179 1 . . . . . 3.44 1.8 3.96 1 1 
       4180 1 . . . . . 4.56 1.8 5.24 1 1 
       4181 1 . . . . . 4.77 1.8 5.49 1 1 
       4182 1 . . . . . 4.99 1.8 5.74 1 1 
       4183 1 . . . . . 4.82 1.8 5.54 1 1 
       4184 1 . . . . . 4.13 1.8 4.75 1 1 
       4185 1 . . . . . 5.04 1.8  5.8 1 1 
       4186 1 . . . . .  5.5 1.8 6.33 1 1 
       4187 1 . . . . . 4.87 1.8  5.6 1 1 
       4188 1 . . . . . 5.82 1.8 6.69 1 1 
       4189 1 . . . . .  3.1 1.8 3.57 1 1 
       4190 1 . . . . . 3.88 1.8 4.46 1 1 
       4191 1 . . . . . 5.95 1.8 6.84 1 1 
       4192 1 . . . . . 3.32 1.8 3.82 1 1 
       4193 1 . . . . .  5.4 1.8 6.21 1 1 
       4194 1 . . . . . 3.73 1.8 4.29 1 1 
       4195 1 . . . . . 4.53 1.8 5.21 1 1 
       4196 1 . . . . . 3.56 1.8 4.09 1 1 
       4197 1 . . . . . 4.99 1.8 5.74 1 1 
       4198 1 . . . . . 3.45 1.8 3.97 1 1 
       4199 1 . . . . . 3.68 1.8 4.23 1 1 
       4200 1 . . . . . 4.62 1.8 5.31 1 1 
       4201 1 . . . . .  5.2 1.8 5.98 1 1 
       4202 1 . . . . . 4.42 1.8 5.08 1 1 
       4203 1 . . . . . 3.45 1.8 3.97 1 1 
       4204 1 . . . . . 5.62 1.8 6.46 1 1 
       4205 1 . . . . .  6.0 1.8  6.9 1 1 
       4206 1 . . . . . 4.29 1.8 4.93 1 1 
       4207 1 . . . . . 2.92 1.8 3.36 1 1 
       4208 1 . . . . .  3.1 1.8 3.57 1 1 
       4209 1 . . . . . 2.56 1.8 2.94 1 1 
       4210 1 . . . . . 3.63 1.8 4.17 1 1 
       4211 1 . . . . . 2.35 1.8  2.7 1 1 
       4212 1 . . . . . 3.51 1.8 4.04 1 1 
       4213 1 . . . . . 5.14 1.8 5.91 1 1 
       4214 1 . . . . . 4.48 1.8 5.15 1 1 
       4215 1 . . . . . 3.92 1.8 4.51 1 1 
       4216 1 . . . . . 4.41 1.8 5.07 1 1 
       4217 1 . . . . . 2.92 1.8 3.36 1 1 
       4218 1 . . . . . 3.29 1.8 3.78 1 1 
       4219 1 . . . . . 2.59 1.8 2.98 1 1 
       4220 1 . . . . . 2.99 1.8 3.44 1 1 
       4221 1 . . . . .  2.9 1.8 3.34 1 1 
       4222 1 . . . . . 2.28 1.8 2.62 1 1 
       4223 1 . . . . . 3.49 1.8 4.01 1 1 
       4224 1 . . . . .  4.7 1.8  5.4 1 1 
       4225 1 . . . . . 4.91 1.8 5.65 1 1 
       4226 1 . . . . . 4.46 1.8 5.13 1 1 
       4227 1 . . . . .  4.6 1.8 5.29 1 1 
       4228 1 . . . . . 4.58 1.8 5.27 1 1 
       4229 1 . . . . . 2.99 1.8 3.44 1 1 
       4230 1 . . . . . 4.81 1.8 5.53 1 1 
       4231 1 . . . . .  2.8 1.8 3.22 1 1 
       4232 1 . . . . . 3.44 1.8 3.96 1 1 
       4233 1 . . . . . 4.92 1.8 5.66 1 1 
       4234 1 . . . . . 2.93 1.8 3.37 1 1 
       4235 1 . . . . . 4.03 1.8 4.63 1 1 
       4236 1 . . . . . 4.87 1.8  5.6 1 1 
       4237 1 . . . . . 4.49 1.8 5.16 1 1 
       4238 1 . . . . . 3.28 1.8 3.77 1 1 
       4239 1 . . . . . 4.86 1.8 5.59 1 1 
       4240 1 . . . . . 3.86 1.8 4.44 1 1 
       4241 1 . . . . . 4.01 1.8 4.61 1 1 
       4242 1 . . . . . 3.04 1.8  3.5 1 1 
       4243 1 . . . . . 3.32 1.8 3.82 1 1 
       4244 1 . . . . . 4.22 1.8 4.85 1 1 
       4245 1 . . . . .  6.0 1.8  6.9 1 1 
       4246 1 . . . . . 3.01 1.8 3.46 1 1 
       4247 1 . . . . . 3.45 1.8 3.97 1 1 
       4248 1 . . . . . 3.52 1.8 4.05 1 1 
       4249 1 . . . . . 4.16 1.8 4.78 1 1 
       4250 1 . . . . . 5.32 1.8 6.12 1 1 
       4251 1 . . . . . 4.94 1.8 5.68 1 1 
       4252 1 . . . . . 3.99 1.8 4.59 1 1 
       4253 1 . . . . . 3.86 1.8 4.44 1 1 
       4254 1 . . . . .  5.7 1.8 6.56 1 1 
       4255 1 . . . . . 5.64 1.8 6.49 1 1 
       4256 1 . . . . . 5.14 1.8 5.91 1 1 
       4257 1 . . . . . 5.85 1.8 6.73 1 1 
       4258 1 . . . . . 3.18 1.8 3.66 1 1 
       4259 1 . . . . . 3.37 1.8 3.88 1 1 
       4260 1 . . . . . 3.92 1.8 4.51 1 1 
       4261 1 . . . . . 5.57 1.8 6.41 1 1 
       4262 1 . . . . .  2.6 1.8 2.99 1 1 
       4263 1 . . . . . 4.34 1.8 4.99 1 1 
       4264 1 . . . . . 3.49 1.8 4.01 1 1 
       4265 1 . . . . . 3.11 1.8 3.58 1 1 
       4266 1 . . . . . 3.32 1.8 3.82 1 1 
       4267 1 . . . . . 4.11 1.8 4.73 1 1 
       4268 1 . . . . . 4.75 1.8 5.46 1 1 
       4269 1 . . . . . 3.41 1.8 3.92 1 1 
       4270 1 . . . . . 4.91 1.8 5.65 1 1 
       4271 1 . . . . . 3.25 1.8 3.74 1 1 
       4272 1 . . . . . 3.92 1.8 4.51 1 1 
       4273 1 . . . . . 2.26 1.8  2.6 1 1 
       4274 1 . . . . . 3.34 1.8 3.84 1 1 
       4275 1 . . . . . 5.99 1.8 6.89 1 1 
       4276 1 . . . . . 4.55 1.8 5.23 1 1 
       4277 1 . . . . . 4.55 1.8 5.23 1 1 
       4278 1 . . . . . 3.57 1.8 4.11 1 1 
       4279 1 . . . . . 3.35 1.8 3.85 1 1 
       4280 1 . . . . . 4.22 1.8 4.85 1 1 
       4281 1 . . . . . 3.51 1.8 4.04 1 1 
       4282 1 . . . . . 2.84 1.8 3.27 1 1 
       4283 1 . . . . . 4.26 1.8  4.9 1 1 
       4284 1 . . . . . 3.03 1.8 3.48 1 1 
       4285 1 . . . . . 3.19 1.8 3.67 1 1 
       4286 1 . . . . . 4.83 1.8 5.55 1 1 
       4287 1 . . . . . 4.21 1.8 4.84 1 1 
       4288 1 . . . . . 3.53 1.8 4.06 1 1 
       4289 1 . . . . . 4.95 1.8 5.69 1 1 
       4290 1 . . . . . 4.02 1.8 4.62 1 1 
       4291 1 . . . . . 4.44 1.8 5.11 1 1 
       4292 1 . . . . . 5.79 1.8 6.66 1 1 
       4293 1 . . . . .  3.2 1.8 3.68 1 1 
       4294 1 . . . . . 5.08 1.8 5.84 1 1 
       4295 1 . . . . . 5.05 1.8 5.81 1 1 
       4296 1 . . . . . 3.35 1.8 3.85 1 1 
       4297 1 . . . . . 4.58 1.8 5.27 1 1 
       4298 1 . . . . . 5.08 1.8 5.84 1 1 
       4299 1 . . . . . 3.07 1.8 3.53 1 1 
       4300 1 . . . . . 3.75 1.8 4.31 1 1 
       4301 1 . . . . . 4.08 1.8 4.69 1 1 
       4302 1 . . . . . 4.46 1.8 5.13 1 1 
       4303 1 . . . . . 3.24 1.8 3.73 1 1 
       4304 1 . . . . .  4.4 1.8 5.06 1 1 
       4305 1 . . . . . 4.82 1.8 5.54 1 1 
       4306 1 . . . . . 4.01 1.8 4.61 1 1 
       4307 1 . . . . . 3.43 1.8 3.94 1 1 
       4308 1 . . . . . 3.79 1.8 4.36 1 1 
       4309 1 . . . . .  3.2 1.8 3.68 1 1 
       4310 1 . . . . . 3.57 1.8 4.11 1 1 
       4311 1 . . . . . 4.14 1.8 4.76 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
       45 1 . . . 1 2 
       46 1 . . . 1 2 
       47 1 . . . 1 2 
       48 1 . . . 1 2 
       49 1 . . . 1 2 
       50 1 . . . 1 2 
       51 1 . . . 1 2 
       52 1 . . . 1 2 
       53 1 . . . 1 2 
       54 1 . . . 1 2 
       55 1 . . . 1 2 
       56 1 . . . 1 2 
       57 1 . . . 1 2 
       58 1 . . . 1 2 
       59 1 . . . 1 2 
       60 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1   4 LEU H .   4 . HN 1 2 
        1 1 2 1 1  77 LYS O .  77 . O  1 2 
        2 1 1 1 1   4 LEU N .   4 . N  1 2 
        2 1 2 1 1  77 LYS O .  77 . O  1 2 
        3 1 1 1 1   6 LEU H .   6 . HN 1 2 
        3 1 2 1 1  79 PHE O .  79 . O  1 2 
        4 1 1 1 1   6 LEU N .   6 . N  1 2 
        4 1 2 1 1  79 PHE O .  79 . O  1 2 
        5 1 1 1 1   7 ILE H .   7 . HN 1 2 
        5 1 2 1 1  56 ILE O .  56 . O  1 2 
        6 1 1 1 1   7 ILE N .   7 . N  1 2 
        6 1 2 1 1  56 ILE O .  56 . O  1 2 
        7 1 1 1 1   8 ASN H .   8 . HN 1 2 
        7 1 2 1 1  81 LEU O .  81 . O  1 2 
        8 1 1 1 1   8 ASN N .   8 . N  1 2 
        8 1 2 1 1  81 LEU O .  81 . O  1 2 
        9 1 1 1 1  11 ASN O .  11 . O  1 2 
        9 1 2 1 1  15 ILE H .  15 . HN 1 2 
       10 1 1 1 1  11 ASN O .  11 . O  1 2 
       10 1 2 1 1  15 ILE N .  15 . N  1 2 
       11 1 1 1 1  14 LEU O .  14 . O  1 2 
       11 1 2 1 1  18 ILE H .  18 . HN 1 2 
       12 1 1 1 1  14 LEU O .  14 . O  1 2 
       12 1 2 1 1  18 ILE N .  18 . N  1 2 
       13 1 1 1 1  15 ILE O .  15 . O  1 2 
       13 1 2 1 1  19 LYS H .  19 . HN 1 2 
       14 1 1 1 1  15 ILE O .  15 . O  1 2 
       14 1 2 1 1  19 LYS N .  19 . N  1 2 
       15 1 1 1 1  17 LYS O .  17 . O  1 2 
       15 1 2 1 1  21 GLU H .  21 . HN 1 2 
       16 1 1 1 1  17 LYS O .  17 . O  1 2 
       16 1 2 1 1  21 GLU N .  21 . N  1 2 
       17 1 1 1 1  18 ILE O .  18 . O  1 2 
       17 1 2 1 1  22 VAL H .  22 . HN 1 2 
       18 1 1 1 1  18 ILE O .  18 . O  1 2 
       18 1 2 1 1  22 VAL N .  22 . N  1 2 
       19 1 1 1 1  22 VAL O .  22 . O  1 2 
       19 1 2 1 1  27 TYR H .  27 . HN 1 2 
       20 1 1 1 1  22 VAL O .  22 . O  1 2 
       20 1 2 1 1  27 TYR N .  27 . N  1 2 
       21 1 1 1 1  30 ARG H .  30 . HN 1 2 
       21 1 2 1 1  55 LEU O .  55 . O  1 2 
       22 1 1 1 1  30 ARG N .  30 . N  1 2 
       22 1 2 1 1  55 LEU O .  55 . O  1 2 
       23 1 1 1 1  32 VAL H .  32 . HN 1 2 
       23 1 2 1 1  57 ILE O .  57 . O  1 2 
       24 1 1 1 1  32 VAL N .  32 . N  1 2 
       24 1 2 1 1  57 ILE O .  57 . O  1 2 
       25 1 1 1 1   5 ILE O .   5 . O  1 2 
       25 1 2 1 1  56 ILE H .  56 . HN 1 2 
       26 1 1 1 1   5 ILE O .   5 . O  1 2 
       26 1 2 1 1  56 ILE N .  56 . N  1 2 
       27 1 1 1 1  30 ARG O .  30 . O  1 2 
       27 1 2 1 1  57 ILE H .  57 . HN 1 2 
       28 1 1 1 1  30 ARG O .  30 . O  1 2 
       28 1 2 1 1  57 ILE N .  57 . N  1 2 
       29 1 1 1 1   7 ILE O .   7 . O  1 2 
       29 1 2 1 1  58 SER H .  58 . HN 1 2 
       30 1 1 1 1   7 ILE O .   7 . O  1 2 
       30 1 2 1 1  58 SER N .  58 . N  1 2 
       31 1 1 1 1  63 LEU O .  63 . O  1 2 
       31 1 2 1 1  67 MET H .  67 . HN 1 2 
       32 1 1 1 1  63 LEU O .  63 . O  1 2 
       32 1 2 1 1  67 MET N .  67 . N  1 2 
       33 1 1 1 1  64 LEU O .  64 . O  1 2 
       33 1 2 1 1  68 LEU H .  68 . HN 1 2 
       34 1 1 1 1  64 LEU O .  64 . O  1 2 
       34 1 2 1 1  68 LEU N .  68 . N  1 2 
       35 1 1 1 1  66 GLU O .  66 . O  1 2 
       35 1 2 1 1  70 LEU H .  70 . HN 1 2 
       36 1 1 1 1  66 GLU O .  66 . O  1 2 
       36 1 2 1 1  70 LEU N .  70 . N  1 2 
       37 1 1 1 1  67 MET O .  67 . O  1 2 
       37 1 2 1 1  71 ILE H .  71 . HN 1 2 
       38 1 1 1 1  67 MET O .  67 . O  1 2 
       38 1 2 1 1  71 ILE N .  71 . N  1 2 
       39 1 1 1 1  71 ILE O .  71 . O  1 2 
       39 1 2 1 1  75 GLY H .  75 . HN 1 2 
       40 1 1 1 1  71 ILE O .  71 . O  1 2 
       40 1 2 1 1  75 GLY N .  75 . N  1 2 
       41 1 1 1 1   4 LEU O .   4 . O  1 2 
       41 1 2 1 1  79 PHE H .  79 . HN 1 2 
       42 1 1 1 1   4 LEU O .   4 . O  1 2 
       42 1 2 1 1  79 PHE N .  79 . N  1 2 
       43 1 1 1 1  80 LEU H .  80 . HN 1 2 
       43 1 2 1 1 103 GLU O . 103 . O  1 2 
       44 1 1 1 1  80 LEU N .  80 . N  1 2 
       44 1 2 1 1 103 GLU O . 103 . O  1 2 
       45 1 1 1 1  82 LEU H .  82 . HN 1 2 
       45 1 2 1 1 105 ARG O . 105 . O  1 2 
       46 1 1 1 1  82 LEU N .  82 . N  1 2 
       46 1 2 1 1 105 ARG O . 105 . O  1 2 
       47 1 1 1 1  90 LEU O .  90 . O  1 2 
       47 1 2 1 1  94 LYS H .  94 . HN 1 2 
       48 1 1 1 1  90 LEU O .  90 . O  1 2 
       48 1 2 1 1  94 LYS N .  94 . N  1 2 
       49 1 1 1 1  91 GLU O .  91 . O  1 2 
       49 1 2 1 1  95 ARG H .  95 . HN 1 2 
       50 1 1 1 1  91 GLU O .  91 . O  1 2 
       50 1 2 1 1  95 ARG N .  95 . N  1 2 
       51 1 1 1 1  94 LYS O .  94 . O  1 2 
       51 1 2 1 1  98 GLU H .  98 . HN 1 2 
       52 1 1 1 1  94 LYS O .  94 . O  1 2 
       52 1 2 1 1  98 GLU N .  98 . N  1 2 
       53 1 1 1 1  80 LEU O .  80 . O  1 2 
       53 1 2 1 1 105 ARG H . 105 . HN 1 2 
       54 1 1 1 1  80 LEU O .  80 . O  1 2 
       54 1 2 1 1 105 ARG N . 105 . N  1 2 
       55 1 1 1 1 116 ILE O . 116 . O  1 2 
       55 1 2 1 1 120 PHE H . 120 . HN 1 2 
       56 1 1 1 1 116 ILE O . 116 . O  1 2 
       56 1 2 1 1 120 PHE N . 120 . N  1 2 
       57 1 1 1 1 119 GLU O . 119 . O  1 2 
       57 1 2 1 1 123 LYS H . 123 . HN 1 2 
       58 1 1 1 1 119 GLU O . 119 . O  1 2 
       58 1 2 1 1 123 LYS N . 123 . N  1 2 
       59 1 1 1 1 120 PHE O . 120 . O  1 2 
       59 1 2 1 1 124 ALA H . 124 . HN 1 2 
       60 1 1 1 1 120 PHE O . 120 . O  1 2 
       60 1 2 1 1 124 ALA N . 124 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . .  1.9 1.8 2.18 1 2 
        2 1 . . . . . 2.85 2.7 3.28 1 2 
        3 1 . . . . .  1.9 1.8 2.18 1 2 
        4 1 . . . . . 2.85 2.7 3.28 1 2 
        5 1 . . . . .  1.9 1.8 2.18 1 2 
        6 1 . . . . . 2.85 2.7 3.28 1 2 
        7 1 . . . . .  1.9 1.8 2.18 1 2 
        8 1 . . . . . 2.85 2.7 3.28 1 2 
        9 1 . . . . .  1.9 1.8 2.18 1 2 
       10 1 . . . . . 2.85 2.7 3.28 1 2 
       11 1 . . . . .  1.9 1.8 2.18 1 2 
       12 1 . . . . . 2.85 2.7 3.28 1 2 
       13 1 . . . . .  1.9 1.8 2.18 1 2 
       14 1 . . . . . 2.85 2.7 3.28 1 2 
       15 1 . . . . .  1.9 1.8 2.18 1 2 
       16 1 . . . . . 2.85 2.7 3.28 1 2 
       17 1 . . . . .  1.9 1.8 2.18 1 2 
       18 1 . . . . . 2.85 2.7 3.28 1 2 
       19 1 . . . . .  1.9 1.8 2.18 1 2 
       20 1 . . . . . 2.85 2.7 3.28 1 2 
       21 1 . . . . .  1.9 1.8 2.18 1 2 
       22 1 . . . . . 2.85 2.7 3.28 1 2 
       23 1 . . . . .  1.9 1.8 2.18 1 2 
       24 1 . . . . . 2.85 2.7 3.28 1 2 
       25 1 . . . . .  1.9 1.8 2.18 1 2 
       26 1 . . . . . 2.85 2.7 3.28 1 2 
       27 1 . . . . .  1.9 1.8 2.18 1 2 
       28 1 . . . . . 2.85 2.7 3.28 1 2 
       29 1 . . . . .  1.9 1.8 2.18 1 2 
       30 1 . . . . . 2.85 2.7 3.28 1 2 
       31 1 . . . . .  1.9 1.8 2.18 1 2 
       32 1 . . . . . 2.85 2.7 3.28 1 2 
       33 1 . . . . .  1.9 1.8 2.18 1 2 
       34 1 . . . . . 2.85 2.7 3.28 1 2 
       35 1 . . . . .  1.9 1.8 2.18 1 2 
       36 1 . . . . . 2.85 2.7 3.28 1 2 
       37 1 . . . . .  1.9 1.8 2.18 1 2 
       38 1 . . . . . 2.85 2.7 3.28 1 2 
       39 1 . . . . .  1.9 1.8 2.18 1 2 
       40 1 . . . . . 2.85 2.7 3.28 1 2 
       41 1 . . . . .  1.9 1.8 2.18 1 2 
       42 1 . . . . . 2.85 2.7 3.28 1 2 
       43 1 . . . . .  1.9 1.8 2.18 1 2 
       44 1 . . . . . 2.85 2.7 3.28 1 2 
       45 1 . . . . .  1.9 1.8 2.18 1 2 
       46 1 . . . . . 2.85 2.7 3.28 1 2 
       47 1 . . . . .  1.9 1.8 2.18 1 2 
       48 1 . . . . . 2.85 2.7 3.28 1 2 
       49 1 . . . . .  1.9 1.8 2.18 1 2 
       50 1 . . . . . 2.85 2.7 3.28 1 2 
       51 1 . . . . .  1.9 1.8 2.18 1 2 
       52 1 . . . . . 2.85 2.7 3.28 1 2 
       53 1 . . . . .  1.9 1.8 2.18 1 2 
       54 1 . . . . . 2.85 2.7 3.28 1 2 
       55 1 . . . . .  1.9 1.8 2.18 1 2 
       56 1 . . . . . 2.85 2.7 3.28 1 2 
       57 1 . . . . .  1.9 1.8 2.18 1 2 
       58 1 . . . . . 2.85 2.7 3.28 1 2 
       59 1 . . . . .  1.9 1.8 2.18 1 2 
       60 1 . . . . . 2.85 2.7 3.28 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   1 MET C 1 1   2 LYS N  1 1   2 LYS CA 1 1   2 LYS C      -183.6      -45.3 .   1 . C .   2 . N  .   2 . CA .   2 . C 1 1 
         2 . 1 1   2 LYS N 1 1   2 LYS CA 1 1   2 LYS C  1 1   3 GLU N        93.0      178.5 .   2 . N .   2 . CA .   2 . C  .   3 . N 1 1 
         3 . 1 1   2 LYS C 1 1   3 GLU N  1 1   3 GLU CA 1 1   3 GLU C      -168.1  -66.99999 .   2 . C .   3 . N  .   3 . CA .   3 . C 1 1 
         4 . 1 1   3 GLU N 1 1   3 GLU CA 1 1   3 GLU C  1 1   4 LEU N       113.7      179.0 .   3 . N .   3 . CA .   3 . C  .   4 . N 1 1 
         5 . 1 1   3 GLU C 1 1   4 LEU N  1 1   4 LEU CA 1 1   4 LEU C      -165.1 -83.399994 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 1 
         6 . 1 1   4 LEU N 1 1   4 LEU CA 1 1   4 LEU C  1 1   5 ILE N       113.7      163.3 .   4 . N .   4 . CA .   4 . C  .   5 . N 1 1 
         7 . 1 1   4 LEU C 1 1   5 ILE N  1 1   5 ILE CA 1 1   5 ILE C      -133.3      -93.3 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 1 
         8 . 1 1   5 ILE N 1 1   5 ILE CA 1 1   5 ILE C  1 1   6 LEU N       105.5      145.5 .   5 . N .   5 . CA .   5 . C  .   6 . N 1 1 
         9 . 1 1   5 ILE C 1 1   6 LEU N  1 1   6 LEU CA 1 1   6 LEU C      -138.3      -87.1 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 1 
        10 . 1 1   6 LEU N 1 1   6 LEU CA 1 1   6 LEU C  1 1   7 ILE N       112.0  158.59999 .   6 . N .   6 . CA .   6 . C  .   7 . N 1 1 
        11 . 1 1   6 LEU C 1 1   7 ILE N  1 1   7 ILE CA 1 1   7 ILE C      -143.8     -100.6 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
        12 . 1 1   7 ILE N 1 1   7 ILE CA 1 1   7 ILE C  1 1   8 ASN N       114.8  154.79999 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 1 
        13 . 1 1   7 ILE C 1 1   8 ASN N  1 1   8 ASN CA 1 1   8 ASN C      -149.6  -98.19999 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 1 
        14 . 1 1   8 ASN N 1 1   8 ASN CA 1 1   8 ASN C  1 1   9 THR N       110.1      153.5 .   8 . N .   8 . CA .   8 . C  .   9 . N 1 1 
        15 . 1 1   8 ASN C 1 1   9 THR N  1 1   9 THR CA 1 1   9 THR C      -143.2  -73.59999 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
        16 . 1 1   9 THR N 1 1   9 THR CA 1 1   9 THR C  1 1  10 ASN N        96.3      160.2 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 1 
        17 . 1 1  11 ASN C 1 1  12 ASP N  1 1  12 ASP CA 1 1  12 ASP C       -78.3      -38.3 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
        18 . 1 1  12 ASP N 1 1  12 ASP CA 1 1  12 ASP C  1 1  13 GLU N       -57.8      -17.8 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 1 
        19 . 1 1  12 ASP C 1 1  13 GLU N  1 1  13 GLU CA 1 1  13 GLU C       -83.8      -43.8 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        20 . 1 1  13 GLU N 1 1  13 GLU CA 1 1  13 GLU C  1 1  14 LEU N  -59.400005      -19.4 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
        21 . 1 1  13 GLU C 1 1  14 LEU N  1 1  14 LEU CA 1 1  14 LEU C       -82.9      -42.9 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        22 . 1 1  14 LEU N 1 1  14 LEU CA 1 1  14 LEU C  1 1  15 ILE N       -64.9      -24.9 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        23 . 1 1  14 LEU C 1 1  15 ILE N  1 1  15 ILE CA 1 1  15 ILE C       -81.8      -41.8 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        24 . 1 1  15 ILE N 1 1  15 ILE CA 1 1  15 ILE C  1 1  16 LYS N       -67.2      -27.2 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        25 . 1 1  15 ILE C 1 1  16 LYS N  1 1  16 LYS CA 1 1  16 LYS C       -78.8      -38.8 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        26 . 1 1  16 LYS N 1 1  16 LYS CA 1 1  16 LYS C  1 1  17 LYS N       -60.6      -20.6 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        27 . 1 1  16 LYS C 1 1  17 LYS N  1 1  17 LYS CA 1 1  17 LYS C       -82.4      -42.4 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        28 . 1 1  17 LYS N 1 1  17 LYS CA 1 1  17 LYS C  1 1  18 ILE N  -62.700005      -22.7 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        29 . 1 1  17 LYS C 1 1  18 ILE N  1 1  18 ILE CA 1 1  18 ILE C       -84.1      -44.1 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        30 . 1 1  18 ILE N 1 1  18 ILE CA 1 1  18 ILE C  1 1  19 LYS N       -66.4      -26.4 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
        31 . 1 1  18 ILE C 1 1  19 LYS N  1 1  19 LYS CA 1 1  19 LYS C       -79.2      -39.2 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 1 
        32 . 1 1  19 LYS N 1 1  19 LYS CA 1 1  19 LYS C  1 1  20 LYS N       -60.6      -20.6 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 1 
        33 . 1 1  19 LYS C 1 1  20 LYS N  1 1  20 LYS CA 1 1  20 LYS C       -82.8 -42.799995 .  19 . C .  20 . N  .  20 . CA .  20 . C 1 1 
        34 . 1 1  20 LYS N 1 1  20 LYS CA 1 1  20 LYS C  1 1  21 GLU N  -57.899998      -17.9 .  20 . N .  20 . CA .  20 . C  .  21 . N 1 1 
        35 . 1 1  20 LYS C 1 1  21 GLU N  1 1  21 GLU CA 1 1  21 GLU C      -101.9      -31.5 .  20 . C .  21 . N  .  21 . CA .  21 . C 1 1 
        36 . 1 1  21 GLU N 1 1  21 GLU CA 1 1  21 GLU C  1 1  22 VAL N       -58.1      -14.9 .  21 . N .  21 . CA .  21 . C  .  22 . N 1 1 
        37 . 1 1  21 GLU C 1 1  22 VAL N  1 1  22 VAL CA 1 1  22 VAL C       -89.9 -49.899998 .  21 . C .  22 . N  .  22 . CA .  22 . C 1 1 
        38 . 1 1  22 VAL N 1 1  22 VAL CA 1 1  22 VAL C  1 1  23 GLU N       -65.8  2.2999997 .  22 . N .  22 . CA .  22 . C  .  23 . N 1 1 
        39 . 1 1  22 VAL C 1 1  23 GLU N  1 1  23 GLU CA 1 1  23 GLU C       -83.5      -43.5 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 1 
        40 . 1 1  23 GLU N 1 1  23 GLU CA 1 1  23 GLU C  1 1  24 ASN N       -62.4      -22.4 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 1 
        41 . 1 1  23 GLU C 1 1  24 ASN N  1 1  24 ASN CA 1 1  24 ASN C       -87.9      -47.9 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        42 . 1 1  24 ASN N 1 1  24 ASN CA 1 1  24 ASN C  1 1  25 GLN N       -51.9      -11.9 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
        43 . 1 1  24 ASN C 1 1  25 GLN N  1 1  25 GLN CA 1 1  25 GLN C  -118.19999      -69.4 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        44 . 1 1  25 GLN N 1 1  25 GLN CA 1 1  25 GLN C  1 1  26 GLY N       -28.5       33.8 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
        45 . 1 1  26 GLY C 1 1  27 TYR N  1 1  27 TYR CA 1 1  27 TYR C      -140.6      -52.5 .  26 . C .  27 . N  .  27 . CA .  27 . C 1 1 
        46 . 1 1  27 TYR N 1 1  27 TYR CA 1 1  27 TYR C  1 1  28 GLN N        58.9  198.89998 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
        47 . 1 1  27 TYR C 1 1  28 GLN N  1 1  28 GLN CA 1 1  28 GLN C      -177.2      -77.1 .  27 . C .  28 . N  .  28 . CA .  28 . C 1 1 
        48 . 1 1  28 GLN N 1 1  28 GLN CA 1 1  28 GLN C  1 1  29 VAL N       114.1      177.6 .  28 . N .  28 . CA .  28 . C  .  29 . N 1 1 
        49 . 1 1  28 GLN C 1 1  29 VAL N  1 1  29 VAL CA 1 1  29 VAL C      -152.4 -57.599995 .  28 . C .  29 . N  .  29 . CA .  29 . C 1 1 
        50 . 1 1  29 VAL N 1 1  29 VAL CA 1 1  29 VAL C  1 1  30 ARG N        99.9      145.4 .  29 . N .  29 . CA .  29 . C  .  30 . N 1 1 
        51 . 1 1  29 VAL C 1 1  30 ARG N  1 1  30 ARG CA 1 1  30 ARG C      -132.3      -76.2 .  29 . C .  30 . N  .  30 . CA .  30 . C 1 1 
        52 . 1 1  30 ARG N 1 1  30 ARG CA 1 1  30 ARG C  1 1  31 ASP N       110.2      161.3 .  30 . N .  30 . CA .  30 . C  .  31 . N 1 1 
        53 . 1 1  30 ARG C 1 1  31 ASP N  1 1  31 ASP CA 1 1  31 ASP C      -126.7 -56.199997 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        54 . 1 1  31 ASP N 1 1  31 ASP CA 1 1  31 ASP C  1 1  32 VAL N   118.19999      164.1 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 1 
        55 . 1 1  31 ASP C 1 1  32 VAL N  1 1  32 VAL CA 1 1  32 VAL C      -161.1 -57.599995 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        56 . 1 1  32 VAL N 1 1  32 VAL CA 1 1  32 VAL C  1 1  33 ASN N   123.09999      163.1 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        57 . 1 1  33 ASN C 1 1  34 ASP N  1 1  34 ASP CA 1 1  34 ASP C      -170.5 -30.499998 .  33 . C .  34 . N  .  34 . CA .  34 . C 1 1 
        58 . 1 1  34 ASP N 1 1  34 ASP CA 1 1  34 ASP C  1 1  35 SER N       144.6      186.7 .  34 . N .  34 . CA .  34 . C  .  35 . N 1 1 
        59 . 1 1  34 ASP C 1 1  35 SER N  1 1  35 SER CA 1 1  35 SER C       -81.6      -41.6 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 1 
        60 . 1 1  35 SER N 1 1  35 SER CA 1 1  35 SER C  1 1  36 ASP N  -57.500004       -9.6 .  35 . N .  35 . CA .  35 . C  .  36 . N 1 1 
        61 . 1 1  35 SER C 1 1  36 ASP N  1 1  36 ASP CA 1 1  36 ASP C       -87.9      -47.9 .  35 . C .  36 . N  .  36 . CA .  36 . C 1 1 
        62 . 1 1  36 ASP N 1 1  36 ASP CA 1 1  36 ASP C  1 1  37 GLU N  -62.599995      -22.6 .  36 . N .  36 . CA .  36 . C  .  37 . N 1 1 
        63 . 1 1  36 ASP C 1 1  37 GLU N  1 1  37 GLU CA 1 1  37 GLU C       -83.2      -43.2 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
        64 . 1 1  37 GLU N 1 1  37 GLU CA 1 1  37 GLU C  1 1  38 LEU N  -63.599995      -23.6 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 1 
        65 . 1 1  37 GLU C 1 1  38 LEU N  1 1  38 LEU CA 1 1  38 LEU C       -82.9      -42.9 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        66 . 1 1  38 LEU N 1 1  38 LEU CA 1 1  38 LEU C  1 1  39 LYS N       -60.7      -20.7 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
        67 . 1 1  38 LEU C 1 1  39 LYS N  1 1  39 LYS CA 1 1  39 LYS C  -83.399994      -43.4 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        68 . 1 1  39 LYS N 1 1  39 LYS CA 1 1  39 LYS C  1 1  40 LYS N  -62.799995      -22.8 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
        69 . 1 1  39 LYS C 1 1  40 LYS N  1 1  40 LYS CA 1 1  40 LYS C       -84.8      -44.8 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        70 . 1 1  40 LYS N 1 1  40 LYS CA 1 1  40 LYS C  1 1  41 GLU N   -65.09999      -25.1 .  40 . N .  40 . CA .  40 . C  .  41 . N 1 1 
        71 . 1 1  40 LYS C 1 1  41 GLU N  1 1  41 GLU CA 1 1  41 GLU C       -84.8      -44.8 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        72 . 1 1  41 GLU N 1 1  41 GLU CA 1 1  41 GLU C  1 1  42 MET N  -59.400005      -19.4 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        73 . 1 1  41 GLU C 1 1  42 MET N  1 1  42 MET CA 1 1  42 MET C   -86.19999      -46.2 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        74 . 1 1  42 MET N 1 1  42 MET CA 1 1  42 MET C  1 1  43 LYS N  -57.500004      -17.5 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        75 . 1 1  42 MET C 1 1  43 LYS N  1 1  43 LYS CA 1 1  43 LYS C       -83.3      -43.3 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        76 . 1 1  43 LYS N 1 1  43 LYS CA 1 1  43 LYS C  1 1  44 LYS N       -60.7      -20.7 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 1 
        77 . 1 1  43 LYS C 1 1  44 LYS N  1 1  44 LYS CA 1 1  44 LYS C       -82.8 -42.799995 .  43 . C .  44 . N  .  44 . CA .  44 . C 1 1 
        78 . 1 1  44 LYS N 1 1  44 LYS CA 1 1  44 LYS C  1 1  45 LEU N  -63.899998      -13.4 .  44 . N .  44 . CA .  44 . C  .  45 . N 1 1 
        79 . 1 1  44 LYS C 1 1  45 LEU N  1 1  45 LEU CA 1 1  45 LEU C       -84.1      -44.1 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 1 
        80 . 1 1  45 LEU N 1 1  45 LEU CA 1 1  45 LEU C  1 1  46 ALA N  -62.700005      -16.8 .  45 . N .  45 . CA .  45 . C  .  46 . N 1 1 
        81 . 1 1  45 LEU C 1 1  46 ALA N  1 1  46 ALA CA 1 1  46 ALA C      -111.7      -37.1 .  45 . C .  46 . N  .  46 . CA .  46 . C 1 1 
        82 . 1 1  46 ALA N 1 1  46 ALA CA 1 1  46 ALA C  1 1  47 GLU N       -64.2  1.9000001 .  46 . N .  46 . CA .  46 . C  .  47 . N 1 1 
        83 . 1 1  46 ALA C 1 1  47 GLU N  1 1  47 GLU CA 1 1  47 GLU C -117.899994      -55.5 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 1 
        84 . 1 1  47 GLU N 1 1  47 GLU CA 1 1  47 GLU C  1 1  48 GLU N       -53.7       19.2 .  47 . N .  47 . CA .  47 . C  .  48 . N 1 1 
        85 . 1 1  47 GLU C 1 1  48 GLU N  1 1  48 GLU CA 1 1  48 GLU C      -179.1      -45.8 .  47 . C .  48 . N  .  48 . CA .  48 . C 1 1 
        86 . 1 1  48 GLU N 1 1  48 GLU CA 1 1  48 GLU C  1 1  49 LYS N        32.7      172.7 .  48 . N .  48 . CA .  48 . C  .  49 . N 1 1 
        87 . 1 1  48 GLU C 1 1  49 LYS N  1 1  49 LYS CA 1 1  49 LYS C      -103.5      -49.5 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        88 . 1 1  49 LYS N 1 1  49 LYS CA 1 1  49 LYS C  1 1  50 ASN N       -63.3       28.9 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 1 
        89 . 1 1  50 ASN C 1 1  51 PHE N  1 1  51 PHE CA 1 1  51 PHE C  -173.69998      -33.7 .  50 . C .  51 . N  .  51 . CA .  51 . C 1 1 
        90 . 1 1  51 PHE N 1 1  51 PHE CA 1 1  51 PHE C  1 1  52 GLU N        90.7      181.5 .  51 . N .  51 . CA .  51 . C  .  52 . N 1 1 
        91 . 1 1  51 PHE C 1 1  52 GLU N  1 1  52 GLU CA 1 1  52 GLU C      -168.3      -28.3 .  51 . C .  52 . N  .  52 . CA .  52 . C 1 1 
        92 . 1 1  52 GLU N 1 1  52 GLU CA 1 1  52 GLU C  1 1  53 LYS N    89.99999      217.0 .  52 . N .  52 . CA .  52 . C  .  53 . N 1 1 
        93 . 1 1  52 GLU C 1 1  53 LYS N  1 1  53 LYS CA 1 1  53 LYS C      -166.5      -26.5 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        94 . 1 1  53 LYS N 1 1  53 LYS CA 1 1  53 LYS C  1 1  54 ILE N        76.7      167.7 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
        95 . 1 1  53 LYS C 1 1  54 ILE N  1 1  54 ILE CA 1 1  54 ILE C      -150.4 -91.899994 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        96 . 1 1  54 ILE N 1 1  54 ILE CA 1 1  54 ILE C  1 1  55 LEU N       114.1      160.0 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        97 . 1 1  54 ILE C 1 1  55 LEU N  1 1  55 LEU CA 1 1  55 LEU C      -138.1      -74.5 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 1 
        98 . 1 1  55 LEU N 1 1  55 LEU CA 1 1  55 LEU C  1 1  56 ILE N        98.4      154.4 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 1 
        99 . 1 1  55 LEU C 1 1  56 ILE N  1 1  56 ILE CA 1 1  56 ILE C      -139.5      -99.5 .  55 . C .  56 . N  .  56 . CA .  56 . C 1 1 
       100 . 1 1  56 ILE N 1 1  56 ILE CA 1 1  56 ILE C  1 1  57 ILE N       110.4      150.4 .  56 . N .  56 . CA .  56 . C  .  57 . N 1 1 
       101 . 1 1  56 ILE C 1 1  57 ILE N  1 1  57 ILE CA 1 1  57 ILE C      -154.4      -81.0 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
       102 . 1 1  57 ILE N 1 1  57 ILE CA 1 1  57 ILE C  1 1  58 SER N       106.5      157.7 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
       103 . 1 1  57 ILE C 1 1  58 SER N  1 1  58 SER CA 1 1  58 SER C      -155.9     -115.9 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 1 
       104 . 1 1  58 SER N 1 1  58 SER CA 1 1  58 SER C  1 1  59 ASN N   106.69999      184.1 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 1 
       105 . 1 1  60 ASP C 1 1  61 LYS N  1 1  61 LYS CA 1 1  61 LYS C       -87.0      -38.3 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 1 
       106 . 1 1  61 LYS N 1 1  61 LYS CA 1 1  61 LYS C  1 1  62 GLN N       -74.2        2.8 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 1 
       107 . 1 1  61 LYS C 1 1  62 GLN N  1 1  62 GLN CA 1 1  62 GLN C       -82.9      -42.9 .  61 . C .  62 . N  .  62 . CA .  62 . C 1 1 
       108 . 1 1  62 GLN N 1 1  62 GLN CA 1 1  62 GLN C  1 1  63 LEU N       -58.4 -18.399998 .  62 . N .  62 . CA .  62 . C  .  63 . N 1 1 
       109 . 1 1  62 GLN C 1 1  63 LEU N  1 1  63 LEU CA 1 1  63 LEU C      -101.9      -38.0 .  62 . C .  63 . N  .  63 . CA .  63 . C 1 1 
       110 . 1 1  63 LEU N 1 1  63 LEU CA 1 1  63 LEU C  1 1  64 LEU N       -66.8        4.5 .  63 . N .  63 . CA .  63 . C  .  64 . N 1 1 
       111 . 1 1  63 LEU C 1 1  64 LEU N  1 1  64 LEU CA 1 1  64 LEU C       -85.7      -45.7 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 1 
       112 . 1 1  64 LEU N 1 1  64 LEU CA 1 1  64 LEU C  1 1  65 LYS N       -59.0      -19.0 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 1 
       113 . 1 1  64 LEU C 1 1  65 LYS N  1 1  65 LYS CA 1 1  65 LYS C       -82.2      -42.2 .  64 . C .  65 . N  .  65 . CA .  65 . C 1 1 
       114 . 1 1  65 LYS N 1 1  65 LYS CA 1 1  65 LYS C  1 1  66 GLU N       -64.2      -24.2 .  65 . N .  65 . CA .  65 . C  .  66 . N 1 1 
       115 . 1 1  65 LYS C 1 1  66 GLU N  1 1  66 GLU CA 1 1  66 GLU C       -87.6      -47.6 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 1 
       116 . 1 1  66 GLU N 1 1  66 GLU CA 1 1  66 GLU C  1 1  67 MET N  -60.399998      -20.4 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
       117 . 1 1  66 GLU C 1 1  67 MET N  1 1  67 MET CA 1 1  67 MET C       -82.5      -42.5 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 1 
       118 . 1 1  67 MET N 1 1  67 MET CA 1 1  67 MET C  1 1  68 LEU N  -62.599995      -22.6 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 1 
       119 . 1 1  67 MET C 1 1  68 LEU N  1 1  68 LEU CA 1 1  68 LEU C   -85.59999      -45.6 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
       120 . 1 1  68 LEU N 1 1  68 LEU CA 1 1  68 LEU C  1 1  69 GLU N       -59.7      -19.7 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
       121 . 1 1  68 LEU C 1 1  69 GLU N  1 1  69 GLU CA 1 1  69 GLU C       -82.1      -42.1 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
       122 . 1 1  69 GLU N 1 1  69 GLU CA 1 1  69 GLU C  1 1  70 LEU N       -63.2      -23.2 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
       123 . 1 1  69 GLU C 1 1  70 LEU N  1 1  70 LEU CA 1 1  70 LEU C       -83.6      -43.6 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
       124 . 1 1  70 LEU N 1 1  70 LEU CA 1 1  70 LEU C  1 1  71 ILE N  -63.500004      -23.5 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
       125 . 1 1  70 LEU C 1 1  71 ILE N  1 1  71 ILE CA 1 1  71 ILE C       -86.5      -46.5 .  70 . C .  71 . N  .  71 . CA .  71 . C 1 1 
       126 . 1 1  71 ILE N 1 1  71 ILE CA 1 1  71 ILE C  1 1  72 SER N       -63.1      -23.1 .  71 . N .  71 . CA .  71 . C  .  72 . N 1 1 
       127 . 1 1  71 ILE C 1 1  72 SER N  1 1  72 SER CA 1 1  72 SER C       -80.3      -40.3 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
       128 . 1 1  72 SER N 1 1  72 SER CA 1 1  72 SER C  1 1  73 LYS N   -65.09999      -25.1 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
       129 . 1 1  72 SER C 1 1  73 LYS N  1 1  73 LYS CA 1 1  73 LYS C       -85.4      -45.4 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 1 
       130 . 1 1  73 LYS N 1 1  73 LYS CA 1 1  73 LYS C  1 1  74 LEU N       -48.3       -8.3 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 1 
       131 . 1 1  73 LYS C 1 1  74 LEU N  1 1  74 LEU CA 1 1  74 LEU C  -115.69999      -61.3 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
       132 . 1 1  74 LEU N 1 1  74 LEU CA 1 1  74 LEU C  1 1  75 GLY N       -47.3       26.3 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
       133 . 1 1  75 GLY C 1 1  76 TYR N  1 1  76 TYR CA 1 1  76 TYR C      -165.3      -25.3 .  75 . C .  76 . N  .  76 . CA .  76 . C 1 1 
       134 . 1 1  76 TYR N 1 1  76 TYR CA 1 1  76 TYR C  1 1  77 LYS N        86.1      175.5 .  76 . N .  76 . CA .  76 . C  .  77 . N 1 1 
       135 . 1 1  76 TYR C 1 1  77 LYS N  1 1  77 LYS CA 1 1  77 LYS C      -132.4      -67.6 .  76 . C .  77 . N  .  77 . CA .  77 . C 1 1 
       136 . 1 1  77 LYS N 1 1  77 LYS CA 1 1  77 LYS C  1 1  78 VAL N        91.3      145.2 .  77 . N .  77 . CA .  77 . C  .  78 . N 1 1 
       137 . 1 1  77 LYS C 1 1  78 VAL N  1 1  78 VAL CA 1 1  78 VAL C      -142.2      -91.4 .  77 . C .  78 . N  .  78 . CA .  78 . C 1 1 
       138 . 1 1  78 VAL N 1 1  78 VAL CA 1 1  78 VAL C  1 1  79 PHE N       109.7      149.7 .  78 . N .  78 . CA .  78 . C  .  79 . N 1 1 
       139 . 1 1  78 VAL C 1 1  79 PHE N  1 1  79 PHE CA 1 1  79 PHE C      -145.6      -75.7 .  78 . C .  79 . N  .  79 . CA .  79 . C 1 1 
       140 . 1 1  79 PHE N 1 1  79 PHE CA 1 1  79 PHE C  1 1  80 LEU N   106.69999      161.2 .  79 . N .  79 . CA .  79 . C  .  80 . N 1 1 
       141 . 1 1  79 PHE C 1 1  80 LEU N  1 1  80 LEU CA 1 1  80 LEU C      -146.3      -67.1 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
       142 . 1 1  80 LEU N 1 1  80 LEU CA 1 1  80 LEU C  1 1  81 LEU N        97.4      146.2 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 1 
       143 . 1 1  80 LEU C 1 1  81 LEU N  1 1  81 LEU CA 1 1  81 LEU C      -153.4      -68.6 .  80 . C .  81 . N  .  81 . CA .  81 . C 1 1 
       144 . 1 1  81 LEU N 1 1  81 LEU CA 1 1  81 LEU C  1 1  82 LEU N   115.00001      155.0 .  81 . N .  81 . CA .  81 . C  .  82 . N 1 1 
       145 . 1 1  81 LEU C 1 1  82 LEU N  1 1  82 LEU CA 1 1  82 LEU C  -174.99998      -84.3 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
       146 . 1 1  82 LEU N 1 1  82 LEU CA 1 1  82 LEU C  1 1  83 GLN N       122.5      169.2 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 1 
       147 . 1 1  82 LEU C 1 1  83 GLN N  1 1  83 GLN CA 1 1  83 GLN C      -159.8      -70.4 .  82 . C .  83 . N  .  83 . CA .  83 . C 1 1 
       148 . 1 1  83 GLN N 1 1  83 GLN CA 1 1  83 GLN C  1 1  84 ASP N       103.6      159.6 .  83 . N .  83 . CA .  83 . C  .  84 . N 1 1 
       149 . 1 1  83 GLN C 1 1  84 ASP N  1 1  84 ASP CA 1 1  84 ASP C      -163.2      -36.7 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 1 
       150 . 1 1  84 ASP N 1 1  84 ASP CA 1 1  84 ASP C  1 1  85 GLN N   117.50001      174.3 .  84 . N .  84 . CA .  84 . C  .  85 . N 1 1 
       151 . 1 1  85 GLN C 1 1  86 ASP N  1 1  86 ASP CA 1 1  86 ASP C      -151.2      -46.5 .  85 . C .  86 . N  .  86 . CA .  86 . C 1 1 
       152 . 1 1  86 ASP N 1 1  86 ASP CA 1 1  86 ASP C  1 1  87 GLU N        57.3      197.3 .  86 . N .  86 . CA .  86 . C  .  87 . N 1 1 
       153 . 1 1  86 ASP C 1 1  87 GLU N  1 1  87 GLU CA 1 1  87 GLU C      -107.1      -26.2 .  86 . C .  87 . N  .  87 . CA .  87 . C 1 1 
       154 . 1 1  87 GLU N 1 1  87 GLU CA 1 1  87 GLU C  1 1  88 ASN N  -60.999996       10.5 .  87 . N .  87 . CA .  87 . C  .  88 . N 1 1 
       155 . 1 1  87 GLU C 1 1  88 ASN N  1 1  88 ASN CA 1 1  88 ASN C  -83.399994      -43.4 .  87 . C .  88 . N  .  88 . CA .  88 . C 1 1 
       156 . 1 1  88 ASN N 1 1  88 ASN CA 1 1  88 ASN C  1 1  89 GLU N  -59.099995      -19.1 .  88 . N .  88 . CA .  88 . C  .  89 . N 1 1 
       157 . 1 1  88 ASN C 1 1  89 GLU N  1 1  89 GLU CA 1 1  89 GLU C       -85.2      -45.2 .  88 . C .  89 . N  .  89 . CA .  89 . C 1 1 
       158 . 1 1  89 GLU N 1 1  89 GLU CA 1 1  89 GLU C  1 1  90 LEU N       -61.5      -21.5 .  89 . N .  89 . CA .  89 . C  .  90 . N 1 1 
       159 . 1 1  89 GLU C 1 1  90 LEU N  1 1  90 LEU CA 1 1  90 LEU C       -81.4      -41.4 .  89 . C .  90 . N  .  90 . CA .  90 . C 1 1 
       160 . 1 1  90 LEU N 1 1  90 LEU CA 1 1  90 LEU C  1 1  91 GLU N       -62.1      -22.1 .  90 . N .  90 . CA .  90 . C  .  91 . N 1 1 
       161 . 1 1  90 LEU C 1 1  91 GLU N  1 1  91 GLU CA 1 1  91 GLU C       -84.8      -44.8 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 1 
       162 . 1 1  91 GLU N 1 1  91 GLU CA 1 1  91 GLU C  1 1  92 GLU N  -60.800003      -20.8 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 1 
       163 . 1 1  91 GLU C 1 1  92 GLU N  1 1  92 GLU CA 1 1  92 GLU C       -83.9      -43.9 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 1 
       164 . 1 1  92 GLU N 1 1  92 GLU CA 1 1  92 GLU C  1 1  93 PHE N  -61.999996      -22.0 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 1 
       165 . 1 1  92 GLU C 1 1  93 PHE N  1 1  93 PHE CA 1 1  93 PHE C       -85.9      -45.9 .  92 . C .  93 . N  .  93 . CA .  93 . C 1 1 
       166 . 1 1  93 PHE N 1 1  93 PHE CA 1 1  93 PHE C  1 1  94 LYS N       -60.9      -20.9 .  93 . N .  93 . CA .  93 . C  .  94 . N 1 1 
       167 . 1 1  93 PHE C 1 1  94 LYS N  1 1  94 LYS CA 1 1  94 LYS C       -80.0      -40.0 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
       168 . 1 1  94 LYS N 1 1  94 LYS CA 1 1  94 LYS C  1 1  95 ARG N       -66.0      -26.0 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
       169 . 1 1  94 LYS C 1 1  95 ARG N  1 1  95 ARG CA 1 1  95 ARG C       -82.8 -42.799995 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 1 
       170 . 1 1  95 ARG N 1 1  95 ARG CA 1 1  95 ARG C  1 1  96 LYS N  -61.399998 -21.399998 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 1 
       171 . 1 1  95 ARG C 1 1  96 LYS N  1 1  96 LYS CA 1 1  96 LYS C  -83.399994      -43.4 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 1 
       172 . 1 1  96 LYS N 1 1  96 LYS CA 1 1  96 LYS C  1 1  97 ILE N  -60.299995      -20.3 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 1 
       173 . 1 1  96 LYS C 1 1  97 ILE N  1 1  97 ILE CA 1 1  97 ILE C       -94.0      -46.5 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
       174 . 1 1  97 ILE N 1 1  97 ILE CA 1 1  97 ILE C  1 1  98 GLU N  -57.899998      -17.9 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
       175 . 1 1  97 ILE C 1 1  98 GLU N  1 1  98 GLU CA 1 1  98 GLU C       -87.2      -47.2 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
       176 . 1 1  98 GLU N 1 1  98 GLU CA 1 1  98 GLU C  1 1  99 SER N       -56.6      -16.6 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
       177 . 1 1  98 GLU C 1 1  99 SER N  1 1  99 SER CA 1 1  99 SER C       -86.4      -46.4 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
       178 . 1 1  99 SER N 1 1  99 SER CA 1 1  99 SER C  1 1 100 GLN N       -62.3      -10.6 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
       179 . 1 1  99 SER C 1 1 100 GLN N  1 1 100 GLN CA 1 1 100 GLN C      -104.7      -64.7 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
       180 . 1 1 100 GLN N 1 1 100 GLN CA 1 1 100 GLN C  1 1 101 GLY N       -23.1       16.9 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
       181 . 1 1 100 GLN C 1 1 101 GLY N  1 1 101 GLY CA 1 1 101 GLY C        48.5      113.7 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
       182 . 1 1 101 GLY N 1 1 101 GLY CA 1 1 101 GLY C  1 1 102 TYR N       -10.5       47.7 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
       183 . 1 1 101 GLY C 1 1 102 TYR N  1 1 102 TYR CA 1 1 102 TYR C      -138.7      -68.7 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
       184 . 1 1 102 TYR N 1 1 102 TYR CA 1 1 102 TYR C  1 1 103 GLU N       113.2      169.0 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
       185 . 1 1 102 TYR C 1 1 103 GLU N  1 1 103 GLU CA 1 1 103 GLU C      -129.3      -66.5 . 102 . C . 103 . N  . 103 . CA . 103 . C 1 1 
       186 . 1 1 103 GLU N 1 1 103 GLU CA 1 1 103 GLU C  1 1 104 VAL N   89.399994      149.1 . 103 . N . 103 . CA . 103 . C  . 104 . N 1 1 
       187 . 1 1 103 GLU C 1 1 104 VAL N  1 1 104 VAL CA 1 1 104 VAL C      -135.3      -95.3 . 103 . C . 104 . N  . 104 . CA . 104 . C 1 1 
       188 . 1 1 104 VAL N 1 1 104 VAL CA 1 1 104 VAL C  1 1 105 ARG N       112.1      158.8 . 104 . N . 104 . CA . 104 . C  . 105 . N 1 1 
       189 . 1 1 104 VAL C 1 1 105 ARG N  1 1 105 ARG CA 1 1 105 ARG C      -149.8      -80.3 . 104 . C . 105 . N  . 105 . CA . 105 . C 1 1 
       190 . 1 1 105 ARG N 1 1 105 ARG CA 1 1 105 ARG C  1 1 106 LYS N       114.5      154.5 . 105 . N . 105 . CA . 105 . C  . 106 . N 1 1 
       191 . 1 1 105 ARG C 1 1 106 LYS N  1 1 106 LYS CA 1 1 106 LYS C      -144.6      -89.9 . 105 . C . 106 . N  . 106 . CA . 106 . C 1 1 
       192 . 1 1 106 LYS N 1 1 106 LYS CA 1 1 106 LYS C  1 1 107 VAL N       108.7      163.8 . 106 . N . 106 . CA . 106 . C  . 107 . N 1 1 
       193 . 1 1 106 LYS C 1 1 107 VAL N  1 1 107 VAL CA 1 1 107 VAL C      -167.1      -95.0 . 106 . C . 107 . N  . 107 . CA . 107 . C 1 1 
       194 . 1 1 107 VAL N 1 1 107 VAL CA 1 1 107 VAL C  1 1 108 THR N       125.1      180.6 . 107 . N . 107 . CA . 107 . C  . 108 . N 1 1 
       195 . 1 1 109 ASP C 1 1 110 ASP N  1 1 110 ASP CA 1 1 110 ASP C       -79.9      -39.9 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 1 
       196 . 1 1 110 ASP N 1 1 110 ASP CA 1 1 110 ASP C  1 1 111 GLU N       -58.4 -18.399998 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 1 
       197 . 1 1 110 ASP C 1 1 111 GLU N  1 1 111 GLU CA 1 1 111 GLU C       -83.2      -43.2 . 110 . C . 111 . N  . 111 . CA . 111 . C 1 1 
       198 . 1 1 111 GLU N 1 1 111 GLU CA 1 1 111 GLU C  1 1 112 GLU N       -62.5 -22.499998 . 111 . N . 111 . CA . 111 . C  . 112 . N 1 1 
       199 . 1 1 111 GLU C 1 1 112 GLU N  1 1 112 GLU CA 1 1 112 GLU C       -85.7      -45.7 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 1 
       200 . 1 1 112 GLU N 1 1 112 GLU CA 1 1 112 GLU C  1 1 113 ALA N       -64.7      -24.7 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 1 
       201 . 1 1 112 GLU C 1 1 113 ALA N  1 1 113 ALA CA 1 1 113 ALA C       -82.0      -42.0 . 112 . C . 113 . N  . 113 . CA . 113 . C 1 1 
       202 . 1 1 113 ALA N 1 1 113 ALA CA 1 1 113 ALA C  1 1 114 LEU N  -58.499996 -15.200001 . 113 . N . 113 . CA . 113 . C  . 114 . N 1 1 
       203 . 1 1 113 ALA C 1 1 114 LEU N  1 1 114 LEU CA 1 1 114 LEU C       -86.0      -46.0 . 113 . C . 114 . N  . 114 . CA . 114 . C 1 1 
       204 . 1 1 114 LEU N 1 1 114 LEU CA 1 1 114 LEU C  1 1 115 LYS N  -57.699997      -17.7 . 114 . N . 114 . CA . 114 . C  . 115 . N 1 1 
       205 . 1 1 114 LEU C 1 1 115 LYS N  1 1 115 LYS CA 1 1 115 LYS C  -83.399994      -43.4 . 114 . C . 115 . N  . 115 . CA . 115 . C 1 1 
       206 . 1 1 115 LYS N 1 1 115 LYS CA 1 1 115 LYS C  1 1 116 ILE N       -64.1      -24.1 . 115 . N . 115 . CA . 115 . C  . 116 . N 1 1 
       207 . 1 1 115 LYS C 1 1 116 ILE N  1 1 116 ILE CA 1 1 116 ILE C       -81.8      -41.8 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 1 
       208 . 1 1 116 ILE N 1 1 116 ILE CA 1 1 116 ILE C  1 1 117 VAL N       -66.5      -26.5 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 1 
       209 . 1 1 116 ILE C 1 1 117 VAL N  1 1 117 VAL CA 1 1 117 VAL C       -82.9      -42.9 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
       210 . 1 1 117 VAL N 1 1 117 VAL CA 1 1 117 VAL C  1 1 118 ARG N       -62.5 -22.499998 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
       211 . 1 1 117 VAL C 1 1 118 ARG N  1 1 118 ARG CA 1 1 118 ARG C       -81.1      -41.1 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
       212 . 1 1 118 ARG N 1 1 118 ARG CA 1 1 118 ARG C  1 1 119 GLU N       -63.2      -23.2 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
       213 . 1 1 118 ARG C 1 1 119 GLU N  1 1 119 GLU CA 1 1 119 GLU C       -85.8      -45.8 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
       214 . 1 1 119 GLU N 1 1 119 GLU CA 1 1 119 GLU C  1 1 120 PHE N       -63.0      -23.0 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
       215 . 1 1 119 GLU C 1 1 120 PHE N  1 1 120 PHE CA 1 1 120 PHE C   -88.09999 -44.999996 . 119 . C . 120 . N  . 120 . CA . 120 . C 1 1 
       216 . 1 1 120 PHE N 1 1 120 PHE CA 1 1 120 PHE C  1 1 121 MET N       -61.1      -12.2 . 120 . N . 120 . CA . 120 . C  . 121 . N 1 1 
       217 . 1 1 120 PHE C 1 1 121 MET N  1 1 121 MET CA 1 1 121 MET C       -82.0      -42.0 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 1 
       218 . 1 1 121 MET N 1 1 121 MET CA 1 1 121 MET C  1 1 122 GLN N       -60.9 -7.6000004 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 1 
       219 . 1 1 121 MET C 1 1 122 GLN N  1 1 122 GLN CA 1 1 122 GLN C       -97.7      -45.2 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 1 
       220 . 1 1 122 GLN N 1 1 122 GLN CA 1 1 122 GLN C  1 1 123 LYS N       -57.2      -12.5 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 1 
       221 . 1 1 122 GLN C 1 1 123 LYS N  1 1 123 LYS CA 1 1 123 LYS C       -89.3 -49.099995 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 1 
       222 . 1 1 123 LYS N 1 1 123 LYS CA 1 1 123 LYS C  1 1 124 ALA N       -61.5       -4.9 . 123 . N . 123 . CA . 123 . C  . 124 . N 1 1 
       223 . 1 1 123 LYS C 1 1 124 ALA N  1 1 124 ALA CA 1 1 124 ALA C  -93.799995      -43.9 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 1 
       224 . 1 1 124 ALA N 1 1 124 ALA CA 1 1 124 ALA C  1 1 125 GLY N       -75.3       12.9 . 124 . N . 124 . CA . 124 . C  . 125 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C -14.225   6.723   4.238 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C -14.740   8.122   4.634 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C -14.147   8.594   5.992 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C -10.221   9.659   5.006 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C -12.617   8.707   6.025 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H -16.553   7.469   5.434 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H -16.617   7.830   3.783 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H -16.566   9.083   4.916 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H -14.452   8.826   3.862 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H -14.554   9.571   6.222 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H -14.458   7.903   6.774 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H  -9.898   8.628   4.987 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H -10.005  10.086   5.974 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H  -9.694  10.214   4.243 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H -12.311   9.136   6.974 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H -12.189   7.717   5.925 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N -16.221   8.129   4.697 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O -14.819   5.701   4.617 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S -11.980   9.739   4.692 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 LYS C    C -10.962   5.653   3.035 1.00 . A A .   2 LYS C    1 1 
        1    21 1 1   2 LYS CA   C -12.484   5.459   2.990 1.00 . A A .   2 LYS CA   1 1 
        1    22 1 1   2 LYS CB   C -12.967   5.101   1.560 1.00 . A A .   2 LYS CB   1 1 
        1    23 1 1   2 LYS CD   C -12.854   3.502  -0.465 1.00 . A A .   2 LYS CD   1 1 
        1    24 1 1   2 LYS CE   C -14.384   3.323  -0.517 1.00 . A A .   2 LYS CE   1 1 
        1    25 1 1   2 LYS CG   C -12.339   3.816   0.960 1.00 . A A .   2 LYS CG   1 1 
        1    26 1 1   2 LYS H    H -12.727   7.547   3.180 1.00 . A A .   2 LYS H    1 1 
        1    27 1 1   2 LYS HA   H -12.754   4.654   3.669 1.00 . A A .   2 LYS HA   1 1 
        1    28 1 1   2 LYS HB2  H -14.044   4.969   1.590 1.00 . A A .   2 LYS HB2  1 1 
        1    29 1 1   2 LYS HB3  H -12.744   5.933   0.897 1.00 . A A .   2 LYS HB3  1 1 
        1    30 1 1   2 LYS HD2  H -12.575   4.315  -1.126 1.00 . A A .   2 LYS HD2  1 1 
        1    31 1 1   2 LYS HD3  H -12.384   2.588  -0.815 1.00 . A A .   2 LYS HD3  1 1 
        1    32 1 1   2 LYS HE2  H -14.859   4.265  -0.280 1.00 . A A .   2 LYS HE2  1 1 
        1    33 1 1   2 LYS HE3  H -14.670   3.028  -1.520 1.00 . A A .   2 LYS HE3  1 1 
        1    34 1 1   2 LYS HG2  H -11.262   3.941   0.920 1.00 . A A .   2 LYS HG2  1 1 
        1    35 1 1   2 LYS HG3  H -12.570   2.976   1.608 1.00 . A A .   2 LYS HG3  1 1 
        1    36 1 1   2 LYS HZ1  H -14.625   2.542   1.416 1.00 . A A .   2 LYS HZ1  1 1 
        1    37 1 1   2 LYS HZ2  H -14.455   1.359   0.218 1.00 . A A .   2 LYS HZ2  1 1 
        1    38 1 1   2 LYS HZ3  H -15.911   2.204   0.377 1.00 . A A .   2 LYS HZ3  1 1 
        1    39 1 1   2 LYS N    N -13.130   6.695   3.452 1.00 . A A .   2 LYS N    1 1 
        1    40 1 1   2 LYS NZ   N -14.876   2.284   0.441 1.00 . A A .   2 LYS NZ   1 1 
        1    41 1 1   2 LYS O    O -10.456   6.719   2.680 1.00 . A A .   2 LYS O    1 1 
        1    42 1 1   3 GLU C    C  -8.134   3.720   2.677 1.00 . A A .   3 GLU C    1 1 
        1    43 1 1   3 GLU CA   C  -8.788   4.666   3.702 1.00 . A A .   3 GLU CA   1 1 
        1    44 1 1   3 GLU CB   C  -8.375   4.289   5.175 1.00 . A A .   3 GLU CB   1 1 
        1    45 1 1   3 GLU CD   C -10.277   5.564   6.448 1.00 . A A .   3 GLU CD   1 1 
        1    46 1 1   3 GLU CG   C  -9.520   4.243   6.219 1.00 . A A .   3 GLU CG   1 1 
        1    47 1 1   3 GLU H    H -10.731   3.827   3.787 1.00 . A A .   3 GLU H    1 1 
        1    48 1 1   3 GLU HA   H  -8.448   5.682   3.493 1.00 . A A .   3 GLU HA   1 1 
        1    49 1 1   3 GLU HB2  H  -7.894   3.314   5.179 1.00 . A A .   3 GLU HB2  1 1 
        1    50 1 1   3 GLU HB3  H  -7.647   5.011   5.528 1.00 . A A .   3 GLU HB3  1 1 
        1    51 1 1   3 GLU HG2  H -10.227   3.492   5.892 1.00 . A A .   3 GLU HG2  1 1 
        1    52 1 1   3 GLU HG3  H  -9.110   3.924   7.166 1.00 . A A .   3 GLU HG3  1 1 
        1    53 1 1   3 GLU N    N -10.250   4.631   3.525 1.00 . A A .   3 GLU N    1 1 
        1    54 1 1   3 GLU O    O  -8.706   2.681   2.311 1.00 . A A .   3 GLU O    1 1 
        1    55 1 1   3 GLU OE1  O  -9.635   6.601   6.681 1.00 . A A .   3 GLU OE1  1 1 
        1    56 1 1   3 GLU OE2  O -11.528   5.556   6.413 1.00 . A A .   3 GLU OE2  1 1 
        1    57 1 1   4 LEU C    C  -4.742   3.157   1.731 1.00 . A A .   4 LEU C    1 1 
        1    58 1 1   4 LEU CA   C  -6.165   3.371   1.194 1.00 . A A .   4 LEU CA   1 1 
        1    59 1 1   4 LEU CB   C  -6.116   4.125  -0.176 1.00 . A A .   4 LEU CB   1 1 
        1    60 1 1   4 LEU CD1  C  -7.558   2.461  -1.496 1.00 . A A .   4 LEU CD1  1 1 
        1    61 1 1   4 LEU CD2  C  -8.631   4.607  -0.628 1.00 . A A .   4 LEU CD2  1 1 
        1    62 1 1   4 LEU CG   C  -7.336   3.943  -1.149 1.00 . A A .   4 LEU CG   1 1 
        1    63 1 1   4 LEU H    H  -6.575   4.940   2.542 1.00 . A A .   4 LEU H    1 1 
        1    64 1 1   4 LEU HA   H  -6.632   2.399   1.042 1.00 . A A .   4 LEU HA   1 1 
        1    65 1 1   4 LEU HB2  H  -6.000   5.187   0.023 1.00 . A A .   4 LEU HB2  1 1 
        1    66 1 1   4 LEU HB3  H  -5.226   3.798  -0.711 1.00 . A A .   4 LEU HB3  1 1 
        1    67 1 1   4 LEU HD11 H  -7.779   1.893  -0.602 1.00 . A A .   4 LEU HD11 1 1 
        1    68 1 1   4 LEU HD12 H  -6.669   2.059  -1.965 1.00 . A A .   4 LEU HD12 1 1 
        1    69 1 1   4 LEU HD13 H  -8.387   2.371  -2.190 1.00 . A A .   4 LEU HD13 1 1 
        1    70 1 1   4 LEU HD21 H  -8.939   4.148   0.303 1.00 . A A .   4 LEU HD21 1 1 
        1    71 1 1   4 LEU HD22 H  -9.420   4.497  -1.361 1.00 . A A .   4 LEU HD22 1 1 
        1    72 1 1   4 LEU HD23 H  -8.454   5.662  -0.462 1.00 . A A .   4 LEU HD23 1 1 
        1    73 1 1   4 LEU HG   H  -7.088   4.437  -2.085 1.00 . A A .   4 LEU HG   1 1 
        1    74 1 1   4 LEU N    N  -6.952   4.115   2.195 1.00 . A A .   4 LEU N    1 1 
        1    75 1 1   4 LEU O    O  -3.998   4.123   1.929 1.00 . A A .   4 LEU O    1 1 
        1    76 1 1   5 ILE C    C  -2.334   0.742   1.231 1.00 . A A .   5 ILE C    1 1 
        1    77 1 1   5 ILE CA   C  -3.023   1.499   2.385 1.00 . A A .   5 ILE CA   1 1 
        1    78 1 1   5 ILE CB   C  -3.039   0.649   3.716 1.00 . A A .   5 ILE CB   1 1 
        1    79 1 1   5 ILE CD1  C  -1.491  -0.663   5.376 1.00 . A A .   5 ILE CD1  1 1 
        1    80 1 1   5 ILE CG1  C  -1.595   0.177   4.106 1.00 . A A .   5 ILE CG1  1 1 
        1    81 1 1   5 ILE CG2  C  -4.029  -0.531   3.628 1.00 . A A .   5 ILE CG2  1 1 
        1    82 1 1   5 ILE H    H  -5.051   1.183   1.830 1.00 . A A .   5 ILE H    1 1 
        1    83 1 1   5 ILE HA   H  -2.459   2.416   2.584 1.00 . A A .   5 ILE HA   1 1 
        1    84 1 1   5 ILE HB   H  -3.407   1.305   4.505 1.00 . A A .   5 ILE HB   1 1 
        1    85 1 1   5 ILE HD11 H  -0.455  -0.908   5.558 1.00 . A A .   5 ILE HD11 1 1 
        1    86 1 1   5 ILE HD12 H  -2.061  -1.574   5.259 1.00 . A A .   5 ILE HD12 1 1 
        1    87 1 1   5 ILE HD13 H  -1.878  -0.102   6.214 1.00 . A A .   5 ILE HD13 1 1 
        1    88 1 1   5 ILE HG12 H  -1.188  -0.416   3.299 1.00 . A A .   5 ILE HG12 1 1 
        1    89 1 1   5 ILE HG13 H  -0.965   1.048   4.241 1.00 . A A .   5 ILE HG13 1 1 
        1    90 1 1   5 ILE HG21 H  -5.022  -0.165   3.391 1.00 . A A .   5 ILE HG21 1 1 
        1    91 1 1   5 ILE HG22 H  -4.063  -1.057   4.573 1.00 . A A .   5 ILE HG22 1 1 
        1    92 1 1   5 ILE HG23 H  -3.708  -1.213   2.852 1.00 . A A .   5 ILE HG23 1 1 
        1    93 1 1   5 ILE N    N  -4.380   1.888   1.965 1.00 . A A .   5 ILE N    1 1 
        1    94 1 1   5 ILE O    O  -2.856  -0.252   0.723 1.00 . A A .   5 ILE O    1 1 
        1    95 1 1   6 LEU C    C   0.807  -0.067   0.298 1.00 . A A .   6 LEU C    1 1 
        1    96 1 1   6 LEU CA   C  -0.382   0.705  -0.293 1.00 . A A .   6 LEU CA   1 1 
        1    97 1 1   6 LEU CB   C   0.127   1.844  -1.230 1.00 . A A .   6 LEU CB   1 1 
        1    98 1 1   6 LEU CD1  C  -1.812   3.586  -1.146 1.00 . A A .   6 LEU CD1  1 1 
        1    99 1 1   6 LEU CD2  C  -0.271   3.465  -3.173 1.00 . A A .   6 LEU CD2  1 1 
        1   100 1 1   6 LEU CG   C  -0.949   2.661  -2.042 1.00 . A A .   6 LEU CG   1 1 
        1   101 1 1   6 LEU H    H  -0.819   2.037   1.275 1.00 . A A .   6 LEU H    1 1 
        1   102 1 1   6 LEU HA   H  -1.008   0.022  -0.873 1.00 . A A .   6 LEU HA   1 1 
        1   103 1 1   6 LEU HB2  H   0.696   2.546  -0.627 1.00 . A A .   6 LEU HB2  1 1 
        1   104 1 1   6 LEU HB3  H   0.812   1.397  -1.947 1.00 . A A .   6 LEU HB3  1 1 
        1   105 1 1   6 LEU HD11 H  -2.541   4.105  -1.753 1.00 . A A .   6 LEU HD11 1 1 
        1   106 1 1   6 LEU HD12 H  -1.182   4.312  -0.647 1.00 . A A .   6 LEU HD12 1 1 
        1   107 1 1   6 LEU HD13 H  -2.328   2.992  -0.402 1.00 . A A .   6 LEU HD13 1 1 
        1   108 1 1   6 LEU HD21 H  -1.017   4.009  -3.735 1.00 . A A .   6 LEU HD21 1 1 
        1   109 1 1   6 LEU HD22 H   0.247   2.786  -3.839 1.00 . A A .   6 LEU HD22 1 1 
        1   110 1 1   6 LEU HD23 H   0.441   4.167  -2.756 1.00 . A A .   6 LEU HD23 1 1 
        1   111 1 1   6 LEU HG   H  -1.630   1.963  -2.516 1.00 . A A .   6 LEU HG   1 1 
        1   112 1 1   6 LEU N    N  -1.172   1.255   0.811 1.00 . A A .   6 LEU N    1 1 
        1   113 1 1   6 LEU O    O   1.603   0.504   1.043 1.00 . A A .   6 LEU O    1 1 
        1   114 1 1   7 ILE C    C   2.940  -2.407  -0.803 1.00 . A A .   7 ILE C    1 1 
        1   115 1 1   7 ILE CA   C   1.995  -2.239   0.398 1.00 . A A .   7 ILE CA   1 1 
        1   116 1 1   7 ILE CB   C   1.490  -3.660   0.914 1.00 . A A .   7 ILE CB   1 1 
        1   117 1 1   7 ILE CD1  C  -0.531  -2.829   2.351 1.00 . A A .   7 ILE CD1  1 1 
        1   118 1 1   7 ILE CG1  C   0.790  -3.570   2.323 1.00 . A A .   7 ILE CG1  1 1 
        1   119 1 1   7 ILE CG2  C   2.643  -4.699   0.965 1.00 . A A .   7 ILE CG2  1 1 
        1   120 1 1   7 ILE H    H   0.165  -1.757  -0.535 1.00 . A A .   7 ILE H    1 1 
        1   121 1 1   7 ILE HA   H   2.541  -1.755   1.209 1.00 . A A .   7 ILE HA   1 1 
        1   122 1 1   7 ILE HB   H   0.759  -4.031   0.193 1.00 . A A .   7 ILE HB   1 1 
        1   123 1 1   7 ILE HD11 H  -0.374  -1.796   2.075 1.00 . A A .   7 ILE HD11 1 1 
        1   124 1 1   7 ILE HD12 H  -0.948  -2.873   3.348 1.00 . A A .   7 ILE HD12 1 1 
        1   125 1 1   7 ILE HD13 H  -1.222  -3.285   1.655 1.00 . A A .   7 ILE HD13 1 1 
        1   126 1 1   7 ILE HG12 H   0.592  -4.573   2.687 1.00 . A A .   7 ILE HG12 1 1 
        1   127 1 1   7 ILE HG13 H   1.457  -3.079   3.019 1.00 . A A .   7 ILE HG13 1 1 
        1   128 1 1   7 ILE HG21 H   2.257  -5.650   1.294 1.00 . A A .   7 ILE HG21 1 1 
        1   129 1 1   7 ILE HG22 H   3.407  -4.364   1.654 1.00 . A A .   7 ILE HG22 1 1 
        1   130 1 1   7 ILE HG23 H   3.080  -4.815  -0.021 1.00 . A A .   7 ILE HG23 1 1 
        1   131 1 1   7 ILE N    N   0.884  -1.367  -0.007 1.00 . A A .   7 ILE N    1 1 
        1   132 1 1   7 ILE O    O   2.483  -2.611  -1.931 1.00 . A A .   7 ILE O    1 1 
        1   133 1 1   8 ASN C    C   6.114  -3.754  -1.046 1.00 . A A .   8 ASN C    1 1 
        1   134 1 1   8 ASN CA   C   5.298  -2.566  -1.541 1.00 . A A .   8 ASN CA   1 1 
        1   135 1 1   8 ASN CB   C   6.218  -1.332  -1.721 1.00 . A A .   8 ASN CB   1 1 
        1   136 1 1   8 ASN CG   C   7.263  -1.468  -2.843 1.00 . A A .   8 ASN CG   1 1 
        1   137 1 1   8 ASN H    H   4.528  -2.019   0.346 1.00 . A A .   8 ASN H    1 1 
        1   138 1 1   8 ASN HA   H   4.833  -2.808  -2.497 1.00 . A A .   8 ASN HA   1 1 
        1   139 1 1   8 ASN HB2  H   5.604  -0.472  -1.947 1.00 . A A .   8 ASN HB2  1 1 
        1   140 1 1   8 ASN HB3  H   6.738  -1.141  -0.789 1.00 . A A .   8 ASN HB3  1 1 
        1   141 1 1   8 ASN HD21 H   5.968  -2.419  -4.031 1.00 . A A .   8 ASN HD21 1 1 
        1   142 1 1   8 ASN HD22 H   7.548  -2.162  -4.681 1.00 . A A .   8 ASN HD22 1 1 
        1   143 1 1   8 ASN N    N   4.250  -2.293  -0.551 1.00 . A A .   8 ASN N    1 1 
        1   144 1 1   8 ASN ND2  N   6.888  -2.080  -3.963 1.00 . A A .   8 ASN ND2  1 1 
        1   145 1 1   8 ASN O    O   6.792  -3.642  -0.027 1.00 . A A .   8 ASN O    1 1 
        1   146 1 1   8 ASN OD1  O   8.386  -0.977  -2.722 1.00 . A A .   8 ASN OD1  1 1 
        1   147 1 1   9 THR C    C   7.001  -6.874  -2.752 1.00 . A A .   9 THR C    1 1 
        1   148 1 1   9 THR CA   C   6.812  -6.076  -1.453 1.00 . A A .   9 THR CA   1 1 
        1   149 1 1   9 THR CB   C   6.242  -6.981  -0.298 1.00 . A A .   9 THR CB   1 1 
        1   150 1 1   9 THR CG2  C   4.781  -7.407  -0.523 1.00 . A A .   9 THR CG2  1 1 
        1   151 1 1   9 THR H    H   5.269  -4.971  -2.390 1.00 . A A .   9 THR H    1 1 
        1   152 1 1   9 THR HA   H   7.795  -5.713  -1.132 1.00 . A A .   9 THR HA   1 1 
        1   153 1 1   9 THR HB   H   6.286  -6.409   0.627 1.00 . A A .   9 THR HB   1 1 
        1   154 1 1   9 THR HG1  H   7.494  -8.112   0.737 1.00 . A A .   9 THR HG1  1 1 
        1   155 1 1   9 THR HG21 H   4.146  -6.531  -0.576 1.00 . A A .   9 THR HG21 1 1 
        1   156 1 1   9 THR HG22 H   4.453  -8.034   0.299 1.00 . A A .   9 THR HG22 1 1 
        1   157 1 1   9 THR HG23 H   4.698  -7.963  -1.446 1.00 . A A .   9 THR HG23 1 1 
        1   158 1 1   9 THR N    N   5.968  -4.905  -1.705 1.00 . A A .   9 THR N    1 1 
        1   159 1 1   9 THR O    O   6.054  -7.041  -3.534 1.00 . A A .   9 THR O    1 1 
        1   160 1 1   9 THR OG1  O   7.063  -8.147  -0.127 1.00 . A A .   9 THR OG1  1 1 
        1   161 1 1  10 ASN C    C   8.516  -9.704  -3.648 1.00 . A A .  10 ASN C    1 1 
        1   162 1 1  10 ASN CA   C   8.581  -8.234  -4.102 1.00 . A A .  10 ASN CA   1 1 
        1   163 1 1  10 ASN CB   C   9.992  -7.906  -4.664 1.00 . A A .  10 ASN CB   1 1 
        1   164 1 1  10 ASN CG   C  10.036  -6.582  -5.434 1.00 . A A .  10 ASN CG   1 1 
        1   165 1 1  10 ASN H    H   8.965  -7.025  -2.394 1.00 . A A .  10 ASN H    1 1 
        1   166 1 1  10 ASN HA   H   7.846  -8.096  -4.891 1.00 . A A .  10 ASN HA   1 1 
        1   167 1 1  10 ASN HB2  H  10.698  -7.856  -3.842 1.00 . A A .  10 ASN HB2  1 1 
        1   168 1 1  10 ASN HB3  H  10.304  -8.698  -5.338 1.00 . A A .  10 ASN HB3  1 1 
        1   169 1 1  10 ASN HD21 H  10.555  -5.580  -3.794 1.00 . A A .  10 ASN HD21 1 1 
        1   170 1 1  10 ASN HD22 H  10.388  -4.637  -5.231 1.00 . A A .  10 ASN HD22 1 1 
        1   171 1 1  10 ASN N    N   8.243  -7.322  -2.987 1.00 . A A .  10 ASN N    1 1 
        1   172 1 1  10 ASN ND2  N  10.358  -5.489  -4.752 1.00 . A A .  10 ASN ND2  1 1 
        1   173 1 1  10 ASN O    O   8.631 -10.615  -4.475 1.00 . A A .  10 ASN O    1 1 
        1   174 1 1  10 ASN OD1  O   9.788  -6.551  -6.640 1.00 . A A .  10 ASN OD1  1 1 
        1   175 1 1  11 ASN C    C   6.862 -11.855  -1.970 1.00 . A A .  11 ASN C    1 1 
        1   176 1 1  11 ASN CA   C   8.268 -11.260  -1.742 1.00 . A A .  11 ASN CA   1 1 
        1   177 1 1  11 ASN CB   C   8.626 -11.200  -0.226 1.00 . A A .  11 ASN CB   1 1 
        1   178 1 1  11 ASN CG   C   8.801 -12.592   0.399 1.00 . A A .  11 ASN CG   1 1 
        1   179 1 1  11 ASN H    H   8.203  -9.144  -1.746 1.00 . A A .  11 ASN H    1 1 
        1   180 1 1  11 ASN HA   H   9.005 -11.884  -2.250 1.00 . A A .  11 ASN HA   1 1 
        1   181 1 1  11 ASN HB2  H   9.552 -10.646  -0.104 1.00 . A A .  11 ASN HB2  1 1 
        1   182 1 1  11 ASN HB3  H   7.840 -10.676   0.311 1.00 . A A .  11 ASN HB3  1 1 
        1   183 1 1  11 ASN HD21 H  10.723 -12.592  -0.069 1.00 . A A .  11 ASN HD21 1 1 
        1   184 1 1  11 ASN HD22 H  10.140 -14.001   0.743 1.00 . A A .  11 ASN HD22 1 1 
        1   185 1 1  11 ASN N    N   8.327  -9.919  -2.334 1.00 . A A .  11 ASN N    1 1 
        1   186 1 1  11 ASN ND2  N  10.007 -13.113   0.356 1.00 . A A .  11 ASN ND2  1 1 
        1   187 1 1  11 ASN O    O   5.921 -11.520  -1.243 1.00 . A A .  11 ASN O    1 1 
        1   188 1 1  11 ASN OD1  O   7.859 -13.199   0.893 1.00 . A A .  11 ASN OD1  1 1 
        1   189 1 1  12 ASP C    C   4.786 -14.066  -2.247 1.00 . A A .  12 ASP C    1 1 
        1   190 1 1  12 ASP CA   C   5.514 -13.415  -3.436 1.00 . A A .  12 ASP CA   1 1 
        1   191 1 1  12 ASP CB   C   5.875 -14.509  -4.495 1.00 . A A .  12 ASP CB   1 1 
        1   192 1 1  12 ASP CG   C   4.811 -15.624  -4.644 1.00 . A A .  12 ASP CG   1 1 
        1   193 1 1  12 ASP H    H   7.543 -12.801  -3.595 1.00 . A A .  12 ASP H    1 1 
        1   194 1 1  12 ASP HA   H   4.852 -12.691  -3.897 1.00 . A A .  12 ASP HA   1 1 
        1   195 1 1  12 ASP HB2  H   5.992 -14.033  -5.452 1.00 . A A .  12 ASP HB2  1 1 
        1   196 1 1  12 ASP HB3  H   6.828 -14.966  -4.230 1.00 . A A .  12 ASP HB3  1 1 
        1   197 1 1  12 ASP N    N   6.749 -12.687  -3.033 1.00 . A A .  12 ASP N    1 1 
        1   198 1 1  12 ASP O    O   3.552 -13.950  -2.107 1.00 . A A .  12 ASP O    1 1 
        1   199 1 1  12 ASP OD1  O   3.731 -15.362  -5.221 1.00 . A A .  12 ASP OD1  1 1 
        1   200 1 1  12 ASP OD2  O   5.033 -16.752  -4.134 1.00 . A A .  12 ASP OD2  1 1 
        1   201 1 1  13 GLU C    C   4.423 -14.619   0.757 1.00 . A A .  13 GLU C    1 1 
        1   202 1 1  13 GLU CA   C   5.040 -15.549  -0.308 1.00 . A A .  13 GLU CA   1 1 
        1   203 1 1  13 GLU CB   C   6.142 -16.457   0.284 1.00 . A A .  13 GLU CB   1 1 
        1   204 1 1  13 GLU CD   C   7.719 -18.459  -0.075 1.00 . A A .  13 GLU CD   1 1 
        1   205 1 1  13 GLU CG   C   6.638 -17.555  -0.690 1.00 . A A .  13 GLU CG   1 1 
        1   206 1 1  13 GLU H    H   6.530 -14.794  -1.598 1.00 . A A .  13 GLU H    1 1 
        1   207 1 1  13 GLU HA   H   4.255 -16.182  -0.710 1.00 . A A .  13 GLU HA   1 1 
        1   208 1 1  13 GLU HB2  H   6.987 -15.838   0.564 1.00 . A A .  13 GLU HB2  1 1 
        1   209 1 1  13 GLU HB3  H   5.760 -16.944   1.176 1.00 . A A .  13 GLU HB3  1 1 
        1   210 1 1  13 GLU HG2  H   5.792 -18.169  -0.988 1.00 . A A .  13 GLU HG2  1 1 
        1   211 1 1  13 GLU HG3  H   7.042 -17.076  -1.578 1.00 . A A .  13 GLU HG3  1 1 
        1   212 1 1  13 GLU N    N   5.566 -14.782  -1.430 1.00 . A A .  13 GLU N    1 1 
        1   213 1 1  13 GLU O    O   3.384 -14.954   1.339 1.00 . A A .  13 GLU O    1 1 
        1   214 1 1  13 GLU OE1  O   7.367 -19.427   0.642 1.00 . A A .  13 GLU OE1  1 1 
        1   215 1 1  13 GLU OE2  O   8.922 -18.203  -0.290 1.00 . A A .  13 GLU OE2  1 1 
        1   216 1 1  14 LEU C    C   3.184 -11.847   1.370 1.00 . A A .  14 LEU C    1 1 
        1   217 1 1  14 LEU CA   C   4.505 -12.422   1.896 1.00 . A A .  14 LEU CA   1 1 
        1   218 1 1  14 LEU CB   C   5.507 -11.263   2.162 1.00 . A A .  14 LEU CB   1 1 
        1   219 1 1  14 LEU CD1  C   4.458 -10.525   4.419 1.00 . A A .  14 LEU CD1  1 1 
        1   220 1 1  14 LEU CD2  C   5.940  -8.915   3.117 1.00 . A A .  14 LEU CD2  1 1 
        1   221 1 1  14 LEU CG   C   4.941 -10.073   3.018 1.00 . A A .  14 LEU CG   1 1 
        1   222 1 1  14 LEU H    H   5.849 -13.220   0.457 1.00 . A A .  14 LEU H    1 1 
        1   223 1 1  14 LEU HA   H   4.311 -12.930   2.843 1.00 . A A .  14 LEU HA   1 1 
        1   224 1 1  14 LEU HB2  H   6.376 -11.673   2.672 1.00 . A A .  14 LEU HB2  1 1 
        1   225 1 1  14 LEU HB3  H   5.837 -10.868   1.202 1.00 . A A .  14 LEU HB3  1 1 
        1   226 1 1  14 LEU HD11 H   3.626 -11.210   4.312 1.00 . A A .  14 LEU HD11 1 1 
        1   227 1 1  14 LEU HD12 H   4.129  -9.664   4.986 1.00 . A A .  14 LEU HD12 1 1 
        1   228 1 1  14 LEU HD13 H   5.259 -11.019   4.952 1.00 . A A .  14 LEU HD13 1 1 
        1   229 1 1  14 LEU HD21 H   6.850  -9.248   3.602 1.00 . A A .  14 LEU HD21 1 1 
        1   230 1 1  14 LEU HD22 H   5.505  -8.107   3.691 1.00 . A A .  14 LEU HD22 1 1 
        1   231 1 1  14 LEU HD23 H   6.177  -8.553   2.125 1.00 . A A .  14 LEU HD23 1 1 
        1   232 1 1  14 LEU HG   H   4.066  -9.685   2.508 1.00 . A A .  14 LEU HG   1 1 
        1   233 1 1  14 LEU N    N   5.033 -13.429   0.961 1.00 . A A .  14 LEU N    1 1 
        1   234 1 1  14 LEU O    O   2.255 -11.677   2.145 1.00 . A A .  14 LEU O    1 1 
        1   235 1 1  15 ILE C    C   0.657 -11.803  -0.257 1.00 . A A .  15 ILE C    1 1 
        1   236 1 1  15 ILE CA   C   1.924 -10.983  -0.608 1.00 . A A .  15 ILE CA   1 1 
        1   237 1 1  15 ILE CB   C   2.102 -10.893  -2.176 1.00 . A A .  15 ILE CB   1 1 
        1   238 1 1  15 ILE CD1  C   3.674  -9.912  -4.015 1.00 . A A .  15 ILE CD1  1 1 
        1   239 1 1  15 ILE CG1  C   3.342 -10.011  -2.535 1.00 . A A .  15 ILE CG1  1 1 
        1   240 1 1  15 ILE CG2  C   0.821 -10.354  -2.866 1.00 . A A .  15 ILE CG2  1 1 
        1   241 1 1  15 ILE H    H   3.907 -11.763  -0.511 1.00 . A A .  15 ILE H    1 1 
        1   242 1 1  15 ILE HA   H   1.806  -9.972  -0.222 1.00 . A A .  15 ILE HA   1 1 
        1   243 1 1  15 ILE HB   H   2.274 -11.903  -2.547 1.00 . A A .  15 ILE HB   1 1 
        1   244 1 1  15 ILE HD11 H   4.560  -9.309  -4.141 1.00 . A A .  15 ILE HD11 1 1 
        1   245 1 1  15 ILE HD12 H   2.849  -9.454  -4.545 1.00 . A A .  15 ILE HD12 1 1 
        1   246 1 1  15 ILE HD13 H   3.854 -10.901  -4.414 1.00 . A A .  15 ILE HD13 1 1 
        1   247 1 1  15 ILE HG12 H   3.178  -9.004  -2.178 1.00 . A A .  15 ILE HG12 1 1 
        1   248 1 1  15 ILE HG13 H   4.214 -10.414  -2.038 1.00 . A A .  15 ILE HG13 1 1 
        1   249 1 1  15 ILE HG21 H   0.596  -9.360  -2.493 1.00 . A A .  15 ILE HG21 1 1 
        1   250 1 1  15 ILE HG22 H  -0.012 -11.008  -2.650 1.00 . A A .  15 ILE HG22 1 1 
        1   251 1 1  15 ILE HG23 H   0.967 -10.309  -3.938 1.00 . A A .  15 ILE HG23 1 1 
        1   252 1 1  15 ILE N    N   3.120 -11.566   0.045 1.00 . A A .  15 ILE N    1 1 
        1   253 1 1  15 ILE O    O  -0.366 -11.235   0.140 1.00 . A A .  15 ILE O    1 1 
        1   254 1 1  16 LYS C    C  -0.594 -14.087   1.533 1.00 . A A .  16 LYS C    1 1 
        1   255 1 1  16 LYS CA   C  -0.294 -14.091   0.014 1.00 . A A .  16 LYS CA   1 1 
        1   256 1 1  16 LYS CB   C   0.044 -15.527  -0.480 1.00 . A A .  16 LYS CB   1 1 
        1   257 1 1  16 LYS CD   C   0.032 -17.197  -2.461 1.00 . A A .  16 LYS CD   1 1 
        1   258 1 1  16 LYS CE   C   1.453 -17.772  -2.341 1.00 . A A .  16 LYS CE   1 1 
        1   259 1 1  16 LYS CG   C  -0.070 -15.712  -2.016 1.00 . A A .  16 LYS CG   1 1 
        1   260 1 1  16 LYS H    H   1.643 -13.508  -0.655 1.00 . A A .  16 LYS H    1 1 
        1   261 1 1  16 LYS HA   H  -1.194 -13.760  -0.503 1.00 . A A .  16 LYS HA   1 1 
        1   262 1 1  16 LYS HB2  H   1.058 -15.772  -0.178 1.00 . A A .  16 LYS HB2  1 1 
        1   263 1 1  16 LYS HB3  H  -0.633 -16.235  -0.005 1.00 . A A .  16 LYS HB3  1 1 
        1   264 1 1  16 LYS HD2  H  -0.636 -17.793  -1.851 1.00 . A A .  16 LYS HD2  1 1 
        1   265 1 1  16 LYS HD3  H  -0.286 -17.273  -3.498 1.00 . A A .  16 LYS HD3  1 1 
        1   266 1 1  16 LYS HE2  H   1.838 -17.577  -1.350 1.00 . A A .  16 LYS HE2  1 1 
        1   267 1 1  16 LYS HE3  H   1.418 -18.841  -2.503 1.00 . A A .  16 LYS HE3  1 1 
        1   268 1 1  16 LYS HG2  H  -1.028 -15.319  -2.339 1.00 . A A .  16 LYS HG2  1 1 
        1   269 1 1  16 LYS HG3  H   0.718 -15.146  -2.497 1.00 . A A .  16 LYS HG3  1 1 
        1   270 1 1  16 LYS HZ1  H   3.326 -17.584  -3.242 1.00 . A A .  16 LYS HZ1  1 1 
        1   271 1 1  16 LYS HZ2  H   2.432 -16.149  -3.224 1.00 . A A .  16 LYS HZ2  1 1 
        1   272 1 1  16 LYS HZ3  H   2.028 -17.383  -4.302 1.00 . A A .  16 LYS HZ3  1 1 
        1   273 1 1  16 LYS N    N   0.786 -13.144  -0.342 1.00 . A A .  16 LYS N    1 1 
        1   274 1 1  16 LYS NZ   N   2.373 -17.179  -3.341 1.00 . A A .  16 LYS NZ   1 1 
        1   275 1 1  16 LYS O    O  -1.763 -14.177   1.926 1.00 . A A .  16 LYS O    1 1 
        1   276 1 1  17 LYS C    C  -0.478 -12.641   4.273 1.00 . A A .  17 LYS C    1 1 
        1   277 1 1  17 LYS CA   C   0.308 -13.902   3.855 1.00 . A A .  17 LYS CA   1 1 
        1   278 1 1  17 LYS CB   C   1.692 -13.924   4.560 1.00 . A A .  17 LYS CB   1 1 
        1   279 1 1  17 LYS CD   C   3.838 -15.228   5.141 1.00 . A A .  17 LYS CD   1 1 
        1   280 1 1  17 LYS CE   C   3.698 -15.006   6.656 1.00 . A A .  17 LYS CE   1 1 
        1   281 1 1  17 LYS CG   C   2.466 -15.256   4.419 1.00 . A A .  17 LYS CG   1 1 
        1   282 1 1  17 LYS H    H   1.358 -13.916   1.992 1.00 . A A .  17 LYS H    1 1 
        1   283 1 1  17 LYS HA   H  -0.257 -14.779   4.165 1.00 . A A .  17 LYS HA   1 1 
        1   284 1 1  17 LYS HB2  H   2.304 -13.128   4.145 1.00 . A A .  17 LYS HB2  1 1 
        1   285 1 1  17 LYS HB3  H   1.551 -13.727   5.619 1.00 . A A .  17 LYS HB3  1 1 
        1   286 1 1  17 LYS HD2  H   4.348 -16.170   4.972 1.00 . A A .  17 LYS HD2  1 1 
        1   287 1 1  17 LYS HD3  H   4.436 -14.425   4.722 1.00 . A A .  17 LYS HD3  1 1 
        1   288 1 1  17 LYS HE2  H   3.179 -14.072   6.830 1.00 . A A .  17 LYS HE2  1 1 
        1   289 1 1  17 LYS HE3  H   3.116 -15.813   7.080 1.00 . A A .  17 LYS HE3  1 1 
        1   290 1 1  17 LYS HG2  H   1.865 -16.060   4.836 1.00 . A A .  17 LYS HG2  1 1 
        1   291 1 1  17 LYS HG3  H   2.626 -15.452   3.364 1.00 . A A .  17 LYS HG3  1 1 
        1   292 1 1  17 LYS HZ1  H   5.652 -14.305   6.852 1.00 . A A .  17 LYS HZ1  1 1 
        1   293 1 1  17 LYS HZ2  H   5.443 -15.900   7.363 1.00 . A A .  17 LYS HZ2  1 1 
        1   294 1 1  17 LYS HZ3  H   4.891 -14.625   8.327 1.00 . A A .  17 LYS HZ3  1 1 
        1   295 1 1  17 LYS N    N   0.458 -13.969   2.374 1.00 . A A .  17 LYS N    1 1 
        1   296 1 1  17 LYS NZ   N   5.011 -14.954   7.347 1.00 . A A .  17 LYS NZ   1 1 
        1   297 1 1  17 LYS O    O  -1.309 -12.686   5.204 1.00 . A A .  17 LYS O    1 1 
        1   298 1 1  18 ILE C    C  -2.378 -10.435   3.431 1.00 . A A .  18 ILE C    1 1 
        1   299 1 1  18 ILE CA   C  -0.895 -10.251   3.761 1.00 . A A .  18 ILE CA   1 1 
        1   300 1 1  18 ILE CB   C  -0.272  -9.093   2.884 1.00 . A A .  18 ILE CB   1 1 
        1   301 1 1  18 ILE CD1  C   1.971  -7.936   2.332 1.00 . A A .  18 ILE CD1  1 1 
        1   302 1 1  18 ILE CG1  C   1.232  -8.894   3.237 1.00 . A A .  18 ILE CG1  1 1 
        1   303 1 1  18 ILE CG2  C  -1.051  -7.762   3.056 1.00 . A A .  18 ILE CG2  1 1 
        1   304 1 1  18 ILE H    H   0.453 -11.588   2.845 1.00 . A A .  18 ILE H    1 1 
        1   305 1 1  18 ILE HA   H  -0.791  -9.982   4.815 1.00 . A A .  18 ILE HA   1 1 
        1   306 1 1  18 ILE HB   H  -0.348  -9.388   1.837 1.00 . A A .  18 ILE HB   1 1 
        1   307 1 1  18 ILE HD11 H   1.948  -8.306   1.318 1.00 . A A .  18 ILE HD11 1 1 
        1   308 1 1  18 ILE HD12 H   2.999  -7.855   2.659 1.00 . A A .  18 ILE HD12 1 1 
        1   309 1 1  18 ILE HD13 H   1.506  -6.961   2.373 1.00 . A A .  18 ILE HD13 1 1 
        1   310 1 1  18 ILE HG12 H   1.318  -8.514   4.245 1.00 . A A .  18 ILE HG12 1 1 
        1   311 1 1  18 ILE HG13 H   1.743  -9.847   3.181 1.00 . A A .  18 ILE HG13 1 1 
        1   312 1 1  18 ILE HG21 H  -2.083  -7.897   2.753 1.00 . A A .  18 ILE HG21 1 1 
        1   313 1 1  18 ILE HG22 H  -0.603  -6.989   2.446 1.00 . A A .  18 ILE HG22 1 1 
        1   314 1 1  18 ILE HG23 H  -1.024  -7.457   4.095 1.00 . A A .  18 ILE HG23 1 1 
        1   315 1 1  18 ILE N    N  -0.212 -11.529   3.553 1.00 . A A .  18 ILE N    1 1 
        1   316 1 1  18 ILE O    O  -3.219 -10.130   4.264 1.00 . A A .  18 ILE O    1 1 
        1   317 1 1  19 LYS C    C  -4.870 -12.033   2.820 1.00 . A A .  19 LYS C    1 1 
        1   318 1 1  19 LYS CA   C  -4.048 -11.278   1.768 1.00 . A A .  19 LYS CA   1 1 
        1   319 1 1  19 LYS CB   C  -4.069 -12.073   0.436 1.00 . A A .  19 LYS CB   1 1 
        1   320 1 1  19 LYS CD   C  -3.515 -12.137  -2.056 1.00 . A A .  19 LYS CD   1 1 
        1   321 1 1  19 LYS CE   C  -2.781 -11.444  -3.205 1.00 . A A .  19 LYS CE   1 1 
        1   322 1 1  19 LYS CG   C  -3.381 -11.360  -0.732 1.00 . A A .  19 LYS CG   1 1 
        1   323 1 1  19 LYS H    H  -1.918 -11.311   1.667 1.00 . A A .  19 LYS H    1 1 
        1   324 1 1  19 LYS HA   H  -4.504 -10.306   1.600 1.00 . A A .  19 LYS HA   1 1 
        1   325 1 1  19 LYS HB2  H  -3.578 -13.030   0.588 1.00 . A A .  19 LYS HB2  1 1 
        1   326 1 1  19 LYS HB3  H  -5.102 -12.258   0.154 1.00 . A A .  19 LYS HB3  1 1 
        1   327 1 1  19 LYS HD2  H  -3.100 -13.131  -1.928 1.00 . A A .  19 LYS HD2  1 1 
        1   328 1 1  19 LYS HD3  H  -4.566 -12.221  -2.311 1.00 . A A .  19 LYS HD3  1 1 
        1   329 1 1  19 LYS HE2  H  -3.107 -10.413  -3.268 1.00 . A A .  19 LYS HE2  1 1 
        1   330 1 1  19 LYS HE3  H  -1.720 -11.466  -3.006 1.00 . A A .  19 LYS HE3  1 1 
        1   331 1 1  19 LYS HG2  H  -3.827 -10.378  -0.855 1.00 . A A .  19 LYS HG2  1 1 
        1   332 1 1  19 LYS HG3  H  -2.331 -11.240  -0.499 1.00 . A A .  19 LYS HG3  1 1 
        1   333 1 1  19 LYS HZ1  H  -2.644 -13.063  -4.519 1.00 . A A .  19 LYS HZ1  1 1 
        1   334 1 1  19 LYS HZ2  H  -2.572 -11.550  -5.273 1.00 . A A .  19 LYS HZ2  1 1 
        1   335 1 1  19 LYS HZ3  H  -4.051 -12.143  -4.707 1.00 . A A .  19 LYS HZ3  1 1 
        1   336 1 1  19 LYS N    N  -2.665 -11.030   2.240 1.00 . A A .  19 LYS N    1 1 
        1   337 1 1  19 LYS NZ   N  -3.031 -12.096  -4.515 1.00 . A A .  19 LYS NZ   1 1 
        1   338 1 1  19 LYS O    O  -6.012 -11.671   3.075 1.00 . A A .  19 LYS O    1 1 
        1   339 1 1  20 LYS C    C  -5.266 -12.901   5.696 1.00 . A A .  20 LYS C    1 1 
        1   340 1 1  20 LYS CA   C  -4.863 -13.830   4.542 1.00 . A A .  20 LYS CA   1 1 
        1   341 1 1  20 LYS CB   C  -3.894 -14.930   5.060 1.00 . A A .  20 LYS CB   1 1 
        1   342 1 1  20 LYS CD   C  -4.754 -16.854   3.560 1.00 . A A .  20 LYS CD   1 1 
        1   343 1 1  20 LYS CE   C  -5.431 -17.627   4.703 1.00 . A A .  20 LYS CE   1 1 
        1   344 1 1  20 LYS CG   C  -3.539 -16.022   4.031 1.00 . A A .  20 LYS CG   1 1 
        1   345 1 1  20 LYS H    H  -3.334 -13.287   3.169 1.00 . A A .  20 LYS H    1 1 
        1   346 1 1  20 LYS HA   H  -5.762 -14.306   4.144 1.00 . A A .  20 LYS HA   1 1 
        1   347 1 1  20 LYS HB2  H  -2.970 -14.454   5.372 1.00 . A A .  20 LYS HB2  1 1 
        1   348 1 1  20 LYS HB3  H  -4.334 -15.414   5.928 1.00 . A A .  20 LYS HB3  1 1 
        1   349 1 1  20 LYS HD2  H  -5.481 -16.194   3.099 1.00 . A A .  20 LYS HD2  1 1 
        1   350 1 1  20 LYS HD3  H  -4.411 -17.567   2.817 1.00 . A A .  20 LYS HD3  1 1 
        1   351 1 1  20 LYS HE2  H  -4.709 -18.294   5.156 1.00 . A A .  20 LYS HE2  1 1 
        1   352 1 1  20 LYS HE3  H  -5.784 -16.923   5.448 1.00 . A A .  20 LYS HE3  1 1 
        1   353 1 1  20 LYS HG2  H  -3.094 -15.547   3.168 1.00 . A A .  20 LYS HG2  1 1 
        1   354 1 1  20 LYS HG3  H  -2.810 -16.695   4.471 1.00 . A A .  20 LYS HG3  1 1 
        1   355 1 1  20 LYS HZ1  H  -6.994 -18.987   4.991 1.00 . A A .  20 LYS HZ1  1 1 
        1   356 1 1  20 LYS HZ2  H  -6.278 -19.072   3.460 1.00 . A A .  20 LYS HZ2  1 1 
        1   357 1 1  20 LYS HZ3  H  -7.319 -17.798   3.839 1.00 . A A .  20 LYS HZ3  1 1 
        1   358 1 1  20 LYS N    N  -4.244 -13.055   3.448 1.00 . A A .  20 LYS N    1 1 
        1   359 1 1  20 LYS NZ   N  -6.584 -18.425   4.215 1.00 . A A .  20 LYS NZ   1 1 
        1   360 1 1  20 LYS O    O  -6.424 -12.922   6.126 1.00 . A A .  20 LYS O    1 1 
        1   361 1 1  21 GLU C    C  -5.685 -10.115   6.892 1.00 . A A .  21 GLU C    1 1 
        1   362 1 1  21 GLU CA   C  -4.532 -11.074   7.230 1.00 . A A .  21 GLU CA   1 1 
        1   363 1 1  21 GLU CB   C  -3.236 -10.265   7.522 1.00 . A A .  21 GLU CB   1 1 
        1   364 1 1  21 GLU CD   C  -2.376 -11.872   9.327 1.00 . A A .  21 GLU CD   1 1 
        1   365 1 1  21 GLU CG   C  -2.054 -11.109   8.027 1.00 . A A .  21 GLU CG   1 1 
        1   366 1 1  21 GLU H    H  -3.405 -12.119   5.749 1.00 . A A .  21 GLU H    1 1 
        1   367 1 1  21 GLU HA   H  -4.799 -11.631   8.122 1.00 . A A .  21 GLU HA   1 1 
        1   368 1 1  21 GLU HB2  H  -2.927  -9.761   6.611 1.00 . A A .  21 GLU HB2  1 1 
        1   369 1 1  21 GLU HB3  H  -3.453  -9.511   8.272 1.00 . A A .  21 GLU HB3  1 1 
        1   370 1 1  21 GLU HG2  H  -1.786 -11.819   7.250 1.00 . A A .  21 GLU HG2  1 1 
        1   371 1 1  21 GLU HG3  H  -1.204 -10.457   8.205 1.00 . A A .  21 GLU HG3  1 1 
        1   372 1 1  21 GLU N    N  -4.305 -12.063   6.150 1.00 . A A .  21 GLU N    1 1 
        1   373 1 1  21 GLU O    O  -6.546  -9.863   7.725 1.00 . A A .  21 GLU O    1 1 
        1   374 1 1  21 GLU OE1  O  -2.391 -11.241  10.406 1.00 . A A .  21 GLU OE1  1 1 
        1   375 1 1  21 GLU OE2  O  -2.624 -13.104   9.277 1.00 . A A .  21 GLU OE2  1 1 
        1   376 1 1  22 VAL C    C  -8.088  -9.246   5.070 1.00 . A A .  22 VAL C    1 1 
        1   377 1 1  22 VAL CA   C  -6.668  -8.639   5.156 1.00 . A A .  22 VAL CA   1 1 
        1   378 1 1  22 VAL CB   C  -6.186  -8.094   3.760 1.00 . A A .  22 VAL CB   1 1 
        1   379 1 1  22 VAL CG1  C  -7.122  -7.023   3.177 1.00 . A A .  22 VAL CG1  1 1 
        1   380 1 1  22 VAL CG2  C  -4.753  -7.544   3.861 1.00 . A A .  22 VAL CG2  1 1 
        1   381 1 1  22 VAL H    H  -5.048  -9.994   5.010 1.00 . A A .  22 VAL H    1 1 
        1   382 1 1  22 VAL HA   H  -6.686  -7.812   5.865 1.00 . A A .  22 VAL HA   1 1 
        1   383 1 1  22 VAL HB   H  -6.166  -8.930   3.064 1.00 . A A .  22 VAL HB   1 1 
        1   384 1 1  22 VAL HG11 H  -7.130  -6.153   3.819 1.00 . A A .  22 VAL HG11 1 1 
        1   385 1 1  22 VAL HG12 H  -8.128  -7.416   3.097 1.00 . A A .  22 VAL HG12 1 1 
        1   386 1 1  22 VAL HG13 H  -6.778  -6.733   2.191 1.00 . A A .  22 VAL HG13 1 1 
        1   387 1 1  22 VAL HG21 H  -4.092  -8.308   4.238 1.00 . A A .  22 VAL HG21 1 1 
        1   388 1 1  22 VAL HG22 H  -4.727  -6.694   4.532 1.00 . A A .  22 VAL HG22 1 1 
        1   389 1 1  22 VAL HG23 H  -4.406  -7.234   2.883 1.00 . A A .  22 VAL HG23 1 1 
        1   390 1 1  22 VAL N    N  -5.703  -9.642   5.644 1.00 . A A .  22 VAL N    1 1 
        1   391 1 1  22 VAL O    O  -9.083  -8.560   5.327 1.00 . A A .  22 VAL O    1 1 
        1   392 1 1  23 GLU C    C  -9.900 -11.596   6.179 1.00 . A A .  23 GLU C    1 1 
        1   393 1 1  23 GLU CA   C  -9.417 -11.318   4.740 1.00 . A A .  23 GLU CA   1 1 
        1   394 1 1  23 GLU CB   C  -9.253 -12.641   3.934 1.00 . A A .  23 GLU CB   1 1 
        1   395 1 1  23 GLU CD   C -10.014 -11.625   1.669 1.00 . A A .  23 GLU CD   1 1 
        1   396 1 1  23 GLU CG   C  -8.954 -12.452   2.424 1.00 . A A .  23 GLU CG   1 1 
        1   397 1 1  23 GLU H    H  -7.328 -11.017   4.505 1.00 . A A .  23 GLU H    1 1 
        1   398 1 1  23 GLU HA   H -10.166 -10.702   4.245 1.00 . A A .  23 GLU HA   1 1 
        1   399 1 1  23 GLU HB2  H  -8.440 -13.209   4.372 1.00 . A A .  23 GLU HB2  1 1 
        1   400 1 1  23 GLU HB3  H -10.159 -13.228   4.023 1.00 . A A .  23 GLU HB3  1 1 
        1   401 1 1  23 GLU HG2  H  -7.994 -11.960   2.322 1.00 . A A .  23 GLU HG2  1 1 
        1   402 1 1  23 GLU HG3  H  -8.883 -13.433   1.963 1.00 . A A .  23 GLU HG3  1 1 
        1   403 1 1  23 GLU N    N  -8.156 -10.552   4.747 1.00 . A A .  23 GLU N    1 1 
        1   404 1 1  23 GLU O    O -11.108 -11.675   6.425 1.00 . A A .  23 GLU O    1 1 
        1   405 1 1  23 GLU OE1  O -11.004 -12.211   1.172 1.00 . A A .  23 GLU OE1  1 1 
        1   406 1 1  23 GLU OE2  O  -9.867 -10.386   1.564 1.00 . A A .  23 GLU OE2  1 1 
        1   407 1 1  24 ASN C    C  -9.867 -10.637   9.157 1.00 . A A .  24 ASN C    1 1 
        1   408 1 1  24 ASN CA   C  -9.244 -11.910   8.569 1.00 . A A .  24 ASN CA   1 1 
        1   409 1 1  24 ASN CB   C  -7.960 -12.282   9.378 1.00 . A A .  24 ASN CB   1 1 
        1   410 1 1  24 ASN CG   C  -7.314 -13.593   8.925 1.00 . A A .  24 ASN CG   1 1 
        1   411 1 1  24 ASN H    H  -8.003 -11.657   6.853 1.00 . A A .  24 ASN H    1 1 
        1   412 1 1  24 ASN HA   H  -9.962 -12.723   8.651 1.00 . A A .  24 ASN HA   1 1 
        1   413 1 1  24 ASN HB2  H  -7.231 -11.486   9.277 1.00 . A A .  24 ASN HB2  1 1 
        1   414 1 1  24 ASN HB3  H  -8.216 -12.384  10.431 1.00 . A A .  24 ASN HB3  1 1 
        1   415 1 1  24 ASN HD21 H  -5.502 -12.949   9.443 1.00 . A A .  24 ASN HD21 1 1 
        1   416 1 1  24 ASN HD22 H  -5.571 -14.528   8.749 1.00 . A A .  24 ASN HD22 1 1 
        1   417 1 1  24 ASN N    N  -8.943 -11.715   7.127 1.00 . A A .  24 ASN N    1 1 
        1   418 1 1  24 ASN ND2  N  -5.995 -13.700   9.055 1.00 . A A .  24 ASN ND2  1 1 
        1   419 1 1  24 ASN O    O -10.737 -10.705  10.027 1.00 . A A .  24 ASN O    1 1 
        1   420 1 1  24 ASN OD1  O  -7.991 -14.500   8.445 1.00 . A A .  24 ASN OD1  1 1 
        1   421 1 1  25 GLN C    C -11.133  -7.716   8.399 1.00 . A A .  25 GLN C    1 1 
        1   422 1 1  25 GLN CA   C  -9.859  -8.155   9.138 1.00 . A A .  25 GLN CA   1 1 
        1   423 1 1  25 GLN CB   C  -8.732  -7.100   8.961 1.00 . A A .  25 GLN CB   1 1 
        1   424 1 1  25 GLN CD   C  -7.399  -7.943  11.032 1.00 . A A .  25 GLN CD   1 1 
        1   425 1 1  25 GLN CG   C  -7.361  -7.510   9.562 1.00 . A A .  25 GLN CG   1 1 
        1   426 1 1  25 GLN H    H  -8.734  -9.506   7.945 1.00 . A A .  25 GLN H    1 1 
        1   427 1 1  25 GLN HA   H -10.089  -8.242  10.201 1.00 . A A .  25 GLN HA   1 1 
        1   428 1 1  25 GLN HB2  H  -8.590  -6.908   7.900 1.00 . A A .  25 GLN HB2  1 1 
        1   429 1 1  25 GLN HB3  H  -9.041  -6.174   9.435 1.00 . A A .  25 GLN HB3  1 1 
        1   430 1 1  25 GLN HE21 H  -5.801  -9.099  10.775 1.00 . A A .  25 GLN HE21 1 1 
        1   431 1 1  25 GLN HE22 H  -6.485  -9.095  12.361 1.00 . A A .  25 GLN HE22 1 1 
        1   432 1 1  25 GLN HG2  H  -6.976  -8.335   8.984 1.00 . A A .  25 GLN HG2  1 1 
        1   433 1 1  25 GLN HG3  H  -6.678  -6.679   9.469 1.00 . A A .  25 GLN HG3  1 1 
        1   434 1 1  25 GLN N    N  -9.402  -9.475   8.663 1.00 . A A .  25 GLN N    1 1 
        1   435 1 1  25 GLN NE2  N  -6.463  -8.791  11.431 1.00 . A A .  25 GLN NE2  1 1 
        1   436 1 1  25 GLN O    O -11.930  -6.938   8.931 1.00 . A A .  25 GLN O    1 1 
        1   437 1 1  25 GLN OE1  O  -8.236  -7.491  11.807 1.00 . A A .  25 GLN OE1  1 1 
        1   438 1 1  26 GLY C    C -12.254  -6.844   5.314 1.00 . A A .  26 GLY C    1 1 
        1   439 1 1  26 GLY CA   C -12.476  -7.945   6.344 1.00 . A A .  26 GLY CA   1 1 
        1   440 1 1  26 GLY H    H -10.600  -8.810   6.803 1.00 . A A .  26 GLY H    1 1 
        1   441 1 1  26 GLY HA2  H -12.740  -8.852   5.819 1.00 . A A .  26 GLY HA2  1 1 
        1   442 1 1  26 GLY HA3  H -13.308  -7.667   6.983 1.00 . A A .  26 GLY HA3  1 1 
        1   443 1 1  26 GLY N    N -11.300  -8.226   7.166 1.00 . A A .  26 GLY N    1 1 
        1   444 1 1  26 GLY O    O -13.208  -6.422   4.658 1.00 . A A .  26 GLY O    1 1 
        1   445 1 1  27 TYR C    C -10.581  -5.965   2.741 1.00 . A A .  27 TYR C    1 1 
        1   446 1 1  27 TYR CA   C -10.627  -5.357   4.155 1.00 . A A .  27 TYR CA   1 1 
        1   447 1 1  27 TYR CB   C  -9.278  -4.665   4.514 1.00 . A A .  27 TYR CB   1 1 
        1   448 1 1  27 TYR CD1  C -10.071  -4.002   6.866 1.00 . A A .  27 TYR CD1  1 1 
        1   449 1 1  27 TYR CD2  C  -8.523  -2.557   5.752 1.00 . A A .  27 TYR CD2  1 1 
        1   450 1 1  27 TYR CE1  C -10.073  -3.159   7.956 1.00 . A A .  27 TYR CE1  1 1 
        1   451 1 1  27 TYR CE2  C  -8.524  -1.714   6.848 1.00 . A A .  27 TYR CE2  1 1 
        1   452 1 1  27 TYR CG   C  -9.297  -3.725   5.733 1.00 . A A .  27 TYR CG   1 1 
        1   453 1 1  27 TYR CZ   C  -9.301  -2.023   7.945 1.00 . A A .  27 TYR CZ   1 1 
        1   454 1 1  27 TYR H    H -10.281  -6.776   5.703 1.00 . A A .  27 TYR H    1 1 
        1   455 1 1  27 TYR HA   H -11.406  -4.607   4.169 1.00 . A A .  27 TYR HA   1 1 
        1   456 1 1  27 TYR HB2  H  -8.542  -5.429   4.722 1.00 . A A .  27 TYR HB2  1 1 
        1   457 1 1  27 TYR HB3  H  -8.941  -4.091   3.654 1.00 . A A .  27 TYR HB3  1 1 
        1   458 1 1  27 TYR HD1  H -10.682  -4.897   6.880 1.00 . A A .  27 TYR HD1  1 1 
        1   459 1 1  27 TYR HD2  H  -7.912  -2.312   4.891 1.00 . A A .  27 TYR HD2  1 1 
        1   460 1 1  27 TYR HE1  H -10.681  -3.397   8.821 1.00 . A A .  27 TYR HE1  1 1 
        1   461 1 1  27 TYR HE2  H  -7.918  -0.818   6.841 1.00 . A A .  27 TYR HE2  1 1 
        1   462 1 1  27 TYR HH   H  -9.323  -1.714   9.848 1.00 . A A .  27 TYR HH   1 1 
        1   463 1 1  27 TYR N    N -10.991  -6.392   5.150 1.00 . A A .  27 TYR N    1 1 
        1   464 1 1  27 TYR O    O -10.504  -7.190   2.578 1.00 . A A .  27 TYR O    1 1 
        1   465 1 1  27 TYR OH   O  -9.308  -1.186   9.041 1.00 . A A .  27 TYR OH   1 1 
        1   466 1 1  28 GLN C    C  -9.321  -5.581  -0.317 1.00 . A A .  28 GLN C    1 1 
        1   467 1 1  28 GLN CA   C -10.729  -5.507   0.316 1.00 . A A .  28 GLN CA   1 1 
        1   468 1 1  28 GLN CB   C -11.604  -4.479  -0.459 1.00 . A A .  28 GLN CB   1 1 
        1   469 1 1  28 GLN CD   C -13.938  -5.207   0.394 1.00 . A A .  28 GLN CD   1 1 
        1   470 1 1  28 GLN CG   C -12.929  -4.067   0.223 1.00 . A A .  28 GLN CG   1 1 
        1   471 1 1  28 GLN H    H -10.572  -4.133   1.920 1.00 . A A .  28 GLN H    1 1 
        1   472 1 1  28 GLN HA   H -11.203  -6.485   0.268 1.00 . A A .  28 GLN HA   1 1 
        1   473 1 1  28 GLN HB2  H -11.020  -3.582  -0.603 1.00 . A A .  28 GLN HB2  1 1 
        1   474 1 1  28 GLN HB3  H -11.841  -4.888  -1.437 1.00 . A A .  28 GLN HB3  1 1 
        1   475 1 1  28 GLN HE21 H -13.273  -5.591   2.231 1.00 . A A .  28 GLN HE21 1 1 
        1   476 1 1  28 GLN HE22 H -14.561  -6.588   1.665 1.00 . A A .  28 GLN HE22 1 1 
        1   477 1 1  28 GLN HG2  H -12.697  -3.664   1.198 1.00 . A A .  28 GLN HG2  1 1 
        1   478 1 1  28 GLN HG3  H -13.395  -3.285  -0.370 1.00 . A A .  28 GLN HG3  1 1 
        1   479 1 1  28 GLN N    N -10.626  -5.094   1.725 1.00 . A A .  28 GLN N    1 1 
        1   480 1 1  28 GLN NE2  N -13.922  -5.863   1.546 1.00 . A A .  28 GLN NE2  1 1 
        1   481 1 1  28 GLN O    O  -8.670  -4.543  -0.469 1.00 . A A .  28 GLN O    1 1 
        1   482 1 1  28 GLN OE1  O -14.748  -5.470  -0.494 1.00 . A A .  28 GLN OE1  1 1 
        1   483 1 1  29 VAL C    C  -7.700  -6.678  -2.863 1.00 . A A .  29 VAL C    1 1 
        1   484 1 1  29 VAL CA   C  -7.551  -6.988  -1.362 1.00 . A A .  29 VAL CA   1 1 
        1   485 1 1  29 VAL CB   C  -6.991  -8.464  -1.233 1.00 . A A .  29 VAL CB   1 1 
        1   486 1 1  29 VAL CG1  C  -5.565  -8.577  -1.841 1.00 . A A .  29 VAL CG1  1 1 
        1   487 1 1  29 VAL CG2  C  -7.013  -8.952   0.228 1.00 . A A .  29 VAL CG2  1 1 
        1   488 1 1  29 VAL H    H  -9.396  -7.583  -0.462 1.00 . A A .  29 VAL H    1 1 
        1   489 1 1  29 VAL HA   H  -6.826  -6.302  -0.920 1.00 . A A .  29 VAL HA   1 1 
        1   490 1 1  29 VAL HB   H  -7.644  -9.126  -1.806 1.00 . A A .  29 VAL HB   1 1 
        1   491 1 1  29 VAL HG11 H  -5.583  -8.270  -2.880 1.00 . A A .  29 VAL HG11 1 1 
        1   492 1 1  29 VAL HG12 H  -5.220  -9.601  -1.783 1.00 . A A .  29 VAL HG12 1 1 
        1   493 1 1  29 VAL HG13 H  -4.881  -7.941  -1.292 1.00 . A A .  29 VAL HG13 1 1 
        1   494 1 1  29 VAL HG21 H  -6.370  -8.322   0.832 1.00 . A A .  29 VAL HG21 1 1 
        1   495 1 1  29 VAL HG22 H  -6.665  -9.977   0.288 1.00 . A A .  29 VAL HG22 1 1 
        1   496 1 1  29 VAL HG23 H  -8.023  -8.898   0.616 1.00 . A A .  29 VAL HG23 1 1 
        1   497 1 1  29 VAL N    N  -8.855  -6.795  -0.674 1.00 . A A .  29 VAL N    1 1 
        1   498 1 1  29 VAL O    O  -8.569  -7.258  -3.521 1.00 . A A .  29 VAL O    1 1 
        1   499 1 1  30 ARG C    C  -5.224  -5.494  -5.179 1.00 . A A .  30 ARG C    1 1 
        1   500 1 1  30 ARG CA   C  -6.725  -5.542  -4.847 1.00 . A A .  30 ARG CA   1 1 
        1   501 1 1  30 ARG CB   C  -7.431  -4.241  -5.349 1.00 . A A .  30 ARG CB   1 1 
        1   502 1 1  30 ARG CD   C  -9.645  -3.916  -4.018 1.00 . A A .  30 ARG CD   1 1 
        1   503 1 1  30 ARG CG   C  -8.991  -4.271  -5.365 1.00 . A A .  30 ARG CG   1 1 
        1   504 1 1  30 ARG CZ   C -11.769  -2.782  -4.762 1.00 . A A .  30 ARG CZ   1 1 
        1   505 1 1  30 ARG H    H  -6.349  -5.192  -2.783 1.00 . A A .  30 ARG H    1 1 
        1   506 1 1  30 ARG HA   H  -7.165  -6.400  -5.363 1.00 . A A .  30 ARG HA   1 1 
        1   507 1 1  30 ARG HB2  H  -7.115  -3.412  -4.725 1.00 . A A .  30 ARG HB2  1 1 
        1   508 1 1  30 ARG HB3  H  -7.094  -4.041  -6.366 1.00 . A A .  30 ARG HB3  1 1 
        1   509 1 1  30 ARG HD2  H  -9.430  -4.701  -3.303 1.00 . A A .  30 ARG HD2  1 1 
        1   510 1 1  30 ARG HD3  H  -9.223  -2.987  -3.654 1.00 . A A .  30 ARG HD3  1 1 
        1   511 1 1  30 ARG HE   H -11.654  -4.454  -3.656 1.00 . A A .  30 ARG HE   1 1 
        1   512 1 1  30 ARG HG2  H  -9.343  -3.562  -6.106 1.00 . A A .  30 ARG HG2  1 1 
        1   513 1 1  30 ARG HG3  H  -9.318  -5.264  -5.661 1.00 . A A .  30 ARG HG3  1 1 
        1   514 1 1  30 ARG HH11 H -10.116  -1.811  -5.436 1.00 . A A .  30 ARG HH11 1 1 
        1   515 1 1  30 ARG HH12 H -11.632  -1.100  -5.890 1.00 . A A .  30 ARG HH12 1 1 
        1   516 1 1  30 ARG HH21 H -13.594  -3.480  -4.235 1.00 . A A .  30 ARG HH21 1 1 
        1   517 1 1  30 ARG HH22 H -13.597  -2.039  -5.213 1.00 . A A .  30 ARG HH22 1 1 
        1   518 1 1  30 ARG N    N  -6.880  -5.754  -3.391 1.00 . A A .  30 ARG N    1 1 
        1   519 1 1  30 ARG NE   N -11.114  -3.769  -4.108 1.00 . A A .  30 ARG NE   1 1 
        1   520 1 1  30 ARG NH1  N -11.120  -1.818  -5.412 1.00 . A A .  30 ARG NH1  1 1 
        1   521 1 1  30 ARG NH2  N -13.089  -2.764  -4.733 1.00 . A A .  30 ARG NH2  1 1 
        1   522 1 1  30 ARG O    O  -4.465  -4.758  -4.533 1.00 . A A .  30 ARG O    1 1 
        1   523 1 1  31 ASP C    C  -3.232  -5.415  -7.838 1.00 . A A .  31 ASP C    1 1 
        1   524 1 1  31 ASP CA   C  -3.419  -6.372  -6.654 1.00 . A A .  31 ASP CA   1 1 
        1   525 1 1  31 ASP CB   C  -3.070  -7.823  -7.106 1.00 . A A .  31 ASP CB   1 1 
        1   526 1 1  31 ASP CG   C  -3.081  -8.848  -5.960 1.00 . A A .  31 ASP CG   1 1 
        1   527 1 1  31 ASP H    H  -5.472  -6.884  -6.591 1.00 . A A .  31 ASP H    1 1 
        1   528 1 1  31 ASP HA   H  -2.753  -6.079  -5.844 1.00 . A A .  31 ASP HA   1 1 
        1   529 1 1  31 ASP HB2  H  -3.796  -8.139  -7.848 1.00 . A A .  31 ASP HB2  1 1 
        1   530 1 1  31 ASP HB3  H  -2.090  -7.829  -7.573 1.00 . A A .  31 ASP HB3  1 1 
        1   531 1 1  31 ASP N    N  -4.810  -6.302  -6.168 1.00 . A A .  31 ASP N    1 1 
        1   532 1 1  31 ASP O    O  -4.088  -5.344  -8.732 1.00 . A A .  31 ASP O    1 1 
        1   533 1 1  31 ASP OD1  O  -4.179  -9.165  -5.443 1.00 . A A .  31 ASP OD1  1 1 
        1   534 1 1  31 ASP OD2  O  -2.003  -9.379  -5.599 1.00 . A A .  31 ASP OD2  1 1 
        1   535 1 1  32 VAL C    C  -0.234  -4.220  -9.292 1.00 . A A .  32 VAL C    1 1 
        1   536 1 1  32 VAL CA   C  -1.684  -3.833  -8.949 1.00 . A A .  32 VAL CA   1 1 
        1   537 1 1  32 VAL CB   C  -1.774  -2.291  -8.604 1.00 . A A .  32 VAL CB   1 1 
        1   538 1 1  32 VAL CG1  C  -1.205  -1.434  -9.759 1.00 . A A .  32 VAL CG1  1 1 
        1   539 1 1  32 VAL CG2  C  -3.230  -1.869  -8.267 1.00 . A A .  32 VAL CG2  1 1 
        1   540 1 1  32 VAL H    H  -1.553  -4.708  -7.032 1.00 . A A .  32 VAL H    1 1 
        1   541 1 1  32 VAL HA   H  -2.323  -4.031  -9.814 1.00 . A A .  32 VAL HA   1 1 
        1   542 1 1  32 VAL HB   H  -1.161  -2.106  -7.721 1.00 . A A .  32 VAL HB   1 1 
        1   543 1 1  32 VAL HG11 H  -1.237  -0.388  -9.487 1.00 . A A .  32 VAL HG11 1 1 
        1   544 1 1  32 VAL HG12 H  -1.790  -1.588 -10.656 1.00 . A A .  32 VAL HG12 1 1 
        1   545 1 1  32 VAL HG13 H  -0.177  -1.718  -9.951 1.00 . A A .  32 VAL HG13 1 1 
        1   546 1 1  32 VAL HG21 H  -3.873  -2.049  -9.118 1.00 . A A .  32 VAL HG21 1 1 
        1   547 1 1  32 VAL HG22 H  -3.259  -0.816  -8.011 1.00 . A A .  32 VAL HG22 1 1 
        1   548 1 1  32 VAL HG23 H  -3.588  -2.445  -7.423 1.00 . A A .  32 VAL HG23 1 1 
        1   549 1 1  32 VAL N    N  -2.119  -4.675  -7.828 1.00 . A A .  32 VAL N    1 1 
        1   550 1 1  32 VAL O    O   0.656  -4.103  -8.455 1.00 . A A .  32 VAL O    1 1 
        1   551 1 1  33 ASN C    C   1.512  -4.540 -12.461 1.00 . A A .  33 ASN C    1 1 
        1   552 1 1  33 ASN CA   C   1.315  -5.104 -11.038 1.00 . A A .  33 ASN CA   1 1 
        1   553 1 1  33 ASN CB   C   1.431  -6.666 -11.036 1.00 . A A .  33 ASN CB   1 1 
        1   554 1 1  33 ASN CG   C   1.248  -7.304  -9.649 1.00 . A A .  33 ASN CG   1 1 
        1   555 1 1  33 ASN H    H  -0.788  -4.782 -11.128 1.00 . A A .  33 ASN H    1 1 
        1   556 1 1  33 ASN HA   H   2.085  -4.683 -10.395 1.00 . A A .  33 ASN HA   1 1 
        1   557 1 1  33 ASN HB2  H   0.677  -7.074 -11.700 1.00 . A A .  33 ASN HB2  1 1 
        1   558 1 1  33 ASN HB3  H   2.409  -6.949 -11.415 1.00 . A A .  33 ASN HB3  1 1 
        1   559 1 1  33 ASN HD21 H  -0.730  -7.399  -9.895 1.00 . A A .  33 ASN HD21 1 1 
        1   560 1 1  33 ASN HD22 H  -0.129  -7.995  -8.387 1.00 . A A .  33 ASN HD22 1 1 
        1   561 1 1  33 ASN N    N  -0.017  -4.688 -10.528 1.00 . A A .  33 ASN N    1 1 
        1   562 1 1  33 ASN ND2  N   0.004  -7.600  -9.274 1.00 . A A .  33 ASN ND2  1 1 
        1   563 1 1  33 ASN O    O   2.418  -4.952 -13.192 1.00 . A A .  33 ASN O    1 1 
        1   564 1 1  33 ASN OD1  O   2.211  -7.525  -8.919 1.00 . A A .  33 ASN OD1  1 1 
        1   565 1 1  34 ASP C    C   0.094  -1.533 -14.072 1.00 . A A .  34 ASP C    1 1 
        1   566 1 1  34 ASP CA   C   0.596  -2.985 -14.175 1.00 . A A .  34 ASP CA   1 1 
        1   567 1 1  34 ASP CB   C  -0.340  -3.855 -15.064 1.00 . A A .  34 ASP CB   1 1 
        1   568 1 1  34 ASP CG   C  -0.511  -3.333 -16.502 1.00 . A A .  34 ASP CG   1 1 
        1   569 1 1  34 ASP H    H   0.065  -3.196 -12.142 1.00 . A A .  34 ASP H    1 1 
        1   570 1 1  34 ASP HA   H   1.600  -2.983 -14.596 1.00 . A A .  34 ASP HA   1 1 
        1   571 1 1  34 ASP HB2  H   0.065  -4.861 -15.110 1.00 . A A .  34 ASP HB2  1 1 
        1   572 1 1  34 ASP HB3  H  -1.316  -3.911 -14.589 1.00 . A A .  34 ASP HB3  1 1 
        1   573 1 1  34 ASP N    N   0.667  -3.560 -12.823 1.00 . A A .  34 ASP N    1 1 
        1   574 1 1  34 ASP O    O  -0.741  -1.220 -13.208 1.00 . A A .  34 ASP O    1 1 
        1   575 1 1  34 ASP OD1  O   0.325  -3.658 -17.370 1.00 . A A .  34 ASP OD1  1 1 
        1   576 1 1  34 ASP OD2  O  -1.476  -2.596 -16.764 1.00 . A A .  34 ASP OD2  1 1 
        1   577 1 1  35 SER C    C  -1.088   1.172 -15.309 1.00 . A A .  35 SER C    1 1 
        1   578 1 1  35 SER CA   C   0.360   0.795 -14.923 1.00 . A A .  35 SER CA   1 1 
        1   579 1 1  35 SER CB   C   1.388   1.512 -15.830 1.00 . A A .  35 SER CB   1 1 
        1   580 1 1  35 SER H    H   1.144  -1.014 -15.703 1.00 . A A .  35 SER H    1 1 
        1   581 1 1  35 SER HA   H   0.531   1.118 -13.897 1.00 . A A .  35 SER HA   1 1 
        1   582 1 1  35 SER HB2  H   1.197   2.579 -15.840 1.00 . A A .  35 SER HB2  1 1 
        1   583 1 1  35 SER HB3  H   2.386   1.337 -15.452 1.00 . A A .  35 SER HB3  1 1 
        1   584 1 1  35 SER HG   H   0.592   1.470 -17.615 1.00 . A A .  35 SER HG   1 1 
        1   585 1 1  35 SER N    N   0.597  -0.661 -14.970 1.00 . A A .  35 SER N    1 1 
        1   586 1 1  35 SER O    O  -1.600   2.207 -14.869 1.00 . A A .  35 SER O    1 1 
        1   587 1 1  35 SER OG   O   1.323   1.035 -17.156 1.00 . A A .  35 SER OG   1 1 
        1   588 1 1  36 ASP C    C  -4.124   0.068 -15.497 1.00 . A A .  36 ASP C    1 1 
        1   589 1 1  36 ASP CA   C  -3.124   0.550 -16.565 1.00 . A A .  36 ASP CA   1 1 
        1   590 1 1  36 ASP CB   C  -3.374  -0.155 -17.920 1.00 . A A .  36 ASP CB   1 1 
        1   591 1 1  36 ASP CG   C  -4.756   0.157 -18.509 1.00 . A A .  36 ASP CG   1 1 
        1   592 1 1  36 ASP H    H  -1.286  -0.499 -16.386 1.00 . A A .  36 ASP H    1 1 
        1   593 1 1  36 ASP HA   H  -3.260   1.623 -16.703 1.00 . A A .  36 ASP HA   1 1 
        1   594 1 1  36 ASP HB2  H  -2.615   0.174 -18.626 1.00 . A A .  36 ASP HB2  1 1 
        1   595 1 1  36 ASP HB3  H  -3.272  -1.232 -17.796 1.00 . A A .  36 ASP HB3  1 1 
        1   596 1 1  36 ASP N    N  -1.738   0.323 -16.113 1.00 . A A .  36 ASP N    1 1 
        1   597 1 1  36 ASP O    O  -5.209   0.638 -15.351 1.00 . A A .  36 ASP O    1 1 
        1   598 1 1  36 ASP OD1  O  -4.945   1.287 -19.015 1.00 . A A .  36 ASP OD1  1 1 
        1   599 1 1  36 ASP OD2  O  -5.663  -0.699 -18.448 1.00 . A A .  36 ASP OD2  1 1 
        1   600 1 1  37 GLU C    C  -4.876  -0.529 -12.546 1.00 . A A .  37 GLU C    1 1 
        1   601 1 1  37 GLU CA   C  -4.594  -1.538 -13.675 1.00 . A A .  37 GLU CA   1 1 
        1   602 1 1  37 GLU CB   C  -3.991  -2.847 -13.099 1.00 . A A .  37 GLU CB   1 1 
        1   603 1 1  37 GLU CD   C  -5.304  -4.307 -14.766 1.00 . A A .  37 GLU CD   1 1 
        1   604 1 1  37 GLU CG   C  -3.941  -4.010 -14.108 1.00 . A A .  37 GLU CG   1 1 
        1   605 1 1  37 GLU H    H  -2.865  -1.385 -14.915 1.00 . A A .  37 GLU H    1 1 
        1   606 1 1  37 GLU HA   H  -5.545  -1.786 -14.145 1.00 . A A .  37 GLU HA   1 1 
        1   607 1 1  37 GLU HB2  H  -2.982  -2.647 -12.754 1.00 . A A .  37 GLU HB2  1 1 
        1   608 1 1  37 GLU HB3  H  -4.587  -3.168 -12.249 1.00 . A A .  37 GLU HB3  1 1 
        1   609 1 1  37 GLU HG2  H  -3.219  -3.769 -14.883 1.00 . A A .  37 GLU HG2  1 1 
        1   610 1 1  37 GLU HG3  H  -3.603  -4.906 -13.592 1.00 . A A .  37 GLU HG3  1 1 
        1   611 1 1  37 GLU N    N  -3.738  -0.974 -14.738 1.00 . A A .  37 GLU N    1 1 
        1   612 1 1  37 GLU O    O  -5.998  -0.475 -12.042 1.00 . A A .  37 GLU O    1 1 
        1   613 1 1  37 GLU OE1  O  -6.199  -4.858 -14.093 1.00 . A A .  37 GLU OE1  1 1 
        1   614 1 1  37 GLU OE2  O  -5.494  -3.990 -15.960 1.00 . A A .  37 GLU OE2  1 1 
        1   615 1 1  38 LEU C    C  -5.024   2.331 -11.329 1.00 . A A .  38 LEU C    1 1 
        1   616 1 1  38 LEU CA   C  -3.985   1.228 -11.046 1.00 . A A .  38 LEU CA   1 1 
        1   617 1 1  38 LEU CB   C  -2.591   1.815 -10.669 1.00 . A A .  38 LEU CB   1 1 
        1   618 1 1  38 LEU CD1  C  -2.261   4.305 -11.351 1.00 . A A .  38 LEU CD1  1 1 
        1   619 1 1  38 LEU CD2  C  -0.367   2.663 -11.669 1.00 . A A .  38 LEU CD2  1 1 
        1   620 1 1  38 LEU CG   C  -1.897   2.833 -11.660 1.00 . A A .  38 LEU CG   1 1 
        1   621 1 1  38 LEU H    H  -3.021   0.243 -12.675 1.00 . A A .  38 LEU H    1 1 
        1   622 1 1  38 LEU HA   H  -4.344   0.647 -10.193 1.00 . A A .  38 LEU HA   1 1 
        1   623 1 1  38 LEU HB2  H  -2.688   2.295  -9.699 1.00 . A A .  38 LEU HB2  1 1 
        1   624 1 1  38 LEU HB3  H  -1.925   0.969 -10.535 1.00 . A A .  38 LEU HB3  1 1 
        1   625 1 1  38 LEU HD11 H  -1.766   4.962 -12.057 1.00 . A A .  38 LEU HD11 1 1 
        1   626 1 1  38 LEU HD12 H  -1.948   4.558 -10.346 1.00 . A A .  38 LEU HD12 1 1 
        1   627 1 1  38 LEU HD13 H  -3.331   4.439 -11.435 1.00 . A A .  38 LEU HD13 1 1 
        1   628 1 1  38 LEU HD21 H   0.033   2.876 -10.685 1.00 . A A .  38 LEU HD21 1 1 
        1   629 1 1  38 LEU HD22 H   0.070   3.345 -12.388 1.00 . A A .  38 LEU HD22 1 1 
        1   630 1 1  38 LEU HD23 H  -0.114   1.650 -11.946 1.00 . A A .  38 LEU HD23 1 1 
        1   631 1 1  38 LEU HG   H  -2.244   2.624 -12.667 1.00 . A A .  38 LEU HG   1 1 
        1   632 1 1  38 LEU N    N  -3.865   0.284 -12.178 1.00 . A A .  38 LEU N    1 1 
        1   633 1 1  38 LEU O    O  -5.803   2.684 -10.447 1.00 . A A .  38 LEU O    1 1 
        1   634 1 1  39 LYS C    C  -7.402   3.481 -13.120 1.00 . A A .  39 LYS C    1 1 
        1   635 1 1  39 LYS CA   C  -5.943   3.962 -12.976 1.00 . A A .  39 LYS CA   1 1 
        1   636 1 1  39 LYS CB   C  -5.425   4.642 -14.273 1.00 . A A .  39 LYS CB   1 1 
        1   637 1 1  39 LYS CD   C  -4.751   4.378 -16.765 1.00 . A A .  39 LYS CD   1 1 
        1   638 1 1  39 LYS CE   C  -3.248   4.573 -16.516 1.00 . A A .  39 LYS CE   1 1 
        1   639 1 1  39 LYS CG   C  -5.474   3.758 -15.542 1.00 . A A .  39 LYS CG   1 1 
        1   640 1 1  39 LYS H    H  -4.478   2.433 -13.266 1.00 . A A .  39 LYS H    1 1 
        1   641 1 1  39 LYS HA   H  -5.917   4.692 -12.171 1.00 . A A .  39 LYS HA   1 1 
        1   642 1 1  39 LYS HB2  H  -6.011   5.539 -14.458 1.00 . A A .  39 LYS HB2  1 1 
        1   643 1 1  39 LYS HB3  H  -4.395   4.942 -14.109 1.00 . A A .  39 LYS HB3  1 1 
        1   644 1 1  39 LYS HD2  H  -4.876   3.719 -17.616 1.00 . A A .  39 LYS HD2  1 1 
        1   645 1 1  39 LYS HD3  H  -5.197   5.339 -16.992 1.00 . A A .  39 LYS HD3  1 1 
        1   646 1 1  39 LYS HE2  H  -3.114   5.258 -15.688 1.00 . A A .  39 LYS HE2  1 1 
        1   647 1 1  39 LYS HE3  H  -2.807   3.617 -16.259 1.00 . A A .  39 LYS HE3  1 1 
        1   648 1 1  39 LYS HG2  H  -5.014   2.803 -15.316 1.00 . A A .  39 LYS HG2  1 1 
        1   649 1 1  39 LYS HG3  H  -6.514   3.590 -15.800 1.00 . A A .  39 LYS HG3  1 1 
        1   650 1 1  39 LYS HZ1  H  -1.525   5.239 -17.484 1.00 . A A .  39 LYS HZ1  1 1 
        1   651 1 1  39 LYS HZ2  H  -2.933   6.045 -17.965 1.00 . A A .  39 LYS HZ2  1 1 
        1   652 1 1  39 LYS HZ3  H  -2.628   4.471 -18.505 1.00 . A A .  39 LYS HZ3  1 1 
        1   653 1 1  39 LYS N    N  -5.054   2.836 -12.583 1.00 . A A .  39 LYS N    1 1 
        1   654 1 1  39 LYS NZ   N  -2.535   5.120 -17.697 1.00 . A A .  39 LYS NZ   1 1 
        1   655 1 1  39 LYS O    O  -8.343   4.276 -12.993 1.00 . A A .  39 LYS O    1 1 
        1   656 1 1  40 LYS C    C  -9.351   1.486 -11.862 1.00 . A A .  40 LYS C    1 1 
        1   657 1 1  40 LYS CA   C  -8.866   1.483 -13.322 1.00 . A A .  40 LYS CA   1 1 
        1   658 1 1  40 LYS CB   C  -8.734   0.026 -13.861 1.00 . A A .  40 LYS CB   1 1 
        1   659 1 1  40 LYS CD   C  -7.944  -1.488 -15.812 1.00 . A A .  40 LYS CD   1 1 
        1   660 1 1  40 LYS CE   C  -8.998  -2.581 -15.570 1.00 . A A .  40 LYS CE   1 1 
        1   661 1 1  40 LYS CG   C  -8.398  -0.070 -15.372 1.00 . A A .  40 LYS CG   1 1 
        1   662 1 1  40 LYS H    H  -6.771   1.638 -13.612 1.00 . A A .  40 LYS H    1 1 
        1   663 1 1  40 LYS HA   H  -9.576   2.034 -13.937 1.00 . A A .  40 LYS HA   1 1 
        1   664 1 1  40 LYS HB2  H  -7.951  -0.478 -13.302 1.00 . A A .  40 LYS HB2  1 1 
        1   665 1 1  40 LYS HB3  H  -9.669  -0.497 -13.688 1.00 . A A .  40 LYS HB3  1 1 
        1   666 1 1  40 LYS HD2  H  -7.710  -1.469 -16.872 1.00 . A A .  40 LYS HD2  1 1 
        1   667 1 1  40 LYS HD3  H  -7.042  -1.748 -15.264 1.00 . A A .  40 LYS HD3  1 1 
        1   668 1 1  40 LYS HE2  H  -9.248  -2.608 -14.517 1.00 . A A .  40 LYS HE2  1 1 
        1   669 1 1  40 LYS HE3  H  -9.888  -2.351 -16.144 1.00 . A A .  40 LYS HE3  1 1 
        1   670 1 1  40 LYS HG2  H  -9.277   0.208 -15.946 1.00 . A A .  40 LYS HG2  1 1 
        1   671 1 1  40 LYS HG3  H  -7.601   0.636 -15.595 1.00 . A A .  40 LYS HG3  1 1 
        1   672 1 1  40 LYS HZ1  H  -7.597  -4.135 -15.495 1.00 . A A .  40 LYS HZ1  1 1 
        1   673 1 1  40 LYS HZ2  H  -8.331  -3.943 -17.006 1.00 . A A .  40 LYS HZ2  1 1 
        1   674 1 1  40 LYS HZ3  H  -9.188  -4.661 -15.737 1.00 . A A .  40 LYS HZ3  1 1 
        1   675 1 1  40 LYS N    N  -7.564   2.168 -13.384 1.00 . A A .  40 LYS N    1 1 
        1   676 1 1  40 LYS NZ   N  -8.496  -3.923 -15.979 1.00 . A A .  40 LYS NZ   1 1 
        1   677 1 1  40 LYS O    O -10.442   1.982 -11.567 1.00 . A A .  40 LYS O    1 1 
        1   678 1 1  41 GLU C    C  -9.189   2.192  -8.885 1.00 . A A .  41 GLU C    1 1 
        1   679 1 1  41 GLU CA   C  -8.783   0.860  -9.522 1.00 . A A .  41 GLU CA   1 1 
        1   680 1 1  41 GLU CB   C  -7.592   0.220  -8.748 1.00 . A A .  41 GLU CB   1 1 
        1   681 1 1  41 GLU CD   C  -8.505  -2.136  -9.204 1.00 . A A .  41 GLU CD   1 1 
        1   682 1 1  41 GLU CG   C  -7.265  -1.220  -9.186 1.00 . A A .  41 GLU CG   1 1 
        1   683 1 1  41 GLU H    H  -7.586   0.731 -11.267 1.00 . A A .  41 GLU H    1 1 
        1   684 1 1  41 GLU HA   H  -9.630   0.184  -9.451 1.00 . A A .  41 GLU HA   1 1 
        1   685 1 1  41 GLU HB2  H  -6.705   0.831  -8.893 1.00 . A A .  41 GLU HB2  1 1 
        1   686 1 1  41 GLU HB3  H  -7.824   0.203  -7.688 1.00 . A A .  41 GLU HB3  1 1 
        1   687 1 1  41 GLU HG2  H  -6.834  -1.188 -10.180 1.00 . A A .  41 GLU HG2  1 1 
        1   688 1 1  41 GLU HG3  H  -6.532  -1.639  -8.504 1.00 . A A .  41 GLU HG3  1 1 
        1   689 1 1  41 GLU N    N  -8.472   1.002 -10.953 1.00 . A A .  41 GLU N    1 1 
        1   690 1 1  41 GLU O    O -10.184   2.239  -8.170 1.00 . A A .  41 GLU O    1 1 
        1   691 1 1  41 GLU OE1  O  -9.014  -2.474  -8.118 1.00 . A A .  41 GLU OE1  1 1 
        1   692 1 1  41 GLU OE2  O  -8.991  -2.502 -10.304 1.00 . A A .  41 GLU OE2  1 1 
        1   693 1 1  42 MET C    C -10.161   5.088  -8.883 1.00 . A A .  42 MET C    1 1 
        1   694 1 1  42 MET CA   C  -8.704   4.629  -8.639 1.00 . A A .  42 MET CA   1 1 
        1   695 1 1  42 MET CB   C  -7.727   5.678  -9.231 1.00 . A A .  42 MET CB   1 1 
        1   696 1 1  42 MET CE   C  -5.870   3.761  -6.714 1.00 . A A .  42 MET CE   1 1 
        1   697 1 1  42 MET CG   C  -6.229   5.462  -8.946 1.00 . A A .  42 MET CG   1 1 
        1   698 1 1  42 MET H    H  -7.707   3.163  -9.831 1.00 . A A .  42 MET H    1 1 
        1   699 1 1  42 MET HA   H  -8.533   4.565  -7.567 1.00 . A A .  42 MET HA   1 1 
        1   700 1 1  42 MET HB2  H  -7.858   5.689 -10.309 1.00 . A A .  42 MET HB2  1 1 
        1   701 1 1  42 MET HB3  H  -7.999   6.660  -8.848 1.00 . A A .  42 MET HB3  1 1 
        1   702 1 1  42 MET HE1  H  -6.865   3.391  -6.901 1.00 . A A .  42 MET HE1  1 1 
        1   703 1 1  42 MET HE2  H  -5.641   3.663  -5.662 1.00 . A A .  42 MET HE2  1 1 
        1   704 1 1  42 MET HE3  H  -5.157   3.188  -7.292 1.00 . A A .  42 MET HE3  1 1 
        1   705 1 1  42 MET HG2  H  -5.932   4.509  -9.358 1.00 . A A .  42 MET HG2  1 1 
        1   706 1 1  42 MET HG3  H  -5.669   6.242  -9.450 1.00 . A A .  42 MET HG3  1 1 
        1   707 1 1  42 MET N    N  -8.448   3.276  -9.203 1.00 . A A .  42 MET N    1 1 
        1   708 1 1  42 MET O    O -10.769   5.747  -8.025 1.00 . A A .  42 MET O    1 1 
        1   709 1 1  42 MET SD   S  -5.776   5.493  -7.188 1.00 . A A .  42 MET SD   1 1 
        1   710 1 1  43 LYS C    C -13.089   4.178  -9.687 1.00 . A A .  43 LYS C    1 1 
        1   711 1 1  43 LYS CA   C -12.085   5.044 -10.450 1.00 . A A .  43 LYS CA   1 1 
        1   712 1 1  43 LYS CB   C -12.260   4.890 -11.980 1.00 . A A .  43 LYS CB   1 1 
        1   713 1 1  43 LYS CD   C -11.503   5.667 -14.316 1.00 . A A .  43 LYS CD   1 1 
        1   714 1 1  43 LYS CE   C -10.555   6.585 -15.100 1.00 . A A .  43 LYS CE   1 1 
        1   715 1 1  43 LYS CG   C -11.350   5.837 -12.790 1.00 . A A .  43 LYS CG   1 1 
        1   716 1 1  43 LYS H    H -10.174   4.143 -10.655 1.00 . A A .  43 LYS H    1 1 
        1   717 1 1  43 LYS HA   H -12.256   6.088 -10.187 1.00 . A A .  43 LYS HA   1 1 
        1   718 1 1  43 LYS HB2  H -12.032   3.863 -12.260 1.00 . A A .  43 LYS HB2  1 1 
        1   719 1 1  43 LYS HB3  H -13.293   5.099 -12.244 1.00 . A A .  43 LYS HB3  1 1 
        1   720 1 1  43 LYS HD2  H -11.286   4.638 -14.582 1.00 . A A .  43 LYS HD2  1 1 
        1   721 1 1  43 LYS HD3  H -12.527   5.896 -14.596 1.00 . A A .  43 LYS HD3  1 1 
        1   722 1 1  43 LYS HE2  H -10.699   6.421 -16.162 1.00 . A A .  43 LYS HE2  1 1 
        1   723 1 1  43 LYS HE3  H -10.779   7.621 -14.866 1.00 . A A .  43 LYS HE3  1 1 
        1   724 1 1  43 LYS HG2  H -11.591   6.863 -12.526 1.00 . A A .  43 LYS HG2  1 1 
        1   725 1 1  43 LYS HG3  H -10.318   5.639 -12.518 1.00 . A A .  43 LYS HG3  1 1 
        1   726 1 1  43 LYS HZ1  H  -8.968   6.466 -13.753 1.00 . A A .  43 LYS HZ1  1 1 
        1   727 1 1  43 LYS HZ2  H  -8.514   6.943 -15.308 1.00 . A A .  43 LYS HZ2  1 1 
        1   728 1 1  43 LYS HZ3  H  -8.893   5.327 -14.997 1.00 . A A .  43 LYS HZ3  1 1 
        1   729 1 1  43 LYS N    N -10.709   4.702 -10.051 1.00 . A A .  43 LYS N    1 1 
        1   730 1 1  43 LYS NZ   N  -9.133   6.313 -14.768 1.00 . A A .  43 LYS NZ   1 1 
        1   731 1 1  43 LYS O    O -14.081   4.697  -9.198 1.00 . A A .  43 LYS O    1 1 
        1   732 1 1  44 LYS C    C -13.852   2.374  -7.350 1.00 . A A .  44 LYS C    1 1 
        1   733 1 1  44 LYS CA   C -13.646   1.904  -8.810 1.00 . A A .  44 LYS CA   1 1 
        1   734 1 1  44 LYS CB   C -13.044   0.451  -8.852 1.00 . A A .  44 LYS CB   1 1 
        1   735 1 1  44 LYS CD   C -12.827  -0.182 -11.420 1.00 . A A .  44 LYS CD   1 1 
        1   736 1 1  44 LYS CE   C -13.395   1.043 -12.168 1.00 . A A .  44 LYS CE   1 1 
        1   737 1 1  44 LYS CG   C -13.490  -0.472 -10.038 1.00 . A A .  44 LYS CG   1 1 
        1   738 1 1  44 LYS H    H -11.948   2.536  -9.937 1.00 . A A .  44 LYS H    1 1 
        1   739 1 1  44 LYS HA   H -14.611   1.891  -9.311 1.00 . A A .  44 LYS HA   1 1 
        1   740 1 1  44 LYS HB2  H -11.961   0.526  -8.883 1.00 . A A .  44 LYS HB2  1 1 
        1   741 1 1  44 LYS HB3  H -13.310  -0.061  -7.925 1.00 . A A .  44 LYS HB3  1 1 
        1   742 1 1  44 LYS HD2  H -11.769  -0.023 -11.267 1.00 . A A .  44 LYS HD2  1 1 
        1   743 1 1  44 LYS HD3  H -12.955  -1.057 -12.052 1.00 . A A .  44 LYS HD3  1 1 
        1   744 1 1  44 LYS HE2  H -13.213   1.931 -11.582 1.00 . A A .  44 LYS HE2  1 1 
        1   745 1 1  44 LYS HE3  H -12.886   1.140 -13.119 1.00 . A A .  44 LYS HE3  1 1 
        1   746 1 1  44 LYS HG2  H -13.254  -1.496  -9.770 1.00 . A A .  44 LYS HG2  1 1 
        1   747 1 1  44 LYS HG3  H -14.564  -0.391 -10.146 1.00 . A A .  44 LYS HG3  1 1 
        1   748 1 1  44 LYS HZ1  H -15.210   1.843 -12.795 1.00 . A A .  44 LYS HZ1  1 1 
        1   749 1 1  44 LYS HZ2  H -15.354   0.728 -11.537 1.00 . A A .  44 LYS HZ2  1 1 
        1   750 1 1  44 LYS HZ3  H -15.050   0.189 -13.113 1.00 . A A .  44 LYS HZ3  1 1 
        1   751 1 1  44 LYS N    N -12.785   2.866  -9.547 1.00 . A A .  44 LYS N    1 1 
        1   752 1 1  44 LYS NZ   N -14.851   0.939 -12.420 1.00 . A A .  44 LYS NZ   1 1 
        1   753 1 1  44 LYS O    O -14.964   2.297  -6.810 1.00 . A A .  44 LYS O    1 1 
        1   754 1 1  45 LEU C    C -13.598   4.663  -5.241 1.00 . A A .  45 LEU C    1 1 
        1   755 1 1  45 LEU CA   C -12.727   3.401  -5.369 1.00 . A A .  45 LEU CA   1 1 
        1   756 1 1  45 LEU CB   C -11.257   3.713  -4.963 1.00 . A A .  45 LEU CB   1 1 
        1   757 1 1  45 LEU CD1  C  -8.813   2.958  -4.804 1.00 . A A .  45 LEU CD1  1 1 
        1   758 1 1  45 LEU CD2  C -10.683   1.314  -4.262 1.00 . A A .  45 LEU CD2  1 1 
        1   759 1 1  45 LEU CG   C -10.257   2.525  -5.108 1.00 . A A .  45 LEU CG   1 1 
        1   760 1 1  45 LEU H    H -11.920   2.877  -7.264 1.00 . A A .  45 LEU H    1 1 
        1   761 1 1  45 LEU HA   H -13.118   2.631  -4.710 1.00 . A A .  45 LEU HA   1 1 
        1   762 1 1  45 LEU HB2  H -10.898   4.535  -5.580 1.00 . A A .  45 LEU HB2  1 1 
        1   763 1 1  45 LEU HB3  H -11.244   4.041  -3.927 1.00 . A A .  45 LEU HB3  1 1 
        1   764 1 1  45 LEU HD11 H  -8.143   2.115  -4.916 1.00 . A A .  45 LEU HD11 1 1 
        1   765 1 1  45 LEU HD12 H  -8.745   3.337  -3.793 1.00 . A A .  45 LEU HD12 1 1 
        1   766 1 1  45 LEU HD13 H  -8.519   3.737  -5.496 1.00 . A A .  45 LEU HD13 1 1 
        1   767 1 1  45 LEU HD21 H  -9.971   0.509  -4.394 1.00 . A A .  45 LEU HD21 1 1 
        1   768 1 1  45 LEU HD22 H -11.660   0.973  -4.579 1.00 . A A .  45 LEU HD22 1 1 
        1   769 1 1  45 LEU HD23 H -10.723   1.584  -3.214 1.00 . A A .  45 LEU HD23 1 1 
        1   770 1 1  45 LEU HG   H -10.270   2.201  -6.138 1.00 . A A .  45 LEU HG   1 1 
        1   771 1 1  45 LEU N    N -12.755   2.874  -6.750 1.00 . A A .  45 LEU N    1 1 
        1   772 1 1  45 LEU O    O -14.299   4.845  -4.243 1.00 . A A .  45 LEU O    1 1 
        1   773 1 1  46 ALA C    C -15.781   6.555  -6.520 1.00 . A A .  46 ALA C    1 1 
        1   774 1 1  46 ALA CA   C -14.271   6.793  -6.320 1.00 . A A .  46 ALA CA   1 1 
        1   775 1 1  46 ALA CB   C -13.706   7.688  -7.440 1.00 . A A .  46 ALA CB   1 1 
        1   776 1 1  46 ALA H    H -12.966   5.283  -7.035 1.00 . A A .  46 ALA H    1 1 
        1   777 1 1  46 ALA HA   H -14.116   7.304  -5.372 1.00 . A A .  46 ALA HA   1 1 
        1   778 1 1  46 ALA HB1  H -13.831   7.203  -8.402 1.00 . A A .  46 ALA HB1  1 1 
        1   779 1 1  46 ALA HB2  H -12.653   7.861  -7.265 1.00 . A A .  46 ALA HB2  1 1 
        1   780 1 1  46 ALA HB3  H -14.224   8.639  -7.450 1.00 . A A .  46 ALA HB3  1 1 
        1   781 1 1  46 ALA N    N -13.532   5.520  -6.272 1.00 . A A .  46 ALA N    1 1 
        1   782 1 1  46 ALA O    O -16.615   7.224  -5.898 1.00 . A A .  46 ALA O    1 1 
        1   783 1 1  47 GLU C    C -18.249   4.556  -6.611 1.00 . A A .  47 GLU C    1 1 
        1   784 1 1  47 GLU CA   C -17.503   5.255  -7.759 1.00 . A A .  47 GLU CA   1 1 
        1   785 1 1  47 GLU CB   C -17.514   4.377  -9.042 1.00 . A A .  47 GLU CB   1 1 
        1   786 1 1  47 GLU CD   C -16.845   4.167 -11.526 1.00 . A A .  47 GLU CD   1 1 
        1   787 1 1  47 GLU CG   C -16.976   5.095 -10.305 1.00 . A A .  47 GLU CG   1 1 
        1   788 1 1  47 GLU H    H -15.390   5.034  -7.763 1.00 . A A .  47 GLU H    1 1 
        1   789 1 1  47 GLU HA   H -18.015   6.192  -7.976 1.00 . A A .  47 GLU HA   1 1 
        1   790 1 1  47 GLU HB2  H -16.905   3.493  -8.861 1.00 . A A .  47 GLU HB2  1 1 
        1   791 1 1  47 GLU HB3  H -18.532   4.054  -9.244 1.00 . A A .  47 GLU HB3  1 1 
        1   792 1 1  47 GLU HG2  H -17.644   5.915 -10.555 1.00 . A A .  47 GLU HG2  1 1 
        1   793 1 1  47 GLU HG3  H -15.998   5.512 -10.076 1.00 . A A .  47 GLU HG3  1 1 
        1   794 1 1  47 GLU N    N -16.111   5.576  -7.380 1.00 . A A .  47 GLU N    1 1 
        1   795 1 1  47 GLU O    O -19.446   4.779  -6.415 1.00 . A A .  47 GLU O    1 1 
        1   796 1 1  47 GLU OE1  O -15.780   3.538 -11.700 1.00 . A A .  47 GLU OE1  1 1 
        1   797 1 1  47 GLU OE2  O -17.813   4.051 -12.310 1.00 . A A .  47 GLU OE2  1 1 
        1   798 1 1  48 GLU C    C -17.636   3.594  -3.393 1.00 . A A .  48 GLU C    1 1 
        1   799 1 1  48 GLU CA   C -18.102   2.967  -4.724 1.00 . A A .  48 GLU CA   1 1 
        1   800 1 1  48 GLU CB   C -17.673   1.480  -4.834 1.00 . A A .  48 GLU CB   1 1 
        1   801 1 1  48 GLU CD   C -19.634   0.667  -6.294 1.00 . A A .  48 GLU CD   1 1 
        1   802 1 1  48 GLU CG   C -18.104   0.770  -6.130 1.00 . A A .  48 GLU CG   1 1 
        1   803 1 1  48 GLU H    H -16.581   3.602  -6.060 1.00 . A A .  48 GLU H    1 1 
        1   804 1 1  48 GLU HA   H -19.189   3.018  -4.777 1.00 . A A .  48 GLU HA   1 1 
        1   805 1 1  48 GLU HB2  H -16.591   1.426  -4.764 1.00 . A A .  48 GLU HB2  1 1 
        1   806 1 1  48 GLU HB3  H -18.093   0.936  -3.997 1.00 . A A .  48 GLU HB3  1 1 
        1   807 1 1  48 GLU HG2  H -17.692   1.317  -6.972 1.00 . A A .  48 GLU HG2  1 1 
        1   808 1 1  48 GLU HG3  H -17.685  -0.233  -6.135 1.00 . A A .  48 GLU HG3  1 1 
        1   809 1 1  48 GLU N    N -17.534   3.719  -5.855 1.00 . A A .  48 GLU N    1 1 
        1   810 1 1  48 GLU O    O -16.454   3.521  -3.054 1.00 . A A .  48 GLU O    1 1 
        1   811 1 1  48 GLU OE1  O -20.250  -0.221  -5.667 1.00 . A A .  48 GLU OE1  1 1 
        1   812 1 1  48 GLU OE2  O -20.231   1.476  -7.039 1.00 . A A .  48 GLU OE2  1 1 
        1   813 1 1  49 LYS C    C -18.483   4.099  -0.171 1.00 . A A .  49 LYS C    1 1 
        1   814 1 1  49 LYS CA   C -18.266   4.976  -1.414 1.00 . A A .  49 LYS CA   1 1 
        1   815 1 1  49 LYS CB   C -19.164   6.258  -1.279 1.00 . A A .  49 LYS CB   1 1 
        1   816 1 1  49 LYS CD   C -19.921   6.797  -3.698 1.00 . A A .  49 LYS CD   1 1 
        1   817 1 1  49 LYS CE   C -19.911   7.827  -4.833 1.00 . A A .  49 LYS CE   1 1 
        1   818 1 1  49 LYS CG   C -19.123   7.265  -2.457 1.00 . A A .  49 LYS CG   1 1 
        1   819 1 1  49 LYS H    H -19.517   4.133  -2.917 1.00 . A A .  49 LYS H    1 1 
        1   820 1 1  49 LYS HA   H -17.222   5.284  -1.453 1.00 . A A .  49 LYS HA   1 1 
        1   821 1 1  49 LYS HB2  H -20.197   5.945  -1.148 1.00 . A A .  49 LYS HB2  1 1 
        1   822 1 1  49 LYS HB3  H -18.864   6.790  -0.376 1.00 . A A .  49 LYS HB3  1 1 
        1   823 1 1  49 LYS HD2  H -19.487   5.872  -4.067 1.00 . A A .  49 LYS HD2  1 1 
        1   824 1 1  49 LYS HD3  H -20.948   6.610  -3.404 1.00 . A A .  49 LYS HD3  1 1 
        1   825 1 1  49 LYS HE2  H -20.337   8.758  -4.475 1.00 . A A .  49 LYS HE2  1 1 
        1   826 1 1  49 LYS HE3  H -18.889   8.002  -5.149 1.00 . A A .  49 LYS HE3  1 1 
        1   827 1 1  49 LYS HG2  H -19.538   8.209  -2.121 1.00 . A A .  49 LYS HG2  1 1 
        1   828 1 1  49 LYS HG3  H -18.089   7.420  -2.742 1.00 . A A .  49 LYS HG3  1 1 
        1   829 1 1  49 LYS HZ1  H -20.668   8.074  -6.761 1.00 . A A .  49 LYS HZ1  1 1 
        1   830 1 1  49 LYS HZ2  H -21.691   7.206  -5.735 1.00 . A A .  49 LYS HZ2  1 1 
        1   831 1 1  49 LYS HZ3  H -20.309   6.474  -6.369 1.00 . A A .  49 LYS HZ3  1 1 
        1   832 1 1  49 LYS N    N -18.579   4.210  -2.642 1.00 . A A .  49 LYS N    1 1 
        1   833 1 1  49 LYS NZ   N -20.698   7.362  -6.003 1.00 . A A .  49 LYS NZ   1 1 
        1   834 1 1  49 LYS O    O -17.522   3.720   0.518 1.00 . A A .  49 LYS O    1 1 
        1   835 1 1  50 ASN C    C -19.950   1.560   1.218 1.00 . A A .  50 ASN C    1 1 
        1   836 1 1  50 ASN CA   C -20.208   3.075   1.298 1.00 . A A .  50 ASN CA   1 1 
        1   837 1 1  50 ASN CB   C -21.705   3.382   1.602 1.00 . A A .  50 ASN CB   1 1 
        1   838 1 1  50 ASN CG   C -22.193   2.775   2.931 1.00 . A A .  50 ASN CG   1 1 
        1   839 1 1  50 ASN H    H -20.440   3.946  -0.615 1.00 . A A .  50 ASN H    1 1 
        1   840 1 1  50 ASN HA   H -19.610   3.479   2.117 1.00 . A A .  50 ASN HA   1 1 
        1   841 1 1  50 ASN HB2  H -21.845   4.455   1.655 1.00 . A A .  50 ASN HB2  1 1 
        1   842 1 1  50 ASN HB3  H -22.315   2.992   0.794 1.00 . A A .  50 ASN HB3  1 1 
        1   843 1 1  50 ASN HD21 H -24.043   2.612   2.230 1.00 . A A .  50 ASN HD21 1 1 
        1   844 1 1  50 ASN HD22 H -23.798   2.055   3.848 1.00 . A A .  50 ASN HD22 1 1 
        1   845 1 1  50 ASN N    N -19.766   3.747   0.068 1.00 . A A .  50 ASN N    1 1 
        1   846 1 1  50 ASN ND2  N -23.474   2.449   3.011 1.00 . A A .  50 ASN ND2  1 1 
        1   847 1 1  50 ASN O    O -20.811   0.780   0.802 1.00 . A A .  50 ASN O    1 1 
        1   848 1 1  50 ASN OD1  O -21.421   2.609   3.880 1.00 . A A .  50 ASN OD1  1 1 
        1   849 1 1  51 PHE C    C -16.883  -0.103   2.453 1.00 . A A .  51 PHE C    1 1 
        1   850 1 1  51 PHE CA   C -18.282  -0.174   1.819 1.00 . A A .  51 PHE CA   1 1 
        1   851 1 1  51 PHE CB   C -18.325  -1.101   0.549 1.00 . A A .  51 PHE CB   1 1 
        1   852 1 1  51 PHE CD1  C -17.009   0.297  -1.116 1.00 . A A .  51 PHE CD1  1 1 
        1   853 1 1  51 PHE CD2  C -16.375  -1.993  -0.826 1.00 . A A .  51 PHE CD2  1 1 
        1   854 1 1  51 PHE CE1  C -16.016   0.440  -2.058 1.00 . A A .  51 PHE CE1  1 1 
        1   855 1 1  51 PHE CE2  C -15.383  -1.841  -1.769 1.00 . A A .  51 PHE CE2  1 1 
        1   856 1 1  51 PHE CG   C -17.208  -0.921  -0.478 1.00 . A A .  51 PHE CG   1 1 
        1   857 1 1  51 PHE CZ   C -15.206  -0.622  -2.385 1.00 . A A .  51 PHE CZ   1 1 
        1   858 1 1  51 PHE H    H -18.038   1.907   1.597 1.00 . A A .  51 PHE H    1 1 
        1   859 1 1  51 PHE HA   H -18.961  -0.575   2.568 1.00 . A A .  51 PHE HA   1 1 
        1   860 1 1  51 PHE HB2  H -18.307  -2.133   0.876 1.00 . A A .  51 PHE HB2  1 1 
        1   861 1 1  51 PHE HB3  H -19.263  -0.935   0.033 1.00 . A A .  51 PHE HB3  1 1 
        1   862 1 1  51 PHE HD1  H -17.642   1.141  -0.866 1.00 . A A .  51 PHE HD1  1 1 
        1   863 1 1  51 PHE HD2  H -16.513  -2.953  -0.343 1.00 . A A .  51 PHE HD2  1 1 
        1   864 1 1  51 PHE HE1  H -15.874   1.396  -2.548 1.00 . A A .  51 PHE HE1  1 1 
        1   865 1 1  51 PHE HE2  H -14.745  -2.678  -2.027 1.00 . A A .  51 PHE HE2  1 1 
        1   866 1 1  51 PHE HZ   H -14.426  -0.500  -3.128 1.00 . A A .  51 PHE HZ   1 1 
        1   867 1 1  51 PHE N    N -18.713   1.199   1.541 1.00 . A A .  51 PHE N    1 1 
        1   868 1 1  51 PHE O    O -16.338   1.000   2.652 1.00 . A A .  51 PHE O    1 1 
        1   869 1 1  52 GLU C    C -13.877  -0.635   2.754 1.00 . A A .  52 GLU C    1 1 
        1   870 1 1  52 GLU CA   C -15.025  -1.414   3.446 1.00 . A A .  52 GLU CA   1 1 
        1   871 1 1  52 GLU CB   C -14.679  -2.922   3.535 1.00 . A A .  52 GLU CB   1 1 
        1   872 1 1  52 GLU CD   C -13.645  -2.892   5.883 1.00 . A A .  52 GLU CD   1 1 
        1   873 1 1  52 GLU CG   C -13.460  -3.254   4.405 1.00 . A A .  52 GLU CG   1 1 
        1   874 1 1  52 GLU H    H -16.783  -2.087   2.493 1.00 . A A .  52 GLU H    1 1 
        1   875 1 1  52 GLU HA   H -15.156  -1.027   4.453 1.00 . A A .  52 GLU HA   1 1 
        1   876 1 1  52 GLU HB2  H -15.535  -3.457   3.940 1.00 . A A .  52 GLU HB2  1 1 
        1   877 1 1  52 GLU HB3  H -14.494  -3.294   2.531 1.00 . A A .  52 GLU HB3  1 1 
        1   878 1 1  52 GLU HG2  H -13.262  -4.320   4.333 1.00 . A A .  52 GLU HG2  1 1 
        1   879 1 1  52 GLU HG3  H -12.597  -2.721   4.011 1.00 . A A .  52 GLU HG3  1 1 
        1   880 1 1  52 GLU N    N -16.311  -1.271   2.750 1.00 . A A .  52 GLU N    1 1 
        1   881 1 1  52 GLU O    O -13.916  -0.402   1.539 1.00 . A A .  52 GLU O    1 1 
        1   882 1 1  52 GLU OE1  O -14.271  -3.677   6.626 1.00 . A A .  52 GLU OE1  1 1 
        1   883 1 1  52 GLU OE2  O -13.194  -1.814   6.305 1.00 . A A .  52 GLU OE2  1 1 
        1   884 1 1  53 LYS C    C -10.711  -0.593   2.432 1.00 . A A .  53 LYS C    1 1 
        1   885 1 1  53 LYS CA   C -11.661   0.444   3.064 1.00 . A A .  53 LYS CA   1 1 
        1   886 1 1  53 LYS CB   C -10.953   1.274   4.182 1.00 . A A .  53 LYS CB   1 1 
        1   887 1 1  53 LYS CD   C -11.736   1.269   6.660 1.00 . A A .  53 LYS CD   1 1 
        1   888 1 1  53 LYS CE   C -11.620   0.595   8.028 1.00 . A A .  53 LYS CE   1 1 
        1   889 1 1  53 LYS CG   C -10.832   0.605   5.586 1.00 . A A .  53 LYS CG   1 1 
        1   890 1 1  53 LYS H    H -12.973  -0.369   4.524 1.00 . A A .  53 LYS H    1 1 
        1   891 1 1  53 LYS HA   H -11.967   1.133   2.277 1.00 . A A .  53 LYS HA   1 1 
        1   892 1 1  53 LYS HB2  H  -9.951   1.520   3.841 1.00 . A A .  53 LYS HB2  1 1 
        1   893 1 1  53 LYS HB3  H -11.489   2.210   4.294 1.00 . A A .  53 LYS HB3  1 1 
        1   894 1 1  53 LYS HD2  H -11.445   2.306   6.771 1.00 . A A .  53 LYS HD2  1 1 
        1   895 1 1  53 LYS HD3  H -12.767   1.220   6.334 1.00 . A A .  53 LYS HD3  1 1 
        1   896 1 1  53 LYS HE2  H -11.892  -0.449   7.931 1.00 . A A .  53 LYS HE2  1 1 
        1   897 1 1  53 LYS HE3  H -10.591   0.661   8.364 1.00 . A A .  53 LYS HE3  1 1 
        1   898 1 1  53 LYS HG2  H -11.112  -0.439   5.505 1.00 . A A .  53 LYS HG2  1 1 
        1   899 1 1  53 LYS HG3  H  -9.801   0.663   5.921 1.00 . A A .  53 LYS HG3  1 1 
        1   900 1 1  53 LYS HZ1  H -13.472   1.268   8.708 1.00 . A A .  53 LYS HZ1  1 1 
        1   901 1 1  53 LYS HZ2  H -12.164   2.179   9.266 1.00 . A A .  53 LYS HZ2  1 1 
        1   902 1 1  53 LYS HZ3  H -12.474   0.655   9.925 1.00 . A A .  53 LYS HZ3  1 1 
        1   903 1 1  53 LYS N    N -12.885  -0.209   3.561 1.00 . A A .  53 LYS N    1 1 
        1   904 1 1  53 LYS NZ   N -12.494   1.216   9.053 1.00 . A A .  53 LYS NZ   1 1 
        1   905 1 1  53 LYS O    O -10.657  -1.754   2.856 1.00 . A A .  53 LYS O    1 1 
        1   906 1 1  54 ILE C    C  -7.731  -1.062   0.811 1.00 . A A .  54 ILE C    1 1 
        1   907 1 1  54 ILE CA   C  -9.236  -1.037   0.474 1.00 . A A .  54 ILE CA   1 1 
        1   908 1 1  54 ILE CB   C  -9.466  -0.610  -1.047 1.00 . A A .  54 ILE CB   1 1 
        1   909 1 1  54 ILE CD1  C -12.038  -0.203  -0.931 1.00 . A A .  54 ILE CD1  1 1 
        1   910 1 1  54 ILE CG1  C -10.904  -0.973  -1.560 1.00 . A A .  54 ILE CG1  1 1 
        1   911 1 1  54 ILE CG2  C  -8.402  -1.199  -2.010 1.00 . A A .  54 ILE CG2  1 1 
        1   912 1 1  54 ILE H    H  -9.895   0.823   1.264 1.00 . A A .  54 ILE H    1 1 
        1   913 1 1  54 ILE HA   H  -9.629  -2.046   0.597 1.00 . A A .  54 ILE HA   1 1 
        1   914 1 1  54 ILE HB   H  -9.362   0.471  -1.093 1.00 . A A .  54 ILE HB   1 1 
        1   915 1 1  54 ILE HD11 H -12.095  -0.442   0.124 1.00 . A A .  54 ILE HD11 1 1 
        1   916 1 1  54 ILE HD12 H -12.966  -0.474  -1.407 1.00 . A A .  54 ILE HD12 1 1 
        1   917 1 1  54 ILE HD13 H -11.869   0.858  -1.049 1.00 . A A .  54 ILE HD13 1 1 
        1   918 1 1  54 ILE HG12 H -10.956  -0.790  -2.626 1.00 . A A .  54 ILE HG12 1 1 
        1   919 1 1  54 ILE HG13 H -11.084  -2.020  -1.389 1.00 . A A .  54 ILE HG13 1 1 
        1   920 1 1  54 ILE HG21 H  -7.417  -0.844  -1.730 1.00 . A A .  54 ILE HG21 1 1 
        1   921 1 1  54 ILE HG22 H  -8.612  -0.893  -3.026 1.00 . A A .  54 ILE HG22 1 1 
        1   922 1 1  54 ILE HG23 H  -8.420  -2.280  -1.951 1.00 . A A .  54 ILE HG23 1 1 
        1   923 1 1  54 ILE N    N  -9.970  -0.147   1.399 1.00 . A A .  54 ILE N    1 1 
        1   924 1 1  54 ILE O    O  -7.141  -0.053   1.223 1.00 . A A .  54 ILE O    1 1 
        1   925 1 1  55 LEU C    C  -5.165  -2.863  -0.640 1.00 . A A .  55 LEU C    1 1 
        1   926 1 1  55 LEU CA   C  -5.709  -2.490   0.755 1.00 . A A .  55 LEU CA   1 1 
        1   927 1 1  55 LEU CB   C  -5.480  -3.604   1.815 1.00 . A A .  55 LEU CB   1 1 
        1   928 1 1  55 LEU CD1  C  -3.765  -4.153   3.680 1.00 . A A .  55 LEU CD1  1 1 
        1   929 1 1  55 LEU CD2  C  -3.473  -5.179   1.362 1.00 . A A .  55 LEU CD2  1 1 
        1   930 1 1  55 LEU CG   C  -3.979  -3.952   2.158 1.00 . A A .  55 LEU CG   1 1 
        1   931 1 1  55 LEU H    H  -7.704  -3.006   0.391 1.00 . A A .  55 LEU H    1 1 
        1   932 1 1  55 LEU HA   H  -5.227  -1.573   1.097 1.00 . A A .  55 LEU HA   1 1 
        1   933 1 1  55 LEU HB2  H  -5.979  -3.276   2.727 1.00 . A A .  55 LEU HB2  1 1 
        1   934 1 1  55 LEU HB3  H  -5.986  -4.506   1.477 1.00 . A A .  55 LEU HB3  1 1 
        1   935 1 1  55 LEU HD11 H  -3.994  -3.234   4.198 1.00 . A A .  55 LEU HD11 1 1 
        1   936 1 1  55 LEU HD12 H  -2.735  -4.422   3.877 1.00 . A A .  55 LEU HD12 1 1 
        1   937 1 1  55 LEU HD13 H  -4.415  -4.938   4.045 1.00 . A A .  55 LEU HD13 1 1 
        1   938 1 1  55 LEU HD21 H  -3.546  -4.977   0.302 1.00 . A A .  55 LEU HD21 1 1 
        1   939 1 1  55 LEU HD22 H  -4.071  -6.049   1.603 1.00 . A A .  55 LEU HD22 1 1 
        1   940 1 1  55 LEU HD23 H  -2.439  -5.375   1.612 1.00 . A A .  55 LEU HD23 1 1 
        1   941 1 1  55 LEU HG   H  -3.356  -3.112   1.873 1.00 . A A .  55 LEU HG   1 1 
        1   942 1 1  55 LEU N    N  -7.138  -2.248   0.631 1.00 . A A .  55 LEU N    1 1 
        1   943 1 1  55 LEU O    O  -5.596  -3.863  -1.234 1.00 . A A .  55 LEU O    1 1 
        1   944 1 1  56 ILE C    C  -2.224  -2.824  -2.228 1.00 . A A .  56 ILE C    1 1 
        1   945 1 1  56 ILE CA   C  -3.611  -2.213  -2.477 1.00 . A A .  56 ILE CA   1 1 
        1   946 1 1  56 ILE CB   C  -3.447  -0.833  -3.250 1.00 . A A .  56 ILE CB   1 1 
        1   947 1 1  56 ILE CD1  C  -5.696  -0.900  -4.588 1.00 . A A .  56 ILE CD1  1 1 
        1   948 1 1  56 ILE CG1  C  -4.836  -0.168  -3.558 1.00 . A A .  56 ILE CG1  1 1 
        1   949 1 1  56 ILE CG2  C  -2.608  -0.984  -4.554 1.00 . A A .  56 ILE CG2  1 1 
        1   950 1 1  56 ILE H    H  -4.024  -1.221  -0.654 1.00 . A A .  56 ILE H    1 1 
        1   951 1 1  56 ILE HA   H  -4.216  -2.890  -3.085 1.00 . A A .  56 ILE HA   1 1 
        1   952 1 1  56 ILE HB   H  -2.895  -0.163  -2.595 1.00 . A A .  56 ILE HB   1 1 
        1   953 1 1  56 ILE HD11 H  -6.624  -0.364  -4.725 1.00 . A A .  56 ILE HD11 1 1 
        1   954 1 1  56 ILE HD12 H  -5.911  -1.900  -4.239 1.00 . A A .  56 ILE HD12 1 1 
        1   955 1 1  56 ILE HD13 H  -5.173  -0.954  -5.534 1.00 . A A .  56 ILE HD13 1 1 
        1   956 1 1  56 ILE HG12 H  -5.412  -0.111  -2.645 1.00 . A A .  56 ILE HG12 1 1 
        1   957 1 1  56 ILE HG13 H  -4.674   0.838  -3.926 1.00 . A A .  56 ILE HG13 1 1 
        1   958 1 1  56 ILE HG21 H  -3.095  -1.679  -5.227 1.00 . A A .  56 ILE HG21 1 1 
        1   959 1 1  56 ILE HG22 H  -1.621  -1.357  -4.313 1.00 . A A .  56 ILE HG22 1 1 
        1   960 1 1  56 ILE HG23 H  -2.513  -0.023  -5.043 1.00 . A A .  56 ILE HG23 1 1 
        1   961 1 1  56 ILE N    N  -4.269  -2.015  -1.171 1.00 . A A .  56 ILE N    1 1 
        1   962 1 1  56 ILE O    O  -1.487  -2.323  -1.383 1.00 . A A .  56 ILE O    1 1 
        1   963 1 1  57 ILE C    C   0.105  -4.228  -4.329 1.00 . A A .  57 ILE C    1 1 
        1   964 1 1  57 ILE CA   C  -0.516  -4.478  -2.940 1.00 . A A .  57 ILE CA   1 1 
        1   965 1 1  57 ILE CB   C  -0.486  -6.026  -2.606 1.00 . A A .  57 ILE CB   1 1 
        1   966 1 1  57 ILE CD1  C  -1.239  -7.778  -0.825 1.00 . A A .  57 ILE CD1  1 1 
        1   967 1 1  57 ILE CG1  C  -1.184  -6.311  -1.236 1.00 . A A .  57 ILE CG1  1 1 
        1   968 1 1  57 ILE CG2  C   0.974  -6.576  -2.606 1.00 . A A .  57 ILE CG2  1 1 
        1   969 1 1  57 ILE H    H  -2.587  -4.376  -3.456 1.00 . A A .  57 ILE H    1 1 
        1   970 1 1  57 ILE HA   H   0.080  -3.954  -2.185 1.00 . A A .  57 ILE HA   1 1 
        1   971 1 1  57 ILE HB   H  -1.033  -6.550  -3.390 1.00 . A A .  57 ILE HB   1 1 
        1   972 1 1  57 ILE HD11 H  -1.750  -7.862   0.123 1.00 . A A .  57 ILE HD11 1 1 
        1   973 1 1  57 ILE HD12 H  -0.235  -8.168  -0.726 1.00 . A A .  57 ILE HD12 1 1 
        1   974 1 1  57 ILE HD13 H  -1.776  -8.347  -1.572 1.00 . A A .  57 ILE HD13 1 1 
        1   975 1 1  57 ILE HG12 H  -0.665  -5.781  -0.452 1.00 . A A .  57 ILE HG12 1 1 
        1   976 1 1  57 ILE HG13 H  -2.206  -5.953  -1.279 1.00 . A A .  57 ILE HG13 1 1 
        1   977 1 1  57 ILE HG21 H   0.968  -7.635  -2.380 1.00 . A A .  57 ILE HG21 1 1 
        1   978 1 1  57 ILE HG22 H   1.562  -6.057  -1.863 1.00 . A A .  57 ILE HG22 1 1 
        1   979 1 1  57 ILE HG23 H   1.423  -6.427  -3.583 1.00 . A A .  57 ILE HG23 1 1 
        1   980 1 1  57 ILE N    N  -1.890  -3.920  -2.929 1.00 . A A .  57 ILE N    1 1 
        1   981 1 1  57 ILE O    O  -0.586  -4.338  -5.346 1.00 . A A .  57 ILE O    1 1 
        1   982 1 1  58 SER C    C   3.654  -4.013  -5.297 1.00 . A A .  58 SER C    1 1 
        1   983 1 1  58 SER CA   C   2.177  -3.690  -5.579 1.00 . A A .  58 SER CA   1 1 
        1   984 1 1  58 SER CB   C   2.015  -2.255  -6.144 1.00 . A A .  58 SER CB   1 1 
        1   985 1 1  58 SER H    H   1.839  -3.681  -3.499 1.00 . A A .  58 SER H    1 1 
        1   986 1 1  58 SER HA   H   1.807  -4.402  -6.313 1.00 . A A .  58 SER HA   1 1 
        1   987 1 1  58 SER HB2  H   0.963  -2.043  -6.301 1.00 . A A .  58 SER HB2  1 1 
        1   988 1 1  58 SER HB3  H   2.417  -1.541  -5.440 1.00 . A A .  58 SER HB3  1 1 
        1   989 1 1  58 SER HG   H   2.165  -2.506  -8.086 1.00 . A A .  58 SER HG   1 1 
        1   990 1 1  58 SER N    N   1.393  -3.855  -4.351 1.00 . A A .  58 SER N    1 1 
        1   991 1 1  58 SER O    O   4.088  -4.060  -4.138 1.00 . A A .  58 SER O    1 1 
        1   992 1 1  58 SER OG   O   2.687  -2.097  -7.387 1.00 . A A .  58 SER OG   1 1 
        1   993 1 1  59 ASN C    C   6.701  -3.450  -6.931 1.00 . A A .  59 ASN C    1 1 
        1   994 1 1  59 ASN CA   C   5.846  -4.581  -6.324 1.00 . A A .  59 ASN CA   1 1 
        1   995 1 1  59 ASN CB   C   6.079  -5.931  -7.065 1.00 . A A .  59 ASN CB   1 1 
        1   996 1 1  59 ASN CG   C   5.476  -5.991  -8.486 1.00 . A A .  59 ASN CG   1 1 
        1   997 1 1  59 ASN H    H   3.987  -4.155  -7.254 1.00 . A A .  59 ASN H    1 1 
        1   998 1 1  59 ASN HA   H   6.139  -4.701  -5.282 1.00 . A A .  59 ASN HA   1 1 
        1   999 1 1  59 ASN HB2  H   7.143  -6.115  -7.151 1.00 . A A .  59 ASN HB2  1 1 
        1  1000 1 1  59 ASN HB3  H   5.642  -6.730  -6.471 1.00 . A A .  59 ASN HB3  1 1 
        1  1001 1 1  59 ASN HD21 H   5.055  -7.913  -8.254 1.00 . A A .  59 ASN HD21 1 1 
        1  1002 1 1  59 ASN HD22 H   4.614  -7.224  -9.771 1.00 . A A .  59 ASN HD22 1 1 
        1  1003 1 1  59 ASN N    N   4.410  -4.235  -6.374 1.00 . A A .  59 ASN N    1 1 
        1  1004 1 1  59 ASN ND2  N   5.003  -7.159  -8.877 1.00 . A A .  59 ASN ND2  1 1 
        1  1005 1 1  59 ASN O    O   7.920  -3.413  -6.732 1.00 . A A .  59 ASN O    1 1 
        1  1006 1 1  59 ASN OD1  O   5.409  -4.997  -9.213 1.00 . A A .  59 ASN OD1  1 1 
        1  1007 1 1  60 ASP C    C   6.392  -0.077  -7.804 1.00 . A A .  60 ASP C    1 1 
        1  1008 1 1  60 ASP CA   C   6.699  -1.456  -8.424 1.00 . A A .  60 ASP CA   1 1 
        1  1009 1 1  60 ASP CB   C   6.220  -1.527  -9.898 1.00 . A A .  60 ASP CB   1 1 
        1  1010 1 1  60 ASP CG   C   6.905  -0.497 -10.818 1.00 . A A .  60 ASP CG   1 1 
        1  1011 1 1  60 ASP H    H   5.058  -2.535  -7.632 1.00 . A A .  60 ASP H    1 1 
        1  1012 1 1  60 ASP HA   H   7.775  -1.625  -8.395 1.00 . A A .  60 ASP HA   1 1 
        1  1013 1 1  60 ASP HB2  H   6.418  -2.522 -10.281 1.00 . A A .  60 ASP HB2  1 1 
        1  1014 1 1  60 ASP HB3  H   5.144  -1.363  -9.929 1.00 . A A .  60 ASP HB3  1 1 
        1  1015 1 1  60 ASP N    N   6.039  -2.518  -7.644 1.00 . A A .  60 ASP N    1 1 
        1  1016 1 1  60 ASP O    O   5.231   0.244  -7.518 1.00 . A A .  60 ASP O    1 1 
        1  1017 1 1  60 ASP OD1  O   8.002  -0.780 -11.344 1.00 . A A .  60 ASP OD1  1 1 
        1  1018 1 1  60 ASP OD2  O   6.357   0.607 -11.008 1.00 . A A .  60 ASP OD2  1 1 
        1  1019 1 1  61 LYS C    C   6.742   3.128  -7.826 1.00 . A A .  61 LYS C    1 1 
        1  1020 1 1  61 LYS CA   C   7.400   2.045  -6.961 1.00 . A A .  61 LYS CA   1 1 
        1  1021 1 1  61 LYS CB   C   8.826   2.500  -6.601 1.00 . A A .  61 LYS CB   1 1 
        1  1022 1 1  61 LYS CD   C  11.062   1.987  -5.523 1.00 . A A .  61 LYS CD   1 1 
        1  1023 1 1  61 LYS CE   C  11.910   1.004  -4.721 1.00 . A A .  61 LYS CE   1 1 
        1  1024 1 1  61 LYS CG   C   9.604   1.528  -5.698 1.00 . A A .  61 LYS CG   1 1 
        1  1025 1 1  61 LYS H    H   8.315   0.438  -7.992 1.00 . A A .  61 LYS H    1 1 
        1  1026 1 1  61 LYS HA   H   6.829   1.925  -6.044 1.00 . A A .  61 LYS HA   1 1 
        1  1027 1 1  61 LYS HB2  H   9.391   2.633  -7.522 1.00 . A A .  61 LYS HB2  1 1 
        1  1028 1 1  61 LYS HB3  H   8.772   3.460  -6.093 1.00 . A A .  61 LYS HB3  1 1 
        1  1029 1 1  61 LYS HD2  H  11.513   2.106  -6.502 1.00 . A A .  61 LYS HD2  1 1 
        1  1030 1 1  61 LYS HD3  H  11.070   2.945  -5.014 1.00 . A A .  61 LYS HD3  1 1 
        1  1031 1 1  61 LYS HE2  H  11.546   0.964  -3.702 1.00 . A A .  61 LYS HE2  1 1 
        1  1032 1 1  61 LYS HE3  H  11.837   0.022  -5.167 1.00 . A A .  61 LYS HE3  1 1 
        1  1033 1 1  61 LYS HG2  H   9.122   1.482  -4.723 1.00 . A A .  61 LYS HG2  1 1 
        1  1034 1 1  61 LYS HG3  H   9.593   0.542  -6.148 1.00 . A A .  61 LYS HG3  1 1 
        1  1035 1 1  61 LYS HZ1  H  13.423   2.364  -4.276 1.00 . A A .  61 LYS HZ1  1 1 
        1  1036 1 1  61 LYS HZ2  H  13.712   1.465  -5.680 1.00 . A A .  61 LYS HZ2  1 1 
        1  1037 1 1  61 LYS HZ3  H  13.890   0.755  -4.165 1.00 . A A .  61 LYS HZ3  1 1 
        1  1038 1 1  61 LYS N    N   7.451   0.735  -7.640 1.00 . A A .  61 LYS N    1 1 
        1  1039 1 1  61 LYS NZ   N  13.331   1.423  -4.710 1.00 . A A .  61 LYS NZ   1 1 
        1  1040 1 1  61 LYS O    O   6.102   4.033  -7.290 1.00 . A A .  61 LYS O    1 1 
        1  1041 1 1  62 GLN C    C   4.887   4.055 -10.100 1.00 . A A .  62 GLN C    1 1 
        1  1042 1 1  62 GLN CA   C   6.426   4.042 -10.119 1.00 . A A .  62 GLN CA   1 1 
        1  1043 1 1  62 GLN CB   C   6.946   3.765 -11.562 1.00 . A A .  62 GLN CB   1 1 
        1  1044 1 1  62 GLN CD   C   9.347   4.810 -11.430 1.00 . A A .  62 GLN CD   1 1 
        1  1045 1 1  62 GLN CG   C   8.477   3.562 -11.697 1.00 . A A .  62 GLN CG   1 1 
        1  1046 1 1  62 GLN H    H   7.412   2.250  -9.509 1.00 . A A .  62 GLN H    1 1 
        1  1047 1 1  62 GLN HA   H   6.792   5.016  -9.797 1.00 . A A .  62 GLN HA   1 1 
        1  1048 1 1  62 GLN HB2  H   6.459   2.868 -11.936 1.00 . A A .  62 GLN HB2  1 1 
        1  1049 1 1  62 GLN HB3  H   6.661   4.593 -12.201 1.00 . A A .  62 GLN HB3  1 1 
        1  1050 1 1  62 GLN HE21 H  10.730   4.153 -12.693 1.00 . A A .  62 GLN HE21 1 1 
        1  1051 1 1  62 GLN HE22 H  11.065   5.662 -11.923 1.00 . A A .  62 GLN HE22 1 1 
        1  1052 1 1  62 GLN HG2  H   8.780   2.794 -11.000 1.00 . A A .  62 GLN HG2  1 1 
        1  1053 1 1  62 GLN HG3  H   8.680   3.211 -12.706 1.00 . A A .  62 GLN HG3  1 1 
        1  1054 1 1  62 GLN N    N   6.934   3.034  -9.161 1.00 . A A .  62 GLN N    1 1 
        1  1055 1 1  62 GLN NE2  N  10.495   4.882 -12.081 1.00 . A A .  62 GLN NE2  1 1 
        1  1056 1 1  62 GLN O    O   4.269   5.118 -10.251 1.00 . A A .  62 GLN O    1 1 
        1  1057 1 1  62 GLN OE1  O   9.011   5.690 -10.638 1.00 . A A .  62 GLN OE1  1 1 
        1  1058 1 1  63 LEU C    C   2.338   3.387  -8.489 1.00 . A A .  63 LEU C    1 1 
        1  1059 1 1  63 LEU CA   C   2.840   2.672  -9.754 1.00 . A A .  63 LEU CA   1 1 
        1  1060 1 1  63 LEU CB   C   2.464   1.153  -9.689 1.00 . A A .  63 LEU CB   1 1 
        1  1061 1 1  63 LEU CD1  C   2.442  -1.194 -10.735 1.00 . A A .  63 LEU CD1  1 1 
        1  1062 1 1  63 LEU CD2  C   2.791   0.849 -12.224 1.00 . A A .  63 LEU CD2  1 1 
        1  1063 1 1  63 LEU CG   C   3.016   0.239 -10.829 1.00 . A A .  63 LEU CG   1 1 
        1  1064 1 1  63 LEU H    H   4.872   2.067  -9.767 1.00 . A A .  63 LEU H    1 1 
        1  1065 1 1  63 LEU HA   H   2.369   3.116 -10.630 1.00 . A A .  63 LEU HA   1 1 
        1  1066 1 1  63 LEU HB2  H   2.818   0.755  -8.740 1.00 . A A .  63 LEU HB2  1 1 
        1  1067 1 1  63 LEU HB3  H   1.381   1.076  -9.695 1.00 . A A .  63 LEU HB3  1 1 
        1  1068 1 1  63 LEU HD11 H   1.365  -1.167 -10.845 1.00 . A A .  63 LEU HD11 1 1 
        1  1069 1 1  63 LEU HD12 H   2.690  -1.623  -9.773 1.00 . A A .  63 LEU HD12 1 1 
        1  1070 1 1  63 LEU HD13 H   2.866  -1.811 -11.515 1.00 . A A .  63 LEU HD13 1 1 
        1  1071 1 1  63 LEU HD21 H   3.169   0.176 -12.982 1.00 . A A .  63 LEU HD21 1 1 
        1  1072 1 1  63 LEU HD22 H   3.318   1.792 -12.297 1.00 . A A .  63 LEU HD22 1 1 
        1  1073 1 1  63 LEU HD23 H   1.736   1.017 -12.391 1.00 . A A .  63 LEU HD23 1 1 
        1  1074 1 1  63 LEU HG   H   4.090   0.150 -10.696 1.00 . A A .  63 LEU HG   1 1 
        1  1075 1 1  63 LEU N    N   4.297   2.855  -9.877 1.00 . A A .  63 LEU N    1 1 
        1  1076 1 1  63 LEU O    O   1.482   4.279  -8.556 1.00 . A A .  63 LEU O    1 1 
        1  1077 1 1  64 LEU C    C   2.652   5.031  -5.948 1.00 . A A .  64 LEU C    1 1 
        1  1078 1 1  64 LEU CA   C   2.597   3.505  -6.000 1.00 . A A .  64 LEU CA   1 1 
        1  1079 1 1  64 LEU CB   C   3.576   2.928  -4.952 1.00 . A A .  64 LEU CB   1 1 
        1  1080 1 1  64 LEU CD1  C   4.750   0.924  -3.937 1.00 . A A .  64 LEU CD1  1 1 
        1  1081 1 1  64 LEU CD2  C   2.235   0.854  -4.281 1.00 . A A .  64 LEU CD2  1 1 
        1  1082 1 1  64 LEU CG   C   3.585   1.381  -4.818 1.00 . A A .  64 LEU CG   1 1 
        1  1083 1 1  64 LEU H    H   3.661   2.335  -7.412 1.00 . A A .  64 LEU H    1 1 
        1  1084 1 1  64 LEU HA   H   1.592   3.168  -5.767 1.00 . A A .  64 LEU HA   1 1 
        1  1085 1 1  64 LEU HB2  H   4.579   3.256  -5.215 1.00 . A A .  64 LEU HB2  1 1 
        1  1086 1 1  64 LEU HB3  H   3.332   3.349  -3.978 1.00 . A A .  64 LEU HB3  1 1 
        1  1087 1 1  64 LEU HD11 H   5.685   1.263  -4.363 1.00 . A A .  64 LEU HD11 1 1 
        1  1088 1 1  64 LEU HD12 H   4.762  -0.158  -3.881 1.00 . A A .  64 LEU HD12 1 1 
        1  1089 1 1  64 LEU HD13 H   4.644   1.330  -2.937 1.00 . A A .  64 LEU HD13 1 1 
        1  1090 1 1  64 LEU HD21 H   1.444   1.108  -4.976 1.00 . A A .  64 LEU HD21 1 1 
        1  1091 1 1  64 LEU HD22 H   2.022   1.297  -3.317 1.00 . A A .  64 LEU HD22 1 1 
        1  1092 1 1  64 LEU HD23 H   2.281  -0.221  -4.179 1.00 . A A .  64 LEU HD23 1 1 
        1  1093 1 1  64 LEU HG   H   3.736   0.949  -5.801 1.00 . A A .  64 LEU HG   1 1 
        1  1094 1 1  64 LEU N    N   2.941   2.996  -7.344 1.00 . A A .  64 LEU N    1 1 
        1  1095 1 1  64 LEU O    O   1.745   5.664  -5.425 1.00 . A A .  64 LEU O    1 1 
        1  1096 1 1  65 LYS C    C   2.919   7.826  -7.240 1.00 . A A .  65 LYS C    1 1 
        1  1097 1 1  65 LYS CA   C   4.030   7.019  -6.529 1.00 . A A .  65 LYS CA   1 1 
        1  1098 1 1  65 LYS CB   C   5.423   7.239  -7.176 1.00 . A A .  65 LYS CB   1 1 
        1  1099 1 1  65 LYS CD   C   7.421   8.786  -7.666 1.00 . A A .  65 LYS CD   1 1 
        1  1100 1 1  65 LYS CE   C   7.545   8.294  -9.125 1.00 . A A .  65 LYS CE   1 1 
        1  1101 1 1  65 LYS CG   C   5.977   8.679  -7.104 1.00 . A A .  65 LYS CG   1 1 
        1  1102 1 1  65 LYS H    H   4.325   4.987  -7.036 1.00 . A A .  65 LYS H    1 1 
        1  1103 1 1  65 LYS HA   H   4.074   7.334  -5.487 1.00 . A A .  65 LYS HA   1 1 
        1  1104 1 1  65 LYS HB2  H   6.136   6.586  -6.680 1.00 . A A .  65 LYS HB2  1 1 
        1  1105 1 1  65 LYS HB3  H   5.369   6.948  -8.222 1.00 . A A .  65 LYS HB3  1 1 
        1  1106 1 1  65 LYS HD2  H   7.738   9.822  -7.622 1.00 . A A .  65 LYS HD2  1 1 
        1  1107 1 1  65 LYS HD3  H   8.082   8.192  -7.042 1.00 . A A .  65 LYS HD3  1 1 
        1  1108 1 1  65 LYS HE2  H   7.168   7.280  -9.195 1.00 . A A .  65 LYS HE2  1 1 
        1  1109 1 1  65 LYS HE3  H   6.957   8.935  -9.773 1.00 . A A .  65 LYS HE3  1 1 
        1  1110 1 1  65 LYS HG2  H   5.325   9.339  -7.669 1.00 . A A .  65 LYS HG2  1 1 
        1  1111 1 1  65 LYS HG3  H   5.979   8.996  -6.064 1.00 . A A .  65 LYS HG3  1 1 
        1  1112 1 1  65 LYS HZ1  H   9.318   9.280  -9.620 1.00 . A A .  65 LYS HZ1  1 1 
        1  1113 1 1  65 LYS HZ2  H   9.022   7.904 -10.552 1.00 . A A .  65 LYS HZ2  1 1 
        1  1114 1 1  65 LYS HZ3  H   9.555   7.745  -8.960 1.00 . A A .  65 LYS HZ3  1 1 
        1  1115 1 1  65 LYS N    N   3.722   5.580  -6.545 1.00 . A A .  65 LYS N    1 1 
        1  1116 1 1  65 LYS NZ   N   8.958   8.308  -9.595 1.00 . A A .  65 LYS NZ   1 1 
        1  1117 1 1  65 LYS O    O   2.589   8.944  -6.812 1.00 . A A .  65 LYS O    1 1 
        1  1118 1 1  66 GLU C    C  -0.055   7.766  -7.974 1.00 . A A .  66 GLU C    1 1 
        1  1119 1 1  66 GLU CA   C   1.120   7.763  -8.964 1.00 . A A .  66 GLU CA   1 1 
        1  1120 1 1  66 GLU CB   C   0.736   6.941 -10.229 1.00 . A A .  66 GLU CB   1 1 
        1  1121 1 1  66 GLU CD   C   1.343   6.167 -12.590 1.00 . A A .  66 GLU CD   1 1 
        1  1122 1 1  66 GLU CG   C   1.776   6.974 -11.355 1.00 . A A .  66 GLU CG   1 1 
        1  1123 1 1  66 GLU H    H   2.755   6.429  -8.690 1.00 . A A .  66 GLU H    1 1 
        1  1124 1 1  66 GLU HA   H   1.327   8.789  -9.266 1.00 . A A .  66 GLU HA   1 1 
        1  1125 1 1  66 GLU HB2  H   0.580   5.904  -9.942 1.00 . A A .  66 GLU HB2  1 1 
        1  1126 1 1  66 GLU HB3  H  -0.198   7.329 -10.624 1.00 . A A .  66 GLU HB3  1 1 
        1  1127 1 1  66 GLU HG2  H   1.946   8.006 -11.651 1.00 . A A .  66 GLU HG2  1 1 
        1  1128 1 1  66 GLU HG3  H   2.707   6.570 -10.972 1.00 . A A .  66 GLU HG3  1 1 
        1  1129 1 1  66 GLU N    N   2.338   7.233  -8.314 1.00 . A A .  66 GLU N    1 1 
        1  1130 1 1  66 GLU O    O  -0.653   8.818  -7.730 1.00 . A A .  66 GLU O    1 1 
        1  1131 1 1  66 GLU OE1  O   0.443   6.637 -13.320 1.00 . A A .  66 GLU OE1  1 1 
        1  1132 1 1  66 GLU OE2  O   1.884   5.060 -12.827 1.00 . A A .  66 GLU OE2  1 1 
        1  1133 1 1  67 MET C    C  -1.513   7.277  -5.244 1.00 . A A .  67 MET C    1 1 
        1  1134 1 1  67 MET CA   C  -1.544   6.397  -6.519 1.00 . A A .  67 MET CA   1 1 
        1  1135 1 1  67 MET CB   C  -1.776   4.898  -6.147 1.00 . A A .  67 MET CB   1 1 
        1  1136 1 1  67 MET CE   C  -0.677   1.702  -6.966 1.00 . A A .  67 MET CE   1 1 
        1  1137 1 1  67 MET CG   C  -2.279   3.995  -7.301 1.00 . A A .  67 MET CG   1 1 
        1  1138 1 1  67 MET H    H   0.250   5.815  -7.519 1.00 . A A .  67 MET H    1 1 
        1  1139 1 1  67 MET HA   H  -2.395   6.726  -7.111 1.00 . A A .  67 MET HA   1 1 
        1  1140 1 1  67 MET HB2  H  -0.843   4.483  -5.783 1.00 . A A .  67 MET HB2  1 1 
        1  1141 1 1  67 MET HB3  H  -2.504   4.850  -5.339 1.00 . A A .  67 MET HB3  1 1 
        1  1142 1 1  67 MET HE1  H  -1.584   1.124  -6.848 1.00 . A A .  67 MET HE1  1 1 
        1  1143 1 1  67 MET HE2  H  -0.371   2.098  -6.010 1.00 . A A .  67 MET HE2  1 1 
        1  1144 1 1  67 MET HE3  H   0.102   1.066  -7.359 1.00 . A A .  67 MET HE3  1 1 
        1  1145 1 1  67 MET HG2  H  -3.002   3.289  -6.909 1.00 . A A .  67 MET HG2  1 1 
        1  1146 1 1  67 MET HG3  H  -2.770   4.608  -8.047 1.00 . A A .  67 MET HG3  1 1 
        1  1147 1 1  67 MET N    N  -0.352   6.583  -7.378 1.00 . A A .  67 MET N    1 1 
        1  1148 1 1  67 MET O    O  -2.564   7.715  -4.795 1.00 . A A .  67 MET O    1 1 
        1  1149 1 1  67 MET SD   S  -0.974   3.050  -8.116 1.00 . A A .  67 MET SD   1 1 
        1  1150 1 1  68 LEU C    C  -0.745   9.850  -3.810 1.00 . A A .  68 LEU C    1 1 
        1  1151 1 1  68 LEU CA   C  -0.151   8.454  -3.508 1.00 . A A .  68 LEU CA   1 1 
        1  1152 1 1  68 LEU CB   C   1.351   8.579  -3.115 1.00 . A A .  68 LEU CB   1 1 
        1  1153 1 1  68 LEU CD1  C   3.569   7.480  -2.469 1.00 . A A .  68 LEU CD1  1 1 
        1  1154 1 1  68 LEU CD2  C   1.401   6.561  -1.503 1.00 . A A .  68 LEU CD2  1 1 
        1  1155 1 1  68 LEU CG   C   2.070   7.248  -2.716 1.00 . A A .  68 LEU CG   1 1 
        1  1156 1 1  68 LEU H    H   0.478   7.093  -5.029 1.00 . A A .  68 LEU H    1 1 
        1  1157 1 1  68 LEU HA   H  -0.693   8.018  -2.675 1.00 . A A .  68 LEU HA   1 1 
        1  1158 1 1  68 LEU HB2  H   1.880   9.013  -3.957 1.00 . A A .  68 LEU HB2  1 1 
        1  1159 1 1  68 LEU HB3  H   1.434   9.269  -2.276 1.00 . A A .  68 LEU HB3  1 1 
        1  1160 1 1  68 LEU HD11 H   4.050   6.541  -2.223 1.00 . A A .  68 LEU HD11 1 1 
        1  1161 1 1  68 LEU HD12 H   3.706   8.175  -1.650 1.00 . A A .  68 LEU HD12 1 1 
        1  1162 1 1  68 LEU HD13 H   4.026   7.886  -3.361 1.00 . A A .  68 LEU HD13 1 1 
        1  1163 1 1  68 LEU HD21 H   0.375   6.317  -1.745 1.00 . A A .  68 LEU HD21 1 1 
        1  1164 1 1  68 LEU HD22 H   1.420   7.222  -0.646 1.00 . A A .  68 LEU HD22 1 1 
        1  1165 1 1  68 LEU HD23 H   1.930   5.648  -1.262 1.00 . A A .  68 LEU HD23 1 1 
        1  1166 1 1  68 LEU HG   H   1.997   6.563  -3.552 1.00 . A A .  68 LEU HG   1 1 
        1  1167 1 1  68 LEU N    N  -0.314   7.541  -4.678 1.00 . A A .  68 LEU N    1 1 
        1  1168 1 1  68 LEU O    O  -1.373  10.469  -2.948 1.00 . A A .  68 LEU O    1 1 
        1  1169 1 1  69 GLU C    C  -2.531  11.495  -6.009 1.00 . A A .  69 GLU C    1 1 
        1  1170 1 1  69 GLU CA   C  -1.054  11.585  -5.568 1.00 . A A .  69 GLU CA   1 1 
        1  1171 1 1  69 GLU CB   C  -0.176  12.047  -6.755 1.00 . A A .  69 GLU CB   1 1 
        1  1172 1 1  69 GLU CD   C   1.518  13.405  -5.395 1.00 . A A .  69 GLU CD   1 1 
        1  1173 1 1  69 GLU CG   C   1.305  12.272  -6.412 1.00 . A A .  69 GLU CG   1 1 
        1  1174 1 1  69 GLU H    H  -0.054   9.716  -5.682 1.00 . A A .  69 GLU H    1 1 
        1  1175 1 1  69 GLU HA   H  -0.967  12.318  -4.766 1.00 . A A .  69 GLU HA   1 1 
        1  1176 1 1  69 GLU HB2  H  -0.230  11.298  -7.540 1.00 . A A .  69 GLU HB2  1 1 
        1  1177 1 1  69 GLU HB3  H  -0.573  12.980  -7.149 1.00 . A A .  69 GLU HB3  1 1 
        1  1178 1 1  69 GLU HG2  H   1.709  11.347  -6.015 1.00 . A A .  69 GLU HG2  1 1 
        1  1179 1 1  69 GLU HG3  H   1.841  12.521  -7.322 1.00 . A A .  69 GLU HG3  1 1 
        1  1180 1 1  69 GLU N    N  -0.554  10.293  -5.064 1.00 . A A .  69 GLU N    1 1 
        1  1181 1 1  69 GLU O    O  -3.301  12.428  -5.776 1.00 . A A .  69 GLU O    1 1 
        1  1182 1 1  69 GLU OE1  O   1.350  14.587  -5.770 1.00 . A A .  69 GLU OE1  1 1 
        1  1183 1 1  69 GLU OE2  O   1.828  13.127  -4.222 1.00 . A A .  69 GLU OE2  1 1 
        1  1184 1 1  70 LEU C    C  -5.316  10.064  -6.118 1.00 . A A .  70 LEU C    1 1 
        1  1185 1 1  70 LEU CA   C  -4.252  10.156  -7.228 1.00 . A A .  70 LEU CA   1 1 
        1  1186 1 1  70 LEU CB   C  -4.269   8.878  -8.118 1.00 . A A .  70 LEU CB   1 1 
        1  1187 1 1  70 LEU CD1  C  -3.355   7.576 -10.137 1.00 . A A .  70 LEU CD1  1 1 
        1  1188 1 1  70 LEU CD2  C  -3.875  10.065 -10.353 1.00 . A A .  70 LEU CD2  1 1 
        1  1189 1 1  70 LEU CG   C  -3.392   8.941  -9.411 1.00 . A A .  70 LEU CG   1 1 
        1  1190 1 1  70 LEU H    H  -2.248   9.648  -6.737 1.00 . A A .  70 LEU H    1 1 
        1  1191 1 1  70 LEU HA   H  -4.476  11.017  -7.856 1.00 . A A .  70 LEU HA   1 1 
        1  1192 1 1  70 LEU HB2  H  -3.931   8.043  -7.513 1.00 . A A .  70 LEU HB2  1 1 
        1  1193 1 1  70 LEU HB3  H  -5.295   8.679  -8.420 1.00 . A A .  70 LEU HB3  1 1 
        1  1194 1 1  70 LEU HD11 H  -2.710   7.638 -11.004 1.00 . A A .  70 LEU HD11 1 1 
        1  1195 1 1  70 LEU HD12 H  -4.353   7.299 -10.455 1.00 . A A .  70 LEU HD12 1 1 
        1  1196 1 1  70 LEU HD13 H  -2.973   6.819  -9.465 1.00 . A A .  70 LEU HD13 1 1 
        1  1197 1 1  70 LEU HD21 H  -3.249  10.099 -11.234 1.00 . A A .  70 LEU HD21 1 1 
        1  1198 1 1  70 LEU HD22 H  -3.815  11.019  -9.840 1.00 . A A .  70 LEU HD22 1 1 
        1  1199 1 1  70 LEU HD23 H  -4.900   9.886 -10.649 1.00 . A A .  70 LEU HD23 1 1 
        1  1200 1 1  70 LEU HG   H  -2.373   9.176  -9.125 1.00 . A A .  70 LEU HG   1 1 
        1  1201 1 1  70 LEU N    N  -2.902  10.367  -6.653 1.00 . A A .  70 LEU N    1 1 
        1  1202 1 1  70 LEU O    O  -6.328  10.761  -6.161 1.00 . A A .  70 LEU O    1 1 
        1  1203 1 1  71 ILE C    C  -5.982  10.297  -3.087 1.00 . A A .  71 ILE C    1 1 
        1  1204 1 1  71 ILE CA   C  -5.895   8.995  -3.927 1.00 . A A .  71 ILE CA   1 1 
        1  1205 1 1  71 ILE CB   C  -5.320   7.791  -3.076 1.00 . A A .  71 ILE CB   1 1 
        1  1206 1 1  71 ILE CD1  C  -4.517   5.326  -3.331 1.00 . A A .  71 ILE CD1  1 1 
        1  1207 1 1  71 ILE CG1  C  -5.324   6.469  -3.926 1.00 . A A .  71 ILE CG1  1 1 
        1  1208 1 1  71 ILE CG2  C  -6.086   7.597  -1.746 1.00 . A A .  71 ILE CG2  1 1 
        1  1209 1 1  71 ILE H    H  -4.244   8.652  -5.219 1.00 . A A .  71 ILE H    1 1 
        1  1210 1 1  71 ILE HA   H  -6.898   8.729  -4.262 1.00 . A A .  71 ILE HA   1 1 
        1  1211 1 1  71 ILE HB   H  -4.288   8.031  -2.824 1.00 . A A .  71 ILE HB   1 1 
        1  1212 1 1  71 ILE HD11 H  -4.558   4.474  -3.996 1.00 . A A .  71 ILE HD11 1 1 
        1  1213 1 1  71 ILE HD12 H  -4.925   5.051  -2.371 1.00 . A A .  71 ILE HD12 1 1 
        1  1214 1 1  71 ILE HD13 H  -3.487   5.634  -3.209 1.00 . A A .  71 ILE HD13 1 1 
        1  1215 1 1  71 ILE HG12 H  -6.340   6.118  -4.045 1.00 . A A .  71 ILE HG12 1 1 
        1  1216 1 1  71 ILE HG13 H  -4.911   6.673  -4.908 1.00 . A A .  71 ILE HG13 1 1 
        1  1217 1 1  71 ILE HG21 H  -6.038   8.506  -1.158 1.00 . A A .  71 ILE HG21 1 1 
        1  1218 1 1  71 ILE HG22 H  -5.644   6.788  -1.179 1.00 . A A .  71 ILE HG22 1 1 
        1  1219 1 1  71 ILE HG23 H  -7.123   7.361  -1.951 1.00 . A A .  71 ILE HG23 1 1 
        1  1220 1 1  71 ILE N    N  -5.048   9.196  -5.131 1.00 . A A .  71 ILE N    1 1 
        1  1221 1 1  71 ILE O    O  -7.018  10.589  -2.460 1.00 . A A .  71 ILE O    1 1 
        1  1222 1 1  72 SER C    C  -5.771  13.432  -3.150 1.00 . A A .  72 SER C    1 1 
        1  1223 1 1  72 SER CA   C  -4.827  12.409  -2.462 1.00 . A A .  72 SER CA   1 1 
        1  1224 1 1  72 SER CB   C  -3.364  12.909  -2.463 1.00 . A A .  72 SER CB   1 1 
        1  1225 1 1  72 SER H    H  -4.106  10.775  -3.616 1.00 . A A .  72 SER H    1 1 
        1  1226 1 1  72 SER HA   H  -5.146  12.277  -1.432 1.00 . A A .  72 SER HA   1 1 
        1  1227 1 1  72 SER HB2  H  -2.721  12.139  -2.054 1.00 . A A .  72 SER HB2  1 1 
        1  1228 1 1  72 SER HB3  H  -3.053  13.122  -3.479 1.00 . A A .  72 SER HB3  1 1 
        1  1229 1 1  72 SER HG   H  -2.300  14.090  -1.317 1.00 . A A .  72 SER HG   1 1 
        1  1230 1 1  72 SER N    N  -4.896  11.092  -3.125 1.00 . A A .  72 SER N    1 1 
        1  1231 1 1  72 SER O    O  -6.265  14.356  -2.501 1.00 . A A .  72 SER O    1 1 
        1  1232 1 1  72 SER OG   O  -3.194  14.083  -1.685 1.00 . A A .  72 SER OG   1 1 
        1  1233 1 1  73 LYS C    C  -8.419  13.528  -4.985 1.00 . A A .  73 LYS C    1 1 
        1  1234 1 1  73 LYS CA   C  -6.994  14.037  -5.251 1.00 . A A .  73 LYS CA   1 1 
        1  1235 1 1  73 LYS CB   C  -6.714  13.902  -6.763 1.00 . A A .  73 LYS CB   1 1 
        1  1236 1 1  73 LYS CD   C  -5.035  13.981  -8.670 1.00 . A A .  73 LYS CD   1 1 
        1  1237 1 1  73 LYS CE   C  -3.728  14.580  -9.210 1.00 . A A .  73 LYS CE   1 1 
        1  1238 1 1  73 LYS CG   C  -5.344  14.426  -7.225 1.00 . A A .  73 LYS CG   1 1 
        1  1239 1 1  73 LYS H    H  -5.479  12.571  -4.943 1.00 . A A .  73 LYS H    1 1 
        1  1240 1 1  73 LYS HA   H  -6.918  15.082  -4.961 1.00 . A A .  73 LYS HA   1 1 
        1  1241 1 1  73 LYS HB2  H  -6.782  12.850  -7.031 1.00 . A A .  73 LYS HB2  1 1 
        1  1242 1 1  73 LYS HB3  H  -7.483  14.443  -7.312 1.00 . A A .  73 LYS HB3  1 1 
        1  1243 1 1  73 LYS HD2  H  -4.956  12.896  -8.690 1.00 . A A .  73 LYS HD2  1 1 
        1  1244 1 1  73 LYS HD3  H  -5.860  14.280  -9.305 1.00 . A A .  73 LYS HD3  1 1 
        1  1245 1 1  73 LYS HE2  H  -3.603  14.279 -10.241 1.00 . A A .  73 LYS HE2  1 1 
        1  1246 1 1  73 LYS HE3  H  -3.786  15.661  -9.160 1.00 . A A .  73 LYS HE3  1 1 
        1  1247 1 1  73 LYS HG2  H  -5.342  15.511  -7.177 1.00 . A A .  73 LYS HG2  1 1 
        1  1248 1 1  73 LYS HG3  H  -4.576  14.038  -6.565 1.00 . A A .  73 LYS HG3  1 1 
        1  1249 1 1  73 LYS HZ1  H  -2.658  14.370  -7.431 1.00 . A A .  73 LYS HZ1  1 1 
        1  1250 1 1  73 LYS HZ2  H  -1.684  14.583  -8.795 1.00 . A A .  73 LYS HZ2  1 1 
        1  1251 1 1  73 LYS HZ3  H  -2.432  13.097  -8.520 1.00 . A A .  73 LYS HZ3  1 1 
        1  1252 1 1  73 LYS N    N  -6.003  13.252  -4.470 1.00 . A A .  73 LYS N    1 1 
        1  1253 1 1  73 LYS NZ   N  -2.545  14.126  -8.434 1.00 . A A .  73 LYS NZ   1 1 
        1  1254 1 1  73 LYS O    O  -9.362  14.315  -4.880 1.00 . A A .  73 LYS O    1 1 
        1  1255 1 1  74 LEU C    C -10.417  11.850  -3.290 1.00 . A A .  74 LEU C    1 1 
        1  1256 1 1  74 LEU CA   C  -9.833  11.486  -4.673 1.00 . A A .  74 LEU CA   1 1 
        1  1257 1 1  74 LEU CB   C  -9.656   9.940  -4.789 1.00 . A A .  74 LEU CB   1 1 
        1  1258 1 1  74 LEU CD1  C  -8.974   7.859  -6.130 1.00 . A A .  74 LEU CD1  1 1 
        1  1259 1 1  74 LEU CD2  C -10.243   9.751  -7.286 1.00 . A A .  74 LEU CD2  1 1 
        1  1260 1 1  74 LEU CG   C  -9.221   9.385  -6.185 1.00 . A A .  74 LEU CG   1 1 
        1  1261 1 1  74 LEU H    H  -7.727  11.642  -4.966 1.00 . A A .  74 LEU H    1 1 
        1  1262 1 1  74 LEU HA   H -10.527  11.817  -5.437 1.00 . A A .  74 LEU HA   1 1 
        1  1263 1 1  74 LEU HB2  H  -8.914   9.632  -4.057 1.00 . A A .  74 LEU HB2  1 1 
        1  1264 1 1  74 LEU HB3  H -10.598   9.467  -4.523 1.00 . A A .  74 LEU HB3  1 1 
        1  1265 1 1  74 LEU HD11 H  -8.639   7.507  -7.098 1.00 . A A .  74 LEU HD11 1 1 
        1  1266 1 1  74 LEU HD12 H  -9.887   7.344  -5.860 1.00 . A A .  74 LEU HD12 1 1 
        1  1267 1 1  74 LEU HD13 H  -8.211   7.644  -5.393 1.00 . A A .  74 LEU HD13 1 1 
        1  1268 1 1  74 LEU HD21 H -10.324  10.827  -7.360 1.00 . A A .  74 LEU HD21 1 1 
        1  1269 1 1  74 LEU HD22 H -11.214   9.334  -7.045 1.00 . A A .  74 LEU HD22 1 1 
        1  1270 1 1  74 LEU HD23 H  -9.912   9.357  -8.238 1.00 . A A .  74 LEU HD23 1 1 
        1  1271 1 1  74 LEU HG   H  -8.279   9.845  -6.459 1.00 . A A .  74 LEU HG   1 1 
        1  1272 1 1  74 LEU N    N  -8.541  12.185  -4.905 1.00 . A A .  74 LEU N    1 1 
        1  1273 1 1  74 LEU O    O -11.633  11.780  -3.088 1.00 . A A .  74 LEU O    1 1 
        1  1274 1 1  75 GLY C    C -10.105  11.575  -0.031 1.00 . A A .  75 GLY C    1 1 
        1  1275 1 1  75 GLY CA   C  -9.923  12.699  -1.031 1.00 . A A .  75 GLY CA   1 1 
        1  1276 1 1  75 GLY H    H  -8.569  12.155  -2.567 1.00 . A A .  75 GLY H    1 1 
        1  1277 1 1  75 GLY HA2  H  -9.153  13.365  -0.665 1.00 . A A .  75 GLY HA2  1 1 
        1  1278 1 1  75 GLY HA3  H -10.847  13.262  -1.110 1.00 . A A .  75 GLY HA3  1 1 
        1  1279 1 1  75 GLY N    N  -9.525  12.221  -2.351 1.00 . A A .  75 GLY N    1 1 
        1  1280 1 1  75 GLY O    O -11.155  11.461   0.614 1.00 . A A .  75 GLY O    1 1 
        1  1281 1 1  76 TYR C    C  -7.785   9.662   1.889 1.00 . A A .  76 TYR C    1 1 
        1  1282 1 1  76 TYR CA   C  -9.042   9.596   1.022 1.00 . A A .  76 TYR CA   1 1 
        1  1283 1 1  76 TYR CB   C  -9.077   8.251   0.248 1.00 . A A .  76 TYR CB   1 1 
        1  1284 1 1  76 TYR CD1  C -11.610   8.235  -0.071 1.00 . A A .  76 TYR CD1  1 1 
        1  1285 1 1  76 TYR CD2  C -10.253   7.533  -1.914 1.00 . A A .  76 TYR CD2  1 1 
        1  1286 1 1  76 TYR CE1  C -12.745   8.007  -0.818 1.00 . A A .  76 TYR CE1  1 1 
        1  1287 1 1  76 TYR CE2  C -11.392   7.304  -2.662 1.00 . A A .  76 TYR CE2  1 1 
        1  1288 1 1  76 TYR CG   C -10.336   8.009  -0.598 1.00 . A A .  76 TYR CG   1 1 
        1  1289 1 1  76 TYR CZ   C -12.631   7.544  -2.109 1.00 . A A .  76 TYR CZ   1 1 
        1  1290 1 1  76 TYR H    H  -8.271  10.921  -0.454 1.00 . A A .  76 TYR H    1 1 
        1  1291 1 1  76 TYR HA   H  -9.911   9.654   1.675 1.00 . A A .  76 TYR HA   1 1 
        1  1292 1 1  76 TYR HB2  H  -8.225   8.210  -0.413 1.00 . A A .  76 TYR HB2  1 1 
        1  1293 1 1  76 TYR HB3  H  -9.002   7.430   0.955 1.00 . A A .  76 TYR HB3  1 1 
        1  1294 1 1  76 TYR HD1  H -11.706   8.600   0.944 1.00 . A A .  76 TYR HD1  1 1 
        1  1295 1 1  76 TYR HD2  H  -9.275   7.330  -2.348 1.00 . A A .  76 TYR HD2  1 1 
        1  1296 1 1  76 TYR HE1  H -13.719   8.187  -0.385 1.00 . A A .  76 TYR HE1  1 1 
        1  1297 1 1  76 TYR HE2  H -11.306   6.941  -3.678 1.00 . A A .  76 TYR HE2  1 1 
        1  1298 1 1  76 TYR HH   H -13.674   6.490  -3.322 1.00 . A A .  76 TYR HH   1 1 
        1  1299 1 1  76 TYR N    N  -9.067  10.739   0.089 1.00 . A A .  76 TYR N    1 1 
        1  1300 1 1  76 TYR O    O  -6.870  10.457   1.616 1.00 . A A .  76 TYR O    1 1 
        1  1301 1 1  76 TYR OH   O -13.761   7.321  -2.852 1.00 . A A .  76 TYR OH   1 1 
        1  1302 1 1  77 LYS C    C  -5.542   7.832   2.995 1.00 . A A .  77 LYS C    1 1 
        1  1303 1 1  77 LYS CA   C  -6.572   8.637   3.779 1.00 . A A .  77 LYS CA   1 1 
        1  1304 1 1  77 LYS CB   C  -6.918   7.912   5.110 1.00 . A A .  77 LYS CB   1 1 
        1  1305 1 1  77 LYS CD   C  -6.050   6.850   7.321 1.00 . A A .  77 LYS CD   1 1 
        1  1306 1 1  77 LYS CE   C  -6.950   7.697   8.238 1.00 . A A .  77 LYS CE   1 1 
        1  1307 1 1  77 LYS CG   C  -5.685   7.568   5.997 1.00 . A A .  77 LYS CG   1 1 
        1  1308 1 1  77 LYS H    H  -8.561   8.298   3.144 1.00 . A A .  77 LYS H    1 1 
        1  1309 1 1  77 LYS HA   H  -6.167   9.625   4.011 1.00 . A A .  77 LYS HA   1 1 
        1  1310 1 1  77 LYS HB2  H  -7.584   8.549   5.683 1.00 . A A .  77 LYS HB2  1 1 
        1  1311 1 1  77 LYS HB3  H  -7.442   6.990   4.880 1.00 . A A .  77 LYS HB3  1 1 
        1  1312 1 1  77 LYS HD2  H  -6.565   5.928   7.085 1.00 . A A .  77 LYS HD2  1 1 
        1  1313 1 1  77 LYS HD3  H  -5.135   6.612   7.856 1.00 . A A .  77 LYS HD3  1 1 
        1  1314 1 1  77 LYS HE2  H  -7.928   7.791   7.785 1.00 . A A .  77 LYS HE2  1 1 
        1  1315 1 1  77 LYS HE3  H  -7.050   7.200   9.193 1.00 . A A .  77 LYS HE3  1 1 
        1  1316 1 1  77 LYS HG2  H  -5.020   6.923   5.432 1.00 . A A .  77 LYS HG2  1 1 
        1  1317 1 1  77 LYS HG3  H  -5.156   8.487   6.232 1.00 . A A .  77 LYS HG3  1 1 
        1  1318 1 1  77 LYS HZ1  H  -5.420   8.989   8.809 1.00 . A A .  77 LYS HZ1  1 1 
        1  1319 1 1  77 LYS HZ2  H  -6.968   9.557   9.169 1.00 . A A .  77 LYS HZ2  1 1 
        1  1320 1 1  77 LYS HZ3  H  -6.402   9.594   7.579 1.00 . A A .  77 LYS HZ3  1 1 
        1  1321 1 1  77 LYS N    N  -7.757   8.821   2.937 1.00 . A A .  77 LYS N    1 1 
        1  1322 1 1  77 LYS NZ   N  -6.396   9.052   8.464 1.00 . A A .  77 LYS NZ   1 1 
        1  1323 1 1  77 LYS O    O  -5.792   6.685   2.634 1.00 . A A .  77 LYS O    1 1 
        1  1324 1 1  78 VAL C    C  -2.385   7.184   3.176 1.00 . A A .  78 VAL C    1 1 
        1  1325 1 1  78 VAL CA   C  -3.278   7.772   2.072 1.00 . A A .  78 VAL CA   1 1 
        1  1326 1 1  78 VAL CB   C  -2.453   8.757   1.155 1.00 . A A .  78 VAL CB   1 1 
        1  1327 1 1  78 VAL CG1  C  -1.321   8.015   0.406 1.00 . A A .  78 VAL CG1  1 1 
        1  1328 1 1  78 VAL CG2  C  -3.379   9.508   0.162 1.00 . A A .  78 VAL CG2  1 1 
        1  1329 1 1  78 VAL H    H  -4.316   9.399   2.932 1.00 . A A .  78 VAL H    1 1 
        1  1330 1 1  78 VAL HA   H  -3.665   6.961   1.451 1.00 . A A .  78 VAL HA   1 1 
        1  1331 1 1  78 VAL HB   H  -1.985   9.505   1.796 1.00 . A A .  78 VAL HB   1 1 
        1  1332 1 1  78 VAL HG11 H  -0.754   8.716  -0.196 1.00 . A A .  78 VAL HG11 1 1 
        1  1333 1 1  78 VAL HG12 H  -1.741   7.253  -0.236 1.00 . A A .  78 VAL HG12 1 1 
        1  1334 1 1  78 VAL HG13 H  -0.655   7.546   1.123 1.00 . A A .  78 VAL HG13 1 1 
        1  1335 1 1  78 VAL HG21 H  -3.867   8.797  -0.493 1.00 . A A .  78 VAL HG21 1 1 
        1  1336 1 1  78 VAL HG22 H  -2.797  10.200  -0.436 1.00 . A A .  78 VAL HG22 1 1 
        1  1337 1 1  78 VAL HG23 H  -4.131  10.060   0.710 1.00 . A A .  78 VAL HG23 1 1 
        1  1338 1 1  78 VAL N    N  -4.404   8.451   2.710 1.00 . A A .  78 VAL N    1 1 
        1  1339 1 1  78 VAL O    O  -2.166   7.827   4.213 1.00 . A A .  78 VAL O    1 1 
        1  1340 1 1  79 PHE C    C  -0.014   4.470   2.939 1.00 . A A .  79 PHE C    1 1 
        1  1341 1 1  79 PHE CA   C  -0.938   5.299   3.838 1.00 . A A .  79 PHE CA   1 1 
        1  1342 1 1  79 PHE CB   C  -1.663   4.410   4.892 1.00 . A A .  79 PHE CB   1 1 
        1  1343 1 1  79 PHE CD1  C   0.085   2.819   5.885 1.00 . A A .  79 PHE CD1  1 1 
        1  1344 1 1  79 PHE CD2  C  -0.828   4.512   7.308 1.00 . A A .  79 PHE CD2  1 1 
        1  1345 1 1  79 PHE CE1  C   0.865   2.360   6.929 1.00 . A A .  79 PHE CE1  1 1 
        1  1346 1 1  79 PHE CE2  C  -0.045   4.051   8.352 1.00 . A A .  79 PHE CE2  1 1 
        1  1347 1 1  79 PHE CG   C  -0.779   3.906   6.050 1.00 . A A .  79 PHE CG   1 1 
        1  1348 1 1  79 PHE CZ   C   0.800   2.976   8.160 1.00 . A A .  79 PHE CZ   1 1 
        1  1349 1 1  79 PHE H    H  -2.251   5.455   2.190 1.00 . A A .  79 PHE H    1 1 
        1  1350 1 1  79 PHE HA   H  -0.353   6.064   4.342 1.00 . A A .  79 PHE HA   1 1 
        1  1351 1 1  79 PHE HB2  H  -2.476   4.983   5.323 1.00 . A A .  79 PHE HB2  1 1 
        1  1352 1 1  79 PHE HB3  H  -2.093   3.541   4.398 1.00 . A A .  79 PHE HB3  1 1 
        1  1353 1 1  79 PHE HD1  H   0.145   2.331   4.919 1.00 . A A .  79 PHE HD1  1 1 
        1  1354 1 1  79 PHE HD2  H  -1.491   5.355   7.467 1.00 . A A .  79 PHE HD2  1 1 
        1  1355 1 1  79 PHE HE1  H   1.530   1.517   6.778 1.00 . A A .  79 PHE HE1  1 1 
        1  1356 1 1  79 PHE HE2  H  -0.094   4.534   9.320 1.00 . A A .  79 PHE HE2  1 1 
        1  1357 1 1  79 PHE HZ   H   1.412   2.615   8.978 1.00 . A A .  79 PHE HZ   1 1 
        1  1358 1 1  79 PHE N    N  -1.917   5.956   2.965 1.00 . A A .  79 PHE N    1 1 
        1  1359 1 1  79 PHE O    O  -0.478   3.877   1.964 1.00 . A A .  79 PHE O    1 1 
        1  1360 1 1  80 LEU C    C   3.082   2.810   3.511 1.00 . A A .  80 LEU C    1 1 
        1  1361 1 1  80 LEU CA   C   2.273   3.653   2.511 1.00 . A A .  80 LEU CA   1 1 
        1  1362 1 1  80 LEU CB   C   3.194   4.582   1.653 1.00 . A A .  80 LEU CB   1 1 
        1  1363 1 1  80 LEU CD1  C   3.560   2.907  -0.291 1.00 . A A .  80 LEU CD1  1 1 
        1  1364 1 1  80 LEU CD2  C   5.113   4.907  -0.036 1.00 . A A .  80 LEU CD2  1 1 
        1  1365 1 1  80 LEU CG   C   4.238   3.871   0.710 1.00 . A A .  80 LEU CG   1 1 
        1  1366 1 1  80 LEU H    H   1.592   4.954   4.034 1.00 . A A .  80 LEU H    1 1 
        1  1367 1 1  80 LEU HA   H   1.736   2.976   1.841 1.00 . A A .  80 LEU HA   1 1 
        1  1368 1 1  80 LEU HB2  H   2.555   5.205   1.037 1.00 . A A .  80 LEU HB2  1 1 
        1  1369 1 1  80 LEU HB3  H   3.742   5.235   2.330 1.00 . A A .  80 LEU HB3  1 1 
        1  1370 1 1  80 LEU HD11 H   4.310   2.446  -0.920 1.00 . A A .  80 LEU HD11 1 1 
        1  1371 1 1  80 LEU HD12 H   2.858   3.450  -0.912 1.00 . A A .  80 LEU HD12 1 1 
        1  1372 1 1  80 LEU HD13 H   3.030   2.134   0.251 1.00 . A A .  80 LEU HD13 1 1 
        1  1373 1 1  80 LEU HD21 H   5.851   4.396  -0.640 1.00 . A A .  80 LEU HD21 1 1 
        1  1374 1 1  80 LEU HD22 H   5.621   5.538   0.683 1.00 . A A .  80 LEU HD22 1 1 
        1  1375 1 1  80 LEU HD23 H   4.494   5.525  -0.675 1.00 . A A .  80 LEU HD23 1 1 
        1  1376 1 1  80 LEU HG   H   4.901   3.271   1.323 1.00 . A A .  80 LEU HG   1 1 
        1  1377 1 1  80 LEU N    N   1.283   4.441   3.257 1.00 . A A .  80 LEU N    1 1 
        1  1378 1 1  80 LEU O    O   3.410   3.268   4.609 1.00 . A A .  80 LEU O    1 1 
        1  1379 1 1  81 LEU C    C   4.952  -0.188   2.861 1.00 . A A .  81 LEU C    1 1 
        1  1380 1 1  81 LEU CA   C   4.117   0.581   3.880 1.00 . A A .  81 LEU CA   1 1 
        1  1381 1 1  81 LEU CB   C   3.156  -0.371   4.667 1.00 . A A .  81 LEU CB   1 1 
        1  1382 1 1  81 LEU CD1  C   4.949  -1.395   6.238 1.00 . A A .  81 LEU CD1  1 1 
        1  1383 1 1  81 LEU CD2  C   2.691  -2.558   5.933 1.00 . A A .  81 LEU CD2  1 1 
        1  1384 1 1  81 LEU CG   C   3.780  -1.685   5.264 1.00 . A A .  81 LEU CG   1 1 
        1  1385 1 1  81 LEU H    H   3.016   1.293   2.237 1.00 . A A .  81 LEU H    1 1 
        1  1386 1 1  81 LEU HA   H   4.775   1.103   4.578 1.00 . A A .  81 LEU HA   1 1 
        1  1387 1 1  81 LEU HB2  H   2.720   0.196   5.484 1.00 . A A .  81 LEU HB2  1 1 
        1  1388 1 1  81 LEU HB3  H   2.349  -0.658   3.998 1.00 . A A .  81 LEU HB3  1 1 
        1  1389 1 1  81 LEU HD11 H   4.596  -0.801   7.073 1.00 . A A .  81 LEU HD11 1 1 
        1  1390 1 1  81 LEU HD12 H   5.728  -0.853   5.719 1.00 . A A .  81 LEU HD12 1 1 
        1  1391 1 1  81 LEU HD13 H   5.356  -2.327   6.609 1.00 . A A .  81 LEU HD13 1 1 
        1  1392 1 1  81 LEU HD21 H   3.136  -3.472   6.309 1.00 . A A .  81 LEU HD21 1 1 
        1  1393 1 1  81 LEU HD22 H   1.929  -2.811   5.207 1.00 . A A .  81 LEU HD22 1 1 
        1  1394 1 1  81 LEU HD23 H   2.235  -2.022   6.756 1.00 . A A .  81 LEU HD23 1 1 
        1  1395 1 1  81 LEU HG   H   4.195  -2.263   4.447 1.00 . A A .  81 LEU HG   1 1 
        1  1396 1 1  81 LEU N    N   3.351   1.570   3.116 1.00 . A A .  81 LEU N    1 1 
        1  1397 1 1  81 LEU O    O   4.406  -0.680   1.874 1.00 . A A .  81 LEU O    1 1 
        1  1398 1 1  82 LEU C    C   8.219  -1.782   2.843 1.00 . A A .  82 LEU C    1 1 
        1  1399 1 1  82 LEU CA   C   7.183  -0.907   2.119 1.00 . A A .  82 LEU CA   1 1 
        1  1400 1 1  82 LEU CB   C   7.815   0.175   1.177 1.00 . A A .  82 LEU CB   1 1 
        1  1401 1 1  82 LEU CD1  C   9.809   1.288   2.413 1.00 . A A .  82 LEU CD1  1 1 
        1  1402 1 1  82 LEU CD2  C   8.384   2.668   0.843 1.00 . A A .  82 LEU CD2  1 1 
        1  1403 1 1  82 LEU CG   C   8.398   1.486   1.833 1.00 . A A .  82 LEU CG   1 1 
        1  1404 1 1  82 LEU H    H   6.644   0.126   3.894 1.00 . A A .  82 LEU H    1 1 
        1  1405 1 1  82 LEU HA   H   6.581  -1.577   1.497 1.00 . A A .  82 LEU HA   1 1 
        1  1406 1 1  82 LEU HB2  H   8.603  -0.298   0.597 1.00 . A A .  82 LEU HB2  1 1 
        1  1407 1 1  82 LEU HB3  H   7.038   0.475   0.475 1.00 . A A .  82 LEU HB3  1 1 
        1  1408 1 1  82 LEU HD11 H  10.149   2.209   2.869 1.00 . A A .  82 LEU HD11 1 1 
        1  1409 1 1  82 LEU HD12 H  10.499   1.003   1.628 1.00 . A A .  82 LEU HD12 1 1 
        1  1410 1 1  82 LEU HD13 H   9.788   0.509   3.166 1.00 . A A .  82 LEU HD13 1 1 
        1  1411 1 1  82 LEU HD21 H   8.774   3.556   1.326 1.00 . A A .  82 LEU HD21 1 1 
        1  1412 1 1  82 LEU HD22 H   7.370   2.857   0.521 1.00 . A A .  82 LEU HD22 1 1 
        1  1413 1 1  82 LEU HD23 H   8.995   2.435  -0.020 1.00 . A A .  82 LEU HD23 1 1 
        1  1414 1 1  82 LEU HG   H   7.758   1.765   2.662 1.00 . A A .  82 LEU HG   1 1 
        1  1415 1 1  82 LEU N    N   6.270  -0.265   3.074 1.00 . A A .  82 LEU N    1 1 
        1  1416 1 1  82 LEU O    O   8.651  -1.473   3.965 1.00 . A A .  82 LEU O    1 1 
        1  1417 1 1  83 GLN C    C  10.084  -4.616   1.413 1.00 . A A .  83 GLN C    1 1 
        1  1418 1 1  83 GLN CA   C   9.547  -3.880   2.647 1.00 . A A .  83 GLN CA   1 1 
        1  1419 1 1  83 GLN CB   C   8.918  -4.862   3.697 1.00 . A A .  83 GLN CB   1 1 
        1  1420 1 1  83 GLN CD   C   9.240  -7.361   3.000 1.00 . A A .  83 GLN CD   1 1 
        1  1421 1 1  83 GLN CG   C   8.265  -6.175   3.177 1.00 . A A .  83 GLN CG   1 1 
        1  1422 1 1  83 GLN H    H   8.145  -3.054   1.313 1.00 . A A .  83 GLN H    1 1 
        1  1423 1 1  83 GLN HA   H  10.365  -3.335   3.112 1.00 . A A .  83 GLN HA   1 1 
        1  1424 1 1  83 GLN HB2  H   9.689  -5.140   4.400 1.00 . A A .  83 GLN HB2  1 1 
        1  1425 1 1  83 GLN HB3  H   8.158  -4.311   4.249 1.00 . A A .  83 GLN HB3  1 1 
        1  1426 1 1  83 GLN HE21 H  10.341  -6.789   4.564 1.00 . A A .  83 GLN HE21 1 1 
        1  1427 1 1  83 GLN HE22 H  10.878  -8.203   3.740 1.00 . A A .  83 GLN HE22 1 1 
        1  1428 1 1  83 GLN HG2  H   7.507  -6.489   3.877 1.00 . A A .  83 GLN HG2  1 1 
        1  1429 1 1  83 GLN HG3  H   7.792  -5.964   2.223 1.00 . A A .  83 GLN HG3  1 1 
        1  1430 1 1  83 GLN N    N   8.567  -2.895   2.178 1.00 . A A .  83 GLN N    1 1 
        1  1431 1 1  83 GLN NE2  N  10.251  -7.464   3.857 1.00 . A A .  83 GLN NE2  1 1 
        1  1432 1 1  83 GLN O    O   9.331  -4.884   0.466 1.00 . A A .  83 GLN O    1 1 
        1  1433 1 1  83 GLN OE1  O   9.081  -8.179   2.103 1.00 . A A .  83 GLN OE1  1 1 
        1  1434 1 1  84 ASP C    C  13.414  -6.134   0.801 1.00 . A A .  84 ASP C    1 1 
        1  1435 1 1  84 ASP CA   C  12.050  -5.611   0.324 1.00 . A A .  84 ASP CA   1 1 
        1  1436 1 1  84 ASP CB   C  12.199  -4.672  -0.918 1.00 . A A .  84 ASP CB   1 1 
        1  1437 1 1  84 ASP CG   C  12.743  -5.370  -2.174 1.00 . A A .  84 ASP CG   1 1 
        1  1438 1 1  84 ASP H    H  11.908  -4.685   2.217 1.00 . A A .  84 ASP H    1 1 
        1  1439 1 1  84 ASP HA   H  11.439  -6.467   0.045 1.00 . A A .  84 ASP HA   1 1 
        1  1440 1 1  84 ASP HB2  H  11.219  -4.261  -1.164 1.00 . A A .  84 ASP HB2  1 1 
        1  1441 1 1  84 ASP HB3  H  12.854  -3.848  -0.656 1.00 . A A .  84 ASP HB3  1 1 
        1  1442 1 1  84 ASP N    N  11.379  -4.920   1.428 1.00 . A A .  84 ASP N    1 1 
        1  1443 1 1  84 ASP O    O  13.888  -5.783   1.885 1.00 . A A .  84 ASP O    1 1 
        1  1444 1 1  84 ASP OD1  O  12.186  -6.419  -2.567 1.00 . A A .  84 ASP OD1  1 1 
        1  1445 1 1  84 ASP OD2  O  13.731  -4.883  -2.766 1.00 . A A .  84 ASP OD2  1 1 
        1  1446 1 1  85 GLN C    C  16.436  -6.514   0.117 1.00 . A A .  85 GLN C    1 1 
        1  1447 1 1  85 GLN CA   C  15.336  -7.597   0.196 1.00 . A A .  85 GLN CA   1 1 
        1  1448 1 1  85 GLN CB   C  15.581  -8.708  -0.867 1.00 . A A .  85 GLN CB   1 1 
        1  1449 1 1  85 GLN CD   C  13.149  -9.658  -1.136 1.00 . A A .  85 GLN CD   1 1 
        1  1450 1 1  85 GLN CG   C  14.629  -9.945  -0.816 1.00 . A A .  85 GLN CG   1 1 
        1  1451 1 1  85 GLN H    H  13.516  -7.278  -0.823 1.00 . A A .  85 GLN H    1 1 
        1  1452 1 1  85 GLN HA   H  15.348  -8.047   1.187 1.00 . A A .  85 GLN HA   1 1 
        1  1453 1 1  85 GLN HB2  H  15.491  -8.268  -1.853 1.00 . A A .  85 GLN HB2  1 1 
        1  1454 1 1  85 GLN HB3  H  16.602  -9.069  -0.752 1.00 . A A .  85 GLN HB3  1 1 
        1  1455 1 1  85 GLN HE21 H  13.493  -9.805  -3.082 1.00 . A A .  85 GLN HE21 1 1 
        1  1456 1 1  85 GLN HE22 H  11.873  -9.423  -2.624 1.00 . A A .  85 GLN HE22 1 1 
        1  1457 1 1  85 GLN HG2  H  14.991 -10.677  -1.530 1.00 . A A .  85 GLN HG2  1 1 
        1  1458 1 1  85 GLN HG3  H  14.686 -10.377   0.175 1.00 . A A .  85 GLN HG3  1 1 
        1  1459 1 1  85 GLN N    N  14.007  -7.004  -0.020 1.00 . A A .  85 GLN N    1 1 
        1  1460 1 1  85 GLN NE2  N  12.800  -9.636  -2.407 1.00 . A A .  85 GLN NE2  1 1 
        1  1461 1 1  85 GLN O    O  17.486  -6.637   0.751 1.00 . A A .  85 GLN O    1 1 
        1  1462 1 1  85 GLN OE1  O  12.337  -9.407  -0.245 1.00 . A A .  85 GLN OE1  1 1 
        1  1463 1 1  86 ASP C    C  16.651  -3.171   0.083 1.00 . A A .  86 ASP C    1 1 
        1  1464 1 1  86 ASP CA   C  17.066  -4.314  -0.857 1.00 . A A .  86 ASP CA   1 1 
        1  1465 1 1  86 ASP CB   C  17.045  -3.838  -2.332 1.00 . A A .  86 ASP CB   1 1 
        1  1466 1 1  86 ASP CG   C  17.598  -4.891  -3.302 1.00 . A A .  86 ASP CG   1 1 
        1  1467 1 1  86 ASP H    H  15.337  -5.474  -1.202 1.00 . A A .  86 ASP H    1 1 
        1  1468 1 1  86 ASP HA   H  18.080  -4.626  -0.607 1.00 . A A .  86 ASP HA   1 1 
        1  1469 1 1  86 ASP HB2  H  16.020  -3.601  -2.617 1.00 . A A .  86 ASP HB2  1 1 
        1  1470 1 1  86 ASP HB3  H  17.639  -2.933  -2.423 1.00 . A A .  86 ASP HB3  1 1 
        1  1471 1 1  86 ASP N    N  16.171  -5.467  -0.684 1.00 . A A .  86 ASP N    1 1 
        1  1472 1 1  86 ASP O    O  15.708  -2.430  -0.220 1.00 . A A .  86 ASP O    1 1 
        1  1473 1 1  86 ASP OD1  O  16.847  -5.813  -3.686 1.00 . A A .  86 ASP OD1  1 1 
        1  1474 1 1  86 ASP OD2  O  18.802  -4.825  -3.650 1.00 . A A .  86 ASP OD2  1 1 
        1  1475 1 1  87 GLU C    C  17.434  -0.578   1.625 1.00 . A A .  87 GLU C    1 1 
        1  1476 1 1  87 GLU CA   C  17.121  -1.968   2.229 1.00 . A A .  87 GLU CA   1 1 
        1  1477 1 1  87 GLU CB   C  17.979  -2.193   3.510 1.00 . A A .  87 GLU CB   1 1 
        1  1478 1 1  87 GLU CD   C  16.444  -1.153   5.322 1.00 . A A .  87 GLU CD   1 1 
        1  1479 1 1  87 GLU CG   C  17.815  -1.117   4.621 1.00 . A A .  87 GLU CG   1 1 
        1  1480 1 1  87 GLU H    H  18.046  -3.720   1.433 1.00 . A A .  87 GLU H    1 1 
        1  1481 1 1  87 GLU HA   H  16.068  -2.002   2.505 1.00 . A A .  87 GLU HA   1 1 
        1  1482 1 1  87 GLU HB2  H  17.713  -3.155   3.939 1.00 . A A .  87 GLU HB2  1 1 
        1  1483 1 1  87 GLU HB3  H  19.026  -2.228   3.223 1.00 . A A .  87 GLU HB3  1 1 
        1  1484 1 1  87 GLU HG2  H  18.589  -1.265   5.368 1.00 . A A .  87 GLU HG2  1 1 
        1  1485 1 1  87 GLU HG3  H  17.955  -0.130   4.181 1.00 . A A .  87 GLU HG3  1 1 
        1  1486 1 1  87 GLU N    N  17.355  -3.049   1.236 1.00 . A A .  87 GLU N    1 1 
        1  1487 1 1  87 GLU O    O  16.741   0.407   1.910 1.00 . A A .  87 GLU O    1 1 
        1  1488 1 1  87 GLU OE1  O  15.483  -0.539   4.819 1.00 . A A .  87 GLU OE1  1 1 
        1  1489 1 1  87 GLU OE2  O  16.331  -1.782   6.396 1.00 . A A .  87 GLU OE2  1 1 
        1  1490 1 1  88 ASN C    C  17.819   1.251  -0.807 1.00 . A A .  88 ASN C    1 1 
        1  1491 1 1  88 ASN CA   C  18.939   0.687   0.078 1.00 . A A .  88 ASN CA   1 1 
        1  1492 1 1  88 ASN CB   C  20.200   0.401  -0.791 1.00 . A A .  88 ASN CB   1 1 
        1  1493 1 1  88 ASN CG   C  21.452   0.014   0.005 1.00 . A A .  88 ASN CG   1 1 
        1  1494 1 1  88 ASN H    H  18.973  -1.367   0.606 1.00 . A A .  88 ASN H    1 1 
        1  1495 1 1  88 ASN HA   H  19.194   1.424   0.837 1.00 . A A .  88 ASN HA   1 1 
        1  1496 1 1  88 ASN HB2  H  19.983  -0.412  -1.472 1.00 . A A .  88 ASN HB2  1 1 
        1  1497 1 1  88 ASN HB3  H  20.434   1.288  -1.375 1.00 . A A .  88 ASN HB3  1 1 
        1  1498 1 1  88 ASN HD21 H  22.617   0.634  -1.477 1.00 . A A .  88 ASN HD21 1 1 
        1  1499 1 1  88 ASN HD22 H  23.431  -0.016  -0.104 1.00 . A A .  88 ASN HD22 1 1 
        1  1500 1 1  88 ASN N    N  18.484  -0.538   0.776 1.00 . A A .  88 ASN N    1 1 
        1  1501 1 1  88 ASN ND2  N  22.617   0.238  -0.582 1.00 . A A .  88 ASN ND2  1 1 
        1  1502 1 1  88 ASN O    O  17.633   2.467  -0.883 1.00 . A A .  88 ASN O    1 1 
        1  1503 1 1  88 ASN OD1  O  21.380  -0.503   1.120 1.00 . A A .  88 ASN OD1  1 1 
        1  1504 1 1  89 GLU C    C  14.738   1.197  -1.580 1.00 . A A .  89 GLU C    1 1 
        1  1505 1 1  89 GLU CA   C  15.966   0.698  -2.356 1.00 . A A .  89 GLU CA   1 1 
        1  1506 1 1  89 GLU CB   C  15.605  -0.505  -3.272 1.00 . A A .  89 GLU CB   1 1 
        1  1507 1 1  89 GLU CD   C  16.918   0.481  -5.244 1.00 . A A .  89 GLU CD   1 1 
        1  1508 1 1  89 GLU CG   C  16.635  -0.771  -4.388 1.00 . A A .  89 GLU CG   1 1 
        1  1509 1 1  89 GLU H    H  17.281  -0.609  -1.325 1.00 . A A .  89 GLU H    1 1 
        1  1510 1 1  89 GLU HA   H  16.315   1.514  -2.989 1.00 . A A .  89 GLU HA   1 1 
        1  1511 1 1  89 GLU HB2  H  15.516  -1.400  -2.666 1.00 . A A .  89 GLU HB2  1 1 
        1  1512 1 1  89 GLU HB3  H  14.644  -0.319  -3.747 1.00 . A A .  89 GLU HB3  1 1 
        1  1513 1 1  89 GLU HG2  H  17.558  -1.113  -3.932 1.00 . A A .  89 GLU HG2  1 1 
        1  1514 1 1  89 GLU HG3  H  16.254  -1.555  -5.036 1.00 . A A .  89 GLU HG3  1 1 
        1  1515 1 1  89 GLU N    N  17.076   0.341  -1.458 1.00 . A A .  89 GLU N    1 1 
        1  1516 1 1  89 GLU O    O  13.973   2.031  -2.083 1.00 . A A .  89 GLU O    1 1 
        1  1517 1 1  89 GLU OE1  O  15.985   0.970  -5.924 1.00 . A A .  89 GLU OE1  1 1 
        1  1518 1 1  89 GLU OE2  O  18.059   1.002  -5.215 1.00 . A A .  89 GLU OE2  1 1 
        1  1519 1 1  90 LEU C    C  13.633   2.539   1.001 1.00 . A A .  90 LEU C    1 1 
        1  1520 1 1  90 LEU CA   C  13.463   1.083   0.522 1.00 . A A .  90 LEU CA   1 1 
        1  1521 1 1  90 LEU CB   C  13.397   0.122   1.729 1.00 . A A .  90 LEU CB   1 1 
        1  1522 1 1  90 LEU CD1  C  13.109  -2.228   2.688 1.00 . A A .  90 LEU CD1  1 1 
        1  1523 1 1  90 LEU CD2  C  11.700  -1.460   0.684 1.00 . A A .  90 LEU CD2  1 1 
        1  1524 1 1  90 LEU CG   C  13.062  -1.358   1.408 1.00 . A A .  90 LEU CG   1 1 
        1  1525 1 1  90 LEU H    H  15.201   0.011  -0.046 1.00 . A A .  90 LEU H    1 1 
        1  1526 1 1  90 LEU HA   H  12.536   1.004  -0.041 1.00 . A A .  90 LEU HA   1 1 
        1  1527 1 1  90 LEU HB2  H  14.358   0.154   2.237 1.00 . A A .  90 LEU HB2  1 1 
        1  1528 1 1  90 LEU HB3  H  12.644   0.493   2.420 1.00 . A A .  90 LEU HB3  1 1 
        1  1529 1 1  90 LEU HD11 H  12.330  -1.921   3.376 1.00 . A A .  90 LEU HD11 1 1 
        1  1530 1 1  90 LEU HD12 H  14.072  -2.115   3.168 1.00 . A A .  90 LEU HD12 1 1 
        1  1531 1 1  90 LEU HD13 H  12.969  -3.266   2.426 1.00 . A A .  90 LEU HD13 1 1 
        1  1532 1 1  90 LEU HD21 H  10.917  -1.043   1.305 1.00 . A A .  90 LEU HD21 1 1 
        1  1533 1 1  90 LEU HD22 H  11.475  -2.498   0.476 1.00 . A A .  90 LEU HD22 1 1 
        1  1534 1 1  90 LEU HD23 H  11.742  -0.918  -0.251 1.00 . A A .  90 LEU HD23 1 1 
        1  1535 1 1  90 LEU HG   H  13.816  -1.746   0.732 1.00 . A A .  90 LEU HG   1 1 
        1  1536 1 1  90 LEU N    N  14.563   0.687  -0.362 1.00 . A A .  90 LEU N    1 1 
        1  1537 1 1  90 LEU O    O  12.720   3.358   0.863 1.00 . A A .  90 LEU O    1 1 
        1  1538 1 1  91 GLU C    C  15.179   5.295   1.145 1.00 . A A .  91 GLU C    1 1 
        1  1539 1 1  91 GLU CA   C  15.145   4.139   2.170 1.00 . A A .  91 GLU CA   1 1 
        1  1540 1 1  91 GLU CB   C  16.490   4.049   2.950 1.00 . A A .  91 GLU CB   1 1 
        1  1541 1 1  91 GLU CD   C  19.006   3.442   2.877 1.00 . A A .  91 GLU CD   1 1 
        1  1542 1 1  91 GLU CG   C  17.702   3.648   2.089 1.00 . A A .  91 GLU CG   1 1 
        1  1543 1 1  91 GLU H    H  15.526   2.146   1.537 1.00 . A A .  91 GLU H    1 1 
        1  1544 1 1  91 GLU HA   H  14.353   4.350   2.888 1.00 . A A .  91 GLU HA   1 1 
        1  1545 1 1  91 GLU HB2  H  16.698   5.011   3.407 1.00 . A A .  91 GLU HB2  1 1 
        1  1546 1 1  91 GLU HB3  H  16.379   3.313   3.743 1.00 . A A .  91 GLU HB3  1 1 
        1  1547 1 1  91 GLU HG2  H  17.469   2.719   1.576 1.00 . A A .  91 GLU HG2  1 1 
        1  1548 1 1  91 GLU HG3  H  17.857   4.422   1.343 1.00 . A A .  91 GLU HG3  1 1 
        1  1549 1 1  91 GLU N    N  14.829   2.837   1.546 1.00 . A A .  91 GLU N    1 1 
        1  1550 1 1  91 GLU O    O  14.745   6.407   1.464 1.00 . A A .  91 GLU O    1 1 
        1  1551 1 1  91 GLU OE1  O  19.022   2.598   3.798 1.00 . A A .  91 GLU OE1  1 1 
        1  1552 1 1  91 GLU OE2  O  20.021   4.120   2.579 1.00 . A A .  91 GLU OE2  1 1 
        1  1553 1 1  92 GLU C    C  14.444   6.477  -1.693 1.00 . A A .  92 GLU C    1 1 
        1  1554 1 1  92 GLU CA   C  15.814   6.063  -1.137 1.00 . A A .  92 GLU CA   1 1 
        1  1555 1 1  92 GLU CB   C  16.804   5.621  -2.264 1.00 . A A .  92 GLU CB   1 1 
        1  1556 1 1  92 GLU CD   C  15.523   4.527  -4.269 1.00 . A A .  92 GLU CD   1 1 
        1  1557 1 1  92 GLU CG   C  16.453   4.330  -3.056 1.00 . A A .  92 GLU CG   1 1 
        1  1558 1 1  92 GLU H    H  15.971   4.110  -0.296 1.00 . A A .  92 GLU H    1 1 
        1  1559 1 1  92 GLU HA   H  16.241   6.941  -0.648 1.00 . A A .  92 GLU HA   1 1 
        1  1560 1 1  92 GLU HB2  H  16.899   6.433  -2.979 1.00 . A A .  92 GLU HB2  1 1 
        1  1561 1 1  92 GLU HB3  H  17.776   5.473  -1.802 1.00 . A A .  92 GLU HB3  1 1 
        1  1562 1 1  92 GLU HG2  H  17.376   3.884  -3.414 1.00 . A A .  92 GLU HG2  1 1 
        1  1563 1 1  92 GLU HG3  H  15.991   3.629  -2.367 1.00 . A A .  92 GLU HG3  1 1 
        1  1564 1 1  92 GLU N    N  15.682   5.023  -0.087 1.00 . A A .  92 GLU N    1 1 
        1  1565 1 1  92 GLU O    O  14.256   7.638  -2.055 1.00 . A A .  92 GLU O    1 1 
        1  1566 1 1  92 GLU OE1  O  15.955   5.154  -5.257 1.00 . A A .  92 GLU OE1  1 1 
        1  1567 1 1  92 GLU OE2  O  14.374   4.040  -4.256 1.00 . A A .  92 GLU OE2  1 1 
        1  1568 1 1  93 PHE C    C  11.385   6.547  -1.023 1.00 . A A .  93 PHE C    1 1 
        1  1569 1 1  93 PHE CA   C  12.105   5.801  -2.158 1.00 . A A .  93 PHE CA   1 1 
        1  1570 1 1  93 PHE CB   C  11.364   4.480  -2.518 1.00 . A A .  93 PHE CB   1 1 
        1  1571 1 1  93 PHE CD1  C   9.644   5.467  -4.139 1.00 . A A .  93 PHE CD1  1 1 
        1  1572 1 1  93 PHE CD2  C   8.847   4.002  -2.431 1.00 . A A .  93 PHE CD2  1 1 
        1  1573 1 1  93 PHE CE1  C   8.349   5.619  -4.612 1.00 . A A .  93 PHE CE1  1 1 
        1  1574 1 1  93 PHE CE2  C   7.553   4.151  -2.904 1.00 . A A .  93 PHE CE2  1 1 
        1  1575 1 1  93 PHE CG   C   9.921   4.654  -3.037 1.00 . A A .  93 PHE CG   1 1 
        1  1576 1 1  93 PHE CZ   C   7.305   4.960  -3.994 1.00 . A A .  93 PHE CZ   1 1 
        1  1577 1 1  93 PHE H    H  13.765   4.590  -1.620 1.00 . A A .  93 PHE H    1 1 
        1  1578 1 1  93 PHE HA   H  12.131   6.439  -3.041 1.00 . A A .  93 PHE HA   1 1 
        1  1579 1 1  93 PHE HB2  H  11.925   3.972  -3.293 1.00 . A A .  93 PHE HB2  1 1 
        1  1580 1 1  93 PHE HB3  H  11.340   3.840  -1.639 1.00 . A A .  93 PHE HB3  1 1 
        1  1581 1 1  93 PHE HD1  H  10.457   5.987  -4.632 1.00 . A A .  93 PHE HD1  1 1 
        1  1582 1 1  93 PHE HD2  H   9.032   3.364  -1.577 1.00 . A A .  93 PHE HD2  1 1 
        1  1583 1 1  93 PHE HE1  H   8.156   6.253  -5.468 1.00 . A A .  93 PHE HE1  1 1 
        1  1584 1 1  93 PHE HE2  H   6.737   3.635  -2.416 1.00 . A A .  93 PHE HE2  1 1 
        1  1585 1 1  93 PHE HZ   H   6.293   5.076  -4.365 1.00 . A A .  93 PHE HZ   1 1 
        1  1586 1 1  93 PHE N    N  13.502   5.519  -1.775 1.00 . A A .  93 PHE N    1 1 
        1  1587 1 1  93 PHE O    O  10.764   7.591  -1.262 1.00 . A A .  93 PHE O    1 1 
        1  1588 1 1  94 LYS C    C  11.115   8.000   1.697 1.00 . A A .  94 LYS C    1 1 
        1  1589 1 1  94 LYS CA   C  10.814   6.517   1.409 1.00 . A A .  94 LYS CA   1 1 
        1  1590 1 1  94 LYS CB   C  11.137   5.641   2.655 1.00 . A A .  94 LYS CB   1 1 
        1  1591 1 1  94 LYS CD   C  10.713   5.207   5.142 1.00 . A A .  94 LYS CD   1 1 
        1  1592 1 1  94 LYS CE   C  10.207   5.786   6.459 1.00 . A A .  94 LYS CE   1 1 
        1  1593 1 1  94 LYS CG   C  10.586   6.200   3.978 1.00 . A A .  94 LYS CG   1 1 
        1  1594 1 1  94 LYS H    H  12.137   5.266   0.328 1.00 . A A .  94 LYS H    1 1 
        1  1595 1 1  94 LYS HA   H   9.750   6.423   1.199 1.00 . A A .  94 LYS HA   1 1 
        1  1596 1 1  94 LYS HB2  H  10.711   4.657   2.509 1.00 . A A .  94 LYS HB2  1 1 
        1  1597 1 1  94 LYS HB3  H  12.213   5.540   2.751 1.00 . A A .  94 LYS HB3  1 1 
        1  1598 1 1  94 LYS HD2  H  10.136   4.317   4.910 1.00 . A A .  94 LYS HD2  1 1 
        1  1599 1 1  94 LYS HD3  H  11.755   4.929   5.262 1.00 . A A .  94 LYS HD3  1 1 
        1  1600 1 1  94 LYS HE2  H   9.221   6.197   6.300 1.00 . A A .  94 LYS HE2  1 1 
        1  1601 1 1  94 LYS HE3  H  10.149   4.995   7.187 1.00 . A A .  94 LYS HE3  1 1 
        1  1602 1 1  94 LYS HG2  H  11.133   7.105   4.231 1.00 . A A .  94 LYS HG2  1 1 
        1  1603 1 1  94 LYS HG3  H   9.539   6.450   3.842 1.00 . A A .  94 LYS HG3  1 1 
        1  1604 1 1  94 LYS HZ1  H  11.287   7.550   6.229 1.00 . A A .  94 LYS HZ1  1 1 
        1  1605 1 1  94 LYS HZ2  H  12.009   6.446   7.276 1.00 . A A .  94 LYS HZ2  1 1 
        1  1606 1 1  94 LYS HZ3  H  10.665   7.336   7.781 1.00 . A A .  94 LYS HZ3  1 1 
        1  1607 1 1  94 LYS N    N  11.526   6.019   0.216 1.00 . A A .  94 LYS N    1 1 
        1  1608 1 1  94 LYS NZ   N  11.101   6.853   6.973 1.00 . A A .  94 LYS NZ   1 1 
        1  1609 1 1  94 LYS O    O  10.186   8.769   1.935 1.00 . A A .  94 LYS O    1 1 
        1  1610 1 1  95 ARG C    C  12.183  10.818   1.004 1.00 . A A .  95 ARG C    1 1 
        1  1611 1 1  95 ARG CA   C  12.843   9.783   1.949 1.00 . A A .  95 ARG CA   1 1 
        1  1612 1 1  95 ARG CB   C  14.389   9.908   1.882 1.00 . A A .  95 ARG CB   1 1 
        1  1613 1 1  95 ARG CD   C  16.511   9.852   0.409 1.00 . A A .  95 ARG CD   1 1 
        1  1614 1 1  95 ARG CG   C  15.004   9.564   0.501 1.00 . A A .  95 ARG CG   1 1 
        1  1615 1 1  95 ARG CZ   C  17.773  11.954  -0.148 1.00 . A A .  95 ARG CZ   1 1 
        1  1616 1 1  95 ARG H    H  13.089   7.724   1.415 1.00 . A A .  95 ARG H    1 1 
        1  1617 1 1  95 ARG HA   H  12.523   9.999   2.966 1.00 . A A .  95 ARG HA   1 1 
        1  1618 1 1  95 ARG HB2  H  14.668  10.925   2.137 1.00 . A A .  95 ARG HB2  1 1 
        1  1619 1 1  95 ARG HB3  H  14.824   9.241   2.621 1.00 . A A .  95 ARG HB3  1 1 
        1  1620 1 1  95 ARG HD2  H  17.026   9.321   1.203 1.00 . A A .  95 ARG HD2  1 1 
        1  1621 1 1  95 ARG HD3  H  16.873   9.493  -0.549 1.00 . A A .  95 ARG HD3  1 1 
        1  1622 1 1  95 ARG HE   H  16.261  11.805   1.166 1.00 . A A .  95 ARG HE   1 1 
        1  1623 1 1  95 ARG HG2  H  14.840   8.510   0.303 1.00 . A A .  95 ARG HG2  1 1 
        1  1624 1 1  95 ARG HG3  H  14.493  10.144  -0.260 1.00 . A A .  95 ARG HG3  1 1 
        1  1625 1 1  95 ARG HH11 H  18.443  10.331  -1.181 1.00 . A A .  95 ARG HH11 1 1 
        1  1626 1 1  95 ARG HH12 H  19.275  11.824  -1.516 1.00 . A A .  95 ARG HH12 1 1 
        1  1627 1 1  95 ARG HH21 H  17.343  13.742   0.707 1.00 . A A .  95 ARG HH21 1 1 
        1  1628 1 1  95 ARG HH22 H  18.648  13.760  -0.442 1.00 . A A .  95 ARG HH22 1 1 
        1  1629 1 1  95 ARG N    N  12.407   8.391   1.645 1.00 . A A .  95 ARG N    1 1 
        1  1630 1 1  95 ARG NE   N  16.812  11.294   0.531 1.00 . A A .  95 ARG NE   1 1 
        1  1631 1 1  95 ARG NH1  N  18.558  11.319  -1.018 1.00 . A A .  95 ARG NH1  1 1 
        1  1632 1 1  95 ARG NH2  N  17.937  13.252   0.056 1.00 . A A .  95 ARG NH2  1 1 
        1  1633 1 1  95 ARG O    O  11.926  11.963   1.403 1.00 . A A .  95 ARG O    1 1 
        1  1634 1 1  96 LYS C    C   9.747  11.385  -0.900 1.00 . A A .  96 LYS C    1 1 
        1  1635 1 1  96 LYS CA   C  11.229  11.216  -1.260 1.00 . A A .  96 LYS CA   1 1 
        1  1636 1 1  96 LYS CB   C  11.369  10.577  -2.672 1.00 . A A .  96 LYS CB   1 1 
        1  1637 1 1  96 LYS CD   C  13.804  11.465  -3.087 1.00 . A A .  96 LYS CD   1 1 
        1  1638 1 1  96 LYS CE   C  13.616  12.456  -4.262 1.00 . A A .  96 LYS CE   1 1 
        1  1639 1 1  96 LYS CG   C  12.823  10.255  -3.095 1.00 . A A .  96 LYS CG   1 1 
        1  1640 1 1  96 LYS H    H  12.157   9.469  -0.482 1.00 . A A .  96 LYS H    1 1 
        1  1641 1 1  96 LYS HA   H  11.706  12.196  -1.269 1.00 . A A .  96 LYS HA   1 1 
        1  1642 1 1  96 LYS HB2  H  10.805   9.649  -2.690 1.00 . A A .  96 LYS HB2  1 1 
        1  1643 1 1  96 LYS HB3  H  10.944  11.248  -3.411 1.00 . A A .  96 LYS HB3  1 1 
        1  1644 1 1  96 LYS HD2  H  13.687  12.009  -2.157 1.00 . A A .  96 LYS HD2  1 1 
        1  1645 1 1  96 LYS HD3  H  14.817  11.074  -3.128 1.00 . A A .  96 LYS HD3  1 1 
        1  1646 1 1  96 LYS HE2  H  14.420  13.183  -4.238 1.00 . A A .  96 LYS HE2  1 1 
        1  1647 1 1  96 LYS HE3  H  13.674  11.903  -5.194 1.00 . A A .  96 LYS HE3  1 1 
        1  1648 1 1  96 LYS HG2  H  13.205   9.506  -2.418 1.00 . A A .  96 LYS HG2  1 1 
        1  1649 1 1  96 LYS HG3  H  12.802   9.833  -4.096 1.00 . A A .  96 LYS HG3  1 1 
        1  1650 1 1  96 LYS HZ1  H  11.531  12.538  -4.398 1.00 . A A .  96 LYS HZ1  1 1 
        1  1651 1 1  96 LYS HZ2  H  12.310  13.933  -4.944 1.00 . A A .  96 LYS HZ2  1 1 
        1  1652 1 1  96 LYS HZ3  H  12.188  13.634  -3.289 1.00 . A A .  96 LYS HZ3  1 1 
        1  1653 1 1  96 LYS N    N  11.903  10.386  -0.244 1.00 . A A .  96 LYS N    1 1 
        1  1654 1 1  96 LYS NZ   N  12.322  13.191  -4.219 1.00 . A A .  96 LYS NZ   1 1 
        1  1655 1 1  96 LYS O    O   9.191  12.469  -1.046 1.00 . A A .  96 LYS O    1 1 
        1  1656 1 1  97 ILE C    C   7.490  11.089   1.277 1.00 . A A .  97 ILE C    1 1 
        1  1657 1 1  97 ILE CA   C   7.719  10.250  -0.012 1.00 . A A .  97 ILE CA   1 1 
        1  1658 1 1  97 ILE CB   C   7.227   8.760   0.182 1.00 . A A .  97 ILE CB   1 1 
        1  1659 1 1  97 ILE CD1  C   7.100   8.412  -2.419 1.00 . A A .  97 ILE CD1  1 1 
        1  1660 1 1  97 ILE CG1  C   7.576   7.878  -1.070 1.00 . A A .  97 ILE CG1  1 1 
        1  1661 1 1  97 ILE CG2  C   5.715   8.691   0.491 1.00 . A A .  97 ILE CG2  1 1 
        1  1662 1 1  97 ILE H    H   9.668   9.464  -0.352 1.00 . A A .  97 ILE H    1 1 
        1  1663 1 1  97 ILE HA   H   7.139  10.693  -0.822 1.00 . A A .  97 ILE HA   1 1 
        1  1664 1 1  97 ILE HB   H   7.754   8.351   1.043 1.00 . A A .  97 ILE HB   1 1 
        1  1665 1 1  97 ILE HD11 H   7.334   7.694  -3.190 1.00 . A A .  97 ILE HD11 1 1 
        1  1666 1 1  97 ILE HD12 H   7.599   9.348  -2.641 1.00 . A A .  97 ILE HD12 1 1 
        1  1667 1 1  97 ILE HD13 H   6.032   8.574  -2.395 1.00 . A A .  97 ILE HD13 1 1 
        1  1668 1 1  97 ILE HG12 H   8.649   7.776  -1.133 1.00 . A A .  97 ILE HG12 1 1 
        1  1669 1 1  97 ILE HG13 H   7.149   6.891  -0.941 1.00 . A A .  97 ILE HG13 1 1 
        1  1670 1 1  97 ILE HG21 H   5.418   7.659   0.632 1.00 . A A .  97 ILE HG21 1 1 
        1  1671 1 1  97 ILE HG22 H   5.152   9.113  -0.332 1.00 . A A .  97 ILE HG22 1 1 
        1  1672 1 1  97 ILE HG23 H   5.499   9.250   1.393 1.00 . A A .  97 ILE HG23 1 1 
        1  1673 1 1  97 ILE N    N   9.139  10.289  -0.415 1.00 . A A .  97 ILE N    1 1 
        1  1674 1 1  97 ILE O    O   6.429  11.702   1.451 1.00 . A A .  97 ILE O    1 1 
        1  1675 1 1  98 GLU C    C   8.673  13.464   2.951 1.00 . A A .  98 GLU C    1 1 
        1  1676 1 1  98 GLU CA   C   8.524  11.987   3.361 1.00 . A A .  98 GLU CA   1 1 
        1  1677 1 1  98 GLU CB   C   9.676  11.573   4.312 1.00 . A A .  98 GLU CB   1 1 
        1  1678 1 1  98 GLU CD   C  10.741   9.735   5.741 1.00 . A A .  98 GLU CD   1 1 
        1  1679 1 1  98 GLU CG   C   9.566  10.134   4.844 1.00 . A A .  98 GLU CG   1 1 
        1  1680 1 1  98 GLU H    H   9.230  10.469   2.060 1.00 . A A .  98 GLU H    1 1 
        1  1681 1 1  98 GLU HA   H   7.579  11.868   3.886 1.00 . A A .  98 GLU HA   1 1 
        1  1682 1 1  98 GLU HB2  H  10.620  11.672   3.782 1.00 . A A .  98 GLU HB2  1 1 
        1  1683 1 1  98 GLU HB3  H   9.688  12.246   5.165 1.00 . A A .  98 GLU HB3  1 1 
        1  1684 1 1  98 GLU HG2  H   8.641  10.035   5.409 1.00 . A A .  98 GLU HG2  1 1 
        1  1685 1 1  98 GLU HG3  H   9.523   9.453   3.996 1.00 . A A .  98 GLU HG3  1 1 
        1  1686 1 1  98 GLU N    N   8.498  11.104   2.171 1.00 . A A .  98 GLU N    1 1 
        1  1687 1 1  98 GLU O    O   8.135  14.355   3.619 1.00 . A A .  98 GLU O    1 1 
        1  1688 1 1  98 GLU OE1  O  11.780   9.275   5.219 1.00 . A A .  98 GLU OE1  1 1 
        1  1689 1 1  98 GLU OE2  O  10.631   9.863   6.982 1.00 . A A .  98 GLU OE2  1 1 
        1  1690 1 1  99 SER C    C   8.232  15.485   0.549 1.00 . A A .  99 SER C    1 1 
        1  1691 1 1  99 SER CA   C   9.545  15.053   1.240 1.00 . A A .  99 SER CA   1 1 
        1  1692 1 1  99 SER CB   C  10.717  15.068   0.232 1.00 . A A .  99 SER CB   1 1 
        1  1693 1 1  99 SER H    H   9.873  12.959   1.414 1.00 . A A .  99 SER H    1 1 
        1  1694 1 1  99 SER HA   H   9.764  15.755   2.040 1.00 . A A .  99 SER HA   1 1 
        1  1695 1 1  99 SER HB2  H  11.618  14.729   0.726 1.00 . A A .  99 SER HB2  1 1 
        1  1696 1 1  99 SER HB3  H  10.496  14.402  -0.596 1.00 . A A .  99 SER HB3  1 1 
        1  1697 1 1  99 SER HG   H  10.261  16.974   0.015 1.00 . A A .  99 SER HG   1 1 
        1  1698 1 1  99 SER N    N   9.403  13.708   1.841 1.00 . A A .  99 SER N    1 1 
        1  1699 1 1  99 SER O    O   7.997  16.678   0.355 1.00 . A A .  99 SER O    1 1 
        1  1700 1 1  99 SER OG   O  10.955  16.374  -0.291 1.00 . A A .  99 SER OG   1 1 
        1  1701 1 1 100 GLN C    C   5.058  14.941   0.852 1.00 . A A . 100 GLN C    1 1 
        1  1702 1 1 100 GLN CA   C   6.030  14.722  -0.336 1.00 . A A . 100 GLN CA   1 1 
        1  1703 1 1 100 GLN CB   C   5.560  13.525  -1.206 1.00 . A A . 100 GLN CB   1 1 
        1  1704 1 1 100 GLN CD   C   5.932  12.052  -3.296 1.00 . A A . 100 GLN CD   1 1 
        1  1705 1 1 100 GLN CG   C   6.420  13.243  -2.457 1.00 . A A . 100 GLN CG   1 1 
        1  1706 1 1 100 GLN H    H   7.731  13.569   0.201 1.00 . A A . 100 GLN H    1 1 
        1  1707 1 1 100 GLN HA   H   6.038  15.620  -0.953 1.00 . A A . 100 GLN HA   1 1 
        1  1708 1 1 100 GLN HB2  H   5.555  12.632  -0.590 1.00 . A A . 100 GLN HB2  1 1 
        1  1709 1 1 100 GLN HB3  H   4.543  13.716  -1.537 1.00 . A A . 100 GLN HB3  1 1 
        1  1710 1 1 100 GLN HE21 H   7.787  11.649  -3.878 1.00 . A A . 100 GLN HE21 1 1 
        1  1711 1 1 100 GLN HE22 H   6.560  10.607  -4.502 1.00 . A A . 100 GLN HE22 1 1 
        1  1712 1 1 100 GLN HG2  H   6.416  14.123  -3.091 1.00 . A A . 100 GLN HG2  1 1 
        1  1713 1 1 100 GLN HG3  H   7.436  13.049  -2.137 1.00 . A A . 100 GLN HG3  1 1 
        1  1714 1 1 100 GLN N    N   7.403  14.492   0.160 1.00 . A A . 100 GLN N    1 1 
        1  1715 1 1 100 GLN NE2  N   6.854  11.365  -3.957 1.00 . A A . 100 GLN NE2  1 1 
        1  1716 1 1 100 GLN O    O   3.976  15.502   0.671 1.00 . A A . 100 GLN O    1 1 
        1  1717 1 1 100 GLN OE1  O   4.741  11.753  -3.353 1.00 . A A . 100 GLN OE1  1 1 
        1  1718 1 1 101 GLY C    C   3.665  13.610   3.550 1.00 . A A . 101 GLY C    1 1 
        1  1719 1 1 101 GLY CA   C   4.722  14.680   3.306 1.00 . A A . 101 GLY CA   1 1 
        1  1720 1 1 101 GLY H    H   6.310  13.973   2.092 1.00 . A A . 101 GLY H    1 1 
        1  1721 1 1 101 GLY HA2  H   5.424  14.663   4.131 1.00 . A A . 101 GLY HA2  1 1 
        1  1722 1 1 101 GLY HA3  H   4.246  15.654   3.288 1.00 . A A . 101 GLY HA3  1 1 
        1  1723 1 1 101 GLY N    N   5.471  14.477   2.058 1.00 . A A . 101 GLY N    1 1 
        1  1724 1 1 101 GLY O    O   2.567  13.907   4.039 1.00 . A A . 101 GLY O    1 1 
        1  1725 1 1 102 TYR C    C   3.580  10.264   4.485 1.00 . A A . 102 TYR C    1 1 
        1  1726 1 1 102 TYR CA   C   3.079  11.201   3.385 1.00 . A A . 102 TYR CA   1 1 
        1  1727 1 1 102 TYR CB   C   2.933  10.414   2.060 1.00 . A A . 102 TYR CB   1 1 
        1  1728 1 1 102 TYR CD1  C   0.719  11.163   1.052 1.00 . A A . 102 TYR CD1  1 1 
        1  1729 1 1 102 TYR CD2  C   2.726  11.773  -0.084 1.00 . A A . 102 TYR CD2  1 1 
        1  1730 1 1 102 TYR CE1  C  -0.026  11.810   0.089 1.00 . A A . 102 TYR CE1  1 1 
        1  1731 1 1 102 TYR CE2  C   1.982  12.421  -1.047 1.00 . A A . 102 TYR CE2  1 1 
        1  1732 1 1 102 TYR CG   C   2.114  11.131   0.988 1.00 . A A . 102 TYR CG   1 1 
        1  1733 1 1 102 TYR CZ   C   0.610  12.436  -0.956 1.00 . A A . 102 TYR CZ   1 1 
        1  1734 1 1 102 TYR H    H   4.890  12.182   2.850 1.00 . A A . 102 TYR H    1 1 
        1  1735 1 1 102 TYR HA   H   2.098  11.580   3.676 1.00 . A A . 102 TYR HA   1 1 
        1  1736 1 1 102 TYR HB2  H   3.921  10.222   1.656 1.00 . A A . 102 TYR HB2  1 1 
        1  1737 1 1 102 TYR HB3  H   2.452   9.459   2.253 1.00 . A A . 102 TYR HB3  1 1 
        1  1738 1 1 102 TYR HD1  H   0.216  10.670   1.874 1.00 . A A . 102 TYR HD1  1 1 
        1  1739 1 1 102 TYR HD2  H   3.808  11.760  -0.160 1.00 . A A . 102 TYR HD2  1 1 
        1  1740 1 1 102 TYR HE1  H  -1.107  11.818   0.159 1.00 . A A . 102 TYR HE1  1 1 
        1  1741 1 1 102 TYR HE2  H   2.482  12.913  -1.872 1.00 . A A . 102 TYR HE2  1 1 
        1  1742 1 1 102 TYR HH   H   0.183  12.798  -2.790 1.00 . A A . 102 TYR HH   1 1 
        1  1743 1 1 102 TYR N    N   3.995  12.352   3.213 1.00 . A A . 102 TYR N    1 1 
        1  1744 1 1 102 TYR O    O   4.794  10.097   4.662 1.00 . A A . 102 TYR O    1 1 
        1  1745 1 1 102 TYR OH   O  -0.129  13.078  -1.918 1.00 . A A . 102 TYR OH   1 1 
        1  1746 1 1 103 GLU C    C   3.341   7.326   5.460 1.00 . A A . 103 GLU C    1 1 
        1  1747 1 1 103 GLU CA   C   2.878   8.604   6.194 1.00 . A A . 103 GLU CA   1 1 
        1  1748 1 1 103 GLU CB   C   1.602   8.331   7.043 1.00 . A A . 103 GLU CB   1 1 
        1  1749 1 1 103 GLU CD   C   2.831   7.613   9.199 1.00 . A A . 103 GLU CD   1 1 
        1  1750 1 1 103 GLU CG   C   1.765   7.258   8.146 1.00 . A A . 103 GLU CG   1 1 
        1  1751 1 1 103 GLU H    H   1.689   9.953   5.089 1.00 . A A . 103 GLU H    1 1 
        1  1752 1 1 103 GLU HA   H   3.673   8.950   6.852 1.00 . A A . 103 GLU HA   1 1 
        1  1753 1 1 103 GLU HB2  H   1.302   9.260   7.523 1.00 . A A . 103 GLU HB2  1 1 
        1  1754 1 1 103 GLU HB3  H   0.802   8.020   6.378 1.00 . A A . 103 GLU HB3  1 1 
        1  1755 1 1 103 GLU HG2  H   0.812   7.133   8.651 1.00 . A A . 103 GLU HG2  1 1 
        1  1756 1 1 103 GLU HG3  H   2.027   6.315   7.676 1.00 . A A . 103 GLU HG3  1 1 
        1  1757 1 1 103 GLU N    N   2.618   9.661   5.214 1.00 . A A . 103 GLU N    1 1 
        1  1758 1 1 103 GLU O    O   2.535   6.611   4.848 1.00 . A A . 103 GLU O    1 1 
        1  1759 1 1 103 GLU OE1  O   2.566   8.488  10.051 1.00 . A A . 103 GLU OE1  1 1 
        1  1760 1 1 103 GLU OE2  O   3.932   7.024   9.188 1.00 . A A . 103 GLU OE2  1 1 
        1  1761 1 1 104 VAL C    C   6.128   5.178   5.922 1.00 . A A . 104 VAL C    1 1 
        1  1762 1 1 104 VAL CA   C   5.312   5.944   4.868 1.00 . A A . 104 VAL CA   1 1 
        1  1763 1 1 104 VAL CB   C   6.215   6.392   3.655 1.00 . A A . 104 VAL CB   1 1 
        1  1764 1 1 104 VAL CG1  C   7.131   7.584   4.012 1.00 . A A . 104 VAL CG1  1 1 
        1  1765 1 1 104 VAL CG2  C   7.034   5.206   3.091 1.00 . A A . 104 VAL CG2  1 1 
        1  1766 1 1 104 VAL H    H   5.214   7.736   5.969 1.00 . A A . 104 VAL H    1 1 
        1  1767 1 1 104 VAL HA   H   4.538   5.280   4.478 1.00 . A A . 104 VAL HA   1 1 
        1  1768 1 1 104 VAL HB   H   5.548   6.732   2.866 1.00 . A A . 104 VAL HB   1 1 
        1  1769 1 1 104 VAL HG11 H   7.707   7.879   3.141 1.00 . A A . 104 VAL HG11 1 1 
        1  1770 1 1 104 VAL HG12 H   7.812   7.302   4.806 1.00 . A A . 104 VAL HG12 1 1 
        1  1771 1 1 104 VAL HG13 H   6.531   8.423   4.341 1.00 . A A . 104 VAL HG13 1 1 
        1  1772 1 1 104 VAL HG21 H   6.361   4.412   2.785 1.00 . A A . 104 VAL HG21 1 1 
        1  1773 1 1 104 VAL HG22 H   7.707   4.827   3.851 1.00 . A A . 104 VAL HG22 1 1 
        1  1774 1 1 104 VAL HG23 H   7.611   5.528   2.234 1.00 . A A . 104 VAL HG23 1 1 
        1  1775 1 1 104 VAL N    N   4.654   7.095   5.492 1.00 . A A . 104 VAL N    1 1 
        1  1776 1 1 104 VAL O    O   6.876   5.775   6.707 1.00 . A A . 104 VAL O    1 1 
        1  1777 1 1 105 ARG C    C   7.668   2.116   6.111 1.00 . A A . 105 ARG C    1 1 
        1  1778 1 1 105 ARG CA   C   6.655   2.956   6.889 1.00 . A A . 105 ARG CA   1 1 
        1  1779 1 1 105 ARG CB   C   5.663   2.018   7.637 1.00 . A A . 105 ARG CB   1 1 
        1  1780 1 1 105 ARG CD   C   4.851   3.930   9.168 1.00 . A A . 105 ARG CD   1 1 
        1  1781 1 1 105 ARG CG   C   4.463   2.711   8.314 1.00 . A A . 105 ARG CG   1 1 
        1  1782 1 1 105 ARG CZ   C   6.444   4.553  10.993 1.00 . A A . 105 ARG CZ   1 1 
        1  1783 1 1 105 ARG H    H   5.315   3.451   5.323 1.00 . A A . 105 ARG H    1 1 
        1  1784 1 1 105 ARG HA   H   7.186   3.565   7.621 1.00 . A A . 105 ARG HA   1 1 
        1  1785 1 1 105 ARG HB2  H   5.268   1.294   6.930 1.00 . A A . 105 ARG HB2  1 1 
        1  1786 1 1 105 ARG HB3  H   6.210   1.477   8.403 1.00 . A A . 105 ARG HB3  1 1 
        1  1787 1 1 105 ARG HD2  H   5.240   4.701   8.513 1.00 . A A . 105 ARG HD2  1 1 
        1  1788 1 1 105 ARG HD3  H   3.956   4.304   9.654 1.00 . A A . 105 ARG HD3  1 1 
        1  1789 1 1 105 ARG HE   H   6.118   2.685  10.314 1.00 . A A . 105 ARG HE   1 1 
        1  1790 1 1 105 ARG HG2  H   3.774   3.041   7.544 1.00 . A A . 105 ARG HG2  1 1 
        1  1791 1 1 105 ARG HG3  H   3.956   1.993   8.947 1.00 . A A . 105 ARG HG3  1 1 
        1  1792 1 1 105 ARG HH11 H   5.467   6.151  10.197 1.00 . A A . 105 ARG HH11 1 1 
        1  1793 1 1 105 ARG HH12 H   6.585   6.521  11.474 1.00 . A A . 105 ARG HH12 1 1 
        1  1794 1 1 105 ARG HH21 H   7.547   3.197  12.005 1.00 . A A . 105 ARG HH21 1 1 
        1  1795 1 1 105 ARG HH22 H   7.761   4.847  12.498 1.00 . A A . 105 ARG HH22 1 1 
        1  1796 1 1 105 ARG N    N   5.945   3.848   5.958 1.00 . A A . 105 ARG N    1 1 
        1  1797 1 1 105 ARG NE   N   5.859   3.630  10.200 1.00 . A A . 105 ARG NE   1 1 
        1  1798 1 1 105 ARG NH1  N   6.144   5.844  10.876 1.00 . A A . 105 ARG NH1  1 1 
        1  1799 1 1 105 ARG NH2  N   7.323   4.167  11.903 1.00 . A A . 105 ARG NH2  1 1 
        1  1800 1 1 105 ARG O    O   7.430   1.782   4.949 1.00 . A A . 105 ARG O    1 1 
        1  1801 1 1 106 LYS C    C  10.255  -0.149   7.143 1.00 . A A . 106 LYS C    1 1 
        1  1802 1 1 106 LYS CA   C   9.851   0.951   6.175 1.00 . A A . 106 LYS CA   1 1 
        1  1803 1 1 106 LYS CB   C  11.075   1.827   5.838 1.00 . A A . 106 LYS CB   1 1 
        1  1804 1 1 106 LYS CD   C  13.381   2.023   4.721 1.00 . A A . 106 LYS CD   1 1 
        1  1805 1 1 106 LYS CE   C  14.152   2.640   5.890 1.00 . A A . 106 LYS CE   1 1 
        1  1806 1 1 106 LYS CG   C  12.241   1.078   5.161 1.00 . A A . 106 LYS CG   1 1 
        1  1807 1 1 106 LYS H    H   8.882   2.050   7.697 1.00 . A A . 106 LYS H    1 1 
        1  1808 1 1 106 LYS HA   H   9.476   0.499   5.258 1.00 . A A . 106 LYS HA   1 1 
        1  1809 1 1 106 LYS HB2  H  10.749   2.614   5.167 1.00 . A A . 106 LYS HB2  1 1 
        1  1810 1 1 106 LYS HB3  H  11.444   2.291   6.751 1.00 . A A . 106 LYS HB3  1 1 
        1  1811 1 1 106 LYS HD2  H  14.083   1.460   4.115 1.00 . A A . 106 LYS HD2  1 1 
        1  1812 1 1 106 LYS HD3  H  12.963   2.823   4.115 1.00 . A A . 106 LYS HD3  1 1 
        1  1813 1 1 106 LYS HE2  H  14.951   3.252   5.493 1.00 . A A . 106 LYS HE2  1 1 
        1  1814 1 1 106 LYS HE3  H  13.485   3.255   6.476 1.00 . A A . 106 LYS HE3  1 1 
        1  1815 1 1 106 LYS HG2  H  12.641   0.343   5.855 1.00 . A A . 106 LYS HG2  1 1 
        1  1816 1 1 106 LYS HG3  H  11.858   0.561   4.286 1.00 . A A . 106 LYS HG3  1 1 
        1  1817 1 1 106 LYS HZ1  H  14.018   1.071   7.262 1.00 . A A . 106 LYS HZ1  1 1 
        1  1818 1 1 106 LYS HZ2  H  15.376   2.055   7.465 1.00 . A A . 106 LYS HZ2  1 1 
        1  1819 1 1 106 LYS HZ3  H  15.322   0.944   6.193 1.00 . A A . 106 LYS HZ3  1 1 
        1  1820 1 1 106 LYS N    N   8.779   1.765   6.770 1.00 . A A . 106 LYS N    1 1 
        1  1821 1 1 106 LYS NZ   N  14.758   1.607   6.764 1.00 . A A . 106 LYS NZ   1 1 
        1  1822 1 1 106 LYS O    O  10.510   0.129   8.322 1.00 . A A . 106 LYS O    1 1 
        1  1823 1 1 107 VAL C    C  11.568  -3.515   6.591 1.00 . A A . 107 VAL C    1 1 
        1  1824 1 1 107 VAL CA   C  10.712  -2.564   7.449 1.00 . A A . 107 VAL CA   1 1 
        1  1825 1 1 107 VAL CB   C   9.479  -3.327   8.068 1.00 . A A . 107 VAL CB   1 1 
        1  1826 1 1 107 VAL CG1  C   8.644  -2.417   8.997 1.00 . A A . 107 VAL CG1  1 1 
        1  1827 1 1 107 VAL CG2  C   8.586  -3.954   6.991 1.00 . A A . 107 VAL CG2  1 1 
        1  1828 1 1 107 VAL H    H  10.077  -1.542   5.703 1.00 . A A . 107 VAL H    1 1 
        1  1829 1 1 107 VAL HA   H  11.337  -2.208   8.270 1.00 . A A . 107 VAL HA   1 1 
        1  1830 1 1 107 VAL HB   H   9.873  -4.138   8.682 1.00 . A A . 107 VAL HB   1 1 
        1  1831 1 1 107 VAL HG11 H   9.272  -2.032   9.789 1.00 . A A . 107 VAL HG11 1 1 
        1  1832 1 1 107 VAL HG12 H   7.829  -2.982   9.435 1.00 . A A . 107 VAL HG12 1 1 
        1  1833 1 1 107 VAL HG13 H   8.238  -1.589   8.429 1.00 . A A . 107 VAL HG13 1 1 
        1  1834 1 1 107 VAL HG21 H   7.748  -4.464   7.453 1.00 . A A . 107 VAL HG21 1 1 
        1  1835 1 1 107 VAL HG22 H   9.160  -4.669   6.415 1.00 . A A . 107 VAL HG22 1 1 
        1  1836 1 1 107 VAL HG23 H   8.212  -3.183   6.329 1.00 . A A . 107 VAL HG23 1 1 
        1  1837 1 1 107 VAL N    N  10.303  -1.398   6.651 1.00 . A A . 107 VAL N    1 1 
        1  1838 1 1 107 VAL O    O  11.563  -3.431   5.361 1.00 . A A . 107 VAL O    1 1 
        1  1839 1 1 108 THR C    C  12.593  -6.749   6.589 1.00 . A A . 108 THR C    1 1 
        1  1840 1 1 108 THR CA   C  13.235  -5.352   6.627 1.00 . A A . 108 THR CA   1 1 
        1  1841 1 1 108 THR CB   C  14.587  -5.393   7.419 1.00 . A A . 108 THR CB   1 1 
        1  1842 1 1 108 THR CG2  C  15.689  -6.183   6.681 1.00 . A A . 108 THR CG2  1 1 
        1  1843 1 1 108 THR H    H  12.190  -4.433   8.238 1.00 . A A . 108 THR H    1 1 
        1  1844 1 1 108 THR HA   H  13.436  -5.016   5.610 1.00 . A A . 108 THR HA   1 1 
        1  1845 1 1 108 THR HB   H  14.408  -5.866   8.381 1.00 . A A . 108 THR HB   1 1 
        1  1846 1 1 108 THR HG1  H  15.201  -3.607   6.815 1.00 . A A . 108 THR HG1  1 1 
        1  1847 1 1 108 THR HG21 H  15.903  -5.718   5.727 1.00 . A A . 108 THR HG21 1 1 
        1  1848 1 1 108 THR HG22 H  15.363  -7.202   6.516 1.00 . A A . 108 THR HG22 1 1 
        1  1849 1 1 108 THR HG23 H  16.591  -6.193   7.280 1.00 . A A . 108 THR HG23 1 1 
        1  1850 1 1 108 THR N    N  12.299  -4.406   7.266 1.00 . A A . 108 THR N    1 1 
        1  1851 1 1 108 THR O    O  12.503  -7.381   5.532 1.00 . A A . 108 THR O    1 1 
        1  1852 1 1 108 THR OG1  O  15.043  -4.050   7.658 1.00 . A A . 108 THR OG1  1 1 
        1  1853 1 1 109 ASP C    C   9.983  -8.351   7.493 1.00 . A A . 109 ASP C    1 1 
        1  1854 1 1 109 ASP CA   C  11.438  -8.476   7.951 1.00 . A A . 109 ASP CA   1 1 
        1  1855 1 1 109 ASP CB   C  11.467  -8.911   9.440 1.00 . A A . 109 ASP CB   1 1 
        1  1856 1 1 109 ASP CG   C  12.862  -9.304   9.935 1.00 . A A . 109 ASP CG   1 1 
        1  1857 1 1 109 ASP H    H  12.273  -6.638   8.558 1.00 . A A . 109 ASP H    1 1 
        1  1858 1 1 109 ASP HA   H  11.943  -9.228   7.349 1.00 . A A . 109 ASP HA   1 1 
        1  1859 1 1 109 ASP HB2  H  11.108  -8.089  10.052 1.00 . A A . 109 ASP HB2  1 1 
        1  1860 1 1 109 ASP HB3  H  10.792  -9.757   9.582 1.00 . A A . 109 ASP HB3  1 1 
        1  1861 1 1 109 ASP N    N  12.139  -7.199   7.770 1.00 . A A . 109 ASP N    1 1 
        1  1862 1 1 109 ASP O    O   9.345  -7.305   7.679 1.00 . A A . 109 ASP O    1 1 
        1  1863 1 1 109 ASP OD1  O  13.739  -8.420  10.028 1.00 . A A . 109 ASP OD1  1 1 
        1  1864 1 1 109 ASP OD2  O  13.096 -10.500  10.246 1.00 . A A . 109 ASP OD2  1 1 
        1  1865 1 1 110 ASP C    C   7.096  -9.499   7.650 1.00 . A A . 110 ASP C    1 1 
        1  1866 1 1 110 ASP CA   C   8.078  -9.556   6.455 1.00 . A A . 110 ASP CA   1 1 
        1  1867 1 1 110 ASP CB   C   7.883 -10.878   5.643 1.00 . A A . 110 ASP CB   1 1 
        1  1868 1 1 110 ASP CG   C   7.659 -12.132   6.517 1.00 . A A . 110 ASP CG   1 1 
        1  1869 1 1 110 ASP H    H  10.066 -10.212   6.768 1.00 . A A . 110 ASP H    1 1 
        1  1870 1 1 110 ASP HA   H   7.882  -8.712   5.800 1.00 . A A . 110 ASP HA   1 1 
        1  1871 1 1 110 ASP HB2  H   7.036 -10.761   4.979 1.00 . A A . 110 ASP HB2  1 1 
        1  1872 1 1 110 ASP HB3  H   8.759 -11.049   5.026 1.00 . A A . 110 ASP HB3  1 1 
        1  1873 1 1 110 ASP N    N   9.471  -9.446   6.914 1.00 . A A . 110 ASP N    1 1 
        1  1874 1 1 110 ASP O    O   5.960  -9.039   7.502 1.00 . A A . 110 ASP O    1 1 
        1  1875 1 1 110 ASP OD1  O   8.626 -12.614   7.137 1.00 . A A . 110 ASP OD1  1 1 
        1  1876 1 1 110 ASP OD2  O   6.511 -12.620   6.607 1.00 . A A . 110 ASP OD2  1 1 
        1  1877 1 1 111 GLU C    C   6.357  -8.621  10.537 1.00 . A A . 111 GLU C    1 1 
        1  1878 1 1 111 GLU CA   C   6.755 -10.033  10.071 1.00 . A A . 111 GLU CA   1 1 
        1  1879 1 1 111 GLU CB   C   7.522 -10.784  11.205 1.00 . A A . 111 GLU CB   1 1 
        1  1880 1 1 111 GLU CD   C   9.467 -10.747  12.920 1.00 . A A . 111 GLU CD   1 1 
        1  1881 1 1 111 GLU CG   C   8.800 -10.072  11.710 1.00 . A A . 111 GLU CG   1 1 
        1  1882 1 1 111 GLU H    H   8.476 -10.342   8.860 1.00 . A A . 111 GLU H    1 1 
        1  1883 1 1 111 GLU HA   H   5.849 -10.587   9.844 1.00 . A A . 111 GLU HA   1 1 
        1  1884 1 1 111 GLU HB2  H   6.851 -10.919  12.050 1.00 . A A . 111 GLU HB2  1 1 
        1  1885 1 1 111 GLU HB3  H   7.806 -11.764  10.838 1.00 . A A . 111 GLU HB3  1 1 
        1  1886 1 1 111 GLU HG2  H   9.511 -10.027  10.893 1.00 . A A . 111 GLU HG2  1 1 
        1  1887 1 1 111 GLU HG3  H   8.539  -9.054  11.990 1.00 . A A . 111 GLU HG3  1 1 
        1  1888 1 1 111 GLU N    N   7.561  -9.987   8.829 1.00 . A A . 111 GLU N    1 1 
        1  1889 1 1 111 GLU O    O   5.230  -8.411  11.008 1.00 . A A . 111 GLU O    1 1 
        1  1890 1 1 111 GLU OE1  O   8.809 -10.876  13.971 1.00 . A A . 111 GLU OE1  1 1 
        1  1891 1 1 111 GLU OE2  O  10.651 -11.147  12.831 1.00 . A A . 111 GLU OE2  1 1 
        1  1892 1 1 112 GLU C    C   6.024  -5.593   9.929 1.00 . A A . 112 GLU C    1 1 
        1  1893 1 1 112 GLU CA   C   7.103  -6.263  10.791 1.00 . A A . 112 GLU CA   1 1 
        1  1894 1 1 112 GLU CB   C   8.424  -5.483  10.647 1.00 . A A . 112 GLU CB   1 1 
        1  1895 1 1 112 GLU CD   C  10.914  -5.210  11.116 1.00 . A A . 112 GLU CD   1 1 
        1  1896 1 1 112 GLU CG   C   9.645  -6.043  11.393 1.00 . A A . 112 GLU CG   1 1 
        1  1897 1 1 112 GLU H    H   8.137  -7.909   9.960 1.00 . A A . 112 GLU H    1 1 
        1  1898 1 1 112 GLU HA   H   6.790  -6.248  11.833 1.00 . A A . 112 GLU HA   1 1 
        1  1899 1 1 112 GLU HB2  H   8.676  -5.441   9.591 1.00 . A A . 112 GLU HB2  1 1 
        1  1900 1 1 112 GLU HB3  H   8.261  -4.466  10.992 1.00 . A A . 112 GLU HB3  1 1 
        1  1901 1 1 112 GLU HG2  H   9.440  -6.041  12.462 1.00 . A A . 112 GLU HG2  1 1 
        1  1902 1 1 112 GLU HG3  H   9.814  -7.066  11.072 1.00 . A A . 112 GLU HG3  1 1 
        1  1903 1 1 112 GLU N    N   7.289  -7.663  10.378 1.00 . A A . 112 GLU N    1 1 
        1  1904 1 1 112 GLU O    O   5.220  -4.796  10.430 1.00 . A A . 112 GLU O    1 1 
        1  1905 1 1 112 GLU OE1  O  11.607  -5.476  10.115 1.00 . A A . 112 GLU OE1  1 1 
        1  1906 1 1 112 GLU OE2  O  11.202  -4.254  11.869 1.00 . A A . 112 GLU OE2  1 1 
        1  1907 1 1 113 ALA C    C   3.629  -5.955   8.068 1.00 . A A . 113 ALA C    1 1 
        1  1908 1 1 113 ALA CA   C   5.027  -5.470   7.661 1.00 . A A . 113 ALA CA   1 1 
        1  1909 1 1 113 ALA CB   C   5.381  -5.935   6.239 1.00 . A A . 113 ALA CB   1 1 
        1  1910 1 1 113 ALA H    H   6.745  -6.528   8.304 1.00 . A A . 113 ALA H    1 1 
        1  1911 1 1 113 ALA HA   H   5.039  -4.381   7.669 1.00 . A A . 113 ALA HA   1 1 
        1  1912 1 1 113 ALA HB1  H   6.360  -5.558   5.972 1.00 . A A . 113 ALA HB1  1 1 
        1  1913 1 1 113 ALA HB2  H   4.652  -5.553   5.535 1.00 . A A . 113 ALA HB2  1 1 
        1  1914 1 1 113 ALA HB3  H   5.393  -7.016   6.193 1.00 . A A . 113 ALA HB3  1 1 
        1  1915 1 1 113 ALA N    N   6.032  -5.938   8.624 1.00 . A A . 113 ALA N    1 1 
        1  1916 1 1 113 ALA O    O   2.683  -5.176   8.058 1.00 . A A . 113 ALA O    1 1 
        1  1917 1 1 114 LEU C    C   1.734  -7.222  10.212 1.00 . A A . 114 LEU C    1 1 
        1  1918 1 1 114 LEU CA   C   2.273  -7.870   8.925 1.00 . A A . 114 LEU CA   1 1 
        1  1919 1 1 114 LEU CB   C   2.488  -9.389   9.145 1.00 . A A . 114 LEU CB   1 1 
        1  1920 1 1 114 LEU CD1  C   3.160 -11.683   8.231 1.00 . A A . 114 LEU CD1  1 1 
        1  1921 1 1 114 LEU CD2  C   1.624 -10.161   6.864 1.00 . A A . 114 LEU CD2  1 1 
        1  1922 1 1 114 LEU CG   C   2.802 -10.224   7.868 1.00 . A A . 114 LEU CG   1 1 
        1  1923 1 1 114 LEU H    H   4.360  -7.771   8.548 1.00 . A A . 114 LEU H    1 1 
        1  1924 1 1 114 LEU HA   H   1.543  -7.730   8.133 1.00 . A A . 114 LEU HA   1 1 
        1  1925 1 1 114 LEU HB2  H   3.307  -9.512   9.847 1.00 . A A . 114 LEU HB2  1 1 
        1  1926 1 1 114 LEU HB3  H   1.592  -9.804   9.603 1.00 . A A . 114 LEU HB3  1 1 
        1  1927 1 1 114 LEU HD11 H   2.315 -12.164   8.709 1.00 . A A . 114 LEU HD11 1 1 
        1  1928 1 1 114 LEU HD12 H   4.003 -11.692   8.909 1.00 . A A . 114 LEU HD12 1 1 
        1  1929 1 1 114 LEU HD13 H   3.424 -12.231   7.335 1.00 . A A . 114 LEU HD13 1 1 
        1  1930 1 1 114 LEU HD21 H   0.725 -10.547   7.325 1.00 . A A . 114 LEU HD21 1 1 
        1  1931 1 1 114 LEU HD22 H   1.859 -10.749   5.986 1.00 . A A . 114 LEU HD22 1 1 
        1  1932 1 1 114 LEU HD23 H   1.459  -9.134   6.564 1.00 . A A . 114 LEU HD23 1 1 
        1  1933 1 1 114 LEU HG   H   3.670  -9.793   7.378 1.00 . A A . 114 LEU HG   1 1 
        1  1934 1 1 114 LEU N    N   3.539  -7.235   8.494 1.00 . A A . 114 LEU N    1 1 
        1  1935 1 1 114 LEU O    O   0.510  -7.128  10.398 1.00 . A A . 114 LEU O    1 1 
        1  1936 1 1 115 LYS C    C   1.618  -4.725  11.944 1.00 . A A . 115 LYS C    1 1 
        1  1937 1 1 115 LYS CA   C   2.308  -6.045  12.319 1.00 . A A . 115 LYS CA   1 1 
        1  1938 1 1 115 LYS CB   C   3.554  -5.764  13.213 1.00 . A A . 115 LYS CB   1 1 
        1  1939 1 1 115 LYS CD   C   4.484  -4.559  15.350 1.00 . A A . 115 LYS CD   1 1 
        1  1940 1 1 115 LYS CE   C   4.945  -5.695  16.293 1.00 . A A . 115 LYS CE   1 1 
        1  1941 1 1 115 LYS CG   C   3.243  -4.906  14.477 1.00 . A A . 115 LYS CG   1 1 
        1  1942 1 1 115 LYS H    H   3.610  -6.969  10.914 1.00 . A A . 115 LYS H    1 1 
        1  1943 1 1 115 LYS HA   H   1.610  -6.662  12.881 1.00 . A A . 115 LYS HA   1 1 
        1  1944 1 1 115 LYS HB2  H   3.972  -6.712  13.536 1.00 . A A . 115 LYS HB2  1 1 
        1  1945 1 1 115 LYS HB3  H   4.301  -5.244  12.622 1.00 . A A . 115 LYS HB3  1 1 
        1  1946 1 1 115 LYS HD2  H   5.308  -4.302  14.700 1.00 . A A . 115 LYS HD2  1 1 
        1  1947 1 1 115 LYS HD3  H   4.244  -3.689  15.957 1.00 . A A . 115 LYS HD3  1 1 
        1  1948 1 1 115 LYS HE2  H   5.754  -5.325  16.911 1.00 . A A . 115 LYS HE2  1 1 
        1  1949 1 1 115 LYS HE3  H   4.116  -5.974  16.934 1.00 . A A . 115 LYS HE3  1 1 
        1  1950 1 1 115 LYS HG2  H   2.789  -3.977  14.149 1.00 . A A . 115 LYS HG2  1 1 
        1  1951 1 1 115 LYS HG3  H   2.521  -5.439  15.088 1.00 . A A . 115 LYS HG3  1 1 
        1  1952 1 1 115 LYS HZ1  H   5.858  -7.576  16.247 1.00 . A A . 115 LYS HZ1  1 1 
        1  1953 1 1 115 LYS HZ2  H   6.131  -6.655  14.856 1.00 . A A . 115 LYS HZ2  1 1 
        1  1954 1 1 115 LYS HZ3  H   4.626  -7.393  15.110 1.00 . A A . 115 LYS HZ3  1 1 
        1  1955 1 1 115 LYS N    N   2.663  -6.784  11.097 1.00 . A A . 115 LYS N    1 1 
        1  1956 1 1 115 LYS NZ   N   5.422  -6.911  15.575 1.00 . A A . 115 LYS NZ   1 1 
        1  1957 1 1 115 LYS O    O   0.539  -4.440  12.442 1.00 . A A . 115 LYS O    1 1 
        1  1958 1 1 116 ILE C    C   0.472  -2.707   9.776 1.00 . A A . 116 ILE C    1 1 
        1  1959 1 1 116 ILE CA   C   1.781  -2.622  10.605 1.00 . A A . 116 ILE CA   1 1 
        1  1960 1 1 116 ILE CB   C   2.912  -1.850   9.818 1.00 . A A . 116 ILE CB   1 1 
        1  1961 1 1 116 ILE CD1  C   5.389  -1.083  10.012 1.00 . A A . 116 ILE CD1  1 1 
        1  1962 1 1 116 ILE CG1  C   4.194  -1.709  10.710 1.00 . A A . 116 ILE CG1  1 1 
        1  1963 1 1 116 ILE CG2  C   2.433  -0.452   9.327 1.00 . A A . 116 ILE CG2  1 1 
        1  1964 1 1 116 ILE H    H   3.061  -4.327  10.597 1.00 . A A . 116 ILE H    1 1 
        1  1965 1 1 116 ILE HA   H   1.566  -2.062  11.515 1.00 . A A . 116 ILE HA   1 1 
        1  1966 1 1 116 ILE HB   H   3.166  -2.438   8.939 1.00 . A A . 116 ILE HB   1 1 
        1  1967 1 1 116 ILE HD11 H   5.659  -1.679   9.150 1.00 . A A . 116 ILE HD11 1 1 
        1  1968 1 1 116 ILE HD12 H   6.225  -1.048  10.696 1.00 . A A . 116 ILE HD12 1 1 
        1  1969 1 1 116 ILE HD13 H   5.144  -0.079   9.695 1.00 . A A . 116 ILE HD13 1 1 
        1  1970 1 1 116 ILE HG12 H   3.968  -1.096  11.573 1.00 . A A . 116 ILE HG12 1 1 
        1  1971 1 1 116 ILE HG13 H   4.500  -2.690  11.055 1.00 . A A . 116 ILE HG13 1 1 
        1  1972 1 1 116 ILE HG21 H   1.573  -0.567   8.678 1.00 . A A . 116 ILE HG21 1 1 
        1  1973 1 1 116 ILE HG22 H   3.225   0.037   8.777 1.00 . A A . 116 ILE HG22 1 1 
        1  1974 1 1 116 ILE HG23 H   2.158   0.160  10.177 1.00 . A A . 116 ILE HG23 1 1 
        1  1975 1 1 116 ILE N    N   2.248  -3.966  11.020 1.00 . A A . 116 ILE N    1 1 
        1  1976 1 1 116 ILE O    O  -0.350  -1.784   9.824 1.00 . A A . 116 ILE O    1 1 
        1  1977 1 1 117 VAL C    C  -2.128  -4.222   9.403 1.00 . A A . 117 VAL C    1 1 
        1  1978 1 1 117 VAL CA   C  -0.989  -4.135   8.353 1.00 . A A . 117 VAL CA   1 1 
        1  1979 1 1 117 VAL CB   C  -0.886  -5.476   7.502 1.00 . A A . 117 VAL CB   1 1 
        1  1980 1 1 117 VAL CG1  C  -2.265  -5.965   6.994 1.00 . A A . 117 VAL CG1  1 1 
        1  1981 1 1 117 VAL CG2  C   0.089  -5.310   6.306 1.00 . A A . 117 VAL CG2  1 1 
        1  1982 1 1 117 VAL H    H   1.029  -4.444   8.937 1.00 . A A . 117 VAL H    1 1 
        1  1983 1 1 117 VAL HA   H  -1.204  -3.312   7.670 1.00 . A A . 117 VAL HA   1 1 
        1  1984 1 1 117 VAL HB   H  -0.482  -6.247   8.151 1.00 . A A . 117 VAL HB   1 1 
        1  1985 1 1 117 VAL HG11 H  -2.712  -5.211   6.356 1.00 . A A . 117 VAL HG11 1 1 
        1  1986 1 1 117 VAL HG12 H  -2.918  -6.150   7.835 1.00 . A A . 117 VAL HG12 1 1 
        1  1987 1 1 117 VAL HG13 H  -2.146  -6.884   6.431 1.00 . A A . 117 VAL HG13 1 1 
        1  1988 1 1 117 VAL HG21 H   1.065  -5.021   6.669 1.00 . A A . 117 VAL HG21 1 1 
        1  1989 1 1 117 VAL HG22 H  -0.280  -4.548   5.631 1.00 . A A . 117 VAL HG22 1 1 
        1  1990 1 1 117 VAL HG23 H   0.178  -6.249   5.769 1.00 . A A . 117 VAL HG23 1 1 
        1  1991 1 1 117 VAL N    N   0.285  -3.823   9.036 1.00 . A A . 117 VAL N    1 1 
        1  1992 1 1 117 VAL O    O  -3.177  -3.590   9.235 1.00 . A A . 117 VAL O    1 1 
        1  1993 1 1 118 ARG C    C  -3.015  -3.791  12.413 1.00 . A A . 118 ARG C    1 1 
        1  1994 1 1 118 ARG CA   C  -2.844  -5.115  11.618 1.00 . A A . 118 ARG CA   1 1 
        1  1995 1 1 118 ARG CB   C  -2.445  -6.284  12.568 1.00 . A A . 118 ARG CB   1 1 
        1  1996 1 1 118 ARG CD   C  -2.451  -8.837  12.975 1.00 . A A . 118 ARG CD   1 1 
        1  1997 1 1 118 ARG CG   C  -2.497  -7.698  11.925 1.00 . A A . 118 ARG CG   1 1 
        1  1998 1 1 118 ARG CZ   C  -3.909  -9.678  14.868 1.00 . A A . 118 ARG CZ   1 1 
        1  1999 1 1 118 ARG H    H  -1.001  -5.406  10.585 1.00 . A A . 118 ARG H    1 1 
        1  2000 1 1 118 ARG HA   H  -3.807  -5.354  11.165 1.00 . A A . 118 ARG HA   1 1 
        1  2001 1 1 118 ARG HB2  H  -1.434  -6.109  12.924 1.00 . A A . 118 ARG HB2  1 1 
        1  2002 1 1 118 ARG HB3  H  -3.112  -6.280  13.427 1.00 . A A . 118 ARG HB3  1 1 
        1  2003 1 1 118 ARG HD2  H  -2.460  -9.789  12.455 1.00 . A A . 118 ARG HD2  1 1 
        1  2004 1 1 118 ARG HD3  H  -1.536  -8.753  13.550 1.00 . A A . 118 ARG HD3  1 1 
        1  2005 1 1 118 ARG HE   H  -4.214  -8.015  13.783 1.00 . A A . 118 ARG HE   1 1 
        1  2006 1 1 118 ARG HG2  H  -3.415  -7.792  11.353 1.00 . A A . 118 ARG HG2  1 1 
        1  2007 1 1 118 ARG HG3  H  -1.652  -7.806  11.251 1.00 . A A . 118 ARG HG3  1 1 
        1  2008 1 1 118 ARG HH11 H  -2.332 -10.920  14.533 1.00 . A A . 118 ARG HH11 1 1 
        1  2009 1 1 118 ARG HH12 H  -3.397 -11.406  15.814 1.00 . A A . 118 ARG HH12 1 1 
        1  2010 1 1 118 ARG HH21 H  -5.548  -8.654  15.489 1.00 . A A . 118 ARG HH21 1 1 
        1  2011 1 1 118 ARG HH22 H  -5.215 -10.124  16.353 1.00 . A A . 118 ARG HH22 1 1 
        1  2012 1 1 118 ARG N    N  -1.872  -4.960  10.511 1.00 . A A . 118 ARG N    1 1 
        1  2013 1 1 118 ARG NE   N  -3.611  -8.780  13.897 1.00 . A A . 118 ARG NE   1 1 
        1  2014 1 1 118 ARG NH1  N  -3.152 -10.752  15.088 1.00 . A A . 118 ARG NH1  1 1 
        1  2015 1 1 118 ARG NH2  N  -4.976  -9.471  15.628 1.00 . A A . 118 ARG NH2  1 1 
        1  2016 1 1 118 ARG O    O  -4.132  -3.459  12.833 1.00 . A A . 118 ARG O    1 1 
        1  2017 1 1 119 GLU C    C  -2.787  -0.723  12.544 1.00 . A A . 119 GLU C    1 1 
        1  2018 1 1 119 GLU CA   C  -1.906  -1.731  13.286 1.00 . A A . 119 GLU CA   1 1 
        1  2019 1 1 119 GLU CB   C  -0.462  -1.163  13.420 1.00 . A A . 119 GLU CB   1 1 
        1  2020 1 1 119 GLU CD   C  -0.107  -1.919  15.846 1.00 . A A . 119 GLU CD   1 1 
        1  2021 1 1 119 GLU CG   C   0.441  -1.922  14.405 1.00 . A A . 119 GLU CG   1 1 
        1  2022 1 1 119 GLU H    H  -1.048  -3.427  12.352 1.00 . A A . 119 GLU H    1 1 
        1  2023 1 1 119 GLU HA   H  -2.316  -1.875  14.284 1.00 . A A . 119 GLU HA   1 1 
        1  2024 1 1 119 GLU HB2  H   0.011  -1.182  12.443 1.00 . A A . 119 GLU HB2  1 1 
        1  2025 1 1 119 GLU HB3  H  -0.517  -0.132  13.749 1.00 . A A . 119 GLU HB3  1 1 
        1  2026 1 1 119 GLU HG2  H   0.542  -2.945  14.058 1.00 . A A . 119 GLU HG2  1 1 
        1  2027 1 1 119 GLU HG3  H   1.423  -1.459  14.405 1.00 . A A . 119 GLU HG3  1 1 
        1  2028 1 1 119 GLU N    N  -1.902  -3.052  12.617 1.00 . A A . 119 GLU N    1 1 
        1  2029 1 1 119 GLU O    O  -3.513   0.049  13.177 1.00 . A A . 119 GLU O    1 1 
        1  2030 1 1 119 GLU OE1  O  -0.089  -0.847  16.487 1.00 . A A . 119 GLU OE1  1 1 
        1  2031 1 1 119 GLU OE2  O  -0.557  -2.979  16.336 1.00 . A A . 119 GLU OE2  1 1 
        1  2032 1 1 120 PHE C    C  -5.005  -0.093  10.552 1.00 . A A . 120 PHE C    1 1 
        1  2033 1 1 120 PHE CA   C  -3.506   0.126  10.326 1.00 . A A . 120 PHE CA   1 1 
        1  2034 1 1 120 PHE CB   C  -3.151  -0.110   8.831 1.00 . A A . 120 PHE CB   1 1 
        1  2035 1 1 120 PHE CD1  C  -3.654   2.095   7.648 1.00 . A A . 120 PHE CD1  1 1 
        1  2036 1 1 120 PHE CD2  C  -5.068   0.223   7.161 1.00 . A A . 120 PHE CD2  1 1 
        1  2037 1 1 120 PHE CE1  C  -4.403   2.877   6.786 1.00 . A A . 120 PHE CE1  1 1 
        1  2038 1 1 120 PHE CE2  C  -5.817   1.010   6.306 1.00 . A A . 120 PHE CE2  1 1 
        1  2039 1 1 120 PHE CG   C  -3.968   0.751   7.851 1.00 . A A . 120 PHE CG   1 1 
        1  2040 1 1 120 PHE CZ   C  -5.481   2.336   6.118 1.00 . A A . 120 PHE CZ   1 1 
        1  2041 1 1 120 PHE H    H  -2.106  -1.400  10.781 1.00 . A A . 120 PHE H    1 1 
        1  2042 1 1 120 PHE HA   H  -3.258   1.153  10.589 1.00 . A A . 120 PHE HA   1 1 
        1  2043 1 1 120 PHE HB2  H  -2.101   0.117   8.679 1.00 . A A . 120 PHE HB2  1 1 
        1  2044 1 1 120 PHE HB3  H  -3.314  -1.158   8.585 1.00 . A A . 120 PHE HB3  1 1 
        1  2045 1 1 120 PHE HD1  H  -2.807   2.530   8.166 1.00 . A A . 120 PHE HD1  1 1 
        1  2046 1 1 120 PHE HD2  H  -5.332  -0.819   7.302 1.00 . A A . 120 PHE HD2  1 1 
        1  2047 1 1 120 PHE HE1  H  -4.142   3.919   6.637 1.00 . A A . 120 PHE HE1  1 1 
        1  2048 1 1 120 PHE HE2  H  -6.665   0.586   5.781 1.00 . A A . 120 PHE HE2  1 1 
        1  2049 1 1 120 PHE HZ   H  -6.067   2.952   5.449 1.00 . A A . 120 PHE HZ   1 1 
        1  2050 1 1 120 PHE N    N  -2.715  -0.756  11.199 1.00 . A A . 120 PHE N    1 1 
        1  2051 1 1 120 PHE O    O  -5.769   0.852  10.530 1.00 . A A . 120 PHE O    1 1 
        1  2052 1 1 121 MET C    C  -7.533  -0.968  12.079 1.00 . A A . 121 MET C    1 1 
        1  2053 1 1 121 MET CA   C  -6.809  -1.752  10.953 1.00 . A A . 121 MET CA   1 1 
        1  2054 1 1 121 MET CB   C  -6.917  -3.277  11.201 1.00 . A A . 121 MET CB   1 1 
        1  2055 1 1 121 MET CE   C  -5.721  -4.887   7.479 1.00 . A A . 121 MET CE   1 1 
        1  2056 1 1 121 MET CG   C  -6.199  -4.138  10.156 1.00 . A A . 121 MET CG   1 1 
        1  2057 1 1 121 MET H    H  -4.697  -2.049  10.848 1.00 . A A . 121 MET H    1 1 
        1  2058 1 1 121 MET HA   H  -7.311  -1.521  10.007 1.00 . A A . 121 MET HA   1 1 
        1  2059 1 1 121 MET HB2  H  -6.495  -3.504  12.176 1.00 . A A . 121 MET HB2  1 1 
        1  2060 1 1 121 MET HB3  H  -7.962  -3.560  11.206 1.00 . A A . 121 MET HB3  1 1 
        1  2061 1 1 121 MET HE1  H  -6.009  -4.807   6.441 1.00 . A A . 121 MET HE1  1 1 
        1  2062 1 1 121 MET HE2  H  -5.774  -5.922   7.786 1.00 . A A . 121 MET HE2  1 1 
        1  2063 1 1 121 MET HE3  H  -4.709  -4.528   7.599 1.00 . A A . 121 MET HE3  1 1 
        1  2064 1 1 121 MET HG2  H  -5.146  -3.886  10.160 1.00 . A A . 121 MET HG2  1 1 
        1  2065 1 1 121 MET HG3  H  -6.310  -5.182  10.423 1.00 . A A . 121 MET HG3  1 1 
        1  2066 1 1 121 MET N    N  -5.392  -1.354  10.799 1.00 . A A . 121 MET N    1 1 
        1  2067 1 1 121 MET O    O  -8.746  -0.771  12.002 1.00 . A A . 121 MET O    1 1 
        1  2068 1 1 121 MET SD   S  -6.833  -3.902   8.485 1.00 . A A . 121 MET SD   1 1 
        1  2069 1 1 122 GLN C    C  -6.939   1.804  14.006 1.00 . A A . 122 GLN C    1 1 
        1  2070 1 1 122 GLN CA   C  -7.331   0.317  14.209 1.00 . A A . 122 GLN CA   1 1 
        1  2071 1 1 122 GLN CB   C  -6.891  -0.210  15.609 1.00 . A A . 122 GLN CB   1 1 
        1  2072 1 1 122 GLN CD   C  -5.007  -0.852  17.225 1.00 . A A . 122 GLN CD   1 1 
        1  2073 1 1 122 GLN CG   C  -5.373  -0.212  15.881 1.00 . A A . 122 GLN CG   1 1 
        1  2074 1 1 122 GLN H    H  -5.835  -0.776  13.134 1.00 . A A . 122 GLN H    1 1 
        1  2075 1 1 122 GLN HA   H  -8.421   0.257  14.156 1.00 . A A . 122 GLN HA   1 1 
        1  2076 1 1 122 GLN HB2  H  -7.369   0.394  16.372 1.00 . A A . 122 GLN HB2  1 1 
        1  2077 1 1 122 GLN HB3  H  -7.252  -1.229  15.711 1.00 . A A . 122 GLN HB3  1 1 
        1  2078 1 1 122 GLN HE21 H  -5.242   0.882  18.168 1.00 . A A . 122 GLN HE21 1 1 
        1  2079 1 1 122 GLN HE22 H  -4.780  -0.461  19.152 1.00 . A A . 122 GLN HE22 1 1 
        1  2080 1 1 122 GLN HG2  H  -4.879  -0.767  15.086 1.00 . A A . 122 GLN HG2  1 1 
        1  2081 1 1 122 GLN HG3  H  -5.017   0.813  15.865 1.00 . A A . 122 GLN HG3  1 1 
        1  2082 1 1 122 GLN N    N  -6.785  -0.538  13.122 1.00 . A A . 122 GLN N    1 1 
        1  2083 1 1 122 GLN NE2  N  -5.010  -0.066  18.288 1.00 . A A . 122 GLN NE2  1 1 
        1  2084 1 1 122 GLN O    O  -7.734   2.710  14.289 1.00 . A A . 122 GLN O    1 1 
        1  2085 1 1 122 GLN OE1  O  -4.753  -2.054  17.307 1.00 . A A . 122 GLN OE1  1 1 
        1  2086 1 1 123 LYS C    C  -5.865   4.148  12.133 1.00 . A A . 123 LYS C    1 1 
        1  2087 1 1 123 LYS CA   C  -5.152   3.400  13.270 1.00 . A A . 123 LYS CA   1 1 
        1  2088 1 1 123 LYS CB   C  -3.626   3.320  12.967 1.00 . A A . 123 LYS CB   1 1 
        1  2089 1 1 123 LYS CD   C  -1.227   2.981  13.836 1.00 . A A . 123 LYS CD   1 1 
        1  2090 1 1 123 LYS CE   C  -0.316   3.037  15.076 1.00 . A A . 123 LYS CE   1 1 
        1  2091 1 1 123 LYS CG   C  -2.732   3.060  14.201 1.00 . A A . 123 LYS CG   1 1 
        1  2092 1 1 123 LYS H    H  -5.169   1.267  13.238 1.00 . A A . 123 LYS H    1 1 
        1  2093 1 1 123 LYS HA   H  -5.294   3.967  14.186 1.00 . A A . 123 LYS HA   1 1 
        1  2094 1 1 123 LYS HB2  H  -3.458   2.518  12.253 1.00 . A A . 123 LYS HB2  1 1 
        1  2095 1 1 123 LYS HB3  H  -3.302   4.253  12.512 1.00 . A A . 123 LYS HB3  1 1 
        1  2096 1 1 123 LYS HD2  H  -1.038   2.050  13.309 1.00 . A A . 123 LYS HD2  1 1 
        1  2097 1 1 123 LYS HD3  H  -0.976   3.813  13.181 1.00 . A A . 123 LYS HD3  1 1 
        1  2098 1 1 123 LYS HE2  H   0.714   2.986  14.755 1.00 . A A . 123 LYS HE2  1 1 
        1  2099 1 1 123 LYS HE3  H  -0.479   3.979  15.588 1.00 . A A . 123 LYS HE3  1 1 
        1  2100 1 1 123 LYS HG2  H  -2.881   3.866  14.912 1.00 . A A . 123 LYS HG2  1 1 
        1  2101 1 1 123 LYS HG3  H  -3.032   2.122  14.662 1.00 . A A . 123 LYS HG3  1 1 
        1  2102 1 1 123 LYS HZ1  H   0.096   1.996  16.835 1.00 . A A . 123 LYS HZ1  1 1 
        1  2103 1 1 123 LYS HZ2  H  -0.423   1.008  15.565 1.00 . A A . 123 LYS HZ2  1 1 
        1  2104 1 1 123 LYS HZ3  H  -1.536   1.974  16.397 1.00 . A A . 123 LYS HZ3  1 1 
        1  2105 1 1 123 LYS N    N  -5.714   2.038  13.492 1.00 . A A . 123 LYS N    1 1 
        1  2106 1 1 123 LYS NZ   N  -0.566   1.926  16.033 1.00 . A A . 123 LYS NZ   1 1 
        1  2107 1 1 123 LYS O    O  -5.790   5.373  12.061 1.00 . A A . 123 LYS O    1 1 
        1  2108 1 1 124 ALA C    C  -8.555   4.634  10.595 1.00 . A A . 124 ALA C    1 1 
        1  2109 1 1 124 ALA CA   C  -7.271   3.954  10.112 1.00 . A A . 124 ALA CA   1 1 
        1  2110 1 1 124 ALA CB   C  -7.586   2.849   9.101 1.00 . A A . 124 ALA CB   1 1 
        1  2111 1 1 124 ALA H    H  -6.549   2.429  11.380 1.00 . A A . 124 ALA H    1 1 
        1  2112 1 1 124 ALA HA   H  -6.637   4.694   9.618 1.00 . A A . 124 ALA HA   1 1 
        1  2113 1 1 124 ALA HB1  H  -6.668   2.337   8.831 1.00 . A A . 124 ALA HB1  1 1 
        1  2114 1 1 124 ALA HB2  H  -8.018   3.278   8.218 1.00 . A A . 124 ALA HB2  1 1 
        1  2115 1 1 124 ALA HB3  H  -8.277   2.135   9.531 1.00 . A A . 124 ALA HB3  1 1 
        1  2116 1 1 124 ALA N    N  -6.534   3.397  11.250 1.00 . A A . 124 ALA N    1 1 
        1  2117 1 1 124 ALA O    O  -9.027   5.587   9.973 1.00 . A A . 124 ALA O    1 1 
        1  2118 1 1 125 GLY C    C  -9.871   5.895  13.263 1.00 . A A . 125 GLY C    1 1 
        1  2119 1 1 125 GLY CA   C -10.262   4.714  12.388 1.00 . A A . 125 GLY CA   1 1 
        1  2120 1 1 125 GLY H    H  -8.701   3.312  12.110 1.00 . A A . 125 GLY H    1 1 
        1  2121 1 1 125 GLY HA2  H -10.983   5.042  11.647 1.00 . A A . 125 GLY HA2  1 1 
        1  2122 1 1 125 GLY HA3  H -10.724   3.957  13.006 1.00 . A A . 125 GLY HA3  1 1 
        1  2123 1 1 125 GLY N    N  -9.103   4.123  11.722 1.00 . A A . 125 GLY N    1 1 
        1  2124 1 1 125 GLY O    O -10.106   5.895  14.476 1.00 . A A . 125 GLY O    1 1 
        1  2125 1 1 126 SER C    C  -9.991   9.134  13.320 1.00 . A A . 126 SER C    1 1 
        1  2126 1 1 126 SER CA   C  -8.825   8.138  13.293 1.00 . A A . 126 SER CA   1 1 
        1  2127 1 1 126 SER CB   C  -7.644   8.757  12.521 1.00 . A A . 126 SER CB   1 1 
        1  2128 1 1 126 SER H    H  -9.054   6.809  11.680 1.00 . A A . 126 SER H    1 1 
        1  2129 1 1 126 SER HA   H  -8.514   7.918  14.315 1.00 . A A . 126 SER HA   1 1 
        1  2130 1 1 126 SER HB2  H  -7.935   8.927  11.492 1.00 . A A . 126 SER HB2  1 1 
        1  2131 1 1 126 SER HB3  H  -7.373   9.708  12.970 1.00 . A A . 126 SER HB3  1 1 
        1  2132 1 1 126 SER HG   H  -6.754   7.032  12.800 1.00 . A A . 126 SER HG   1 1 
        1  2133 1 1 126 SER N    N  -9.235   6.896  12.639 1.00 . A A . 126 SER N    1 1 
        1  2134 1 1 126 SER O    O -10.924   9.037  12.504 1.00 . A A . 126 SER O    1 1 
        1  2135 1 1 126 SER OG   O  -6.506   7.923  12.529 1.00 . A A . 126 SER OG   1 1 
        1  2136 1 1 127 LEU C    C -10.503  12.160  13.154 1.00 . A A . 127 LEU C    1 1 
        1  2137 1 1 127 LEU CA   C -10.855  11.219  14.323 1.00 . A A . 127 LEU CA   1 1 
        1  2138 1 1 127 LEU CB   C -10.750  11.929  15.718 1.00 . A A . 127 LEU CB   1 1 
        1  2139 1 1 127 LEU CD1  C -11.745  13.335  17.627 1.00 . A A . 127 LEU CD1  1 1 
        1  2140 1 1 127 LEU CD2  C -12.272  13.998  15.233 1.00 . A A . 127 LEU CD2  1 1 
        1  2141 1 1 127 LEU CG   C -11.965  12.819  16.189 1.00 . A A . 127 LEU CG   1 1 
        1  2142 1 1 127 LEU H    H  -9.205  10.035  14.924 1.00 . A A . 127 LEU H    1 1 
        1  2143 1 1 127 LEU HA   H -11.868  10.838  14.186 1.00 . A A . 127 LEU HA   1 1 
        1  2144 1 1 127 LEU HB2  H -10.603  11.154  16.466 1.00 . A A . 127 LEU HB2  1 1 
        1  2145 1 1 127 LEU HB3  H  -9.859  12.551  15.714 1.00 . A A . 127 LEU HB3  1 1 
        1  2146 1 1 127 LEU HD11 H -12.595  13.930  17.939 1.00 . A A . 127 LEU HD11 1 1 
        1  2147 1 1 127 LEU HD12 H -10.850  13.944  17.672 1.00 . A A . 127 LEU HD12 1 1 
        1  2148 1 1 127 LEU HD13 H -11.637  12.495  18.299 1.00 . A A . 127 LEU HD13 1 1 
        1  2149 1 1 127 LEU HD21 H -11.409  14.647  15.157 1.00 . A A . 127 LEU HD21 1 1 
        1  2150 1 1 127 LEU HD22 H -13.114  14.563  15.612 1.00 . A A . 127 LEU HD22 1 1 
        1  2151 1 1 127 LEU HD23 H -12.519  13.616  14.252 1.00 . A A . 127 LEU HD23 1 1 
        1  2152 1 1 127 LEU HG   H -12.850  12.191  16.213 1.00 . A A . 127 LEU HG   1 1 
        1  2153 1 1 127 LEU N    N  -9.922  10.090  14.257 1.00 . A A . 127 LEU N    1 1 
        1  2154 1 1 127 LEU O    O  -9.659  13.058  13.302 1.00 . A A . 127 LEU O    1 1 
        1  2155 1 1 128 GLU C    C -11.635  14.016  10.923 1.00 . A A . 128 GLU C    1 1 
        1  2156 1 1 128 GLU CA   C -10.902  12.685  10.768 1.00 . A A . 128 GLU CA   1 1 
        1  2157 1 1 128 GLU CB   C -11.380  11.917   9.498 1.00 . A A . 128 GLU CB   1 1 
        1  2158 1 1 128 GLU CD   C  -9.090  10.848   8.966 1.00 . A A . 128 GLU CD   1 1 
        1  2159 1 1 128 GLU CG   C -10.601  10.622   9.194 1.00 . A A . 128 GLU CG   1 1 
        1  2160 1 1 128 GLU H    H -11.663  11.087  11.924 1.00 . A A . 128 GLU H    1 1 
        1  2161 1 1 128 GLU HA   H  -9.833  12.886  10.667 1.00 . A A . 128 GLU HA   1 1 
        1  2162 1 1 128 GLU HB2  H -12.426  11.656   9.628 1.00 . A A . 128 GLU HB2  1 1 
        1  2163 1 1 128 GLU HB3  H -11.299  12.569   8.634 1.00 . A A . 128 GLU HB3  1 1 
        1  2164 1 1 128 GLU HG2  H -10.728   9.941  10.029 1.00 . A A . 128 GLU HG2  1 1 
        1  2165 1 1 128 GLU HG3  H -11.024  10.161   8.305 1.00 . A A . 128 GLU HG3  1 1 
        1  2166 1 1 128 GLU N    N -11.089  11.880  11.977 1.00 . A A . 128 GLU N    1 1 
        1  2167 1 1 128 GLU O    O -12.842  14.117  10.662 1.00 . A A . 128 GLU O    1 1 
        1  2168 1 1 128 GLU OE1  O  -8.673  11.115   7.814 1.00 . A A . 128 GLU OE1  1 1 
        1  2169 1 1 128 GLU OE2  O  -8.306  10.759   9.937 1.00 . A A . 128 GLU OE2  1 1 
        1  2170 1 1 129 HIS C    C -11.431  16.932  10.082 1.00 . A A . 129 HIS C    1 1 
        1  2171 1 1 129 HIS CA   C -11.369  16.388  11.522 1.00 . A A . 129 HIS CA   1 1 
        1  2172 1 1 129 HIS CB   C -10.421  17.208  12.434 1.00 . A A . 129 HIS CB   1 1 
        1  2173 1 1 129 HIS CD2  C -10.480  19.808  12.309 1.00 . A A . 129 HIS CD2  1 1 
        1  2174 1 1 129 HIS CE1  C -12.090  20.161  13.738 1.00 . A A . 129 HIS CE1  1 1 
        1  2175 1 1 129 HIS CG   C -10.890  18.601  12.755 1.00 . A A . 129 HIS CG   1 1 
        1  2176 1 1 129 HIS H    H -10.004  14.795  11.769 1.00 . A A . 129 HIS H    1 1 
        1  2177 1 1 129 HIS HA   H -12.373  16.386  11.952 1.00 . A A . 129 HIS HA   1 1 
        1  2178 1 1 129 HIS HB2  H -10.302  16.687  13.375 1.00 . A A . 129 HIS HB2  1 1 
        1  2179 1 1 129 HIS HB3  H  -9.449  17.284  11.958 1.00 . A A . 129 HIS HB3  1 1 
        1  2180 1 1 129 HIS HD1  H -12.409  18.194  14.155 1.00 . A A . 129 HIS HD1  1 1 
        1  2181 1 1 129 HIS HD2  H  -9.685  19.991  11.600 1.00 . A A . 129 HIS HD2  1 1 
        1  2182 1 1 129 HIS HE1  H -12.813  20.656  14.370 1.00 . A A . 129 HIS HE1  1 1 
        1  2183 1 1 129 HIS HE2  H -11.021  21.712  12.981 1.00 . A A . 129 HIS HE2  1 1 
        1  2184 1 1 129 HIS N    N -10.905  15.008  11.441 1.00 . A A . 129 HIS N    1 1 
        1  2185 1 1 129 HIS ND1  N -11.909  18.864  13.645 1.00 . A A . 129 HIS ND1  1 1 
        1  2186 1 1 129 HIS NE2  N -11.241  20.758  12.936 1.00 . A A . 129 HIS NE2  1 1 
        1  2187 1 1 129 HIS O    O -10.417  17.350   9.528 1.00 . A A . 129 HIS O    1 1 
        1  2188 1 1 130 HIS C    C -12.450  18.419   7.557 1.00 . A A . 130 HIS C    1 1 
        1  2189 1 1 130 HIS CA   C -12.898  17.026   8.046 1.00 . A A . 130 HIS CA   1 1 
        1  2190 1 1 130 HIS CB   C -14.402  16.776   7.744 1.00 . A A . 130 HIS CB   1 1 
        1  2191 1 1 130 HIS CD2  C -15.041  17.539   5.327 1.00 . A A . 130 HIS CD2  1 1 
        1  2192 1 1 130 HIS CE1  C -15.098  15.569   4.378 1.00 . A A . 130 HIS CE1  1 1 
        1  2193 1 1 130 HIS CG   C -14.739  16.622   6.280 1.00 . A A . 130 HIS CG   1 1 
        1  2194 1 1 130 HIS H    H -13.404  16.625  10.063 1.00 . A A . 130 HIS H    1 1 
        1  2195 1 1 130 HIS HA   H -12.312  16.278   7.525 1.00 . A A . 130 HIS HA   1 1 
        1  2196 1 1 130 HIS HB2  H -14.720  15.867   8.243 1.00 . A A . 130 HIS HB2  1 1 
        1  2197 1 1 130 HIS HB3  H -14.992  17.602   8.135 1.00 . A A . 130 HIS HB3  1 1 
        1  2198 1 1 130 HIS HD1  H -14.595  14.531   6.061 1.00 . A A . 130 HIS HD1  1 1 
        1  2199 1 1 130 HIS HD2  H -15.117  18.610   5.467 1.00 . A A . 130 HIS HD2  1 1 
        1  2200 1 1 130 HIS HE1  H -15.205  14.786   3.639 1.00 . A A . 130 HIS HE1  1 1 
        1  2201 1 1 130 HIS HE2  H -15.377  17.265   3.277 1.00 . A A . 130 HIS HE2  1 1 
        1  2202 1 1 130 HIS N    N -12.642  16.841   9.490 1.00 . A A . 130 HIS N    1 1 
        1  2203 1 1 130 HIS ND1  N -14.775  15.397   5.643 1.00 . A A . 130 HIS ND1  1 1 
        1  2204 1 1 130 HIS NE2  N -15.259  16.855   4.160 1.00 . A A . 130 HIS NE2  1 1 
        1  2205 1 1 130 HIS O    O -11.908  18.554   6.457 1.00 . A A . 130 HIS O    1 1 
        1  2206 1 1 131 HIS C    C -10.631  20.747   8.609 1.00 . A A . 131 HIS C    1 1 
        1  2207 1 1 131 HIS CA   C -12.126  20.803   8.216 1.00 . A A . 131 HIS CA   1 1 
        1  2208 1 1 131 HIS CB   C -12.929  21.814   9.086 1.00 . A A . 131 HIS CB   1 1 
        1  2209 1 1 131 HIS CD2  C -13.054  24.185   7.993 1.00 . A A . 131 HIS CD2  1 1 
        1  2210 1 1 131 HIS CE1  C -11.550  25.175   9.227 1.00 . A A . 131 HIS CE1  1 1 
        1  2211 1 1 131 HIS CG   C -12.580  23.267   8.874 1.00 . A A . 131 HIS CG   1 1 
        1  2212 1 1 131 HIS H    H -13.254  19.280   9.183 1.00 . A A . 131 HIS H    1 1 
        1  2213 1 1 131 HIS HA   H -12.217  21.075   7.161 1.00 . A A . 131 HIS HA   1 1 
        1  2214 1 1 131 HIS HB2  H -13.987  21.700   8.874 1.00 . A A . 131 HIS HB2  1 1 
        1  2215 1 1 131 HIS HB3  H -12.763  21.586  10.132 1.00 . A A . 131 HIS HB3  1 1 
        1  2216 1 1 131 HIS HD1  H -11.095  23.530  10.340 1.00 . A A . 131 HIS HD1  1 1 
        1  2217 1 1 131 HIS HD2  H -13.832  24.030   7.251 1.00 . A A . 131 HIS HD2  1 1 
        1  2218 1 1 131 HIS HE1  H -10.888  25.924   9.639 1.00 . A A . 131 HIS HE1  1 1 
        1  2219 1 1 131 HIS HE2  H -12.452  26.172   7.694 1.00 . A A . 131 HIS HE2  1 1 
        1  2220 1 1 131 HIS N    N -12.686  19.444   8.399 1.00 . A A . 131 HIS N    1 1 
        1  2221 1 1 131 HIS ND1  N -11.629  23.926   9.621 1.00 . A A . 131 HIS ND1  1 1 
        1  2222 1 1 131 HIS NE2  N -12.394  25.359   8.240 1.00 . A A . 131 HIS NE2  1 1 
        1  2223 1 1 131 HIS O    O -10.213  21.284   9.635 1.00 . A A . 131 HIS O    1 1 
        1  2224 1 1 132 HIS C    C  -7.427  20.464   8.364 1.00 . A A . 132 HIS C    1 1 
        1  2225 1 1 132 HIS CA   C  -8.558  19.447   8.130 1.00 . A A . 132 HIS CA   1 1 
        1  2226 1 1 132 HIS CB   C  -8.175  18.383   7.056 1.00 . A A . 132 HIS CB   1 1 
        1  2227 1 1 132 HIS CD2  C  -7.294  16.610   8.744 1.00 . A A . 132 HIS CD2  1 1 
        1  2228 1 1 132 HIS CE1  C  -5.821  15.630   7.467 1.00 . A A . 132 HIS CE1  1 1 
        1  2229 1 1 132 HIS CG   C  -7.301  17.256   7.557 1.00 . A A . 132 HIS CG   1 1 
        1  2230 1 1 132 HIS H    H -10.144  19.990   6.827 1.00 . A A . 132 HIS H    1 1 
        1  2231 1 1 132 HIS HA   H  -8.732  18.930   9.070 1.00 . A A . 132 HIS HA   1 1 
        1  2232 1 1 132 HIS HB2  H  -9.080  17.927   6.671 1.00 . A A . 132 HIS HB2  1 1 
        1  2233 1 1 132 HIS HB3  H  -7.659  18.866   6.235 1.00 . A A . 132 HIS HB3  1 1 
        1  2234 1 1 132 HIS HD1  H  -6.122  16.842   5.857 1.00 . A A . 132 HIS HD1  1 1 
        1  2235 1 1 132 HIS HD2  H  -7.904  16.844   9.606 1.00 . A A . 132 HIS HD2  1 1 
        1  2236 1 1 132 HIS HE1  H  -5.055  14.953   7.114 1.00 . A A . 132 HIS HE1  1 1 
        1  2237 1 1 132 HIS HE2  H  -6.324  14.844   9.269 1.00 . A A . 132 HIS HE2  1 1 
        1  2238 1 1 132 HIS N    N  -9.843  20.075   7.753 1.00 . A A . 132 HIS N    1 1 
        1  2239 1 1 132 HIS ND1  N  -6.359  16.614   6.778 1.00 . A A . 132 HIS ND1  1 1 
        1  2240 1 1 132 HIS NE2  N  -6.368  15.607   8.659 1.00 . A A . 132 HIS NE2  1 1 
        1  2241 1 1 132 HIS O    O  -6.429  20.143   9.027 1.00 . A A . 132 HIS O    1 1 
        1  2242 1 1 133 HIS C    C  -7.177  23.600   9.310 1.00 . A A . 133 HIS C    1 1 
        1  2243 1 1 133 HIS CA   C  -6.664  22.796   8.093 1.00 . A A . 133 HIS CA   1 1 
        1  2244 1 1 133 HIS CB   C  -6.496  23.680   6.823 1.00 . A A . 133 HIS CB   1 1 
        1  2245 1 1 133 HIS CD2  C  -4.228  24.842   7.360 1.00 . A A . 133 HIS CD2  1 1 
        1  2246 1 1 133 HIS CE1  C  -4.836  26.915   7.027 1.00 . A A . 133 HIS CE1  1 1 
        1  2247 1 1 133 HIS CG   C  -5.533  24.828   6.998 1.00 . A A . 133 HIS CG   1 1 
        1  2248 1 1 133 HIS H    H  -8.360  21.843   7.245 1.00 . A A . 133 HIS H    1 1 
        1  2249 1 1 133 HIS HA   H  -5.692  22.376   8.352 1.00 . A A . 133 HIS HA   1 1 
        1  2250 1 1 133 HIS HB2  H  -6.132  23.068   6.008 1.00 . A A . 133 HIS HB2  1 1 
        1  2251 1 1 133 HIS HB3  H  -7.462  24.089   6.549 1.00 . A A . 133 HIS HB3  1 1 
        1  2252 1 1 133 HIS HD1  H  -6.759  26.469   6.498 1.00 . A A . 133 HIS HD1  1 1 
        1  2253 1 1 133 HIS HD2  H  -3.615  23.981   7.587 1.00 . A A . 133 HIS HD2  1 1 
        1  2254 1 1 133 HIS HE1  H  -4.814  27.993   6.955 1.00 . A A . 133 HIS HE1  1 1 
        1  2255 1 1 133 HIS HE2  H  -2.979  26.474   7.737 1.00 . A A . 133 HIS HE2  1 1 
        1  2256 1 1 133 HIS N    N  -7.589  21.683   7.829 1.00 . A A . 133 HIS N    1 1 
        1  2257 1 1 133 HIS ND1  N  -5.879  26.147   6.782 1.00 . A A . 133 HIS ND1  1 1 
        1  2258 1 1 133 HIS NE2  N  -3.825  26.149   7.372 1.00 . A A . 133 HIS NE2  1 1 
        1  2259 1 1 133 HIS O    O  -7.645  24.742   9.177 1.00 . A A . 133 HIS O    1 1 
        1  2260 1 1 134 HIS C    C  -9.003  23.964  11.792 1.00 . A A . 134 HIS C    1 1 
        1  2261 1 1 134 HIS CA   C  -7.519  23.480  11.801 1.00 . A A . 134 HIS CA   1 1 
        1  2262 1 1 134 HIS CB   C  -6.545  24.604  12.256 1.00 . A A . 134 HIS CB   1 1 
        1  2263 1 1 134 HIS CD2  C  -6.282  24.822  14.851 1.00 . A A . 134 HIS CD2  1 1 
        1  2264 1 1 134 HIS CE1  C  -7.858  26.300  15.209 1.00 . A A . 134 HIS CE1  1 1 
        1  2265 1 1 134 HIS CG   C  -6.825  25.132  13.649 1.00 . A A . 134 HIS CG   1 1 
        1  2266 1 1 134 HIS H    H  -6.791  22.014  10.470 1.00 . A A . 134 HIS H    1 1 
        1  2267 1 1 134 HIS HA   H  -7.434  22.657  12.504 1.00 . A A . 134 HIS HA   1 1 
        1  2268 1 1 134 HIS HB2  H  -5.530  24.223  12.240 1.00 . A A . 134 HIS HB2  1 1 
        1  2269 1 1 134 HIS HB3  H  -6.614  25.434  11.560 1.00 . A A . 134 HIS HB3  1 1 
        1  2270 1 1 134 HIS HD1  H  -8.401  26.480  13.252 1.00 . A A . 134 HIS HD1  1 1 
        1  2271 1 1 134 HIS HD2  H  -5.472  24.125  15.029 1.00 . A A . 134 HIS HD2  1 1 
        1  2272 1 1 134 HIS HE1  H  -8.533  26.983  15.702 1.00 . A A . 134 HIS HE1  1 1 
        1  2273 1 1 134 HIS HE2  H  -6.878  25.431  16.771 1.00 . A A . 134 HIS HE2  1 1 
        1  2274 1 1 134 HIS N    N  -7.119  22.934  10.488 1.00 . A A . 134 HIS N    1 1 
        1  2275 1 1 134 HIS ND1  N  -7.809  26.064  13.916 1.00 . A A . 134 HIS ND1  1 1 
        1  2276 1 1 134 HIS NE2  N  -6.945  25.562  15.802 1.00 . A A . 134 HIS NE2  1 1 
        1  2277 1 1 134 HIS O    O  -9.266  25.157  11.513 1.00 . A A . 134 HIS O    1 1 
        1  2278 1 1 134 HIS OXT  O  -9.905  23.145  12.032 1.00 . A A . 134 HIS OXT  1 1 
        2  2279 1 1   1 MET C    C -12.451   7.007   5.199 1.00 . A A .   1 MET C    1 1 
        2  2280 1 1   1 MET CA   C -12.665   8.325   5.952 1.00 . A A .   1 MET CA   1 1 
        2  2281 1 1   1 MET CB   C -12.555   8.088   7.488 1.00 . A A .   1 MET CB   1 1 
        2  2282 1 1   1 MET CE   C  -9.494   8.799   8.114 1.00 . A A .   1 MET CE   1 1 
        2  2283 1 1   1 MET CG   C -12.244   9.348   8.304 1.00 . A A .   1 MET CG   1 1 
        2  2284 1 1   1 MET H1   H -14.006   9.113   4.569 1.00 . A A .   1 MET H1   1 1 
        2  2285 1 1   1 MET H2   H -14.060   9.861   6.082 1.00 . A A .   1 MET H2   1 1 
        2  2286 1 1   1 MET H3   H -14.739   8.331   5.873 1.00 . A A .   1 MET H3   1 1 
        2  2287 1 1   1 MET HA   H -11.885   9.020   5.654 1.00 . A A .   1 MET HA   1 1 
        2  2288 1 1   1 MET HB2  H -13.493   7.675   7.847 1.00 . A A .   1 MET HB2  1 1 
        2  2289 1 1   1 MET HB3  H -11.768   7.364   7.682 1.00 . A A .   1 MET HB3  1 1 
        2  2290 1 1   1 MET HE1  H  -8.503   9.153   7.869 1.00 . A A .   1 MET HE1  1 1 
        2  2291 1 1   1 MET HE2  H  -9.730   7.942   7.498 1.00 . A A .   1 MET HE2  1 1 
        2  2292 1 1   1 MET HE3  H  -9.524   8.514   9.156 1.00 . A A .   1 MET HE3  1 1 
        2  2293 1 1   1 MET HG2  H -13.042  10.069   8.163 1.00 . A A .   1 MET HG2  1 1 
        2  2294 1 1   1 MET HG3  H -12.185   9.089   9.354 1.00 . A A .   1 MET HG3  1 1 
        2  2295 1 1   1 MET N    N -13.956   8.950   5.595 1.00 . A A .   1 MET N    1 1 
        2  2296 1 1   1 MET O    O -13.082   5.990   5.520 1.00 . A A .   1 MET O    1 1 
        2  2297 1 1   1 MET SD   S -10.681  10.118   7.808 1.00 . A A .   1 MET SD   1 1 
        2  2298 1 1   2 LYS C    C  -9.447   5.973   3.731 1.00 . A A .   2 LYS C    1 1 
        2  2299 1 1   2 LYS CA   C -10.959   5.850   3.587 1.00 . A A .   2 LYS CA   1 1 
        2  2300 1 1   2 LYS CB   C -11.294   5.634   2.094 1.00 . A A .   2 LYS CB   1 1 
        2  2301 1 1   2 LYS CD   C -13.061   5.019   0.354 1.00 . A A .   2 LYS CD   1 1 
        2  2302 1 1   2 LYS CE   C -14.487   5.331  -0.108 1.00 . A A .   2 LYS CE   1 1 
        2  2303 1 1   2 LYS CG   C -12.785   5.574   1.771 1.00 . A A .   2 LYS CG   1 1 
        2  2304 1 1   2 LYS H    H -11.334   7.922   3.801 1.00 . A A .   2 LYS H    1 1 
        2  2305 1 1   2 LYS HA   H -11.296   4.981   4.153 1.00 . A A .   2 LYS HA   1 1 
        2  2306 1 1   2 LYS HB2  H -10.858   6.444   1.513 1.00 . A A .   2 LYS HB2  1 1 
        2  2307 1 1   2 LYS HB3  H -10.838   4.699   1.773 1.00 . A A .   2 LYS HB3  1 1 
        2  2308 1 1   2 LYS HD2  H -12.355   5.457  -0.347 1.00 . A A .   2 LYS HD2  1 1 
        2  2309 1 1   2 LYS HD3  H -12.922   3.942   0.370 1.00 . A A .   2 LYS HD3  1 1 
        2  2310 1 1   2 LYS HE2  H -14.547   6.378  -0.360 1.00 . A A .   2 LYS HE2  1 1 
        2  2311 1 1   2 LYS HE3  H -14.716   4.740  -0.987 1.00 . A A .   2 LYS HE3  1 1 
        2  2312 1 1   2 LYS HG2  H -13.274   4.928   2.495 1.00 . A A .   2 LYS HG2  1 1 
        2  2313 1 1   2 LYS HG3  H -13.198   6.573   1.853 1.00 . A A .   2 LYS HG3  1 1 
        2  2314 1 1   2 LYS HZ1  H -16.439   5.047   0.557 1.00 . A A .   2 LYS HZ1  1 1 
        2  2315 1 1   2 LYS HZ2  H -15.418   5.738   1.716 1.00 . A A .   2 LYS HZ2  1 1 
        2  2316 1 1   2 LYS HZ3  H -15.302   4.090   1.354 1.00 . A A .   2 LYS HZ3  1 1 
        2  2317 1 1   2 LYS N    N -11.579   7.049   4.170 1.00 . A A .   2 LYS N    1 1 
        2  2318 1 1   2 LYS NZ   N -15.483   5.031   0.950 1.00 . A A .   2 LYS NZ   1 1 
        2  2319 1 1   2 LYS O    O  -8.842   6.935   3.241 1.00 . A A .   2 LYS O    1 1 
        2  2320 1 1   3 GLU C    C  -6.954   3.848   3.473 1.00 . A A .   3 GLU C    1 1 
        2  2321 1 1   3 GLU CA   C  -7.417   4.873   4.525 1.00 . A A .   3 GLU CA   1 1 
        2  2322 1 1   3 GLU CB   C  -7.013   4.433   5.959 1.00 . A A .   3 GLU CB   1 1 
        2  2323 1 1   3 GLU CD   C  -8.997   4.834   7.591 1.00 . A A .   3 GLU CD   1 1 
        2  2324 1 1   3 GLU CG   C  -7.604   5.287   7.113 1.00 . A A .   3 GLU CG   1 1 
        2  2325 1 1   3 GLU H    H  -9.428   4.380   4.905 1.00 . A A .   3 GLU H    1 1 
        2  2326 1 1   3 GLU HA   H  -6.955   5.840   4.312 1.00 . A A .   3 GLU HA   1 1 
        2  2327 1 1   3 GLU HB2  H  -7.319   3.402   6.108 1.00 . A A .   3 GLU HB2  1 1 
        2  2328 1 1   3 GLU HB3  H  -5.929   4.475   6.032 1.00 . A A .   3 GLU HB3  1 1 
        2  2329 1 1   3 GLU HG2  H  -6.925   5.243   7.959 1.00 . A A .   3 GLU HG2  1 1 
        2  2330 1 1   3 GLU HG3  H  -7.667   6.317   6.784 1.00 . A A .   3 GLU HG3  1 1 
        2  2331 1 1   3 GLU N    N  -8.859   5.012   4.429 1.00 . A A .   3 GLU N    1 1 
        2  2332 1 1   3 GLU O    O  -7.182   2.646   3.615 1.00 . A A .   3 GLU O    1 1 
        2  2333 1 1   3 GLU OE1  O  -9.068   3.970   8.490 1.00 . A A .   3 GLU OE1  1 1 
        2  2334 1 1   3 GLU OE2  O -10.021   5.342   7.076 1.00 . A A .   3 GLU OE2  1 1 
        2  2335 1 1   4 LEU C    C  -4.359   3.115   1.673 1.00 . A A .   4 LEU C    1 1 
        2  2336 1 1   4 LEU CA   C  -5.793   3.495   1.338 1.00 . A A .   4 LEU CA   1 1 
        2  2337 1 1   4 LEU CB   C  -5.876   4.233  -0.038 1.00 . A A .   4 LEU CB   1 1 
        2  2338 1 1   4 LEU CD1  C  -7.866   2.933  -1.035 1.00 . A A .   4 LEU CD1  1 1 
        2  2339 1 1   4 LEU CD2  C  -8.279   5.155   0.132 1.00 . A A .   4 LEU CD2  1 1 
        2  2340 1 1   4 LEU CG   C  -7.293   4.329  -0.713 1.00 . A A .   4 LEU CG   1 1 
        2  2341 1 1   4 LEU H    H  -6.046   5.282   2.447 1.00 . A A .   4 LEU H    1 1 
        2  2342 1 1   4 LEU HA   H  -6.402   2.593   1.293 1.00 . A A .   4 LEU HA   1 1 
        2  2343 1 1   4 LEU HB2  H  -5.498   5.241   0.096 1.00 . A A .   4 LEU HB2  1 1 
        2  2344 1 1   4 LEU HB3  H  -5.216   3.725  -0.735 1.00 . A A .   4 LEU HB3  1 1 
        2  2345 1 1   4 LEU HD11 H  -7.180   2.403  -1.683 1.00 . A A .   4 LEU HD11 1 1 
        2  2346 1 1   4 LEU HD12 H  -8.813   3.042  -1.544 1.00 . A A .   4 LEU HD12 1 1 
        2  2347 1 1   4 LEU HD13 H  -8.011   2.367  -0.123 1.00 . A A .   4 LEU HD13 1 1 
        2  2348 1 1   4 LEU HD21 H  -7.865   6.138   0.311 1.00 . A A .   4 LEU HD21 1 1 
        2  2349 1 1   4 LEU HD22 H  -8.456   4.665   1.082 1.00 . A A .   4 LEU HD22 1 1 
        2  2350 1 1   4 LEU HD23 H  -9.219   5.261  -0.396 1.00 . A A .   4 LEU HD23 1 1 
        2  2351 1 1   4 LEU HG   H  -7.183   4.847  -1.664 1.00 . A A .   4 LEU HG   1 1 
        2  2352 1 1   4 LEU N    N  -6.280   4.338   2.433 1.00 . A A .   4 LEU N    1 1 
        2  2353 1 1   4 LEU O    O  -3.462   3.959   1.638 1.00 . A A .   4 LEU O    1 1 
        2  2354 1 1   5 ILE C    C  -2.273   0.545   1.181 1.00 . A A .   5 ILE C    1 1 
        2  2355 1 1   5 ILE CA   C  -2.852   1.300   2.374 1.00 . A A .   5 ILE CA   1 1 
        2  2356 1 1   5 ILE CB   C  -2.945   0.362   3.633 1.00 . A A .   5 ILE CB   1 1 
        2  2357 1 1   5 ILE CD1  C  -1.582  -1.247   5.164 1.00 . A A .   5 ILE CD1  1 1 
        2  2358 1 1   5 ILE CG1  C  -1.577  -0.330   3.950 1.00 . A A .   5 ILE CG1  1 1 
        2  2359 1 1   5 ILE CG2  C  -4.083  -0.661   3.484 1.00 . A A .   5 ILE CG2  1 1 
        2  2360 1 1   5 ILE H    H  -4.931   1.233   1.991 1.00 . A A .   5 ILE H    1 1 
        2  2361 1 1   5 ILE HA   H  -2.189   2.134   2.626 1.00 . A A .   5 ILE HA   1 1 
        2  2362 1 1   5 ILE HB   H  -3.205   0.993   4.481 1.00 . A A .   5 ILE HB   1 1 
        2  2363 1 1   5 ILE HD11 H  -1.822  -0.670   6.046 1.00 . A A .   5 ILE HD11 1 1 
        2  2364 1 1   5 ILE HD12 H  -0.608  -1.697   5.284 1.00 . A A .   5 ILE HD12 1 1 
        2  2365 1 1   5 ILE HD13 H  -2.327  -2.024   5.036 1.00 . A A .   5 ILE HD13 1 1 
        2  2366 1 1   5 ILE HG12 H  -1.275  -0.925   3.099 1.00 . A A .   5 ILE HG12 1 1 
        2  2367 1 1   5 ILE HG13 H  -0.829   0.432   4.121 1.00 . A A .   5 ILE HG13 1 1 
        2  2368 1 1   5 ILE HG21 H  -4.164  -1.262   4.382 1.00 . A A .   5 ILE HG21 1 1 
        2  2369 1 1   5 ILE HG22 H  -3.886  -1.313   2.641 1.00 . A A .   5 ILE HG22 1 1 
        2  2370 1 1   5 ILE HG23 H  -5.021  -0.145   3.319 1.00 . A A .   5 ILE HG23 1 1 
        2  2371 1 1   5 ILE N    N  -4.162   1.840   2.006 1.00 . A A .   5 ILE N    1 1 
        2  2372 1 1   5 ILE O    O  -2.878  -0.399   0.674 1.00 . A A .   5 ILE O    1 1 
        2  2373 1 1   6 LEU C    C   0.800  -0.370   0.253 1.00 . A A .   6 LEU C    1 1 
        2  2374 1 1   6 LEU CA   C  -0.394   0.350  -0.369 1.00 . A A .   6 LEU CA   1 1 
        2  2375 1 1   6 LEU CB   C   0.079   1.374  -1.431 1.00 . A A .   6 LEU CB   1 1 
        2  2376 1 1   6 LEU CD1  C  -1.854   3.116  -1.448 1.00 . A A .   6 LEU CD1  1 1 
        2  2377 1 1   6 LEU CD2  C  -0.399   2.766  -3.502 1.00 . A A .   6 LEU CD2  1 1 
        2  2378 1 1   6 LEU CG   C  -1.028   2.099  -2.275 1.00 . A A .   6 LEU CG   1 1 
        2  2379 1 1   6 LEU H    H  -0.755   1.822   1.098 1.00 . A A .   6 LEU H    1 1 
        2  2380 1 1   6 LEU HA   H  -1.045  -0.385  -0.848 1.00 . A A .   6 LEU HA   1 1 
        2  2381 1 1   6 LEU HB2  H   0.672   2.131  -0.928 1.00 . A A .   6 LEU HB2  1 1 
        2  2382 1 1   6 LEU HB3  H   0.734   0.848  -2.123 1.00 . A A .   6 LEU HB3  1 1 
        2  2383 1 1   6 LEU HD11 H  -1.204   3.889  -1.055 1.00 . A A .   6 LEU HD11 1 1 
        2  2384 1 1   6 LEU HD12 H  -2.337   2.607  -0.625 1.00 . A A .   6 LEU HD12 1 1 
        2  2385 1 1   6 LEU HD13 H  -2.611   3.568  -2.075 1.00 . A A .   6 LEU HD13 1 1 
        2  2386 1 1   6 LEU HD21 H   0.348   3.486  -3.191 1.00 . A A .   6 LEU HD21 1 1 
        2  2387 1 1   6 LEU HD22 H  -1.164   3.269  -4.075 1.00 . A A .   6 LEU HD22 1 1 
        2  2388 1 1   6 LEU HD23 H   0.068   2.013  -4.124 1.00 . A A .   6 LEU HD23 1 1 
        2  2389 1 1   6 LEU HG   H  -1.724   1.356  -2.640 1.00 . A A .   6 LEU HG   1 1 
        2  2390 1 1   6 LEU N    N  -1.129   1.006   0.705 1.00 . A A .   6 LEU N    1 1 
        2  2391 1 1   6 LEU O    O   1.609   0.255   0.933 1.00 . A A .   6 LEU O    1 1 
        2  2392 1 1   7 ILE C    C   2.952  -2.636  -0.758 1.00 . A A .   7 ILE C    1 1 
        2  2393 1 1   7 ILE CA   C   2.041  -2.477   0.460 1.00 . A A .   7 ILE CA   1 1 
        2  2394 1 1   7 ILE CB   C   1.669  -3.911   1.040 1.00 . A A .   7 ILE CB   1 1 
        2  2395 1 1   7 ILE CD1  C  -0.566  -3.355   2.256 1.00 . A A .   7 ILE CD1  1 1 
        2  2396 1 1   7 ILE CG1  C   0.862  -3.827   2.384 1.00 . A A .   7 ILE CG1  1 1 
        2  2397 1 1   7 ILE CG2  C   2.936  -4.779   1.247 1.00 . A A .   7 ILE CG2  1 1 
        2  2398 1 1   7 ILE H    H   0.166  -2.134  -0.427 1.00 . A A .   7 ILE H    1 1 
        2  2399 1 1   7 ILE HA   H   2.575  -1.928   1.234 1.00 . A A .   7 ILE HA   1 1 
        2  2400 1 1   7 ILE HB   H   1.050  -4.409   0.302 1.00 . A A .   7 ILE HB   1 1 
        2  2401 1 1   7 ILE HD11 H  -1.035  -3.375   3.230 1.00 . A A .   7 ILE HD11 1 1 
        2  2402 1 1   7 ILE HD12 H  -1.105  -4.004   1.584 1.00 . A A .   7 ILE HD12 1 1 
        2  2403 1 1   7 ILE HD13 H  -0.577  -2.342   1.876 1.00 . A A .   7 ILE HD13 1 1 
        2  2404 1 1   7 ILE HG12 H   0.823  -4.805   2.846 1.00 . A A .   7 ILE HG12 1 1 
        2  2405 1 1   7 ILE HG13 H   1.369  -3.148   3.059 1.00 . A A .   7 ILE HG13 1 1 
        2  2406 1 1   7 ILE HG21 H   2.651  -5.755   1.612 1.00 . A A .   7 ILE HG21 1 1 
        2  2407 1 1   7 ILE HG22 H   3.586  -4.305   1.968 1.00 . A A .   7 ILE HG22 1 1 
        2  2408 1 1   7 ILE HG23 H   3.463  -4.889   0.307 1.00 . A A .   7 ILE HG23 1 1 
        2  2409 1 1   7 ILE N    N   0.890  -1.684   0.041 1.00 . A A .   7 ILE N    1 1 
        2  2410 1 1   7 ILE O    O   2.475  -2.847  -1.868 1.00 . A A .   7 ILE O    1 1 
        2  2411 1 1   8 ASN C    C   6.097  -3.927  -0.955 1.00 . A A .   8 ASN C    1 1 
        2  2412 1 1   8 ASN CA   C   5.266  -2.801  -1.542 1.00 . A A .   8 ASN CA   1 1 
        2  2413 1 1   8 ASN CB   C   6.154  -1.586  -1.863 1.00 . A A .   8 ASN CB   1 1 
        2  2414 1 1   8 ASN CG   C   7.147  -1.828  -3.008 1.00 . A A .   8 ASN CG   1 1 
        2  2415 1 1   8 ASN H    H   4.545  -2.120   0.310 1.00 . A A .   8 ASN H    1 1 
        2  2416 1 1   8 ASN HA   H   4.778  -3.146  -2.458 1.00 . A A .   8 ASN HA   1 1 
        2  2417 1 1   8 ASN HB2  H   5.522  -0.757  -2.142 1.00 . A A .   8 ASN HB2  1 1 
        2  2418 1 1   8 ASN HB3  H   6.713  -1.308  -0.974 1.00 . A A .   8 ASN HB3  1 1 
        2  2419 1 1   8 ASN HD21 H   5.808  -2.873  -4.066 1.00 . A A .   8 ASN HD21 1 1 
        2  2420 1 1   8 ASN HD22 H   7.366  -2.689  -4.787 1.00 . A A .   8 ASN HD22 1 1 
        2  2421 1 1   8 ASN N    N   4.250  -2.467  -0.553 1.00 . A A .   8 ASN N    1 1 
        2  2422 1 1   8 ASN ND2  N   6.731  -2.535  -4.058 1.00 . A A .   8 ASN ND2  1 1 
        2  2423 1 1   8 ASN O    O   6.578  -3.816   0.169 1.00 . A A .   8 ASN O    1 1 
        2  2424 1 1   8 ASN OD1  O   8.267  -1.337  -2.970 1.00 . A A .   8 ASN OD1  1 1 
        2  2425 1 1   9 THR C    C   7.623  -6.886  -2.443 1.00 . A A .   9 THR C    1 1 
        2  2426 1 1   9 THR CA   C   6.980  -6.192  -1.241 1.00 . A A .   9 THR CA   1 1 
        2  2427 1 1   9 THR CB   C   6.115  -7.185  -0.380 1.00 . A A .   9 THR CB   1 1 
        2  2428 1 1   9 THR CG2  C   4.720  -7.404  -0.962 1.00 . A A .   9 THR CG2  1 1 
        2  2429 1 1   9 THR H    H   5.733  -5.081  -2.541 1.00 . A A .   9 THR H    1 1 
        2  2430 1 1   9 THR HA   H   7.786  -5.821  -0.603 1.00 . A A .   9 THR HA   1 1 
        2  2431 1 1   9 THR HB   H   5.996  -6.745   0.603 1.00 . A A .   9 THR HB   1 1 
        2  2432 1 1   9 THR HG1  H   7.384  -8.392   0.543 1.00 . A A .   9 THR HG1  1 1 
        2  2433 1 1   9 THR HG21 H   4.169  -8.095  -0.336 1.00 . A A .   9 THR HG21 1 1 
        2  2434 1 1   9 THR HG22 H   4.804  -7.816  -1.959 1.00 . A A .   9 THR HG22 1 1 
        2  2435 1 1   9 THR HG23 H   4.187  -6.461  -1.011 1.00 . A A .   9 THR HG23 1 1 
        2  2436 1 1   9 THR N    N   6.199  -5.034  -1.680 1.00 . A A .   9 THR N    1 1 
        2  2437 1 1   9 THR O    O   7.019  -6.988  -3.520 1.00 . A A .   9 THR O    1 1 
        2  2438 1 1   9 THR OG1  O   6.787  -8.450  -0.209 1.00 . A A .   9 THR OG1  1 1 
        2  2439 1 1  10 ASN C    C   9.328  -9.576  -3.127 1.00 . A A .  10 ASN C    1 1 
        2  2440 1 1  10 ASN CA   C   9.642  -8.071  -3.261 1.00 . A A .  10 ASN CA   1 1 
        2  2441 1 1  10 ASN CB   C  11.172  -7.794  -3.090 1.00 . A A .  10 ASN CB   1 1 
        2  2442 1 1  10 ASN CG   C  12.021  -8.109  -4.341 1.00 . A A .  10 ASN CG   1 1 
        2  2443 1 1  10 ASN H    H   9.311  -7.124  -1.394 1.00 . A A .  10 ASN H    1 1 
        2  2444 1 1  10 ASN HA   H   9.330  -7.738  -4.246 1.00 . A A .  10 ASN HA   1 1 
        2  2445 1 1  10 ASN HB2  H  11.313  -6.746  -2.852 1.00 . A A .  10 ASN HB2  1 1 
        2  2446 1 1  10 ASN HB3  H  11.554  -8.385  -2.265 1.00 . A A .  10 ASN HB3  1 1 
        2  2447 1 1  10 ASN HD21 H  13.361  -6.742  -3.817 1.00 . A A .  10 ASN HD21 1 1 
        2  2448 1 1  10 ASN HD22 H  13.687  -7.594  -5.279 1.00 . A A .  10 ASN HD22 1 1 
        2  2449 1 1  10 ASN N    N   8.879  -7.316  -2.253 1.00 . A A .  10 ASN N    1 1 
        2  2450 1 1  10 ASN ND2  N  13.136  -7.412  -4.495 1.00 . A A .  10 ASN ND2  1 1 
        2  2451 1 1  10 ASN O    O   9.529 -10.348  -4.068 1.00 . A A .  10 ASN O    1 1 
        2  2452 1 1  10 ASN OD1  O  11.686  -8.962  -5.165 1.00 . A A .  10 ASN OD1  1 1 
        2  2453 1 1  11 ASN C    C   7.082 -11.749  -2.072 1.00 . A A .  11 ASN C    1 1 
        2  2454 1 1  11 ASN CA   C   8.521 -11.385  -1.638 1.00 . A A .  11 ASN CA   1 1 
        2  2455 1 1  11 ASN CB   C   8.748 -11.628  -0.117 1.00 . A A .  11 ASN CB   1 1 
        2  2456 1 1  11 ASN CG   C   8.715 -13.111   0.315 1.00 . A A .  11 ASN CG   1 1 
        2  2457 1 1  11 ASN H    H   8.570  -9.290  -1.293 1.00 . A A .  11 ASN H    1 1 
        2  2458 1 1  11 ASN HA   H   9.224 -12.005  -2.197 1.00 . A A .  11 ASN HA   1 1 
        2  2459 1 1  11 ASN HB2  H   9.714 -11.228   0.157 1.00 . A A .  11 ASN HB2  1 1 
        2  2460 1 1  11 ASN HB3  H   7.986 -11.098   0.442 1.00 . A A .  11 ASN HB3  1 1 
        2  2461 1 1  11 ASN HD21 H   9.927 -12.703   1.834 1.00 . A A .  11 ASN HD21 1 1 
        2  2462 1 1  11 ASN HD22 H   9.449 -14.356   1.686 1.00 . A A .  11 ASN HD22 1 1 
        2  2463 1 1  11 ASN N    N   8.800  -9.974  -1.959 1.00 . A A .  11 ASN N    1 1 
        2  2464 1 1  11 ASN ND2  N   9.431 -13.422   1.385 1.00 . A A .  11 ASN ND2  1 1 
        2  2465 1 1  11 ASN O    O   6.103 -11.263  -1.493 1.00 . A A .  11 ASN O    1 1 
        2  2466 1 1  11 ASN OD1  O   8.041 -13.959  -0.279 1.00 . A A .  11 ASN OD1  1 1 
        2  2467 1 1  12 ASP C    C   4.829 -13.791  -2.655 1.00 . A A .  12 ASP C    1 1 
        2  2468 1 1  12 ASP CA   C   5.727 -13.099  -3.687 1.00 . A A .  12 ASP CA   1 1 
        2  2469 1 1  12 ASP CB   C   6.035 -14.099  -4.831 1.00 . A A .  12 ASP CB   1 1 
        2  2470 1 1  12 ASP CG   C   4.785 -14.774  -5.420 1.00 . A A .  12 ASP CG   1 1 
        2  2471 1 1  12 ASP H    H   7.833 -12.955  -3.472 1.00 . A A .  12 ASP H    1 1 
        2  2472 1 1  12 ASP HA   H   5.205 -12.242  -4.098 1.00 . A A .  12 ASP HA   1 1 
        2  2473 1 1  12 ASP HB2  H   6.536 -13.574  -5.622 1.00 . A A .  12 ASP HB2  1 1 
        2  2474 1 1  12 ASP HB3  H   6.706 -14.868  -4.456 1.00 . A A .  12 ASP HB3  1 1 
        2  2475 1 1  12 ASP N    N   6.995 -12.616  -3.096 1.00 . A A .  12 ASP N    1 1 
        2  2476 1 1  12 ASP O    O   3.611 -13.560  -2.607 1.00 . A A .  12 ASP O    1 1 
        2  2477 1 1  12 ASP OD1  O   3.993 -14.088  -6.100 1.00 . A A .  12 ASP OD1  1 1 
        2  2478 1 1  12 ASP OD2  O   4.585 -15.992  -5.205 1.00 . A A .  12 ASP OD2  1 1 
        2  2479 1 1  13 GLU C    C   4.261 -14.594   0.288 1.00 . A A .  13 GLU C    1 1 
        2  2480 1 1  13 GLU CA   C   4.745 -15.476  -0.872 1.00 . A A .  13 GLU CA   1 1 
        2  2481 1 1  13 GLU CB   C   5.653 -16.617  -0.358 1.00 . A A .  13 GLU CB   1 1 
        2  2482 1 1  13 GLU CD   C   7.042 -18.688  -0.943 1.00 . A A .  13 GLU CD   1 1 
        2  2483 1 1  13 GLU CG   C   6.177 -17.540  -1.474 1.00 . A A .  13 GLU CG   1 1 
        2  2484 1 1  13 GLU H    H   6.417 -14.784  -1.960 1.00 . A A .  13 GLU H    1 1 
        2  2485 1 1  13 GLU HA   H   3.888 -15.911  -1.374 1.00 . A A .  13 GLU HA   1 1 
        2  2486 1 1  13 GLU HB2  H   6.507 -16.181   0.153 1.00 . A A .  13 GLU HB2  1 1 
        2  2487 1 1  13 GLU HB3  H   5.097 -17.222   0.352 1.00 . A A .  13 GLU HB3  1 1 
        2  2488 1 1  13 GLU HG2  H   5.328 -17.953  -2.013 1.00 . A A .  13 GLU HG2  1 1 
        2  2489 1 1  13 GLU HG3  H   6.770 -16.949  -2.167 1.00 . A A .  13 GLU HG3  1 1 
        2  2490 1 1  13 GLU N    N   5.451 -14.670  -1.864 1.00 . A A .  13 GLU N    1 1 
        2  2491 1 1  13 GLU O    O   3.196 -14.843   0.853 1.00 . A A .  13 GLU O    1 1 
        2  2492 1 1  13 GLU OE1  O   8.230 -18.459  -0.640 1.00 . A A .  13 GLU OE1  1 1 
        2  2493 1 1  13 GLU OE2  O   6.538 -19.823  -0.805 1.00 . A A .  13 GLU OE2  1 1 
        2  2494 1 1  14 LEU C    C   3.423 -11.797   1.242 1.00 . A A .  14 LEU C    1 1 
        2  2495 1 1  14 LEU CA   C   4.683 -12.569   1.653 1.00 . A A .  14 LEU CA   1 1 
        2  2496 1 1  14 LEU CB   C   5.839 -11.586   1.954 1.00 . A A .  14 LEU CB   1 1 
        2  2497 1 1  14 LEU CD1  C   5.303 -11.247   4.451 1.00 . A A .  14 LEU CD1  1 1 
        2  2498 1 1  14 LEU CD2  C   6.757  -9.551   3.215 1.00 . A A .  14 LEU CD2  1 1 
        2  2499 1 1  14 LEU CG   C   5.588 -10.550   3.102 1.00 . A A .  14 LEU CG   1 1 
        2  2500 1 1  14 LEU H    H   5.878 -13.391   0.107 1.00 . A A .  14 LEU H    1 1 
        2  2501 1 1  14 LEU HA   H   4.467 -13.136   2.556 1.00 . A A .  14 LEU HA   1 1 
        2  2502 1 1  14 LEU HB2  H   6.720 -12.173   2.208 1.00 . A A .  14 LEU HB2  1 1 
        2  2503 1 1  14 LEU HB3  H   6.060 -11.038   1.041 1.00 . A A .  14 LEU HB3  1 1 
        2  2504 1 1  14 LEU HD11 H   4.425 -11.872   4.358 1.00 . A A .  14 LEU HD11 1 1 
        2  2505 1 1  14 LEU HD12 H   5.125 -10.503   5.215 1.00 . A A .  14 LEU HD12 1 1 
        2  2506 1 1  14 LEU HD13 H   6.151 -11.860   4.739 1.00 . A A .  14 LEU HD13 1 1 
        2  2507 1 1  14 LEU HD21 H   7.674 -10.081   3.447 1.00 . A A .  14 LEU HD21 1 1 
        2  2508 1 1  14 LEU HD22 H   6.547  -8.836   3.999 1.00 . A A .  14 LEU HD22 1 1 
        2  2509 1 1  14 LEU HD23 H   6.875  -9.024   2.278 1.00 . A A .  14 LEU HD23 1 1 
        2  2510 1 1  14 LEU HG   H   4.701  -9.975   2.858 1.00 . A A .  14 LEU HG   1 1 
        2  2511 1 1  14 LEU N    N   5.048 -13.535   0.608 1.00 . A A .  14 LEU N    1 1 
        2  2512 1 1  14 LEU O    O   2.579 -11.542   2.093 1.00 . A A .  14 LEU O    1 1 
        2  2513 1 1  15 ILE C    C   0.837 -11.647  -0.225 1.00 . A A .  15 ILE C    1 1 
        2  2514 1 1  15 ILE CA   C   2.076 -10.831  -0.636 1.00 . A A .  15 ILE CA   1 1 
        2  2515 1 1  15 ILE CB   C   2.083 -10.742  -2.217 1.00 . A A .  15 ILE CB   1 1 
        2  2516 1 1  15 ILE CD1  C   3.439  -9.890  -4.272 1.00 . A A .  15 ILE CD1  1 1 
        2  2517 1 1  15 ILE CG1  C   3.340 -10.000  -2.754 1.00 . A A .  15 ILE CG1  1 1 
        2  2518 1 1  15 ILE CG2  C   0.790 -10.068  -2.739 1.00 . A A .  15 ILE CG2  1 1 
        2  2519 1 1  15 ILE H    H   4.059 -11.632  -0.683 1.00 . A A .  15 ILE H    1 1 
        2  2520 1 1  15 ILE HA   H   1.999  -9.825  -0.230 1.00 . A A .  15 ILE HA   1 1 
        2  2521 1 1  15 ILE HB   H   2.098 -11.762  -2.603 1.00 . A A .  15 ILE HB   1 1 
        2  2522 1 1  15 ILE HD11 H   3.446 -10.878  -4.709 1.00 . A A .  15 ILE HD11 1 1 
        2  2523 1 1  15 ILE HD12 H   4.352  -9.376  -4.534 1.00 . A A .  15 ILE HD12 1 1 
        2  2524 1 1  15 ILE HD13 H   2.595  -9.332  -4.657 1.00 . A A .  15 ILE HD13 1 1 
        2  2525 1 1  15 ILE HG12 H   3.346  -8.993  -2.364 1.00 . A A .  15 ILE HG12 1 1 
        2  2526 1 1  15 ILE HG13 H   4.227 -10.512  -2.408 1.00 . A A .  15 ILE HG13 1 1 
        2  2527 1 1  15 ILE HG21 H   0.799 -10.032  -3.821 1.00 . A A .  15 ILE HG21 1 1 
        2  2528 1 1  15 ILE HG22 H   0.719  -9.062  -2.346 1.00 . A A .  15 ILE HG22 1 1 
        2  2529 1 1  15 ILE HG23 H  -0.073 -10.636  -2.411 1.00 . A A .  15 ILE HG23 1 1 
        2  2530 1 1  15 ILE N    N   3.301 -11.459  -0.077 1.00 . A A .  15 ILE N    1 1 
        2  2531 1 1  15 ILE O    O  -0.126 -11.104   0.314 1.00 . A A .  15 ILE O    1 1 
        2  2532 1 1  16 LYS C    C  -0.480 -14.082   1.273 1.00 . A A .  16 LYS C    1 1 
        2  2533 1 1  16 LYS CA   C  -0.162 -13.923  -0.229 1.00 . A A .  16 LYS CA   1 1 
        2  2534 1 1  16 LYS CB   C   0.194 -15.290  -0.866 1.00 . A A .  16 LYS CB   1 1 
        2  2535 1 1  16 LYS CD   C   0.692 -16.625  -3.005 1.00 . A A .  16 LYS CD   1 1 
        2  2536 1 1  16 LYS CE   C   0.674 -16.623  -4.542 1.00 . A A .  16 LYS CE   1 1 
        2  2537 1 1  16 LYS CG   C   0.342 -15.246  -2.403 1.00 . A A .  16 LYS CG   1 1 
        2  2538 1 1  16 LYS H    H   1.784 -13.311  -0.802 1.00 . A A .  16 LYS H    1 1 
        2  2539 1 1  16 LYS HA   H  -1.044 -13.531  -0.728 1.00 . A A .  16 LYS HA   1 1 
        2  2540 1 1  16 LYS HB2  H   1.130 -15.642  -0.441 1.00 . A A .  16 LYS HB2  1 1 
        2  2541 1 1  16 LYS HB3  H  -0.586 -16.005  -0.622 1.00 . A A .  16 LYS HB3  1 1 
        2  2542 1 1  16 LYS HD2  H   1.682 -16.909  -2.670 1.00 . A A .  16 LYS HD2  1 1 
        2  2543 1 1  16 LYS HD3  H  -0.027 -17.357  -2.647 1.00 . A A .  16 LYS HD3  1 1 
        2  2544 1 1  16 LYS HE2  H   0.912 -17.620  -4.899 1.00 . A A .  16 LYS HE2  1 1 
        2  2545 1 1  16 LYS HE3  H  -0.317 -16.356  -4.885 1.00 . A A .  16 LYS HE3  1 1 
        2  2546 1 1  16 LYS HG2  H  -0.593 -14.902  -2.832 1.00 . A A .  16 LYS HG2  1 1 
        2  2547 1 1  16 LYS HG3  H   1.128 -14.541  -2.658 1.00 . A A .  16 LYS HG3  1 1 
        2  2548 1 1  16 LYS HZ1  H   1.604 -15.682  -6.161 1.00 . A A .  16 LYS HZ1  1 1 
        2  2549 1 1  16 LYS HZ2  H   2.621 -15.920  -4.830 1.00 . A A .  16 LYS HZ2  1 1 
        2  2550 1 1  16 LYS HZ3  H   1.450 -14.707  -4.794 1.00 . A A .  16 LYS HZ3  1 1 
        2  2551 1 1  16 LYS N    N   0.932 -12.965  -0.461 1.00 . A A .  16 LYS N    1 1 
        2  2552 1 1  16 LYS NZ   N   1.655 -15.669  -5.120 1.00 . A A .  16 LYS NZ   1 1 
        2  2553 1 1  16 LYS O    O  -1.645 -14.238   1.643 1.00 . A A .  16 LYS O    1 1 
        2  2554 1 1  17 LYS C    C  -0.328 -12.842   4.113 1.00 . A A .  17 LYS C    1 1 
        2  2555 1 1  17 LYS CA   C   0.405 -14.095   3.595 1.00 . A A .  17 LYS CA   1 1 
        2  2556 1 1  17 LYS CB   C   1.789 -14.248   4.278 1.00 . A A .  17 LYS CB   1 1 
        2  2557 1 1  17 LYS CD   C   3.957 -15.624   4.505 1.00 . A A .  17 LYS CD   1 1 
        2  2558 1 1  17 LYS CE   C   3.952 -15.706   6.041 1.00 . A A .  17 LYS CE   1 1 
        2  2559 1 1  17 LYS CG   C   2.537 -15.546   3.897 1.00 . A A .  17 LYS CG   1 1 
        2  2560 1 1  17 LYS H    H   1.468 -13.941   1.757 1.00 . A A .  17 LYS H    1 1 
        2  2561 1 1  17 LYS HA   H  -0.193 -14.973   3.822 1.00 . A A .  17 LYS HA   1 1 
        2  2562 1 1  17 LYS HB2  H   2.411 -13.402   4.002 1.00 . A A .  17 LYS HB2  1 1 
        2  2563 1 1  17 LYS HB3  H   1.654 -14.241   5.356 1.00 . A A .  17 LYS HB3  1 1 
        2  2564 1 1  17 LYS HD2  H   4.456 -16.504   4.115 1.00 . A A .  17 LYS HD2  1 1 
        2  2565 1 1  17 LYS HD3  H   4.514 -14.743   4.201 1.00 . A A .  17 LYS HD3  1 1 
        2  2566 1 1  17 LYS HE2  H   3.472 -14.823   6.445 1.00 . A A .  17 LYS HE2  1 1 
        2  2567 1 1  17 LYS HE3  H   3.400 -16.585   6.348 1.00 . A A .  17 LYS HE3  1 1 
        2  2568 1 1  17 LYS HG2  H   1.960 -16.399   4.241 1.00 . A A .  17 LYS HG2  1 1 
        2  2569 1 1  17 LYS HG3  H   2.617 -15.593   2.815 1.00 . A A .  17 LYS HG3  1 1 
        2  2570 1 1  17 LYS HZ1  H   5.879 -14.947   6.335 1.00 . A A .  17 LYS HZ1  1 1 
        2  2571 1 1  17 LYS HZ2  H   5.815 -16.633   6.217 1.00 . A A .  17 LYS HZ2  1 1 
        2  2572 1 1  17 LYS HZ3  H   5.297 -15.865   7.629 1.00 . A A .  17 LYS HZ3  1 1 
        2  2573 1 1  17 LYS N    N   0.563 -14.029   2.126 1.00 . A A .  17 LYS N    1 1 
        2  2574 1 1  17 LYS NZ   N   5.332 -15.793   6.593 1.00 . A A .  17 LYS NZ   1 1 
        2  2575 1 1  17 LYS O    O  -1.194 -12.936   4.992 1.00 . A A .  17 LYS O    1 1 
        2  2576 1 1  18 ILE C    C  -2.096 -10.462   3.391 1.00 . A A .  18 ILE C    1 1 
        2  2577 1 1  18 ILE CA   C  -0.622 -10.382   3.802 1.00 . A A .  18 ILE CA   1 1 
        2  2578 1 1  18 ILE CB   C   0.092  -9.178   3.056 1.00 . A A .  18 ILE CB   1 1 
        2  2579 1 1  18 ILE CD1  C   2.413  -8.019   2.795 1.00 . A A .  18 ILE CD1  1 1 
        2  2580 1 1  18 ILE CG1  C   1.566  -9.031   3.548 1.00 . A A .  18 ILE CG1  1 1 
        2  2581 1 1  18 ILE CG2  C  -0.684  -7.844   3.228 1.00 . A A .  18 ILE CG2  1 1 
        2  2582 1 1  18 ILE H    H   0.758 -11.697   2.874 1.00 . A A .  18 ILE H    1 1 
        2  2583 1 1  18 ILE HA   H  -0.563 -10.205   4.874 1.00 . A A .  18 ILE HA   1 1 
        2  2584 1 1  18 ILE HB   H   0.108  -9.413   1.996 1.00 . A A .  18 ILE HB   1 1 
        2  2585 1 1  18 ILE HD11 H   2.459  -8.287   1.750 1.00 . A A .  18 ILE HD11 1 1 
        2  2586 1 1  18 ILE HD12 H   3.413  -8.015   3.208 1.00 . A A .  18 ILE HD12 1 1 
        2  2587 1 1  18 ILE HD13 H   1.984  -7.030   2.896 1.00 . A A .  18 ILE HD13 1 1 
        2  2588 1 1  18 ILE HG12 H   1.568  -8.739   4.587 1.00 . A A .  18 ILE HG12 1 1 
        2  2589 1 1  18 ILE HG13 H   2.062  -9.988   3.457 1.00 . A A .  18 ILE HG13 1 1 
        2  2590 1 1  18 ILE HG21 H  -0.171  -7.047   2.701 1.00 . A A .  18 ILE HG21 1 1 
        2  2591 1 1  18 ILE HG22 H  -0.747  -7.592   4.276 1.00 . A A .  18 ILE HG22 1 1 
        2  2592 1 1  18 ILE HG23 H  -1.685  -7.946   2.826 1.00 . A A .  18 ILE HG23 1 1 
        2  2593 1 1  18 ILE N    N   0.031 -11.675   3.525 1.00 . A A .  18 ILE N    1 1 
        2  2594 1 1  18 ILE O    O  -2.967 -10.051   4.156 1.00 . A A .  18 ILE O    1 1 
        2  2595 1 1  19 LYS C    C  -4.582 -11.970   2.707 1.00 . A A .  19 LYS C    1 1 
        2  2596 1 1  19 LYS CA   C  -3.718 -11.241   1.676 1.00 . A A .  19 LYS CA   1 1 
        2  2597 1 1  19 LYS CB   C  -3.738 -12.022   0.328 1.00 . A A .  19 LYS CB   1 1 
        2  2598 1 1  19 LYS CD   C  -3.303 -11.999  -2.203 1.00 . A A .  19 LYS CD   1 1 
        2  2599 1 1  19 LYS CE   C  -2.701 -11.228  -3.383 1.00 . A A .  19 LYS CE   1 1 
        2  2600 1 1  19 LYS CG   C  -3.067 -11.289  -0.850 1.00 . A A .  19 LYS CG   1 1 
        2  2601 1 1  19 LYS H    H  -1.601 -11.383   1.665 1.00 . A A .  19 LYS H    1 1 
        2  2602 1 1  19 LYS HA   H  -4.133 -10.251   1.509 1.00 . A A .  19 LYS HA   1 1 
        2  2603 1 1  19 LYS HB2  H  -3.234 -12.973   0.466 1.00 . A A .  19 LYS HB2  1 1 
        2  2604 1 1  19 LYS HB3  H  -4.772 -12.218   0.053 1.00 . A A .  19 LYS HB3  1 1 
        2  2605 1 1  19 LYS HD2  H  -2.855 -12.986  -2.167 1.00 . A A .  19 LYS HD2  1 1 
        2  2606 1 1  19 LYS HD3  H  -4.372 -12.102  -2.362 1.00 . A A .  19 LYS HD3  1 1 
        2  2607 1 1  19 LYS HE2  H  -3.067 -10.210  -3.368 1.00 . A A .  19 LYS HE2  1 1 
        2  2608 1 1  19 LYS HE3  H  -1.623 -11.220  -3.287 1.00 . A A .  19 LYS HE3  1 1 
        2  2609 1 1  19 LYS HG2  H  -3.468 -10.285  -0.908 1.00 . A A .  19 LYS HG2  1 1 
        2  2610 1 1  19 LYS HG3  H  -1.999 -11.232  -0.663 1.00 . A A .  19 LYS HG3  1 1 
        2  2611 1 1  19 LYS HZ1  H  -2.665 -11.265  -5.469 1.00 . A A .  19 LYS HZ1  1 1 
        2  2612 1 1  19 LYS HZ2  H  -4.091 -11.876  -4.797 1.00 . A A .  19 LYS HZ2  1 1 
        2  2613 1 1  19 LYS HZ3  H  -2.674 -12.795  -4.757 1.00 . A A .  19 LYS HZ3  1 1 
        2  2614 1 1  19 LYS N    N  -2.354 -11.056   2.197 1.00 . A A .  19 LYS N    1 1 
        2  2615 1 1  19 LYS NZ   N  -3.057 -11.836  -4.690 1.00 . A A .  19 LYS NZ   1 1 
        2  2616 1 1  19 LYS O    O  -5.635 -11.462   3.080 1.00 . A A .  19 LYS O    1 1 
        2  2617 1 1  20 LYS C    C  -5.120 -13.249   5.470 1.00 . A A .  20 LYS C    1 1 
        2  2618 1 1  20 LYS CA   C  -4.810 -13.975   4.153 1.00 . A A .  20 LYS CA   1 1 
        2  2619 1 1  20 LYS CB   C  -4.048 -15.295   4.427 1.00 . A A .  20 LYS CB   1 1 
        2  2620 1 1  20 LYS CD   C  -5.010 -16.489   2.331 1.00 . A A .  20 LYS CD   1 1 
        2  2621 1 1  20 LYS CE   C  -6.082 -17.291   3.099 1.00 . A A .  20 LYS CE   1 1 
        2  2622 1 1  20 LYS CG   C  -3.754 -16.157   3.175 1.00 . A A .  20 LYS CG   1 1 
        2  2623 1 1  20 LYS H    H  -3.152 -13.374   2.964 1.00 . A A .  20 LYS H    1 1 
        2  2624 1 1  20 LYS HA   H  -5.755 -14.219   3.673 1.00 . A A .  20 LYS HA   1 1 
        2  2625 1 1  20 LYS HB2  H  -3.099 -15.056   4.900 1.00 . A A .  20 LYS HB2  1 1 
        2  2626 1 1  20 LYS HB3  H  -4.630 -15.894   5.119 1.00 . A A .  20 LYS HB3  1 1 
        2  2627 1 1  20 LYS HD2  H  -5.454 -15.561   1.984 1.00 . A A .  20 LYS HD2  1 1 
        2  2628 1 1  20 LYS HD3  H  -4.697 -17.067   1.468 1.00 . A A .  20 LYS HD3  1 1 
        2  2629 1 1  20 LYS HE2  H  -6.419 -16.711   3.947 1.00 . A A .  20 LYS HE2  1 1 
        2  2630 1 1  20 LYS HE3  H  -6.920 -17.471   2.439 1.00 . A A .  20 LYS HE3  1 1 
        2  2631 1 1  20 LYS HG2  H  -3.053 -15.622   2.547 1.00 . A A .  20 LYS HG2  1 1 
        2  2632 1 1  20 LYS HG3  H  -3.294 -17.087   3.495 1.00 . A A .  20 LYS HG3  1 1 
        2  2633 1 1  20 LYS HZ1  H  -5.188 -19.164   2.808 1.00 . A A .  20 LYS HZ1  1 1 
        2  2634 1 1  20 LYS HZ2  H  -6.354 -19.141   4.032 1.00 . A A .  20 LYS HZ2  1 1 
        2  2635 1 1  20 LYS HZ3  H  -4.829 -18.463   4.305 1.00 . A A .  20 LYS HZ3  1 1 
        2  2636 1 1  20 LYS N    N  -4.068 -13.113   3.219 1.00 . A A .  20 LYS N    1 1 
        2  2637 1 1  20 LYS NZ   N  -5.579 -18.603   3.594 1.00 . A A .  20 LYS NZ   1 1 
        2  2638 1 1  20 LYS O    O  -6.219 -13.414   6.005 1.00 . A A .  20 LYS O    1 1 
        2  2639 1 1  21 GLU C    C  -5.620 -10.708   6.955 1.00 . A A .  21 GLU C    1 1 
        2  2640 1 1  21 GLU CA   C  -4.365 -11.573   7.158 1.00 . A A .  21 GLU CA   1 1 
        2  2641 1 1  21 GLU CB   C  -3.127 -10.652   7.395 1.00 . A A .  21 GLU CB   1 1 
        2  2642 1 1  21 GLU CD   C  -1.968 -11.916   9.308 1.00 . A A .  21 GLU CD   1 1 
        2  2643 1 1  21 GLU CG   C  -1.854 -11.376   7.870 1.00 . A A .  21 GLU CG   1 1 
        2  2644 1 1  21 GLU H    H  -3.268 -12.433   5.544 1.00 . A A .  21 GLU H    1 1 
        2  2645 1 1  21 GLU HA   H  -4.503 -12.213   8.023 1.00 . A A .  21 GLU HA   1 1 
        2  2646 1 1  21 GLU HB2  H  -2.892 -10.139   6.466 1.00 . A A .  21 GLU HB2  1 1 
        2  2647 1 1  21 GLU HB3  H  -3.382  -9.900   8.140 1.00 . A A .  21 GLU HB3  1 1 
        2  2648 1 1  21 GLU HG2  H  -1.650 -12.201   7.195 1.00 . A A .  21 GLU HG2  1 1 
        2  2649 1 1  21 GLU HG3  H  -1.018 -10.680   7.824 1.00 . A A .  21 GLU HG3  1 1 
        2  2650 1 1  21 GLU N    N  -4.149 -12.446   5.978 1.00 . A A .  21 GLU N    1 1 
        2  2651 1 1  21 GLU O    O  -6.571 -10.758   7.736 1.00 . A A .  21 GLU O    1 1 
        2  2652 1 1  21 GLU OE1  O  -1.813 -11.116  10.259 1.00 . A A .  21 GLU OE1  1 1 
        2  2653 1 1  21 GLU OE2  O  -2.215 -13.131   9.497 1.00 . A A .  21 GLU OE2  1 1 
        2  2654 1 1  22 VAL C    C  -7.959  -9.579   5.045 1.00 . A A .  22 VAL C    1 1 
        2  2655 1 1  22 VAL CA   C  -6.600  -8.973   5.482 1.00 . A A .  22 VAL CA   1 1 
        2  2656 1 1  22 VAL CB   C  -5.992  -8.053   4.371 1.00 . A A .  22 VAL CB   1 1 
        2  2657 1 1  22 VAL CG1  C  -6.876  -6.845   4.060 1.00 . A A .  22 VAL CG1  1 1 
        2  2658 1 1  22 VAL CG2  C  -4.583  -7.584   4.766 1.00 . A A .  22 VAL CG2  1 1 
        2  2659 1 1  22 VAL H    H  -4.919 -10.217   5.158 1.00 . A A .  22 VAL H    1 1 
        2  2660 1 1  22 VAL HA   H  -6.761  -8.367   6.372 1.00 . A A .  22 VAL HA   1 1 
        2  2661 1 1  22 VAL HB   H  -5.898  -8.645   3.462 1.00 . A A .  22 VAL HB   1 1 
        2  2662 1 1  22 VAL HG11 H  -6.985  -6.230   4.946 1.00 . A A .  22 VAL HG11 1 1 
        2  2663 1 1  22 VAL HG12 H  -7.854  -7.178   3.735 1.00 . A A .  22 VAL HG12 1 1 
        2  2664 1 1  22 VAL HG13 H  -6.425  -6.256   3.270 1.00 . A A .  22 VAL HG13 1 1 
        2  2665 1 1  22 VAL HG21 H  -3.963  -8.435   5.010 1.00 . A A .  22 VAL HG21 1 1 
        2  2666 1 1  22 VAL HG22 H  -4.642  -6.932   5.629 1.00 . A A .  22 VAL HG22 1 1 
        2  2667 1 1  22 VAL HG23 H  -4.130  -7.043   3.943 1.00 . A A .  22 VAL HG23 1 1 
        2  2668 1 1  22 VAL N    N  -5.620 -10.013   5.820 1.00 . A A .  22 VAL N    1 1 
        2  2669 1 1  22 VAL O    O  -9.009  -8.913   5.146 1.00 . A A .  22 VAL O    1 1 
        2  2670 1 1  23 GLU C    C  -9.960 -11.820   5.590 1.00 . A A .  23 GLU C    1 1 
        2  2671 1 1  23 GLU CA   C  -9.147 -11.640   4.299 1.00 . A A .  23 GLU CA   1 1 
        2  2672 1 1  23 GLU CB   C  -8.790 -13.038   3.708 1.00 . A A .  23 GLU CB   1 1 
        2  2673 1 1  23 GLU CD   C  -9.186 -12.471   1.227 1.00 . A A .  23 GLU CD   1 1 
        2  2674 1 1  23 GLU CG   C  -8.214 -13.033   2.278 1.00 . A A .  23 GLU CG   1 1 
        2  2675 1 1  23 GLU H    H  -7.061 -11.274   4.442 1.00 . A A .  23 GLU H    1 1 
        2  2676 1 1  23 GLU HA   H  -9.740 -11.087   3.576 1.00 . A A .  23 GLU HA   1 1 
        2  2677 1 1  23 GLU HB2  H  -8.064 -13.511   4.358 1.00 . A A .  23 GLU HB2  1 1 
        2  2678 1 1  23 GLU HB3  H  -9.688 -13.653   3.701 1.00 . A A .  23 GLU HB3  1 1 
        2  2679 1 1  23 GLU HG2  H  -7.305 -12.442   2.276 1.00 . A A .  23 GLU HG2  1 1 
        2  2680 1 1  23 GLU HG3  H  -7.961 -14.053   2.002 1.00 . A A .  23 GLU HG3  1 1 
        2  2681 1 1  23 GLU N    N  -7.931 -10.853   4.587 1.00 . A A .  23 GLU N    1 1 
        2  2682 1 1  23 GLU O    O -11.178 -11.604   5.606 1.00 . A A .  23 GLU O    1 1 
        2  2683 1 1  23 GLU OE1  O -10.259 -13.079   1.019 1.00 . A A .  23 GLU OE1  1 1 
        2  2684 1 1  23 GLU OE2  O  -8.881 -11.445   0.591 1.00 . A A .  23 GLU OE2  1 1 
        2  2685 1 1  24 ASN C    C -10.236 -11.047   8.659 1.00 . A A .  24 ASN C    1 1 
        2  2686 1 1  24 ASN CA   C  -9.871 -12.392   8.002 1.00 . A A .  24 ASN CA   1 1 
        2  2687 1 1  24 ASN CB   C  -8.947 -13.218   8.936 1.00 . A A .  24 ASN CB   1 1 
        2  2688 1 1  24 ASN CG   C  -8.744 -14.662   8.459 1.00 . A A .  24 ASN CG   1 1 
        2  2689 1 1  24 ASN H    H  -8.285 -12.319   6.589 1.00 . A A .  24 ASN H    1 1 
        2  2690 1 1  24 ASN HA   H -10.794 -12.951   7.849 1.00 . A A .  24 ASN HA   1 1 
        2  2691 1 1  24 ASN HB2  H  -7.977 -12.734   9.001 1.00 . A A .  24 ASN HB2  1 1 
        2  2692 1 1  24 ASN HB3  H  -9.383 -13.252   9.929 1.00 . A A .  24 ASN HB3  1 1 
        2  2693 1 1  24 ASN HD21 H  -7.004 -14.206   7.631 1.00 . A A .  24 ASN HD21 1 1 
        2  2694 1 1  24 ASN HD22 H  -7.493 -15.853   7.499 1.00 . A A .  24 ASN HD22 1 1 
        2  2695 1 1  24 ASN N    N  -9.255 -12.190   6.679 1.00 . A A .  24 ASN N    1 1 
        2  2696 1 1  24 ASN ND2  N  -7.638 -14.933   7.793 1.00 . A A .  24 ASN ND2  1 1 
        2  2697 1 1  24 ASN O    O -11.075 -11.010   9.566 1.00 . A A .  24 ASN O    1 1 
        2  2698 1 1  24 ASN OD1  O  -9.569 -15.538   8.716 1.00 . A A .  24 ASN OD1  1 1 
        2  2699 1 1  25 GLN C    C -11.203  -8.075   7.901 1.00 . A A .  25 GLN C    1 1 
        2  2700 1 1  25 GLN CA   C  -9.965  -8.587   8.664 1.00 . A A .  25 GLN CA   1 1 
        2  2701 1 1  25 GLN CB   C  -8.777  -7.586   8.519 1.00 . A A .  25 GLN CB   1 1 
        2  2702 1 1  25 GLN CD   C  -7.444  -8.359  10.649 1.00 . A A .  25 GLN CD   1 1 
        2  2703 1 1  25 GLN CG   C  -7.430  -8.044   9.141 1.00 . A A .  25 GLN CG   1 1 
        2  2704 1 1  25 GLN H    H  -8.886 -10.047   7.548 1.00 . A A .  25 GLN H    1 1 
        2  2705 1 1  25 GLN HA   H -10.227  -8.654   9.719 1.00 . A A .  25 GLN HA   1 1 
        2  2706 1 1  25 GLN HB2  H  -8.607  -7.402   7.462 1.00 . A A .  25 GLN HB2  1 1 
        2  2707 1 1  25 GLN HB3  H  -9.060  -6.649   8.985 1.00 . A A .  25 GLN HB3  1 1 
        2  2708 1 1  25 GLN HE21 H  -5.525  -7.867  10.797 1.00 . A A .  25 GLN HE21 1 1 
        2  2709 1 1  25 GLN HE22 H  -6.277  -8.393  12.262 1.00 . A A .  25 GLN HE22 1 1 
        2  2710 1 1  25 GLN HG2  H  -7.107  -8.934   8.627 1.00 . A A .  25 GLN HG2  1 1 
        2  2711 1 1  25 GLN HG3  H  -6.696  -7.261   8.963 1.00 . A A .  25 GLN HG3  1 1 
        2  2712 1 1  25 GLN N    N  -9.602  -9.944   8.205 1.00 . A A .  25 GLN N    1 1 
        2  2713 1 1  25 GLN NE2  N  -6.301  -8.185  11.301 1.00 . A A .  25 GLN NE2  1 1 
        2  2714 1 1  25 GLN O    O -11.840  -7.112   8.329 1.00 . A A .  25 GLN O    1 1 
        2  2715 1 1  25 GLN OE1  O  -8.449  -8.785  11.222 1.00 . A A .  25 GLN OE1  1 1 
        2  2716 1 1  26 GLY C    C -12.593  -7.163   5.132 1.00 . A A .  26 GLY C    1 1 
        2  2717 1 1  26 GLY CA   C -12.722  -8.418   5.986 1.00 . A A .  26 GLY CA   1 1 
        2  2718 1 1  26 GLY H    H -10.923  -9.433   6.449 1.00 . A A .  26 GLY H    1 1 
        2  2719 1 1  26 GLY HA2  H -12.919  -9.252   5.331 1.00 . A A .  26 GLY HA2  1 1 
        2  2720 1 1  26 GLY HA3  H -13.568  -8.306   6.658 1.00 . A A .  26 GLY HA3  1 1 
        2  2721 1 1  26 GLY N    N -11.521  -8.725   6.766 1.00 . A A .  26 GLY N    1 1 
        2  2722 1 1  26 GLY O    O -13.590  -6.493   4.859 1.00 . A A .  26 GLY O    1 1 
        2  2723 1 1  27 TYR C    C -10.947  -6.252   2.363 1.00 . A A .  27 TYR C    1 1 
        2  2724 1 1  27 TYR CA   C -11.065  -5.722   3.801 1.00 . A A .  27 TYR CA   1 1 
        2  2725 1 1  27 TYR CB   C  -9.755  -4.994   4.194 1.00 . A A .  27 TYR CB   1 1 
        2  2726 1 1  27 TYR CD1  C -10.348  -4.570   6.649 1.00 . A A .  27 TYR CD1  1 1 
        2  2727 1 1  27 TYR CD2  C  -9.278  -2.817   5.426 1.00 . A A .  27 TYR CD2  1 1 
        2  2728 1 1  27 TYR CE1  C -10.377  -3.770   7.774 1.00 . A A .  27 TYR CE1  1 1 
        2  2729 1 1  27 TYR CE2  C  -9.305  -2.020   6.544 1.00 . A A .  27 TYR CE2  1 1 
        2  2730 1 1  27 TYR CG   C  -9.801  -4.113   5.447 1.00 . A A .  27 TYR CG   1 1 
        2  2731 1 1  27 TYR CZ   C  -9.856  -2.496   7.715 1.00 . A A .  27 TYR CZ   1 1 
        2  2732 1 1  27 TYR H    H -10.604  -7.383   5.056 1.00 . A A .  27 TYR H    1 1 
        2  2733 1 1  27 TYR HA   H -11.890  -5.015   3.843 1.00 . A A .  27 TYR HA   1 1 
        2  2734 1 1  27 TYR HB2  H  -8.999  -5.739   4.374 1.00 . A A .  27 TYR HB2  1 1 
        2  2735 1 1  27 TYR HB3  H  -9.430  -4.376   3.361 1.00 . A A .  27 TYR HB3  1 1 
        2  2736 1 1  27 TYR HD1  H -10.755  -5.573   6.693 1.00 . A A .  27 TYR HD1  1 1 
        2  2737 1 1  27 TYR HD2  H  -8.843  -2.435   4.506 1.00 . A A .  27 TYR HD2  1 1 
        2  2738 1 1  27 TYR HE1  H -10.809  -4.144   8.695 1.00 . A A .  27 TYR HE1  1 1 
        2  2739 1 1  27 TYR HE2  H  -8.879  -1.021   6.502 1.00 . A A .  27 TYR HE2  1 1 
        2  2740 1 1  27 TYR HH   H  -9.553  -2.181   9.590 1.00 . A A .  27 TYR HH   1 1 
        2  2741 1 1  27 TYR N    N -11.354  -6.841   4.727 1.00 . A A .  27 TYR N    1 1 
        2  2742 1 1  27 TYR O    O -10.816  -7.465   2.141 1.00 . A A .  27 TYR O    1 1 
        2  2743 1 1  27 TYR OH   O  -9.886  -1.691   8.832 1.00 . A A .  27 TYR OH   1 1 
        2  2744 1 1  28 GLN C    C  -9.398  -5.678  -0.425 1.00 . A A .  28 GLN C    1 1 
        2  2745 1 1  28 GLN CA   C -10.887  -5.629  -0.039 1.00 . A A .  28 GLN CA   1 1 
        2  2746 1 1  28 GLN CB   C -11.629  -4.547  -0.897 1.00 . A A .  28 GLN CB   1 1 
        2  2747 1 1  28 GLN CD   C -13.328  -3.484   0.764 1.00 . A A .  28 GLN CD   1 1 
        2  2748 1 1  28 GLN CG   C -13.121  -4.284  -0.540 1.00 . A A .  28 GLN CG   1 1 
        2  2749 1 1  28 GLN H    H -11.027  -4.377   1.654 1.00 . A A .  28 GLN H    1 1 
        2  2750 1 1  28 GLN HA   H -11.343  -6.603  -0.217 1.00 . A A .  28 GLN HA   1 1 
        2  2751 1 1  28 GLN HB2  H -11.095  -3.604  -0.804 1.00 . A A .  28 GLN HB2  1 1 
        2  2752 1 1  28 GLN HB3  H -11.586  -4.855  -1.939 1.00 . A A .  28 GLN HB3  1 1 
        2  2753 1 1  28 GLN HE21 H -13.156  -1.769  -0.212 1.00 . A A .  28 GLN HE21 1 1 
        2  2754 1 1  28 GLN HE22 H -13.424  -1.637   1.488 1.00 . A A .  28 GLN HE22 1 1 
        2  2755 1 1  28 GLN HG2  H -13.583  -3.738  -1.354 1.00 . A A .  28 GLN HG2  1 1 
        2  2756 1 1  28 GLN HG3  H -13.624  -5.241  -0.441 1.00 . A A .  28 GLN HG3  1 1 
        2  2757 1 1  28 GLN N    N -10.977  -5.320   1.396 1.00 . A A .  28 GLN N    1 1 
        2  2758 1 1  28 GLN NE2  N -13.300  -2.164   0.668 1.00 . A A .  28 GLN NE2  1 1 
        2  2759 1 1  28 GLN O    O  -8.714  -4.662  -0.320 1.00 . A A .  28 GLN O    1 1 
        2  2760 1 1  28 GLN OE1  O -13.495  -4.048   1.848 1.00 . A A .  28 GLN OE1  1 1 
        2  2761 1 1  29 VAL C    C  -7.268  -7.116  -2.684 1.00 . A A .  29 VAL C    1 1 
        2  2762 1 1  29 VAL CA   C  -7.462  -7.042  -1.163 1.00 . A A .  29 VAL CA   1 1 
        2  2763 1 1  29 VAL CB   C  -6.866  -8.350  -0.518 1.00 . A A .  29 VAL CB   1 1 
        2  2764 1 1  29 VAL CG1  C  -5.325  -8.397  -0.682 1.00 . A A .  29 VAL CG1  1 1 
        2  2765 1 1  29 VAL CG2  C  -7.272  -8.481   0.962 1.00 . A A .  29 VAL CG2  1 1 
        2  2766 1 1  29 VAL H    H  -9.489  -7.624  -0.906 1.00 . A A .  29 VAL H    1 1 
        2  2767 1 1  29 VAL HA   H  -6.902  -6.188  -0.776 1.00 . A A .  29 VAL HA   1 1 
        2  2768 1 1  29 VAL HB   H  -7.280  -9.204  -1.049 1.00 . A A .  29 VAL HB   1 1 
        2  2769 1 1  29 VAL HG11 H  -4.875  -7.544  -0.190 1.00 . A A .  29 VAL HG11 1 1 
        2  2770 1 1  29 VAL HG12 H  -5.066  -8.377  -1.734 1.00 . A A .  29 VAL HG12 1 1 
        2  2771 1 1  29 VAL HG13 H  -4.939  -9.308  -0.243 1.00 . A A .  29 VAL HG13 1 1 
        2  2772 1 1  29 VAL HG21 H  -8.352  -8.492   1.046 1.00 . A A .  29 VAL HG21 1 1 
        2  2773 1 1  29 VAL HG22 H  -6.882  -7.641   1.523 1.00 . A A .  29 VAL HG22 1 1 
        2  2774 1 1  29 VAL HG23 H  -6.875  -9.400   1.377 1.00 . A A .  29 VAL HG23 1 1 
        2  2775 1 1  29 VAL N    N  -8.892  -6.855  -0.830 1.00 . A A .  29 VAL N    1 1 
        2  2776 1 1  29 VAL O    O  -7.757  -8.053  -3.322 1.00 . A A .  29 VAL O    1 1 
        2  2777 1 1  30 ARG C    C  -4.619  -5.908  -4.704 1.00 . A A .  30 ARG C    1 1 
        2  2778 1 1  30 ARG CA   C  -6.126  -6.155  -4.668 1.00 . A A .  30 ARG CA   1 1 
        2  2779 1 1  30 ARG CB   C  -6.844  -5.093  -5.563 1.00 . A A .  30 ARG CB   1 1 
        2  2780 1 1  30 ARG CD   C  -9.128  -4.440  -4.515 1.00 . A A .  30 ARG CD   1 1 
        2  2781 1 1  30 ARG CG   C  -8.391  -5.224  -5.623 1.00 . A A .  30 ARG CG   1 1 
        2  2782 1 1  30 ARG CZ   C -10.596  -2.448  -4.901 1.00 . A A .  30 ARG CZ   1 1 
        2  2783 1 1  30 ARG H    H  -6.337  -5.335  -2.710 1.00 . A A .  30 ARG H    1 1 
        2  2784 1 1  30 ARG HA   H  -6.325  -7.150  -5.070 1.00 . A A .  30 ARG HA   1 1 
        2  2785 1 1  30 ARG HB2  H  -6.596  -4.102  -5.195 1.00 . A A .  30 ARG HB2  1 1 
        2  2786 1 1  30 ARG HB3  H  -6.458  -5.184  -6.575 1.00 . A A .  30 ARG HB3  1 1 
        2  2787 1 1  30 ARG HD2  H -10.075  -4.929  -4.305 1.00 . A A .  30 ARG HD2  1 1 
        2  2788 1 1  30 ARG HD3  H  -8.527  -4.450  -3.613 1.00 . A A .  30 ARG HD3  1 1 
        2  2789 1 1  30 ARG HE   H  -8.597  -2.501  -5.172 1.00 . A A .  30 ARG HE   1 1 
        2  2790 1 1  30 ARG HG2  H  -8.735  -4.859  -6.583 1.00 . A A .  30 ARG HG2  1 1 
        2  2791 1 1  30 ARG HG3  H  -8.655  -6.274  -5.540 1.00 . A A .  30 ARG HG3  1 1 
        2  2792 1 1  30 ARG HH11 H -11.607  -4.097  -4.261 1.00 . A A .  30 ARG HH11 1 1 
        2  2793 1 1  30 ARG HH12 H -12.581  -2.694  -4.544 1.00 . A A .  30 ARG HH12 1 1 
        2  2794 1 1  30 ARG HH21 H  -9.888  -0.653  -5.519 1.00 . A A .  30 ARG HH21 1 1 
        2  2795 1 1  30 ARG HH22 H -11.607  -0.723  -5.264 1.00 . A A .  30 ARG HH22 1 1 
        2  2796 1 1  30 ARG N    N  -6.575  -6.120  -3.258 1.00 . A A .  30 ARG N    1 1 
        2  2797 1 1  30 ARG NE   N  -9.383  -3.037  -4.900 1.00 . A A .  30 ARG NE   1 1 
        2  2798 1 1  30 ARG NH1  N -11.683  -3.135  -4.538 1.00 . A A .  30 ARG NH1  1 1 
        2  2799 1 1  30 ARG NH2  N -10.710  -1.173  -5.256 1.00 . A A .  30 ARG NH2  1 1 
        2  2800 1 1  30 ARG O    O  -4.125  -5.032  -4.000 1.00 . A A .  30 ARG O    1 1 
        2  2801 1 1  31 ASP C    C  -2.269  -6.072  -7.221 1.00 . A A .  31 ASP C    1 1 
        2  2802 1 1  31 ASP CA   C  -2.454  -6.449  -5.742 1.00 . A A .  31 ASP CA   1 1 
        2  2803 1 1  31 ASP CB   C  -1.583  -7.673  -5.325 1.00 . A A .  31 ASP CB   1 1 
        2  2804 1 1  31 ASP CG   C  -1.794  -8.938  -6.171 1.00 . A A .  31 ASP CG   1 1 
        2  2805 1 1  31 ASP H    H  -4.315  -7.444  -5.956 1.00 . A A .  31 ASP H    1 1 
        2  2806 1 1  31 ASP HA   H  -2.147  -5.591  -5.131 1.00 . A A .  31 ASP HA   1 1 
        2  2807 1 1  31 ASP HB2  H  -0.535  -7.391  -5.375 1.00 . A A .  31 ASP HB2  1 1 
        2  2808 1 1  31 ASP HB3  H  -1.810  -7.919  -4.292 1.00 . A A .  31 ASP HB3  1 1 
        2  2809 1 1  31 ASP N    N  -3.883  -6.690  -5.501 1.00 . A A .  31 ASP N    1 1 
        2  2810 1 1  31 ASP O    O  -2.589  -6.843  -8.134 1.00 . A A .  31 ASP O    1 1 
        2  2811 1 1  31 ASP OD1  O  -2.940  -9.427  -6.259 1.00 . A A .  31 ASP OD1  1 1 
        2  2812 1 1  31 ASP OD2  O  -0.817  -9.463  -6.736 1.00 . A A .  31 ASP OD2  1 1 
        2  2813 1 1  32 VAL C    C  -0.143  -4.650  -9.209 1.00 . A A .  32 VAL C    1 1 
        2  2814 1 1  32 VAL CA   C  -1.565  -4.278  -8.755 1.00 . A A .  32 VAL CA   1 1 
        2  2815 1 1  32 VAL CB   C  -1.757  -2.721  -8.718 1.00 . A A .  32 VAL CB   1 1 
        2  2816 1 1  32 VAL CG1  C  -1.327  -2.058 -10.044 1.00 . A A .  32 VAL CG1  1 1 
        2  2817 1 1  32 VAL CG2  C  -3.226  -2.362  -8.357 1.00 . A A .  32 VAL CG2  1 1 
        2  2818 1 1  32 VAL H    H  -1.633  -4.280  -6.656 1.00 . A A .  32 VAL H    1 1 
        2  2819 1 1  32 VAL HA   H  -2.291  -4.696  -9.454 1.00 . A A .  32 VAL HA   1 1 
        2  2820 1 1  32 VAL HB   H  -1.120  -2.327  -7.932 1.00 . A A .  32 VAL HB   1 1 
        2  2821 1 1  32 VAL HG11 H  -1.445  -0.986  -9.975 1.00 . A A .  32 VAL HG11 1 1 
        2  2822 1 1  32 VAL HG12 H  -1.936  -2.431 -10.856 1.00 . A A .  32 VAL HG12 1 1 
        2  2823 1 1  32 VAL HG13 H  -0.287  -2.285 -10