NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage position program type
654024 6tk0 34460 cing 1-original 1 unknown dihedral angle


# Restraints file 1: pred.tab
REMARK TALOS+ Protein Backbone Torsion Angle Prediction Table
REMARK  Prediction Summary for Chemical Shift Input Cyt.tab
REMARK 
REMARK  PHI is the predicted torsion angle C(i-1) N(i)  CA(i) C(i)   (degrees).
REMARK  PSI is the predicted torsion angle N(i)   CA(i) C(i)  N(i+1) (degrees).
REMARK 
REMARK  DPHI and DPSI are the estimated standard deviations of the
REMARK  prediction errors in PHI and PSI (degrees).
REMARK 
REMARK  DIST is the TALOS+ database matching score.
REMARK 
REMARK  S2 is the Wishart RCI chemical shift order parameter,
REMARK  JACS, 127(43), 14970-14971.
REMARK 
REMARK  COUNT is the number of database triplets used to form
REMARK  the torsion angle predictions.
REMARK 
REMARK  CLASS is the classification of the prediction result:
REMARK    None: no torsion prediction was made.
REMARK 
REMARK    Good: majority consensus in database matches;
REMARK          prediction is likely to be good.
REMARK 
REMARK    Warn: no consensus in database matches, do not use prediction.
REMARK 
REMARK    Dyn:  RCI S2 value indicates that residue has dynamic conformation.
REMARK 
REMARK Reference:
REMARK  Y. Shen, F. Delaglio, G. Cornilescu, and A. Bax:
REMARK  TALOS plus: A hybrid method for predicting protein
REMARK  torsion angles from NMR chemical shifts.
REMARK  J. Biomol. NMR 44, 213-223 (2009).
REMARK 
REMARK  TALOS+ Version 3.80F1 Rev 2012.080.14.41 TALOS_INFO

DATA FIRST_RESID 1
DATA SEQUENCE MDIGINSDPHPPHHHDHHGHGSGWEVPEAEIHRENPIPPDARSLDQGGVLYAEHC
DATA SEQUENCE VRCHGETLRGDGPDAHDLDPPVADLVEHAPHHSDGDLAYRVRIGRGPMPGFGDAL
DATA SEQUENCE DERDIWDLVNFMRDRAQGAALAGTNGHSPDHAAGDHHHGDHHH

VARS   RESID RESNAME PHI PSI DPHI DPSI DIST S2 COUNT CS_COUNT CLASS 
FORMAT %4d %s %8.3f %8.3f %8.3f %8.3f %8.3f %5.3f %2d %2d %s

   3 I 9999.000 9999.000    0.000    0.000    0.000 0.000  0 11 None
   4 G -172.977  165.681   74.042   24.275   34.630 0.824 10 17 Warn
   5 I -124.407  144.107   34.799   28.545   46.865 0.752 10 14 Good
   6 N  -96.901  126.918   31.065   43.153   92.975 0.711  7  9 Warn
   7 S 9999.000 9999.000    0.000    0.000    0.000 0.000  0  3 None
   8 D 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
   9 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  10 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  11 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  12 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  13 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  14 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  15 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  16 D 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  17 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  18 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  19 G 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  20 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  21 G 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  22 S 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  23 G 9999.000 9999.000    0.000    0.000    0.000 0.000  0  6 None
  24 W  -94.273  130.613   56.238   12.660   76.248 0.842 10 12 Warn
  25 E -111.904  119.956   19.893   19.549   44.641 0.841 10 18 Good
  26 V  -93.995  123.792   32.900   17.518   87.323 0.851 10 12 Good
  27 P  -63.780  142.855    9.097   11.998   72.673 0.835 10 11 Good
  28 E  -58.887  -32.239    7.188    9.640   58.718 0.833 10 11 Warn
  29 A  -88.345   -0.010   15.611   16.096   53.603 0.839 10 17 Good
  30 E   53.773   38.040    9.376   11.501   84.827 0.857 10 18 Warn
  31 I  -68.318  -22.259    9.498   14.472   72.249 0.874 10 18 Good
  32 H  -99.507    7.679   16.678    9.152   46.384 0.889 10 18 Good
  33 R  -93.575  124.339   25.755   19.427   53.395 0.896 10 18 Good
  34 E -112.695  124.182   16.785   19.717   41.780 0.895 10 17 Good
  35 N  -81.239  127.292   28.850   17.787  109.616 0.894 10 11 Good
  36 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  5 None
  37 I 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  38 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  39 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  6 None
  40 D -122.275  156.291   59.109   27.599  102.113 0.864  9 12 Warn
  41 A   57.061   33.605   17.403   20.064   97.414 0.862 10 18 Warn
  42 R   60.457   35.097   15.347   13.124   55.261 0.870 10 18 Good
  43 S  -61.690  -37.840    3.433   13.835   42.553 0.864  9 18 Warn
  44 L  -79.438  -11.835   11.034   18.844   27.115 0.858 10 17 Good
  45 D  -82.905  -10.743   22.765   20.656   37.707 0.835 10 17 Good
  46 Q   54.250   41.007    5.323   11.498   53.223 0.816 10 15 Good
  47 G   80.817    3.002   19.376   15.429   63.475 0.823 10 14 Good
  48 G  -92.116  132.538   21.212   20.462   48.979 0.841 10 14 Good
  49 V  -61.189  -20.469    8.180    7.324   31.961 0.854  8 16 Warn
  50 L  -74.538  -15.430   15.808   19.515   27.843 0.839 10 17 Good
  51 Y  -76.053  -32.193   18.090   27.927   33.213 0.824 10 17 Good
  52 A  -67.034  -22.024    7.181   12.693   41.725 0.820 10 17 Good
  53 E  -75.115  -27.983   11.853   16.387   50.212 0.836 10 18 Good
  54 H -102.829  -15.845   16.194   22.621   53.270 0.859 10 18 Good
  55 C -121.337  152.388   17.606   12.418   49.339 0.881 10 18 Good
  56 V -114.086  147.597   53.169   21.550   72.853 0.892 10 18 Warn
  57 R   60.468   31.346   15.080   17.304   51.877 0.905 10 18 Good
  58 C -134.355  164.276   14.392   10.081   52.936 0.917 10 15 Good
  59 H -139.344  154.336    8.090    4.962   54.803 0.915 10 14 Good
  60 G  -85.289  121.846   53.955   58.412   55.688 0.903 10 12 Warn
  61 E  -65.994  -37.331   18.599   14.319   53.993 0.902 10 15 Good
  62 T  -91.625    8.161   11.492   13.215   52.641 0.915 10 16 Warn
  63 L   58.737   30.220    7.295   11.836   57.914 0.928 10 18 Good
  64 R -107.597    5.635   17.341   13.666   60.043 0.907 10 16 Good
  65 G   64.661   32.602   21.755   20.309   49.563 0.839 10 16 Good
  66 D  -98.512    2.177   14.159   21.463   75.936 0.743 10 15 Good
  67 G -135.255   97.314   29.513   45.203   96.449 0.695 10 11 Warn
  68 P  -59.141  -17.449    5.334    8.630   72.867 0.734  7 11 Warn
  69 D  -91.025    0.460   21.540   19.189   64.657 0.855 10 12 Good
  70 A  -74.990  -21.907   21.056   20.375   46.815 0.869 10 17 Good
  71 H  -97.507   12.943    9.163    9.948   41.374 0.892 10 17 Good
  72 D   63.470   33.762   10.960   12.603   44.918 0.910 10 17 Good
  73 L  -95.170  121.158   11.293   30.553   57.453 0.913 10 18 Good
  74 D -102.844  117.791   34.566   29.717  108.839 0.912 10 12 Good
  75 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  6 None
  76 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  77 V 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  78 A 9999.000 9999.000    0.000    0.000    0.000 0.000  0  6 None
  79 D  -86.360  125.677   15.272   46.766   65.296 0.837 10 12 Warn
  80 L  -68.344  -16.888   19.777   21.110   31.202 0.834 10 18 Good
  81 V  -72.704  -36.816    9.490    9.345   28.556 0.839 10 18 Good
  82 E  -81.092  -22.807   14.185   15.140   28.905 0.838 10 18 Good
  83 H  -95.138   -8.624   10.017    9.243   48.925 0.850 10 18 Good
  84 A   55.849   38.605   12.539   15.096  124.260 0.863 10 12 Warn
  85 P  -65.307  -26.653   20.490   14.829  103.296 0.867 10 12 Good
  86 H  -94.696    5.176   10.865   13.728   65.915 0.882  9 12 Warn
  87 H -126.819  127.197   18.532   15.570   46.632 0.884 10 17 Good
  88 S -130.849  151.995   22.699   18.027   49.690 0.866 10 17 Good
  89 D   49.603   41.322    6.709   10.066   55.106 0.845 10 16 Good
  90 G   84.542   -3.553   15.906   13.372   51.555 0.840 10 17 Good
  91 D  -77.033  -15.156   19.394   14.447   42.690 0.872  6 17 Warn
  92 L  -93.805    5.176   12.796   15.301   34.299 0.901 10 18 Good
  93 A   65.069   33.347   14.664    9.842   41.652 0.908 10 18 Good
  94 Y  -74.986  -20.738   19.214   27.571   39.317 0.903 10 18 Good
  95 R  -68.445  -36.165   11.369   11.152   34.352 0.891 10 18 Good
  96 V  -68.849  -19.490    5.871   22.099   37.266 0.892 10 18 Good
  97 R  -89.907   -7.741   21.931   21.200   34.138 0.877  7 18 Warn
  98 I  -97.717    0.800   20.982   21.904   29.620 0.869 10 16 Good
  99 G -136.303  178.682   67.602   23.956   36.908 0.854 10 14 Warn
 100 R -145.246  171.197   55.559   31.669   92.250 0.852  6  8 Warn
 101 G 9999.000 9999.000    0.000    0.000    0.000 0.000  0  4 None
 102 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
 103 M 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
 104 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  4 None
 105 G  -97.771    2.935    7.864    3.027   85.627 0.821  6 10 Warn
 106 F  -98.781  150.564   24.579   32.684   50.518 0.794 10 14 Good
 107 G -156.432  161.471   87.087   33.806   61.566 0.796 10 16 Warn
 108 D  -93.958   -1.237   16.993   26.253   57.623 0.800 10 16 Good
 109 A -104.527    2.667    7.496   22.211   52.234 0.845 10 17 Good
 110 L -125.636  142.105   26.473   21.401   43.492 0.855 10 16 Good
 111 D -100.713  155.826   66.376   44.507   46.975 0.845 10 16 Warn
 112 E  -57.784  -26.387   19.082   21.605   50.192 0.840 10 16 Good
 113 R  -98.854   13.925   10.558    7.027   32.716 0.859 10 17 Good
 114 D   62.092   33.934   11.827   12.007   58.649 0.883 10 17 Good
 115 I   63.422   29.423   12.499   11.399  103.069 0.894 10 18 Warn
 116 W  -94.967    6.805   14.734   13.629   66.353 0.885 10 18 Good
 117 D   54.160   41.200   17.806   11.179   59.005 0.890 10 18 Warn
 118 L  -72.075  -27.538   14.092   27.312   49.728 0.896 10 18 Good
 119 V  -66.533  -36.081   13.357   12.035   46.242 0.908 10 18 Good
 120 N   92.972   16.722   18.467   16.770   55.346 0.904 10 18 Good
 121 F  -68.031  -27.657   14.485   23.775   41.326 0.903 10 18 Good
 122 M  -77.746  -15.924   12.041   21.301   37.171 0.903 10 18 Good
 123 R   60.593   32.620   11.618   10.540   50.510 0.900 10 17 Good
 124 D  -82.172  -21.054   22.128   26.629   55.175 0.893 10 17 Good
 125 R  -96.173    7.635   11.618    7.271   33.854 0.862 10 17 Good
 126 A   58.854   32.106   19.868   22.765   45.249 0.816 10 18 Good
 127 Q  -92.201    1.103   14.351   10.438   44.358 0.773 10 16 Good
 128 G   84.970    7.067    7.945   12.056   45.090 0.759 10 16 Good
 129 A  -80.334  126.322   71.381   48.531   44.724 0.775 10 16 Warn
 130 A  -52.578  138.287   94.327   55.436   29.664 0.804  8 18 Warn
 131 L  -88.590  142.701   61.051   54.813   34.202 0.830 10 18 Warn
 132 A -114.855  148.633   81.014   48.906   36.265 0.847  9 16 Warn
 133 G -141.106  164.795   63.053   24.108   50.216 0.851 10 16 Warn
 134 T -122.928  134.844   35.268   20.666   43.727 0.826 10 16 Warn
 135 N  -76.897  146.825   45.042   37.163   97.211 0.810 10 12 Warn
 136 G 9999.000 9999.000    0.000    0.000    0.000 0.000  0  6 None
 137 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
 138 S 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
 139 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
 140 D 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
 141 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  6 None
 142 A -100.419  135.807   88.407   45.714   57.486 0.845  9 12 Warn
 143 A -116.448  140.134   55.798   29.083   34.153 0.854  9 16 Warn
 144 G -168.532  167.202   53.843   23.595   45.000 0.870 10 16 Warn
 145 D -106.184  134.370   54.356   34.961   42.985 0.857 10 14 Warn
 146 H -101.863  150.710   19.034   31.737   95.196 0.851 10 10 Good
 147 H 9999.000 9999.000    0.000    0.000    0.000 0.000  0  4 None


Please acknowledge these references in publications where the data from this site have been utilized.

Contact the webmaster for help, if required. Saturday, June 29, 2024 11:52:20 PM GMT (wattos1)