![]() |
NMR Restraints Grid |
![]() |
Result table
(Save to zip file containing files for each block)
image | mrblock_id | pdb_id | bmrb_id | cing | stage | program | type |
![]() |
634621 |
6c0a ![]() ![]() |
25902 | cing | 2-parsed | STAR | dipolar coupling |
data_6c0a_MR_file_constraints save_Conversion_project _Study_list.Sf_category study_list _Study_list.Entry_ID parsed_6c0a _Study_list.ID 1 loop_ _Study.ID _Study.Name _Study.Type _Study.Details _Study.Entry_ID _Study.Study_list_ID 1 "Conversion project" NMR . parsed_6c0a 1 stop_ save_ save_entry_information _Entry.Sf_category entry_information _Entry.ID parsed_6c0a _Entry.Title "Original constraint list(s)" _Entry.Version_type original _Entry.Submission_date . _Entry.Accession_date . _Entry.Last_release_date . _Entry.Original_release_date . _Entry.Origination . _Entry.NMR_STAR_version 3.1 _Entry.Original_NMR_STAR_version . _Entry.Experimental_method NMR _Entry.Experimental_method_subtype . loop_ _Related_entries.Database_name _Related_entries.Database_accession_code _Related_entries.Relationship _Related_entries.Entry_ID PDB 6c0a "Master copy" parsed_6c0a stop_ save_ save_global_Org_file_characteristics _Constraint_stat_list.Sf_category constraint_statistics _Constraint_stat_list.Entry_ID parsed_6c0a _Constraint_stat_list.ID 1 loop_ _Constraint_file.ID _Constraint_file.Constraint_filename _Constraint_file.Software_ID _Constraint_file.Software_label _Constraint_file.Software_name _Constraint_file.Block_ID _Constraint_file.Constraint_type _Constraint_file.Constraint_subtype _Constraint_file.Constraint_subsubtype _Constraint_file.Constraint_number _Constraint_file.Entry_ID _Constraint_file.Constraint_stat_list_ID 1 6c0a.mr . . "MR format" 1 comment "Not applicable" "Not applicable" 0 parsed_6c0a 1 1 6c0a.mr . . XPLOR/CNS 2 distance NOE ambi 6 parsed_6c0a 1 1 6c0a.mr . . XPLOR/CNS 3 distance NOE simple 73 parsed_6c0a 1 1 6c0a.mr . . XPLOR/CNS 4 "dipolar coupling" "Not applicable" "Not applicable" 0 parsed_6c0a 1 1 6c0a.mr . . XPLOR/CNS 5 distance "hydrogen bond" simple 0 parsed_6c0a 1 1 6c0a.mr . . "MR format" 6 "nomenclature mapping" "Not applicable" "Not applicable" 0 parsed_6c0a 1 stop_ save_ save_CNS/XPLOR_dipolar_coupling_4 _RDC_constraint_list.Sf_category RDC_constraints _RDC_constraint_list.Entry_ID parsed_6c0a _RDC_constraint_list.ID 1 _RDC_constraint_list.Constraint_file_ID 1 _RDC_constraint_list.Block_ID 4 _RDC_constraint_list.Details "Generated by Wattos" loop_ _RDC_constraint_parse_err.ID _RDC_constraint_parse_err.Content _RDC_constraint_parse_err.Begin_line _RDC_constraint_parse_err.Begin_column _RDC_constraint_parse_err.End_line _RDC_constraint_parse_err.End_column _RDC_constraint_parse_err.Entry_ID _RDC_constraint_parse_err.RDC_constraint_list_ID 1 ; # Restraints file 3: aEF_RDC_Final.txt DATA SEQUENCE DTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL DATA SEQUENCE TVGKFYATFLIQEYFRKFKKRKEQG VARS RESID_I RESNAME_I ATOMNAME_I RESID_J RESNAME_J ATOMNAME_J D DD W FORMAT %5d %6s %6s %5d %6s %6s %9.3f %9.3f %.2f 824 ASP N 824 ASP HN -1.950 1 1 825 THR N 825 THR HN 2.520 1 1 826 ALA N 826 ALA HN -7.470 1 1 827 ASP N 827 ASP HN -7.780 1 1 829 VAL N 829 VAL HN -12.480 1 1 833 PHE N 833 PHE HN -13.280 1 1 834 LYS N 834 LYS HN -15.090 1 1 835 ILE N 835 ILE HN -0.330 1 1 837 ALA N 837 ALA HN -11.150 1 1 839 ASP N 839 ASP HN 14.100 1 1 844 THR N 844 THR HN 6.240 1 1 845 MET N 845 MET HN 14.040 1 1 846 ASP N 846 ASP HN 8.030 1 1 849 ARG N 849 ARG HN 9.660 1 1 851 GLU N 851 GLU HN 17.860 1 1 856 GLN N 856 GLN HN 3.650 1 1 857 ALA N 857 ALA HN 6.820 1 1 858 GLU N 858 GLU HN 9.130 1 1 859 TYR N 859 TYR HN 15.640 1 1 860 CYS N 860 CYS HN 7.060 1 1 862 ALA N 862 ALA HN 12.490 1 1 863 ARG N 863 ARG HN 7.220 1 1 865 ALA N 865 ALA HN 1.700 1 1 867 TYR N 867 TYR HN -1.020 1 1 868 THR N 868 THR HN 7.700 1 1 871 ASP N 871 ASP HN -8.430 1 1 872 SER N 872 SER HN 8.760 1 1 873 VAL N 873 VAL HN -10.780 1 1 875 GLY N 875 GLY HN 8.920 1 1 879 TYR N 879 TYR HN -14.510 1 1 880 MET N 880 MET HN -4.770 1 1 881 SER N 881 SER HN -11.100 1 1 888 GLY N 888 GLY HN -1.050 1 1 890 SER N 890 SER HN 0.730 1 1 1654 ILE N 1654 ILE HN -14.680 1 1 1658 PHE N 1658 PHE HN -19.690 1 1 ; 1 1 43 65 parsed_6c0a 1 stop_ save_
Contact the webmaster for help, if required. Wednesday, June 26, 2024 12:43:16 PM GMT (wattos1)