NMR Restraints Grid |
Result table
image | mrblock_id | pdb_id | bmrb_id | cing | in_recoord | in_dress | stage | program | type |
30566 | 1cwx | 4669 | cing | recoord | dress | 2-parsed | STAR | comment |
data_1cwx_MR_file_constraints save_Conversion_project _Study_list.Sf_category study_list _Study_list.Entry_ID parsed_1cwx _Study_list.ID 1 loop_ _Study.ID _Study.Name _Study.Type _Study.Details _Study.Entry_ID _Study.Study_list_ID 1 "Conversion project" NMR . parsed_1cwx 1 stop_ save_ save_entry_information _Entry.Sf_category entry_information _Entry.ID parsed_1cwx _Entry.Title "Original constraint list(s)" _Entry.Version_type original _Entry.Submission_date . _Entry.Accession_date . _Entry.Last_release_date . _Entry.Original_release_date . _Entry.Origination . _Entry.NMR_STAR_version 3.1 _Entry.Original_NMR_STAR_version . _Entry.Experimental_method NMR _Entry.Experimental_method_subtype . loop_ _Related_entries.Database_name _Related_entries.Database_accession_code _Related_entries.Relationship _Related_entries.Entry_ID PDB 1cwx "Master copy" parsed_1cwx stop_ save_ save_global_Org_file_characteristics _Constraint_stat_list.Sf_category constraint_statistics _Constraint_stat_list.Entry_ID parsed_1cwx _Constraint_stat_list.ID 1 loop_ _Constraint_file.ID _Constraint_file.Constraint_filename _Constraint_file.Software_ID _Constraint_file.Software_label _Constraint_file.Software_name _Constraint_file.Block_ID _Constraint_file.Constraint_type _Constraint_file.Constraint_subtype _Constraint_file.Constraint_subsubtype _Constraint_file.Constraint_number _Constraint_file.Entry_ID _Constraint_file.Constraint_stat_list_ID 1 1cwx.mr . . "MR format" 1 comment "Not applicable" "Not applicable" 0 parsed_1cwx 1 1 1cwx.mr . . XPLOR/CNS 2 distance NOE simple 0 parsed_1cwx 1 1 1cwx.mr . . "MR format" 3 "nomenclature mapping" "Not applicable" "Not applicable" 0 parsed_1cwx 1 stop_ save_ save_MR_file_comment_1 _Org_constr_file_comment.Sf_category org_constr_file_comment _Org_constr_file_comment.Entry_ID parsed_1cwx _Org_constr_file_comment.ID 1 _Org_constr_file_comment.Constraint_file_ID 1 _Org_constr_file_comment.Block_ID 1 _Org_constr_file_comment.Details "Generated by Wattos" _Org_constr_file_comment.Comment ; *HEADER VIRUS/VIRAL PROTEIN 27-AUG-99 1CWX *TITLE SOLUTION STRUCTURE OF THE HEPATITIS C VIRUS N-TERMINAL *TITLE 2 CAPSID PROTEIN 2-45 [C- HCV(2-45)] *COMPND MOL_ID: 1; *COMPND 2 MOLECULE: HEPATITIS C VIRUS CAPSID PROTEIN; *COMPND 3 CHAIN: A; *COMPND 4 FRAGMENT: N-TERMINAL FRAGMENT; *COMPND 5 ENGINEERED: YES *SOURCE MOL_ID: 1; *SOURCE 2 SYNTHETIC: YES; *SOURCE 3 OTHER_DETAILS: THE PROTEIN WAS CHEMICALLY SYNTHESIZED. *SOURCE 4 THIS SEQUENCE OCCURS NATURALLY IN HEPATITIS C VIRUS *SOURCE 5 (GENOTYPE 1A ISOLATE H77).. *KEYWDS HELIX-LOOP-HELIX *EXPDTA NMR, 4 STRUCTURES *AUTHOR L.LADAVIERE, G.DELEAGE, R.MONTSERRET, P.DALBON, M.JOLIVET, *AUTHOR 2 F.PENIN *REVDAT 1 30-AUG-99 1CWX 0 ! This file contains the NMR constraints for Hepatitis C Virus N-terminal ! capsid protein 2-45: STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLG ! This file has been obtained from NOESY spectra recorded in 40% TFE ! 10 mM phosphate, NaCl 0.1M pH 5.9 293 K ! ! File directly usable with X-PLOR 3-1 ! ! For any request please contact f.penin@ibcp.fr ! ; save_
Contact the webmaster for help, if required. Thursday, May 23, 2024 5:25:56 PM GMT (wattos1)