BMRB

NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage position program type
610168 2ndp RC 26068 cing 1-original 1 unknown unknown


REMARK TALOS+ Protein Backbone Torsion Angle Prediction Table
REMARK  Prediction Summary for Chemical Shift Input MGal.tab
REMARK 
REMARK  PHI is the predicted torsion angle C(i-1) N(i)  CA(i) C(i)   (degrees).
REMARK  PSI is the predicted torsion angle N(i)   CA(i) C(i)  N(i+1) (degrees).
REMARK 
REMARK  DPHI and DPSI are the estimated standard deviations of the
REMARK  prediction errors in PHI and PSI (degrees).
REMARK 
REMARK  DIST is the TALOS+ database matching score.
REMARK 
REMARK  S2 is the Wishart RCI chemical shift order parameter,
REMARK  JACS, 127(43), 14970-14971.
REMARK 
REMARK  COUNT is the number of database triplets used to form
REMARK  the torsion angle predictions.
REMARK 
REMARK  CLASS is the classification of the prediction result:
REMARK    None: no torsion prediction was made.
REMARK 
REMARK    Good: majority consensus in database matches;
REMARK          prediction is likely to be good.
REMARK 
REMARK    Warn: no consensus in database matches, do not use prediction.
REMARK 
REMARK    Dyn:  RCI S2 value indicates that residue has dynamic conformation.
REMARK 
REMARK Reference:
REMARK  Y. Shen, F. Delaglio, G. Cornilescu, and A. Bax:
REMARK  TALOS plus: A hybrid method for predicting protein
REMARK  torsion angles from NMR chemical shifts.
REMARK  J. Biomol. NMR 44, 213-223 (2009).
REMARK 
REMARK  TALOS+ Version 3.80F1 Rev 2012.080.14.41 TALOS_INFO

DATA FIRST_RESID 1
DATA SEQUENCE GAMAKIKSLSAAEYLKEMADETNIKVQDIRLVVTSLQKVLAKELATTGEVRLFDI
DATA SEQUENCE GKFKLVTTKPRTGINPKTKQKIQIPAGKKIKLTVSKILTDAVDSHK

VARS   RESID RESNAME PHI PSI DPHI DPSI DIST S2 COUNT CS_COUNT CLASS 
FORMAT %4d %s %8.3f %8.3f %8.3f %8.3f %8.3f %5.3f %2d %2d %s

   3 M 9999.000 9999.000    0.000    0.000    0.000 0.000  0  5 None
   4 A  -85.773  145.474   78.522   35.946   57.439 0.766 10  9 Warn
   5 K -105.848  140.381   56.980   36.767   31.111 0.818 10 13 Warn
   6 I -112.256  129.266   18.720   13.859   34.511 0.833 10 13 Good
   7 K -109.251  137.778   29.050   14.125   30.370 0.834 10 13 Good
   8 S -109.094  136.061   27.266   25.927   27.333 0.813 10 13 Good
   9 L  -85.104  126.141   12.209   11.851   24.677 0.802 10 15 Good
  10 S  -86.802  149.310   22.112   33.746   27.918 0.816 10 16 Good
  11 A  -59.449  -33.704    7.156   16.319   29.499 0.839 10 16 Good
  12 A  -62.114  -43.173    6.693    2.521   15.285 0.866 10 16 Good
  13 E  -65.753  -38.683    3.840    6.926   16.081 0.865 10 16 Good
  14 Y  -65.339  -41.482    5.928    9.347   17.668 0.865 10 17 Good
  15 L  -68.694  -34.445   11.097   13.127   14.301 0.865 10 17 Good
  16 K  -62.429  -40.348    3.563    4.097    9.477 0.872 10 18 Good
  17 E  -65.322  -41.505    7.675    7.646   11.978 0.882 10 18 Good
  18 M  -66.499  -36.695    5.125    5.350   15.789 0.882 10 18 Good
  19 A  -66.360  -40.297    6.421    4.642   16.338 0.873 10 18 Good
  20 D  -64.492  -39.225    6.737    9.525   13.065 0.858 10 18 Good
  21 E  -74.364  -34.741   10.426   19.186   16.501 0.843 10 18 Good
  22 T  -98.516   -7.739   12.325   12.481   24.279 0.837 10 18 Good
  23 N   77.320   19.865   22.062   16.581   32.414 0.836 10 18 Good
  24 I  -93.108  128.205   77.020   39.836   28.976 0.844 10 18 Warn
  25 K  -82.980  145.740   30.765   27.087   21.557 0.855 10 17 Good
  26 V  -58.135  -37.837    5.521   10.546   21.183 0.873 10 16 Good
  27 Q  -61.689  -40.334    3.661    4.521   14.641 0.885 10 16 Good
  28 D  -66.165  -39.592    3.552    5.432   14.116 0.892 10 16 Good
  29 I  -61.372  -46.385    4.857    5.622   14.046 0.896 10 16 Good
  30 R  -60.027  -42.415    3.135    4.088   11.682 0.897 10 16 Good
  31 L  -64.100  -40.554    6.528    8.697   11.458 0.901 10 17 Good
  32 V  -63.312  -46.080    4.673    5.156   10.447 0.906 10 18 Good
  33 V  -62.416  -38.374    3.510    4.861   14.294 0.906 10 17 Good
  34 T  -65.706  -39.241    9.209    6.347   14.362 0.899 10 17 Good
  35 S  -63.809  -42.371    4.374    4.256   12.383 0.883 10 16 Good
  36 L  -64.525  -40.065    5.600    8.893    9.823 0.881 10 17 Good
  37 Q  -64.399  -39.050    5.802    5.417   11.588 0.877 10 17 Good
  38 K  -66.307  -40.179    5.825    5.745   18.478 0.879 10 17 Good
  39 V  -63.472  -39.973    3.596    6.594   19.516 0.873 10 16 Good
  40 L  -65.095  -39.747    4.867    8.034   20.336 0.883 10 16 Good
  41 A  -64.538  -38.053    7.050   13.281   19.100 0.893 10 17 Good
  42 K  -66.272  -39.861    6.179    5.022   20.589 0.906 10 18 Good
  43 E  -65.490  -39.742    6.040    5.546   15.406 0.899 10 18 Good
  44 L  -69.330  -29.347    7.543   12.454   12.335 0.875 10 18 Good
  45 A  -71.711  -23.883   12.096   10.810   15.986 0.835 10 18 Good
  46 T -107.733    5.465   14.145   20.457   16.838 0.808 10 18 Good
  47 T  -82.668  -22.290   32.514   22.920   28.436 0.821  7 17 Warn
  48 G -161.975  164.914   39.036   14.093   32.846 0.858  5 17 Warn
  49 E -135.612  158.840   23.449   14.227   31.364 0.902 10 17 Good
  50 V -121.783  121.762   13.190    5.023   34.087 0.917 10 18 Good
  51 R -101.244  118.779   12.684   13.691   38.113 0.920 10 18 Good
  52 L -114.921  124.122   18.517   25.981   36.836 0.911 10 18 Good
  53 F  -82.454  138.266   29.165   15.345   48.421 0.880 10 18 Good
  54 D  -95.380  174.796   69.286   44.000   43.188 0.860 10 18 Warn
  55 I  -79.643  124.773   15.917   13.146   33.456 0.862 10 17 Good
  56 G -127.721  144.461   42.807   35.427   31.423 0.890 10 17 Warn
  57 K -120.733  129.217   13.758   15.681   29.791 0.911 10 17 Good
  58 F -114.287  132.830    8.609   10.588   19.750 0.918 10 18 Good
  59 K -126.455  135.323   11.099   17.001   15.958 0.918 10 18 Good
  60 L -106.657  122.261   16.132   10.494   16.341 0.908 10 18 Good
  61 V -118.554  132.179   11.205   10.062   24.507 0.898 10 17 Good
  62 T -104.255  124.365   20.064   15.657   36.184 0.867 10 15 Good
  63 T -123.906  143.760   20.445   15.493   54.313 0.818 10 13 Good
  64 K -112.645  124.260   31.436   32.231   88.128 0.743 10  9 Good
  65 P  -71.225  155.876   11.365   13.264   72.100 0.751 10  9 Warn
  66 R -107.856  120.410   28.134   13.999   79.267 0.794 10  9 Good
  67 T -111.988  130.761   10.452   12.966   48.686 0.886 10 12 Good
  68 G -127.866  151.142   21.787   20.000   40.774 0.890 10 12 Good
  69 I -120.356  137.527   20.193    9.597   46.115 0.852 10 11 Good
  70 N -101.523  120.001   13.555   18.086  108.306 0.828 10  7 Good
  71 P 9999.000 9999.000    0.000    0.000    0.000 0.000  0  3 None
  72 K 9999.000 9999.000    0.000    0.000    0.000 0.000  0  0 None
  73 T 9999.000 9999.000    0.000    0.000    0.000 0.000  0  1 None
  74 K 9999.000 9999.000    0.000    0.000    0.000 0.000  0  5 None
  75 Q -119.270  142.581  102.549   44.893   63.264 0.829 10  9 Warn
  76 K -115.016  148.782   59.449   33.511   31.957 0.865 10 13 Warn
  77 I -129.962  143.949    9.992   16.295   34.146 0.874 10 13 Good
  78 Q -134.547  157.135   42.348   23.660   39.953 0.868 10 12 Warn
  79 I -112.387  108.758   32.571   41.381   85.657 0.849 10  8 Warn
  80 P  -69.344  148.288    5.965    8.875   77.062 0.822 10 10 Good
  81 A -102.227  128.003   16.193   18.596   48.343 0.828  8 11 Warn
  82 G -147.588  161.665   62.674   22.588   28.662 0.853 10 14 Warn
  83 K -121.678  142.829   15.771    8.377   31.359 0.890 10 14 Good
  84 K -120.932  133.342   22.815   17.341   24.494 0.901 10 16 Good
  85 I -109.936  123.878   10.586    7.932   19.434 0.900 10 18 Good
  86 K -103.313  128.088   14.370   11.522   17.529 0.897 10 18 Good
  87 L -114.831  124.893   18.018    6.995   22.325 0.899 10 18 Good
  88 T  -94.047  129.604   14.680   25.524   37.416 0.904 10 16 Good
  89 V -128.609  163.207   18.562    8.503   52.359 0.908 10 13 Good
  90 S  -99.366  141.696   14.080   33.196   89.653 0.898 10  8 Good
  91 K  -56.260  -43.409    5.572   11.120   67.427 0.879 10 10 Good
  92 I  -65.329  -31.706    9.212   13.119   41.974 0.872 10 12 Good
  93 L  -68.904  -38.439    6.716    4.950   16.814 0.876 10 17 Good
  94 T  -62.968  -41.005    3.380    5.900   16.717 0.891 10 17 Good
  95 D  -65.176  -39.785    7.090    6.599   10.161 0.887 10 18 Good
  96 A  -70.179  -35.215    6.483    5.462    9.070 0.879 10 18 Good
  97 V  -65.481  -38.712    8.996    9.919   10.933 0.857 10 18 Good
  98 D  -68.122  -22.273    7.286   17.139   16.748 0.845 10 17 Good
  99 S  -97.367    1.940    6.604   15.372   21.480 0.819 10 17 Good
 100 H  -90.916  117.599   36.869   31.122   29.590 0.789 10 16 Warn
 101 K 9999.000 9999.000    0.000    0.000    0.000 0.000  0 11 None