NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
579181 2moz 19115 cing 4-filtered-FRED STAR entry full 305


data_FRED_restraints_with_modified_coordinates_PDB_code_2moz

# This FRED archive file contains, for PDB entry <2moz>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2moz
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2moz
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        8667.38

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $MerF A . 1 1 
    stop_

save_


save_MerF
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         MerF
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK
    _Entity.Number_of_monomers           81

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 MET . 1 1 
        2 LYS . 1 1 
        3 ASP . 1 1 
        4 PRO . 1 1 
        5 LYS . 1 1 
        6 THR . 1 1 
        7 LEU . 1 1 
        8 LEU . 1 1 
        9 ARG . 1 1 
       10 VAL . 1 1 
       11 SER . 1 1 
       12 ILE . 1 1 
       13 ILE . 1 1 
       14 GLY . 1 1 
       15 THR . 1 1 
       16 THR . 1 1 
       17 LEU . 1 1 
       18 VAL . 1 1 
       19 ALA . 1 1 
       20 LEU . 1 1 
       21 SER . 1 1 
       22 SER . 1 1 
       23 PHE . 1 1 
       24 THR . 1 1 
       25 PRO . 1 1 
       26 VAL . 1 1 
       27 LEU . 1 1 
       28 VAL . 1 1 
       29 ILE . 1 1 
       30 LEU . 1 1 
       31 LEU . 1 1 
       32 GLY . 1 1 
       33 VAL . 1 1 
       34 VAL . 1 1 
       35 GLY . 1 1 
       36 LEU . 1 1 
       37 SER . 1 1 
       38 ALA . 1 1 
       39 LEU . 1 1 
       40 THR . 1 1 
       41 GLY . 1 1 
       42 TYR . 1 1 
       43 LEU . 1 1 
       44 ASP . 1 1 
       45 TYR . 1 1 
       46 VAL . 1 1 
       47 LEU . 1 1 
       48 LEU . 1 1 
       49 PRO . 1 1 
       50 ALA . 1 1 
       51 LEU . 1 1 
       52 ALA . 1 1 
       53 ILE . 1 1 
       54 PHE . 1 1 
       55 ILE . 1 1 
       56 GLY . 1 1 
       57 LEU . 1 1 
       58 THR . 1 1 
       59 ILE . 1 1 
       60 TYR . 1 1 
       61 ALA . 1 1 
       62 ILE . 1 1 
       63 GLN . 1 1 
       64 ARG . 1 1 
       65 LYS . 1 1 
       66 ARG . 1 1 
       67 GLN . 1 1 
       68 ALA . 1 1 
       69 ASP . 1 1 
       70 ALA . 1 1 
       71 SER . 1 1 
       72 SER . 1 1 
       73 THR . 1 1 
       74 PRO . 1 1 
       75 LYS . 1 1 
       76 PHE . 1 1 
       77 ASN . 1 1 
       78 GLY . 1 1 
       79 VAL . 1 1 
       80 LYS . 1 1 
       81 LYS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET  1  1 1 1 
       LYS  2  2 1 1 
       ASP  3  3 1 1 
       PRO  4  4 1 1 
       LYS  5  5 1 1 
       THR  6  6 1 1 
       LEU  7  7 1 1 
       LEU  8  8 1 1 
       ARG  9  9 1 1 
       VAL 10 10 1 1 
       SER 11 11 1 1 
       ILE 12 12 1 1 
       ILE 13 13 1 1 
       GLY 14 14 1 1 
       THR 15 15 1 1 
       THR 16 16 1 1 
       LEU 17 17 1 1 
       VAL 18 18 1 1 
       ALA 19 19 1 1 
       LEU 20 20 1 1 
       SER 21 21 1 1 
       SER 22 22 1 1 
       PHE 23 23 1 1 
       THR 24 24 1 1 
       PRO 25 25 1 1 
       VAL 26 26 1 1 
       LEU 27 27 1 1 
       VAL 28 28 1 1 
       ILE 29 29 1 1 
       LEU 30 30 1 1 
       LEU 31 31 1 1 
       GLY 32 32 1 1 
       VAL 33 33 1 1 
       VAL 34 34 1 1 
       GLY 35 35 1 1 
       LEU 36 36 1 1 
       SER 37 37 1 1 
       ALA 38 38 1 1 
       LEU 39 39 1 1 
       THR 40 40 1 1 
       GLY 41 41 1 1 
       TYR 42 42 1 1 
       LEU 43 43 1 1 
       ASP 44 44 1 1 
       TYR 45 45 1 1 
       VAL 46 46 1 1 
       LEU 47 47 1 1 
       LEU 48 48 1 1 
       PRO 49 49 1 1 
       ALA 50 50 1 1 
       LEU 51 51 1 1 
       ALA 52 52 1 1 
       ILE 53 53 1 1 
       PHE 54 54 1 1 
       ILE 55 55 1 1 
       GLY 56 56 1 1 
       LEU 57 57 1 1 
       THR 58 58 1 1 
       ILE 59 59 1 1 
       TYR 60 60 1 1 
       ALA 61 61 1 1 
       ILE 62 62 1 1 
       GLN 63 63 1 1 
       ARG 64 64 1 1 
       LYS 65 65 1 1 
       ARG 66 66 1 1 
       GLN 67 67 1 1 
       ALA 68 68 1 1 
       ASP 69 69 1 1 
       ALA 70 70 1 1 
       SER 71 71 1 1 
       SER 72 72 1 1 
       THR 73 73 1 1 
       PRO 74 74 1 1 
       LYS 75 75 1 1 
       PHE 76 76 1 1 
       ASN 77 77 1 1 
       GLY 78 78 1 1 
       VAL 79 79 1 1 
       LYS 80 80 1 1 
       LYS 81 81 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 1 
        2 1 . . . 1 1 
        3 1 . . . 1 1 
        4 1 . . . 1 1 
        5 1 . . . 1 1 
        6 1 . . . 1 1 
        7 1 . . . 1 1 
        8 1 . . . 1 1 
        9 1 . . . 1 1 
       10 1 . . . 1 1 
       11 1 . . . 1 1 
       12 1 . . . 1 1 
       13 1 . . . 1 1 
       14 1 . . . 1 1 
       15 1 . . . 1 1 
       16 1 . . . 1 1 
       17 1 . . . 1 1 
       18 1 . . . 1 1 
       19 1 . . . 1 1 
       20 1 . . . 1 1 
       21 1 . . . 1 1 
       22 1 . . . 1 1 
       23 1 . . . 1 1 
       24 1 . . . 1 1 
       25 1 . . . 1 1 
       26 1 . . . 1 1 
       27 1 . . . 1 1 
       28 1 . . . 1 1 
       29 1 . . . 1 1 
       30 1 . . . 1 1 
       31 1 . . . 1 1 
       32 1 . . . 1 1 
       33 1 . . . 1 1 
       34 1 . . . 1 1 
       35 1 . . . 1 1 
       36 1 . . . 1 1 
       37 1 . . . 1 1 
       38 1 . . . 1 1 
       39 1 . . . 1 1 
       40 1 . . . 1 1 
       41 1 . . . 1 1 
       42 1 . . . 1 1 
       43 1 . . . 1 1 
       44 1 . . . 1 1 
       45 1 . . . 1 1 
       46 1 . . . 1 1 
       47 1 . . . 1 1 
       48 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1  9 ARG CA  .  9 . CA  1 1 
        1 1 2 1 1 10 VAL CA  . 10 . CA  1 1 
        2 1 1 1 1 11 SER CA  . 11 . CA  1 1 
        2 1 2 1 1 12 ILE CA  . 12 . CA  1 1 
        3 1 1 1 1 11 SER CB  . 11 . CB  1 1 
        3 1 2 1 1 12 ILE CD1 . 12 . CD1 1 1 
        4 1 1 1 1 11 SER CB  . 11 . CB  1 1 
        4 1 2 1 1 12 ILE CG2 . 12 . CG2 1 1 
        5 1 1 1 1 13 ILE CD1 . 13 . CD1 1 1 
        5 1 2 1 1 14 GLY CA  . 14 . CA  1 1 
        6 1 1 1 1 13 ILE CG2 . 13 . CG2 1 1 
        6 1 2 1 1 14 GLY CA  . 14 . CA  1 1 
        7 1 1 1 1 14 GLY CA  . 14 . CA  1 1 
        7 1 2 1 1 15 THR CB  . 15 . CB  1 1 
        8 1 1 1 1 14 GLY CA  . 14 . CA  1 1 
        8 1 2 1 1 15 THR CG2 . 15 . CG2 1 1 
        9 1 1 1 1 18 VAL CA  . 18 . CA  1 1 
        9 1 2 1 1 19 ALA CA  . 19 . CA  1 1 
       10 1 1 1 1 18 VAL CB  . 18 . CB  1 1 
       10 1 2 1 1 19 ALA CB  . 19 . CB  1 1 
       11 1 1 1 1 18 VAL CG2 . 18 . CG2 1 1 
       11 1 2 1 1 19 ALA CB  . 19 . CB  1 1 
       12 1 1 1 1 23 PHE CZ  . 23 . CZ  1 1 
       12 1 2 1 1 63 GLN CG  . 63 . CG  1 1 
       13 1 1 1 1 25 PRO CD  . 25 . CD  1 1 
       13 1 2 1 1 26 VAL CB  . 26 . CB  1 1 
       14 1 1 1 1 28 VAL CA  . 28 . CA  1 1 
       14 1 2 1 1 29 ILE CB  . 29 . CB  1 1 
       15 1 1 1 1 28 VAL CA  . 28 . CA  1 1 
       15 1 2 1 1 29 ILE CD1 . 29 . CD1 1 1 
       16 1 1 1 1 29 ILE CA  . 29 . CA  1 1 
       16 1 2 1 1 30 LEU CA  . 30 . CA  1 1 
       17 1 1 1 1 29 ILE CG2 . 29 . CG2 1 1 
       17 1 2 1 1 30 LEU CA  . 30 . CA  1 1 
       18 1 1 1 1 31 LEU CB  . 31 . CB  1 1 
       18 1 2 1 1 32 GLY CA  . 32 . CA  1 1 
       19 1 1 1 1 32 GLY CA  . 32 . CA  1 1 
       19 1 2 1 1 33 VAL CB  . 33 . CB  1 1 
       20 1 1 1 1 34 VAL CB  . 34 . CB  1 1 
       20 1 2 1 1 35 GLY CA  . 35 . CA  1 1 
       21 1 1 1 1 35 GLY CA  . 35 . CA  1 1 
       21 1 2 1 1 36 LEU CB  . 36 . CB  1 1 
       22 1 1 1 1 35 GLY CA  . 35 . CA  1 1 
       22 1 2 1 1 36 LEU CG  . 36 . CG  1 1 
       23 1 1 1 1 36 LEU CB  . 36 . CB  1 1 
       23 1 2 1 1 37 SER CA  . 37 . CA  1 1 
       24 1 1 1 1 36 LEU CG  . 36 . CG  1 1 
       24 1 2 1 1 37 SER CA  . 37 . CA  1 1 
       25 1 1 1 1 37 SER CA  . 37 . CA  1 1 
       25 1 2 1 1 38 ALA CA  . 38 . CA  1 1 
       26 1 1 1 1 37 SER CA  . 37 . CA  1 1 
       26 1 2 1 1 38 ALA CB  . 38 . CB  1 1 
       27 1 1 1 1 39 LEU CA  . 39 . CA  1 1 
       27 1 2 1 1 40 THR CA  . 40 . CA  1 1 
       28 1 1 1 1 40 THR CB  . 40 . CB  1 1 
       28 1 2 1 1 41 GLY CA  . 41 . CA  1 1 
       29 1 1 1 1 48 LEU CA  . 48 . CA  1 1 
       29 1 2 1 1 49 PRO CD  . 49 . CD  1 1 
       30 1 1 1 1 48 LEU CG  . 48 . CG  1 1 
       30 1 2 1 1 49 PRO CD  . 49 . CD  1 1 
       31 1 1 1 1 49 PRO CD  . 49 . CD  1 1 
       31 1 2 1 1 50 ALA CA  . 50 . CA  1 1 
       32 1 1 1 1 49 PRO CD  . 49 . CD  1 1 
       32 1 2 1 1 50 ALA CB  . 50 . CB  1 1 
       33 1 1 1 1 52 ALA CA  . 52 . CA  1 1 
       33 1 2 1 1 53 ILE CA  . 53 . CA  1 1 
       34 1 1 1 1 52 ALA CA  . 52 . CA  1 1 
       34 1 2 1 1 53 ILE CB  . 53 . CB  1 1 
       35 1 1 1 1 54 PHE CA  . 54 . CA  1 1 
       35 1 2 1 1 55 ILE CA  . 55 . CA  1 1 
       36 1 1 1 1 55 ILE CA  . 55 . CA  1 1 
       36 1 2 1 1 56 GLY CA  . 56 . CA  1 1 
       37 1 1 1 1 55 ILE CB  . 55 . CB  1 1 
       37 1 2 1 1 56 GLY CA  . 56 . CA  1 1 
       38 1 1 1 1 55 ILE CG1 . 55 . CG1 1 1 
       38 1 2 1 1 56 GLY CA  . 56 . CA  1 1 
       39 1 1 1 1 55 ILE CG2 . 55 . CG2 1 1 
       39 1 2 1 1 56 GLY CA  . 56 . CA  1 1 
       40 1 1 1 1 56 GLY CA  . 56 . CA  1 1 
       40 1 2 1 1 57 LEU CB  . 57 . CB  1 1 
       41 1 1 1 1 56 GLY CA  . 56 . CA  1 1 
       41 1 2 1 1 57 LEU CG  . 57 . CG  1 1 
       42 1 1 1 1 58 THR CA  . 58 . CA  1 1 
       42 1 2 1 1 59 ILE CB  . 59 . CB  1 1 
       43 1 1 1 1 58 THR CA  . 58 . CA  1 1 
       43 1 2 1 1 59 ILE CG2 . 59 . CG2 1 1 
       44 1 1 1 1 60 TYR CA  . 60 . CA  1 1 
       44 1 2 1 1 61 ALA CB  . 61 . CB  1 1 
       45 1 1 1 1 61 ALA CA  . 61 . CA  1 1 
       45 1 2 1 1 62 ILE CA  . 62 . CA  1 1 
       46 1 1 1 1 61 ALA CA  . 61 . CA  1 1 
       46 1 2 1 1 62 ILE CB  . 62 . CB  1 1 
       47 1 1 1 1 61 ALA CA  . 61 . CA  1 1 
       47 1 2 1 1 62 ILE CG2 . 62 . CG2 1 1 
       48 1 1 1 1 62 ILE CB  . 62 . CB  1 1 
       48 1 2 1 1 63 GLN CA  . 63 . CA  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . 5.0 2.0 8.0 1 1 
        2 1 . . . . . 5.0 2.0 8.0 1 1 
        3 1 . . . . . 5.0 2.0 8.0 1 1 
        4 1 . . . . . 5.0 2.0 8.0 1 1 
        5 1 . . . . . 5.0 2.0 8.0 1 1 
        6 1 . . . . . 5.0 2.0 8.0 1 1 
        7 1 . . . . . 5.0 2.0 8.0 1 1 
        8 1 . . . . . 5.0 2.0 8.0 1 1 
        9 1 . . . . . 5.0 2.0 8.0 1 1 
       10 1 . . . . . 5.0 2.0 8.0 1 1 
       11 1 . . . . . 5.0 2.0 8.0 1 1 
       12 1 . . . . . 5.0 2.0 8.0 1 1 
       13 1 . . . . . 5.0 2.0 8.0 1 1 
       14 1 . . . . . 5.0 2.0 8.0 1 1 
       15 1 . . . . . 5.0 2.0 8.0 1 1 
       16 1 . . . . . 5.0 2.0 8.0 1 1 
       17 1 . . . . . 5.0 2.0 8.0 1 1 
       18 1 . . . . . 5.0 2.0 8.0 1 1 
       19 1 . . . . . 5.0 2.0 8.0 1 1 
       20 1 . . . . . 5.0 2.0 8.0 1 1 
       21 1 . . . . . 5.0 2.0 8.0 1 1 
       22 1 . . . . . 5.0 2.0 8.0 1 1 
       23 1 . . . . . 5.0 2.0 8.0 1 1 
       24 1 . . . . . 5.0 2.0 8.0 1 1 
       25 1 . . . . . 5.0 2.0 8.0 1 1 
       26 1 . . . . . 5.0 2.0 8.0 1 1 
       27 1 . . . . . 5.0 2.0 8.0 1 1 
       28 1 . . . . . 5.0 2.0 8.0 1 1 
       29 1 . . . . . 5.0 2.0 8.0 1 1 
       30 1 . . . . . 5.0 2.0 8.0 1 1 
       31 1 . . . . . 5.0 2.0 8.0 1 1 
       32 1 . . . . . 5.0 2.0 8.0 1 1 
       33 1 . . . . . 5.0 2.0 8.0 1 1 
       34 1 . . . . . 5.0 2.0 8.0 1 1 
       35 1 . . . . . 5.0 2.0 8.0 1 1 
       36 1 . . . . . 5.0 2.0 8.0 1 1 
       37 1 . . . . . 5.0 2.0 8.0 1 1 
       38 1 . . . . . 5.0 2.0 8.0 1 1 
       39 1 . . . . . 5.0 2.0 8.0 1 1 
       40 1 . . . . . 5.0 2.0 8.0 1 1 
       41 1 . . . . . 5.0 2.0 8.0 1 1 
       42 1 . . . . . 5.0 2.0 8.0 1 1 
       43 1 . . . . . 5.0 2.0 8.0 1 1 
       44 1 . . . . . 5.0 2.0 8.0 1 1 
       45 1 . . . . . 5.0 2.0 8.0 1 1 
       46 1 . . . . . 5.0 2.0 8.0 1 1 
       47 1 . . . . . 5.0 2.0 8.0 1 1 
       48 1 . . . . . 5.0 2.0 8.0 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1  3 ASP C 1 1  4 PRO N  1 1  4 PRO CA 1 1  4 PRO C    -75.5813 -35.581295 .  3 . C .  4 . N  .  4 . CA .  4 . C 1 1 
         2 . 1 1  4 PRO N 1 1  4 PRO CA 1 1  4 PRO C  1 1  5 LYS N    -56.9529 123.047104 .  4 . N .  4 . CA .  4 . C  .  5 . N 1 1 
         3 . 1 1  4 PRO C 1 1  5 LYS N  1 1  5 LYS CA 1 1  5 LYS C    -74.3114   -54.3114 .  4 . C .  5 . N  .  5 . CA .  5 . C 1 1 
         4 . 1 1  5 LYS N 1 1  5 LYS CA 1 1  5 LYS C  1 1  6 THR N    -51.8871   -31.8871 .  5 . N .  5 . CA .  5 . C  .  6 . N 1 1 
         5 . 1 1  5 LYS C 1 1  6 THR N  1 1  6 THR CA 1 1  6 THR C    -75.2196   -55.2196 .  5 . C .  6 . N  .  6 . CA .  6 . C 1 1 
         6 . 1 1  6 THR N 1 1  6 THR CA 1 1  6 THR C  1 1  7 LEU N    -53.9069   -33.9069 .  6 . N .  6 . CA .  6 . C  .  7 . N 1 1 
         7 . 1 1  6 THR C 1 1  7 LEU N  1 1  7 LEU CA 1 1  7 LEU C    -73.0712   -53.0712 .  6 . C .  7 . N  .  7 . CA .  7 . C 1 1 
         8 . 1 1  7 LEU N 1 1  7 LEU CA 1 1  7 LEU C  1 1  8 LEU N    -50.0756 -30.075602 .  7 . N .  7 . CA .  7 . C  .  8 . N 1 1 
         9 . 1 1  7 LEU C 1 1  8 LEU N  1 1  8 LEU CA 1 1  8 LEU C    -72.1729   -52.1729 .  7 . C .  8 . N  .  8 . CA .  8 . C 1 1 
        10 . 1 1  8 LEU N 1 1  8 LEU CA 1 1  8 LEU C  1 1  9 ARG N  -54.705196   -34.7052 .  8 . N .  8 . CA .  8 . C  .  9 . N 1 1 
        11 . 1 1  8 LEU C 1 1  9 ARG N  1 1  9 ARG CA 1 1  9 ARG C    -71.4249   -51.4249 .  8 . C .  9 . N  .  9 . CA .  9 . C 1 1 
        12 . 1 1  9 ARG N 1 1  9 ARG CA 1 1  9 ARG C  1 1 10 VAL N    -52.3534   -32.3534 .  9 . N .  9 . CA .  9 . C  . 10 . N 1 1 
        13 . 1 1  9 ARG C 1 1 10 VAL N  1 1 10 VAL CA 1 1 10 VAL C    -74.9475   -54.9475 .  9 . C . 10 . N  . 10 . CA . 10 . C 1 1 
        14 . 1 1 10 VAL N 1 1 10 VAL CA 1 1 10 VAL C  1 1 11 SER N     -52.376    -32.376 . 10 . N . 10 . CA . 10 . C  . 11 . N 1 1 
        15 . 1 1 10 VAL C 1 1 11 SER N  1 1 11 SER CA 1 1 11 SER C    -72.6752   -52.6752 . 10 . C . 11 . N  . 11 . CA . 11 . C 1 1 
        16 . 1 1 11 SER N 1 1 11 SER CA 1 1 11 SER C  1 1 12 ILE N    -51.0288 -31.028797 . 11 . N . 11 . CA . 11 . C  . 12 . N 1 1 
        17 . 1 1 11 SER C 1 1 12 ILE N  1 1 12 ILE CA 1 1 12 ILE C    -74.4519   -54.4519 . 11 . C . 12 . N  . 12 . CA . 12 . C 1 1 
        18 . 1 1 12 ILE N 1 1 12 ILE CA 1 1 12 ILE C  1 1 13 ILE N    -54.9839   -34.9839 . 12 . N . 12 . CA . 12 . C  . 13 . N 1 1 
        19 . 1 1 12 ILE C 1 1 13 ILE N  1 1 13 ILE CA 1 1 13 ILE C    -72.3403   -52.3403 . 12 . C . 13 . N  . 13 . CA . 13 . C 1 1 
        20 . 1 1 13 ILE N 1 1 13 ILE CA 1 1 13 ILE C  1 1 14 GLY N    -55.0561   -35.0561 . 13 . N . 13 . CA . 13 . C  . 14 . N 1 1 
        21 . 1 1 13 ILE C 1 1 14 GLY N  1 1 14 GLY CA 1 1 14 GLY C    -80.4901   -40.4901 . 13 . C . 14 . N  . 14 . CA . 14 . C 1 1 
        22 . 1 1 14 GLY N 1 1 14 GLY CA 1 1 14 GLY C  1 1 15 THR N    -97.0982    22.9018 . 14 . N . 14 . CA . 14 . C  . 15 . N 1 1 
        23 . 1 1 14 GLY C 1 1 15 THR N  1 1 15 THR CA 1 1 15 THR C    -73.6911   -53.6911 . 14 . C . 15 . N  . 15 . CA . 15 . C 1 1 
        24 . 1 1 15 THR N 1 1 15 THR CA 1 1 15 THR C  1 1 16 THR N    -50.3021   -30.3021 . 15 . N . 15 . CA . 15 . C  . 16 . N 1 1 
        25 . 1 1 15 THR C 1 1 16 THR N  1 1 16 THR CA 1 1 16 THR C    -73.4634   -53.4634 . 15 . C . 16 . N  . 16 . CA . 16 . C 1 1 
        26 . 1 1 16 THR N 1 1 16 THR CA 1 1 16 THR C  1 1 17 LEU N  -53.657295   -33.6573 . 16 . N . 16 . CA . 16 . C  . 17 . N 1 1 
        27 . 1 1 16 THR C 1 1 17 LEU N  1 1 17 LEU CA 1 1 17 LEU C    -73.7914   -53.7914 . 16 . C . 17 . N  . 17 . CA . 17 . C 1 1 
        28 . 1 1 17 LEU N 1 1 17 LEU CA 1 1 17 LEU C  1 1 18 VAL N    -52.1903   -32.1903 . 17 . N . 17 . CA . 17 . C  . 18 . N 1 1 
        29 . 1 1 17 LEU C 1 1 18 VAL N  1 1 18 VAL CA 1 1 18 VAL C    -74.4783   -54.4783 . 17 . C . 18 . N  . 18 . CA . 18 . C 1 1 
        30 . 1 1 18 VAL N 1 1 18 VAL CA 1 1 18 VAL C  1 1 19 ALA N    -54.9394   -34.9394 . 18 . N . 18 . CA . 18 . C  . 19 . N 1 1 
        31 . 1 1 18 VAL C 1 1 19 ALA N  1 1 19 ALA CA 1 1 19 ALA C    -69.9954   -49.9954 . 18 . C . 19 . N  . 19 . CA . 19 . C 1 1 
        32 . 1 1 19 ALA N 1 1 19 ALA CA 1 1 19 ALA C  1 1 20 LEU N    -52.8547   -32.8547 . 19 . N . 19 . CA . 19 . C  . 20 . N 1 1 
        33 . 1 1 19 ALA C 1 1 20 LEU N  1 1 20 LEU CA 1 1 20 LEU C    -72.9778   -52.9778 . 19 . C . 20 . N  . 20 . CA . 20 . C 1 1 
        34 . 1 1 20 LEU N 1 1 20 LEU CA 1 1 20 LEU C  1 1 21 SER N    -55.1644   -35.1644 . 20 . N . 20 . CA . 20 . C  . 21 . N 1 1 
        35 . 1 1 20 LEU C 1 1 21 SER N  1 1 21 SER CA 1 1 21 SER C    -75.0002   -55.0002 . 20 . C . 21 . N  . 21 . CA . 21 . C 1 1 
        36 . 1 1 21 SER N 1 1 21 SER CA 1 1 21 SER C  1 1 22 SER N  -59.449005      0.551 . 21 . N . 21 . CA . 21 . C  . 22 . N 1 1 
        37 . 1 1 21 SER C 1 1 22 SER N  1 1 22 SER CA 1 1 22 SER C     -83.389    -63.389 . 21 . C . 22 . N  . 22 . CA . 22 . C 1 1 
        38 . 1 1 22 SER N 1 1 22 SER CA 1 1 22 SER C  1 1 23 PHE N    -47.2223    -7.2223 . 22 . N . 22 . CA . 22 . C  . 23 . N 1 1 
        39 . 1 1 22 SER C 1 1 23 PHE N  1 1 23 PHE CA 1 1 23 PHE C   -113.9193  -73.91929 . 22 . C . 23 . N  . 23 . CA . 23 . C 1 1 
        40 . 1 1 23 PHE N 1 1 23 PHE CA 1 1 23 PHE C  1 1 24 THR N    -32.8806     7.1194 . 23 . N . 23 . CA . 23 . C  . 24 . N 1 1 
        41 . 1 1 23 PHE C 1 1 24 THR N  1 1 24 THR CA 1 1 24 THR C    -67.4575   -47.4575 . 23 . C . 24 . N  . 24 . CA . 24 . C 1 1 
        42 . 1 1 24 THR N 1 1 24 THR CA 1 1 24 THR C  1 1 25 PRO N  -59.605797   -39.6058 . 24 . N . 24 . CA . 24 . C  . 25 . N 1 1 
        43 . 1 1 24 THR C 1 1 25 PRO N  1 1 25 PRO CA 1 1 25 PRO C    -67.6951   -47.6951 . 24 . C . 25 . N  . 25 . CA . 25 . C 1 1 
        44 . 1 1 25 PRO N 1 1 25 PRO CA 1 1 25 PRO C  1 1 26 VAL N    -45.6429   -25.6429 . 25 . N . 25 . CA . 25 . C  . 26 . N 1 1 
        45 . 1 1 25 PRO C 1 1 26 VAL N  1 1 26 VAL CA 1 1 26 VAL C    -79.1449   -59.1449 . 25 . C . 26 . N  . 26 . CA . 26 . C 1 1 
        46 . 1 1 26 VAL N 1 1 26 VAL CA 1 1 26 VAL C  1 1 27 LEU N    -51.9879   -31.9879 . 26 . N . 26 . CA . 26 . C  . 27 . N 1 1 
        47 . 1 1 26 VAL C 1 1 27 LEU N  1 1 27 LEU CA 1 1 27 LEU C    -72.3697   -52.3697 . 26 . C . 27 . N  . 27 . CA . 27 . C 1 1 
        48 . 1 1 27 LEU N 1 1 27 LEU CA 1 1 27 LEU C  1 1 28 VAL N    -50.5799   -30.5799 . 27 . N . 27 . CA . 27 . C  . 28 . N 1 1 
        49 . 1 1 27 LEU C 1 1 28 VAL N  1 1 28 VAL CA 1 1 28 VAL C    -73.7567 -53.756695 . 27 . C . 28 . N  . 28 . CA . 28 . C 1 1 
        50 . 1 1 28 VAL N 1 1 28 VAL CA 1 1 28 VAL C  1 1 29 ILE N    -54.8321   -34.8321 . 28 . N . 28 . CA . 28 . C  . 29 . N 1 1 
        51 . 1 1 28 VAL C 1 1 29 ILE N  1 1 29 ILE CA 1 1 29 ILE C    -71.7413   -51.7413 . 28 . C . 29 . N  . 29 . CA . 29 . C 1 1 
        52 . 1 1 29 ILE N 1 1 29 ILE CA 1 1 29 ILE C  1 1 30 LEU N    -54.6342   -34.6342 . 29 . N . 29 . CA . 29 . C  . 30 . N 1 1 
        53 . 1 1 29 ILE C 1 1 30 LEU N  1 1 30 LEU CA 1 1 30 LEU C    -71.6322   -51.6322 . 29 . C . 30 . N  . 30 . CA . 30 . C 1 1 
        54 . 1 1 30 LEU N 1 1 30 LEU CA 1 1 30 LEU C  1 1 31 LEU N    -52.0357   -32.0357 . 30 . N . 30 . CA . 30 . C  . 31 . N 1 1 
        55 . 1 1 30 LEU C 1 1 31 LEU N  1 1 31 LEU CA 1 1 31 LEU C    -73.2178 -53.217796 . 30 . C . 31 . N  . 31 . CA . 31 . C 1 1 
        56 . 1 1 31 LEU N 1 1 31 LEU CA 1 1 31 LEU C  1 1 32 GLY N    -49.8218 -29.821802 . 31 . N . 31 . CA . 31 . C  . 32 . N 1 1 
        57 . 1 1 31 LEU C 1 1 32 GLY N  1 1 32 GLY CA 1 1 32 GLY C    -80.7981   -40.7981 . 31 . C . 32 . N  . 32 . CA . 32 . C 1 1 
        58 . 1 1 32 GLY N 1 1 32 GLY CA 1 1 32 GLY C  1 1 33 VAL N   -69.69879    -9.6988 . 32 . N . 32 . CA . 32 . C  . 33 . N 1 1 
        59 . 1 1 32 GLY C 1 1 33 VAL N  1 1 33 VAL CA 1 1 33 VAL C    -75.4651   -55.4651 . 32 . C . 33 . N  . 33 . CA . 33 . C 1 1 
        60 . 1 1 33 VAL N 1 1 33 VAL CA 1 1 33 VAL C  1 1 34 VAL N    -53.7852   -33.7852 . 33 . N . 33 . CA . 33 . C  . 34 . N 1 1 
        61 . 1 1 33 VAL C 1 1 34 VAL N  1 1 34 VAL CA 1 1 34 VAL C    -74.5033 -54.503296 . 33 . C . 34 . N  . 34 . CA . 34 . C 1 1 
        62 . 1 1 34 VAL N 1 1 34 VAL CA 1 1 34 VAL C  1 1 35 GLY N    -49.7127   -29.7127 . 34 . N . 34 . CA . 34 . C  . 35 . N 1 1 
        63 . 1 1 34 VAL C 1 1 35 GLY N  1 1 35 GLY CA 1 1 35 GLY C    -78.8375   -18.8375 . 34 . C . 35 . N  . 35 . CA . 35 . C 1 1 
        64 . 1 1 35 GLY N 1 1 35 GLY CA 1 1 35 GLY C  1 1 36 LEU N    -67.9297   -27.9297 . 35 . N . 35 . CA . 35 . C  . 36 . N 1 1 
        65 . 1 1 35 GLY C 1 1 36 LEU N  1 1 36 LEU CA 1 1 36 LEU C    -73.5967   -53.5967 . 35 . C . 36 . N  . 36 . CA . 36 . C 1 1 
        66 . 1 1 36 LEU N 1 1 36 LEU CA 1 1 36 LEU C  1 1 37 SER N    -52.7446   -32.7446 . 36 . N . 36 . CA . 36 . C  . 37 . N 1 1 
        67 . 1 1 36 LEU C 1 1 37 SER N  1 1 37 SER CA 1 1 37 SER C    -74.7049   -54.7049 . 36 . C . 37 . N  . 37 . CA . 37 . C 1 1 
        68 . 1 1 37 SER N 1 1 37 SER CA 1 1 37 SER C  1 1 38 ALA N    -48.2179   -28.2179 . 37 . N . 37 . CA . 37 . C  . 38 . N 1 1 
        69 . 1 1 37 SER C 1 1 38 ALA N  1 1 38 ALA CA 1 1 38 ALA C    -72.9341   -52.9341 . 37 . C . 38 . N  . 38 . CA . 38 . C 1 1 
        70 . 1 1 38 ALA N 1 1 38 ALA CA 1 1 38 ALA C  1 1 39 LEU N    -47.8707   -27.8707 . 38 . N . 38 . CA . 38 . C  . 39 . N 1 1 
        71 . 1 1 38 ALA C 1 1 39 LEU N  1 1 39 LEU CA 1 1 39 LEU C    -77.2741   -57.2741 . 38 . C . 39 . N  . 39 . CA . 39 . C 1 1 
        72 . 1 1 39 LEU N 1 1 39 LEU CA 1 1 39 LEU C  1 1 40 THR N    -48.0328    -8.0328 . 39 . N . 39 . CA . 39 . C  . 40 . N 1 1 
        73 . 1 1 39 LEU C 1 1 40 THR N  1 1 40 THR CA 1 1 40 THR C -123.200005      -83.2 . 39 . C . 40 . N  . 40 . CA . 40 . C 1 1 
        74 . 1 1 40 THR N 1 1 40 THR CA 1 1 40 THR C  1 1 41 GLY N  -32.257595    27.7424 . 40 . N . 40 . CA . 40 . C  . 41 . N 1 1 
        75 . 1 1 40 THR C 1 1 41 GLY N  1 1 41 GLY CA 1 1 41 GLY C    -59.0772 120.922806 . 40 . C . 41 . N  . 41 . CA . 41 . C 1 1 
        76 . 1 1 41 GLY N 1 1 41 GLY CA 1 1 41 GLY C  1 1 42 TYR N    -65.3055   114.6945 . 41 . N . 41 . CA . 41 . C  . 42 . N 1 1 
        77 . 1 1 41 GLY C 1 1 42 TYR N  1 1 42 TYR CA 1 1 42 TYR C    -131.693    -71.693 . 41 . C . 42 . N  . 42 . CA . 42 . C 1 1 
        78 . 1 1 42 TYR N 1 1 42 TYR CA 1 1 42 TYR C  1 1 43 LEU N     16.4421   136.4421 . 42 . N . 42 . CA . 42 . C  . 43 . N 1 1 
        79 . 1 1 42 TYR C 1 1 43 LEU N  1 1 43 LEU CA 1 1 43 LEU C    -70.6168   -50.6168 . 42 . C . 43 . N  . 43 . CA . 43 . C 1 1 
        80 . 1 1 43 LEU N 1 1 43 LEU CA 1 1 43 LEU C  1 1 44 ASP N  -60.437298   -20.4373 . 43 . N . 43 . CA . 43 . C  . 44 . N 1 1 
        81 . 1 1 43 LEU C 1 1 44 ASP N  1 1 44 ASP CA 1 1 44 ASP C   -74.13719   -54.1372 . 43 . C . 44 . N  . 44 . CA . 44 . C 1 1 
        82 . 1 1 44 ASP N 1 1 44 ASP CA 1 1 44 ASP C  1 1 45 TYR N    -46.1314   -26.1314 . 44 . N . 44 . CA . 44 . C  . 45 . N 1 1 
        83 . 1 1 44 ASP C 1 1 45 TYR N  1 1 45 TYR CA 1 1 45 TYR C    -88.3451   -48.3451 . 44 . C . 45 . N  . 45 . CA . 45 . C 1 1 
        84 . 1 1 45 TYR N 1 1 45 TYR CA 1 1 45 TYR C  1 1 46 VAL N    -56.2293   -16.2293 . 45 . N . 45 . CA . 45 . C  . 46 . N 1 1 
        85 . 1 1 45 TYR C 1 1 46 VAL N  1 1 46 VAL CA 1 1 46 VAL C    -132.346    -12.346 . 45 . C . 46 . N  . 46 . CA . 46 . C 1 1 
        86 . 1 1 46 VAL N 1 1 46 VAL CA 1 1 46 VAL C  1 1 47 LEU N    -48.2684    11.7316 . 46 . N . 46 . CA . 46 . C  . 47 . N 1 1 
        87 . 1 1 46 VAL C 1 1 47 LEU N  1 1 47 LEU CA 1 1 47 LEU C    -86.5363 -46.536297 . 46 . C . 47 . N  . 47 . CA . 47 . C 1 1 
        88 . 1 1 47 LEU N 1 1 47 LEU CA 1 1 47 LEU C  1 1 48 LEU N    -62.6022   -22.6022 . 47 . N . 47 . CA . 47 . C  . 48 . N 1 1 
        89 . 1 1 47 LEU C 1 1 48 LEU N  1 1 48 LEU CA 1 1 48 LEU C     -71.513    -51.513 . 47 . C . 48 . N  . 48 . CA . 48 . C 1 1 
        90 . 1 1 48 LEU N 1 1 48 LEU CA 1 1 48 LEU C  1 1 49 PRO N    -63.5099   -43.5099 . 48 . N . 48 . CA . 48 . C  . 49 . N 1 1 
        91 . 1 1 48 LEU C 1 1 49 PRO N  1 1 49 PRO CA 1 1 49 PRO C    -67.7059   -47.7059 . 48 . C . 49 . N  . 49 . CA . 49 . C 1 1 
        92 . 1 1 49 PRO N 1 1 49 PRO CA 1 1 49 PRO C  1 1 50 ALA N    -46.4394   -26.4394 . 49 . N . 49 . CA . 49 . C  . 50 . N 1 1 
        93 . 1 1 49 PRO C 1 1 50 ALA N  1 1 50 ALA CA 1 1 50 ALA C    -73.5614   -53.5614 . 49 . C . 50 . N  . 50 . CA . 50 . C 1 1 
        94 . 1 1 50 ALA N 1 1 50 ALA CA 1 1 50 ALA C  1 1 51 LEU N    -51.8559   -31.8559 . 50 . N . 50 . CA . 50 . C  . 51 . N 1 1 
        95 . 1 1 50 ALA C 1 1 51 LEU N  1 1 51 LEU CA 1 1 51 LEU C    -75.6963   -55.6963 . 50 . C . 51 . N  . 51 . CA . 51 . C 1 1 
        96 . 1 1 51 LEU N 1 1 51 LEU CA 1 1 51 LEU C  1 1 52 ALA N    -49.3617   -29.3617 . 51 . N . 51 . CA . 51 . C  . 52 . N 1 1 
        97 . 1 1 51 LEU C 1 1 52 ALA N  1 1 52 ALA CA 1 1 52 ALA C    -72.8327   -52.8327 . 51 . C . 52 . N  . 52 . CA . 52 . C 1 1 
        98 . 1 1 52 ALA N 1 1 52 ALA CA 1 1 52 ALA C  1 1 53 ILE N    -51.1525   -31.1525 . 52 . N . 52 . CA . 52 . C  . 53 . N 1 1 
        99 . 1 1 52 ALA C 1 1 53 ILE N  1 1 53 ILE CA 1 1 53 ILE C    -74.5418 -54.541798 . 52 . C . 53 . N  . 53 . CA . 53 . C 1 1 
       100 . 1 1 53 ILE N 1 1 53 ILE CA 1 1 53 ILE C  1 1 54 PHE N     -52.757    -32.757 . 53 . N . 53 . CA . 53 . C  . 54 . N 1 1 
       101 . 1 1 53 ILE C 1 1 54 PHE N  1 1 54 PHE CA 1 1 54 PHE C    -70.1537   -50.1537 . 53 . C . 54 . N  . 54 . CA . 54 . C 1 1 
       102 . 1 1 54 PHE N 1 1 54 PHE CA 1 1 54 PHE C  1 1 55 ILE N    -54.4599   -34.4599 . 54 . N . 54 . CA . 54 . C  . 55 . N 1 1 
       103 . 1 1 54 PHE C 1 1 55 ILE N  1 1 55 ILE CA 1 1 55 ILE C    -73.3532   -53.3532 . 54 . C . 55 . N  . 55 . CA . 55 . C 1 1 
       104 . 1 1 55 ILE N 1 1 55 ILE CA 1 1 55 ILE C  1 1 56 GLY N    -54.4957   -34.4957 . 55 . N . 55 . CA . 55 . C  . 56 . N 1 1 
       105 . 1 1 55 ILE C 1 1 56 GLY N  1 1 56 GLY CA 1 1 56 GLY C    -70.8365   -50.8365 . 55 . C . 56 . N  . 56 . CA . 56 . C 1 1 
       106 . 1 1 56 GLY N 1 1 56 GLY CA 1 1 56 GLY C  1 1 57 LEU N    -52.4521 -32.452095 . 56 . N . 56 . CA . 56 . C  . 57 . N 1 1 
       107 . 1 1 56 GLY C 1 1 57 LEU N  1 1 57 LEU CA 1 1 57 LEU C    -74.0351   -54.0351 . 56 . C . 57 . N  . 57 . CA . 57 . C 1 1 
       108 . 1 1 57 LEU N 1 1 57 LEU CA 1 1 57 LEU C  1 1 58 THR N    -50.3278 -30.327803 . 57 . N . 57 . CA . 57 . C  . 58 . N 1 1 
       109 . 1 1 57 LEU C 1 1 58 THR N  1 1 58 THR CA 1 1 58 THR C    -72.0844   -52.0844 . 57 . C . 58 . N  . 58 . CA . 58 . C 1 1 
       110 . 1 1 58 THR N 1 1 58 THR CA 1 1 58 THR C  1 1 59 ILE N    -53.8226   -33.8226 . 58 . N . 58 . CA . 58 . C  . 59 . N 1 1 
       111 . 1 1 58 THR C 1 1 59 ILE N  1 1 59 ILE CA 1 1 59 ILE C    -71.4724   -51.4724 . 58 . C . 59 . N  . 59 . CA . 59 . C 1 1 
       112 . 1 1 59 ILE N 1 1 59 ILE CA 1 1 59 ILE C  1 1 60 TYR N    -52.5777   -32.5777 . 59 . N . 59 . CA . 59 . C  . 60 . N 1 1 
       113 . 1 1 59 ILE C 1 1 60 TYR N  1 1 60 TYR CA 1 1 60 TYR C    -70.3152   -50.3152 . 59 . C . 60 . N  . 60 . CA . 60 . C 1 1 
       114 . 1 1 60 TYR N 1 1 60 TYR CA 1 1 60 TYR C  1 1 61 ALA N     -54.161    -34.161 . 60 . N . 60 . CA . 60 . C  . 61 . N 1 1 
       115 . 1 1 60 TYR C 1 1 61 ALA N  1 1 61 ALA CA 1 1 61 ALA C     -71.751    -51.751 . 60 . C . 61 . N  . 61 . CA . 61 . C 1 1 
       116 . 1 1 61 ALA N 1 1 61 ALA CA 1 1 61 ALA C  1 1 62 ILE N    -50.7115 -30.711498 . 61 . N . 61 . CA . 61 . C  . 62 . N 1 1 
       117 . 1 1 61 ALA C 1 1 62 ILE N  1 1 62 ILE CA 1 1 62 ILE C    -72.1802 -52.180195 . 61 . C . 62 . N  . 62 . CA . 62 . C 1 1 
       118 . 1 1 62 ILE N 1 1 62 ILE CA 1 1 62 ILE C  1 1 63 GLN N  -54.574398   -34.5744 . 62 . N . 62 . CA . 62 . C  . 63 . N 1 1 
       119 . 1 1 62 ILE C 1 1 63 GLN N  1 1 63 GLN CA 1 1 63 GLN C    -74.1707   -54.1707 . 62 . C . 63 . N  . 63 . CA . 63 . C 1 1 
       120 . 1 1 63 GLN N 1 1 63 GLN CA 1 1 63 GLN C  1 1 64 ARG N    -49.0292   -29.0292 . 63 . N . 63 . CA . 63 . C  . 64 . N 1 1 
       121 . 1 1 63 GLN C 1 1 64 ARG N  1 1 64 ARG CA 1 1 64 ARG C    -74.4571   -54.4571 . 63 . C . 64 . N  . 64 . CA . 64 . C 1 1 
       122 . 1 1 64 ARG N 1 1 64 ARG CA 1 1 64 ARG C  1 1 65 LYS N    -50.1144 -30.114399 . 64 . N . 64 . CA . 64 . C  . 65 . N 1 1 
       123 . 1 1 64 ARG C 1 1 65 LYS N  1 1 65 LYS CA 1 1 65 LYS C    -75.1149 -55.114895 . 64 . C . 65 . N  . 65 . CA . 65 . C 1 1 
       124 . 1 1 65 LYS N 1 1 65 LYS CA 1 1 65 LYS C  1 1 66 ARG N    -49.1523   -29.1523 . 65 . N . 65 . CA . 65 . C  . 66 . N 1 1 
       125 . 1 1 65 LYS C 1 1 66 ARG N  1 1 66 ARG CA 1 1 66 ARG C    -74.0474   -54.0474 . 65 . C . 66 . N  . 66 . CA . 66 . C 1 1 
       126 . 1 1 66 ARG N 1 1 66 ARG CA 1 1 66 ARG C  1 1 67 GLN N    -50.8937   -30.8937 . 66 . N . 66 . CA . 66 . C  . 67 . N 1 1 
       127 . 1 1 66 ARG C 1 1 67 GLN N  1 1 67 GLN CA 1 1 67 GLN C    -76.3266   -56.3266 . 66 . C . 67 . N  . 67 . CA . 67 . C 1 1 
       128 . 1 1 67 GLN N 1 1 67 GLN CA 1 1 67 GLN C  1 1 68 ALA N  -58.706604   -18.7066 . 67 . N . 67 . CA . 67 . C  . 68 . N 1 1 
       129 . 1 1 67 GLN C 1 1 68 ALA N  1 1 68 ALA CA 1 1 68 ALA C    -72.2435   -52.2435 . 67 . C . 68 . N  . 68 . CA . 68 . C 1 1 
       130 . 1 1 68 ALA N 1 1 68 ALA CA 1 1 68 ALA C  1 1 69 ASP N    -52.0817   -32.0817 . 68 . N . 68 . CA . 68 . C  . 69 . N 1 1 
       131 . 1 1 68 ALA C 1 1 69 ASP N  1 1 69 ASP CA 1 1 69 ASP C     -74.797    -54.797 . 68 . C . 69 . N  . 69 . CA . 69 . C 1 1 
       132 . 1 1 69 ASP N 1 1 69 ASP CA 1 1 69 ASP C  1 1 70 ALA N    -50.7924 -30.792398 . 69 . N . 69 . CA . 69 . C  . 70 . N 1 1 
       133 . 1 1 69 ASP C 1 1 70 ALA N  1 1 70 ALA CA 1 1 70 ALA C    -73.0704   -53.0704 . 69 . C . 70 . N  . 70 . CA . 70 . C 1 1 
       134 . 1 1 70 ALA N 1 1 70 ALA CA 1 1 70 ALA C  1 1 71 SER N    -50.3565 -30.356499 . 70 . N . 70 . CA . 70 . C  . 71 . N 1 1 
    stop_

save_


save_CNS/XPLOR_dipolar_coupling_4
    _RDC_constraint_list.Sf_category         RDC_constraints
    _RDC_constraint_list.Entry_ID            1
    _RDC_constraint_list.ID                  1
    _RDC_constraint_list.Constraint_file_ID  .
    _RDC_constraint_list.Block_ID            .

    loop_
       _RDC_constraint.ID
       _RDC_constraint.Entity_assembly_ID_1
       _RDC_constraint.Entity_ID_1
       _RDC_constraint.Comp_index_ID_1
       _RDC_constraint.Comp_ID_1
       _RDC_constraint.Atom_ID_1
       _RDC_constraint.Entity_assembly_ID_2
       _RDC_constraint.Entity_ID_2
       _RDC_constraint.Comp_index_ID_2
       _RDC_constraint.Comp_ID_2
       _RDC_constraint.Atom_ID_2
       _RDC_constraint.RDC_val
       _RDC_constraint.RDC_lower_bound
       _RDC_constraint.RDC_upper_bound
       _RDC_constraint.RDC_val_err
       _RDC_constraint.Auth_asym_ID_1
       _RDC_constraint.Auth_seq_ID_1
       _RDC_constraint.Auth_comp_ID_1
       _RDC_constraint.Auth_atom_ID_1
       _RDC_constraint.Auth_asym_ID_2
       _RDC_constraint.Auth_seq_ID_2
       _RDC_constraint.Auth_comp_ID_2
       _RDC_constraint.Auth_atom_ID_2
       _RDC_constraint.Entry_ID
       _RDC_constraint.RDC_constraint_list_ID

         1 1 1  5 LYS N 1 1  5 LYS H 10.816 . . . .  5 . N .  5 . HN 1 1 
         2 1 1  7 LEU N 1 1  7 LEU H 16.656 . . . .  7 . N .  7 . HN 1 1 
         3 1 1  8 LEU N 1 1  8 LEU H 16.902 . . . .  8 . N .  8 . HN 1 1 
         4 1 1 11 SER N 1 1 11 SER H 15.092 . . . . 11 . N . 11 . HN 1 1 
         5 1 1 12 ILE N 1 1 12 ILE H  16.75 . . . . 12 . N . 12 . HN 1 1 
         6 1 1 13 ILE N 1 1 13 ILE H 13.768 . . . . 13 . N . 13 . HN 1 1 
         7 1 1 15 THR N 1 1 15 THR H 17.734 . . . . 15 . N . 15 . HN 1 1 
         8 1 1 18 VAL N 1 1 18 VAL H 15.384 . . . . 18 . N . 18 . HN 1 1 
         9 1 1 19 ALA N 1 1 19 ALA H 15.424 . . . . 19 . N . 19 . HN 1 1 
        10 1 1 20 LEU N 1 1 20 LEU H 13.572 . . . . 20 . N . 20 . HN 1 1 
        11 1 1 21 SER N 1 1 21 SER H 11.846 . . . . 21 . N . 21 . HN 1 1 
        12 1 1 22 SER N 1 1 22 SER H  18.52 . . . . 22 . N . 22 . HN 1 1 
        13 1 1 24 THR N 1 1 24 THR H 15.344 . . . . 24 . N . 24 . HN 1 1 
        14 1 1 26 VAL N 1 1 26 VAL H 12.956 . . . . 26 . N . 26 . HN 1 1 
        15 1 1 27 LEU N 1 1 27 LEU H 18.714 . . . . 27 . N . 27 . HN 1 1 
        16 1 1 28 VAL N 1 1 28 VAL H 14.894 . . . . 28 . N . 28 . HN 1 1 
        17 1 1 29 ILE N 1 1 29 ILE H  11.96 . . . . 29 . N . 29 . HN 1 1 
        18 1 1 30 LEU N 1 1 30 LEU H  15.62 . . . . 30 . N . 30 . HN 1 1 
        19 1 1 31 LEU N 1 1 31 LEU H 17.294 . . . . 31 . N . 31 . HN 1 1 
        20 1 1 33 VAL N 1 1 33 VAL H  16.51 . . . . 33 . N . 33 . HN 1 1 
        21 1 1 34 VAL N 1 1 34 VAL H 15.384 . . . . 34 . N . 34 . HN 1 1 
        22 1 1 36 LEU N 1 1 36 LEU H   12.2 . . . . 36 . N . 36 . HN 1 1 
        23 1 1 37 SER N 1 1 37 SER H 10.822 . . . . 37 . N . 37 . HN 1 1 
        24 1 1 38 ALA N 1 1 38 ALA H 18.246 . . . . 38 . N . 38 . HN 1 1 
        25 1 1 39 LEU N 1 1 39 LEU H 19.012 . . . . 39 . N . 39 . HN 1 1 
        26 1 1 40 THR N 1 1 40 THR H 18.268 . . . . 40 . N . 40 . HN 1 1 
        27 1 1 47 LEU N 1 1 47 LEU H 16.314 . . . . 47 . N . 47 . HN 1 1 
        28 1 1 48 LEU N 1 1 48 LEU H 14.906 . . . . 48 . N . 48 . HN 1 1 
        29 1 1 50 ALA N 1 1 50 ALA H 12.886 . . . . 50 . N . 50 . HN 1 1 
        30 1 1 51 LEU N 1 1 51 LEU H 17.244 . . . . 51 . N . 51 . HN 1 1 
        31 1 1 52 ALA N 1 1 52 ALA H  12.29 . . . . 52 . N . 52 . HN 1 1 
        32 1 1 53 ILE N 1 1 53 ILE H  13.67 . . . . 53 . N . 53 . HN 1 1 
        33 1 1 54 PHE N 1 1 54 PHE H  17.94 . . . . 54 . N . 54 . HN 1 1 
        34 1 1 55 ILE N 1 1 55 ILE H 14.692 . . . . 55 . N . 55 . HN 1 1 
        35 1 1 56 GLY N 1 1 56 GLY H 10.278 . . . . 56 . N . 56 . HN 1 1 
        36 1 1 57 LEU N 1 1 57 LEU H 15.236 . . . . 57 . N . 57 . HN 1 1 
        37 1 1 58 THR N 1 1 58 THR H  16.95 . . . . 58 . N . 58 . HN 1 1 
        38 1 1 59 ILE N 1 1 59 ILE H  15.33 . . . . 59 . N . 59 . HN 1 1 
        39 1 1 60 TYR N 1 1 60 TYR H 15.294 . . . . 60 . N . 60 . HN 1 1 
        40 1 1 61 ALA N 1 1 61 ALA H   12.2 . . . . 61 . N . 61 . HN 1 1 
        41 1 1 62 ILE N 1 1 62 ILE H  15.97 . . . . 62 . N . 62 . HN 1 1 
        42 1 1 63 GLN N 1 1 63 GLN H 13.768 . . . . 63 . N . 63 . HN 1 1 
        43 1 1 64 ARG N 1 1 64 ARG H 12.494 . . . . 64 . N . 64 . HN 1 1 
        44 1 1 65 LYS N 1 1 65 LYS H 14.256 . . . . 65 . N . 65 . HN 1 1 
        45 1 1 67 GLN N 1 1 67 GLN H   14.6 . . . . 67 . N . 67 . HN 1 1 
        46 1 1  6 THR N 1 1  6 THR H  3.874 . . . .  6 . N .  6 . HN 1 1 
        47 1 1  9 ARG N 1 1  9 ARG H  9.066 . . . .  9 . N .  9 . HN 1 1 
        48 1 1 10 VAL N 1 1 10 VAL H  7.134 . . . . 10 . N . 10 . HN 1 1 
        49 1 1 16 THR N 1 1 16 THR H   6.34 . . . . 16 . N . 16 . HN 1 1 
        50 1 1 17 LEU N 1 1 17 LEU H   8.71 . . . . 17 . N . 17 . HN 1 1 
        51 1 1 23 PHE N 1 1 23 PHE H  7.254 . . . . 23 . N . 23 . HN 1 1 
        52 1 1 42 TYR N 1 1 42 TYR H  1.648 . . . . 42 . N . 42 . HN 1 1 
        53 1 1 43 LEU N 1 1 43 LEU H   1.23 . . . . 43 . N . 43 . HN 1 1 
        54 1 1 44 ASP N 1 1 44 ASP H  3.456 . . . . 44 . N . 44 . HN 1 1 
        55 1 1 45 TYR N 1 1 45 TYR H  1.574 . . . . 45 . N . 45 . HN 1 1 
        56 1 1 46 VAL N 1 1 46 VAL H  1.176 . . . . 46 . N . 46 . HN 1 1 
        57 1 1 66 ARG N 1 1 66 ARG H  8.038 . . . . 66 . N . 66 . HN 1 1 
        58 1 1 68 ALA N 1 1 68 ALA H   7.06 . . . . 68 . N . 68 . HN 1 1 
        59 1 1 69 ASP N 1 1 69 ASP H  4.196 . . . . 69 . N . 69 . HN 1 1 
        60 1 1  5 LYS N 1 1  5 LYS H  12.51 . . . .  5 . N .  5 . HN 1 1 
        61 1 1  6 THR N 1 1  6 THR H 18.645 . . . .  6 . N .  6 . HN 1 1 
        62 1 1  7 LEU N 1 1  7 LEU H 13.165 . . . .  7 . N .  7 . HN 1 1 
        63 1 1  8 LEU N 1 1  8 LEU H  15.12 . . . .  8 . N .  8 . HN 1 1 
        64 1 1 11 SER N 1 1 11 SER H 13.365 . . . . 11 . N . 11 . HN 1 1 
        65 1 1 12 ILE N 1 1 12 ILE H  18.36 . . . . 12 . N . 12 . HN 1 1 
        66 1 1 13 ILE N 1 1 13 ILE H  14.67 . . . . 13 . N . 13 . HN 1 1 
        67 1 1 14 GLY N 1 1 14 GLY H  10.53 . . . . 14 . N . 14 . HN 1 1 
        68 1 1 15 THR N 1 1 15 THR H  19.55 . . . . 15 . N . 15 . HN 1 1 
        69 1 1 18 VAL N 1 1 18 VAL H  10.62 . . . . 18 . N . 18 . HN 1 1 
        70 1 1 19 ALA N 1 1 19 ALA H 17.065 . . . . 19 . N . 19 . HN 1 1 
        71 1 1 20 LEU N 1 1 20 LEU H  12.21 . . . . 20 . N . 20 . HN 1 1 
        72 1 1 21 SER N 1 1 21 SER H  10.55 . . . . 21 . N . 21 . HN 1 1 
        73 1 1 22 SER N 1 1 22 SER H 18.075 . . . . 22 . N . 22 . HN 1 1 
        74 1 1 23 PHE N 1 1 23 PHE H  12.38 . . . . 23 . N . 23 . HN 1 1 
        75 1 1 24 THR N 1 1 24 THR H  12.87 . . . . 24 . N . 24 . HN 1 1 
        76 1 1 26 VAL N 1 1 26 VAL H  10.44 . . . . 26 . N . 26 . HN 1 1 
        77 1 1 27 LEU N 1 1 27 LEU H 15.405 . . . . 27 . N . 27 . HN 1 1 
        78 1 1 28 VAL N 1 1 28 VAL H 14.325 . . . . 28 . N . 28 . HN 1 1 
        79 1 1 29 ILE N 1 1 29 ILE H   12.8 . . . . 29 . N . 29 . HN 1 1 
        80 1 1 30 LEU N 1 1 30 LEU H 13.785 . . . . 30 . N . 30 . HN 1 1 
        81 1 1 31 LEU N 1 1 31 LEU H  17.57 . . . . 31 . N . 31 . HN 1 1 
        82 1 1 32 GLY N 1 1 32 GLY H 16.565 . . . . 32 . N . 32 . HN 1 1 
        83 1 1 33 VAL N 1 1 33 VAL H  12.27 . . . . 33 . N . 33 . HN 1 1 
        84 1 1 34 VAL N 1 1 34 VAL H  15.38 . . . . 34 . N . 34 . HN 1 1 
        85 1 1 35 GLY N 1 1 35 GLY H  19.34 . . . . 35 . N . 35 . HN 1 1 
        86 1 1 36 LEU N 1 1 36 LEU H 15.165 . . . . 36 . N . 36 . HN 1 1 
        87 1 1 37 SER N 1 1 37 SER H  11.91 . . . . 37 . N . 37 . HN 1 1 
        88 1 1 38 ALA N 1 1 38 ALA H  18.69 . . . . 38 . N . 38 . HN 1 1 
        89 1 1 39 LEU N 1 1 39 LEU H  18.66 . . . . 39 . N . 39 . HN 1 1 
        90 1 1 40 THR N 1 1 40 THR H  18.83 . . . . 40 . N . 40 . HN 1 1 
        91 1 1 47 LEU N 1 1 47 LEU H 15.905 . . . . 47 . N . 47 . HN 1 1 
        92 1 1 48 LEU N 1 1 48 LEU H 15.585 . . . . 48 . N . 48 . HN 1 1 
        93 1 1 50 ALA N 1 1 50 ALA H 17.595 . . . . 50 . N . 50 . HN 1 1 
        94 1 1 51 LEU N 1 1 51 LEU H  18.66 . . . . 51 . N . 51 . HN 1 1 
        95 1 1 52 ALA N 1 1 52 ALA H 12.795 . . . . 52 . N . 52 . HN 1 1 
        96 1 1 53 ILE N 1 1 53 ILE H  13.19 . . . . 53 . N . 53 . HN 1 1 
        97 1 1 54 PHE N 1 1 54 PHE H  17.34 . . . . 54 . N . 54 . HN 1 1 
        98 1 1 55 ILE N 1 1 55 ILE H  15.98 . . . . 55 . N . 55 . HN 1 1 
        99 1 1 56 GLY N 1 1 56 GLY H 12.575 . . . . 56 . N . 56 . HN 1 1 
       100 1 1 57 LEU N 1 1 57 LEU H  15.72 . . . . 57 . N . 57 . HN 1 1 
       101 1 1 58 THR N 1 1 58 THR H  19.52 . . . . 58 . N . 58 . HN 1 1 
       102 1 1 59 ILE N 1 1 59 ILE H 13.795 . . . . 59 . N . 59 . HN 1 1 
       103 1 1 60 TYR N 1 1 60 TYR H 13.875 . . . . 60 . N . 60 . HN 1 1 
       104 1 1 61 ALA N 1 1 61 ALA H 17.595 . . . . 61 . N . 61 . HN 1 1 
       105 1 1 62 ILE N 1 1 62 ILE H  17.31 . . . . 62 . N . 62 . HN 1 1 
       106 1 1 63 GLN N 1 1 63 GLN H 12.795 . . . . 63 . N . 63 . HN 1 1 
       107 1 1 64 ARG N 1 1 64 ARG H 12.875 . . . . 64 . N . 64 . HN 1 1 
       108 1 1 65 LYS N 1 1 65 LYS H 13.795 . . . . 65 . N . 65 . HN 1 1 
       109 1 1 67 GLN N 1 1 67 GLN H 16.235 . . . . 67 . N . 67 . HN 1 1 
       110 1 1  9 ARG N 1 1  9 ARG H   8.25 . . . .  9 . N .  9 . HN 1 1 
       111 1 1 10 VAL N 1 1 10 VAL H  9.165 . . . . 10 . N . 10 . HN 1 1 
       112 1 1 16 THR N 1 1 16 THR H   7.74 . . . . 16 . N . 16 . HN 1 1 
       113 1 1 17 LEU N 1 1 17 LEU H  7.875 . . . . 17 . N . 17 . HN 1 1 
       114 1 1 41 GLY N 1 1 41 GLY H  3.845 . . . . 41 . N . 41 . HN 1 1 
       115 1 1 42 TYR N 1 1 42 TYR H   1.36 . . . . 42 . N . 42 . HN 1 1 
       116 1 1 43 LEU N 1 1 43 LEU H    0.8 . . . . 43 . N . 43 . HN 1 1 
       117 1 1 44 ASP N 1 1 44 ASP H   5.33 . . . . 44 . N . 44 . HN 1 1 
       118 1 1 45 TYR N 1 1 45 TYR H  3.845 . . . . 45 . N . 45 . HN 1 1 
       119 1 1 46 VAL N 1 1 46 VAL H  1.925 . . . . 46 . N . 46 . HN 1 1 
       120 1 1 66 ARG N 1 1 66 ARG H   8.25 . . . . 66 . N . 66 . HN 1 1 
       121 1 1 68 ALA N 1 1 68 ALA H  5.025 . . . . 68 . N . 68 . HN 1 1 
       122 1 1 69 ASP N 1 1 69 ASP H   4.31 . . . . 69 . N . 69 . HN 1 1 
       123 1 1 70 ALA N 1 1 70 ALA H   1.75 . . . . 70 . N . 70 . HN 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 MET C    C  -2.800   4.713  -6.404 1.00 . A A .  1 MET C    1 1 
        1     2 1 1  1 MET CA   C  -1.587   4.402  -7.274 1.00 . A A .  1 MET CA   1 1 
        1     3 1 1  1 MET CB   C  -1.976   3.432  -8.393 1.00 . A A .  1 MET CB   1 1 
        1     4 1 1  1 MET CE   C   0.473   1.742 -11.237 1.00 . A A .  1 MET CE   1 1 
        1     5 1 1  1 MET CG   C  -0.751   3.143  -9.261 1.00 . A A .  1 MET CG   1 1 
        1     6 1 1  1 MET H1   H  -0.766   3.894  -5.430 1.00 . A A .  1 MET H1   1 1 
        1     7 1 1  1 MET H2   H   0.386   4.256  -6.625 1.00 . A A .  1 MET H2   1 1 
        1     8 1 1  1 MET H3   H  -0.444   2.773  -6.660 1.00 . A A .  1 MET H3   1 1 
        1     9 1 1  1 MET HA   H  -1.215   5.318  -7.708 1.00 . A A .  1 MET HA   1 1 
        1    10 1 1  1 MET HB2  H  -2.339   2.510  -7.960 1.00 . A A .  1 MET HB2  1 1 
        1    11 1 1  1 MET HB3  H  -2.751   3.874  -9.000 1.00 . A A .  1 MET HB3  1 1 
        1    12 1 1  1 MET HE1  H   1.193   1.679 -10.433 1.00 . A A .  1 MET HE1  1 1 
        1    13 1 1  1 MET HE2  H   0.708   2.591 -11.860 1.00 . A A .  1 MET HE2  1 1 
        1    14 1 1  1 MET HE3  H   0.509   0.841 -11.832 1.00 . A A .  1 MET HE3  1 1 
        1    15 1 1  1 MET HG2  H  -0.416   4.058  -9.727 1.00 . A A .  1 MET HG2  1 1 
        1    16 1 1  1 MET HG3  H   0.040   2.742  -8.645 1.00 . A A .  1 MET HG3  1 1 
        1    17 1 1  1 MET N    N  -0.522   3.784  -6.435 1.00 . A A .  1 MET N    1 1 
        1    18 1 1  1 MET O    O  -3.630   5.551  -6.755 1.00 . A A .  1 MET O    1 1 
        1    19 1 1  1 MET SD   S  -1.186   1.940 -10.543 1.00 . A A .  1 MET SD   1 1 
        1    20 1 1  2 LYS C    C  -3.999   5.684  -3.829 1.00 . A A .  2 LYS C    1 1 
        1    21 1 1  2 LYS CA   C  -4.006   4.248  -4.347 1.00 . A A .  2 LYS CA   1 1 
        1    22 1 1  2 LYS CB   C  -3.912   3.271  -3.173 1.00 . A A .  2 LYS CB   1 1 
        1    23 1 1  2 LYS CD   C  -4.116   0.876  -2.490 1.00 . A A .  2 LYS CD   1 1 
        1    24 1 1  2 LYS CE   C  -4.361  -0.548  -2.989 1.00 . A A .  2 LYS CE   1 1 
        1    25 1 1  2 LYS CG   C  -4.196   1.851  -3.666 1.00 . A A .  2 LYS CG   1 1 
        1    26 1 1  2 LYS H    H  -2.199   3.381  -5.035 1.00 . A A .  2 LYS H    1 1 
        1    27 1 1  2 LYS HA   H  -4.932   4.071  -4.874 1.00 . A A .  2 LYS HA   1 1 
        1    28 1 1  2 LYS HB2  H  -2.919   3.312  -2.750 1.00 . A A .  2 LYS HB2  1 1 
        1    29 1 1  2 LYS HB3  H  -4.637   3.541  -2.420 1.00 . A A .  2 LYS HB3  1 1 
        1    30 1 1  2 LYS HD2  H  -3.136   0.937  -2.038 1.00 . A A .  2 LYS HD2  1 1 
        1    31 1 1  2 LYS HD3  H  -4.867   1.133  -1.757 1.00 . A A .  2 LYS HD3  1 1 
        1    32 1 1  2 LYS HE2  H  -3.637  -0.794  -3.750 1.00 . A A .  2 LYS HE2  1 1 
        1    33 1 1  2 LYS HE3  H  -4.266  -1.240  -2.165 1.00 . A A .  2 LYS HE3  1 1 
        1    34 1 1  2 LYS HG2  H  -5.185   1.812  -4.101 1.00 . A A .  2 LYS HG2  1 1 
        1    35 1 1  2 LYS HG3  H  -3.464   1.575  -4.409 1.00 . A A .  2 LYS HG3  1 1 
        1    36 1 1  2 LYS HZ1  H  -6.290  -1.335  -3.017 1.00 . A A .  2 LYS HZ1  1 1 
        1    37 1 1  2 LYS HZ2  H  -5.674  -0.952  -4.555 1.00 . A A .  2 LYS HZ2  1 1 
        1    38 1 1  2 LYS HZ3  H  -6.197   0.285  -3.513 1.00 . A A .  2 LYS HZ3  1 1 
        1    39 1 1  2 LYS N    N  -2.894   4.034  -5.265 1.00 . A A .  2 LYS N    1 1 
        1    40 1 1  2 LYS NZ   N  -5.735  -0.645  -3.562 1.00 . A A .  2 LYS NZ   1 1 
        1    41 1 1  2 LYS O    O  -5.050   6.306  -3.676 1.00 . A A .  2 LYS O    1 1 
        1    42 1 1  3 ASP C    C  -3.534   7.808  -1.835 1.00 . A A .  3 ASP C    1 1 
        1    43 1 1  3 ASP CA   C  -2.662   7.570  -3.068 1.00 . A A .  3 ASP CA   1 1 
        1    44 1 1  3 ASP CB   C  -3.027   8.558  -4.178 1.00 . A A .  3 ASP CB   1 1 
        1    45 1 1  3 ASP CG   C  -2.043   8.392  -5.332 1.00 . A A .  3 ASP CG   1 1 
        1    46 1 1  3 ASP H    H  -2.001   5.662  -3.709 1.00 . A A .  3 ASP H    1 1 
        1    47 1 1  3 ASP HA   H  -1.629   7.732  -2.796 1.00 . A A .  3 ASP HA   1 1 
        1    48 1 1  3 ASP HB2  H  -4.031   8.357  -4.525 1.00 . A A .  3 ASP HB2  1 1 
        1    49 1 1  3 ASP HB3  H  -2.969   9.567  -3.800 1.00 . A A .  3 ASP HB3  1 1 
        1    50 1 1  3 ASP N    N  -2.803   6.205  -3.565 1.00 . A A .  3 ASP N    1 1 
        1    51 1 1  3 ASP O    O  -4.396   8.686  -1.828 1.00 . A A .  3 ASP O    1 1 
        1    52 1 1  3 ASP OD1  O  -1.022   7.765  -5.111 1.00 . A A .  3 ASP OD1  1 1 
        1    53 1 1  3 ASP OD2  O  -2.322   8.884  -6.413 1.00 . A A .  3 ASP OD2  1 1 
        1    54 1 1  4 PRO C    C  -3.599   8.372   1.305 1.00 . A A .  4 PRO C    1 1 
        1    55 1 1  4 PRO CA   C  -4.069   7.161   0.491 1.00 . A A .  4 PRO CA   1 1 
        1    56 1 1  4 PRO CB   C  -3.744   5.837   1.197 1.00 . A A .  4 PRO CB   1 1 
        1    57 1 1  4 PRO CD   C  -2.294   5.972  -0.727 1.00 . A A .  4 PRO CD   1 1 
        1    58 1 1  4 PRO CG   C  -2.376   5.478   0.719 1.00 . A A .  4 PRO CG   1 1 
        1    59 1 1  4 PRO HA   H  -5.127   7.223   0.296 1.00 . A A .  4 PRO HA   1 1 
        1    60 1 1  4 PRO HB2  H  -3.747   5.962   2.267 1.00 . A A .  4 PRO HB2  1 1 
        1    61 1 1  4 PRO HB3  H  -4.448   5.073   0.905 1.00 . A A .  4 PRO HB3  1 1 
        1    62 1 1  4 PRO HD2  H  -1.308   6.364  -0.939 1.00 . A A .  4 PRO HD2  1 1 
        1    63 1 1  4 PRO HD3  H  -2.545   5.181  -1.415 1.00 . A A .  4 PRO HD3  1 1 
        1    64 1 1  4 PRO HG2  H  -1.628   5.973   1.328 1.00 . A A .  4 PRO HG2  1 1 
        1    65 1 1  4 PRO HG3  H  -2.233   4.409   0.750 1.00 . A A .  4 PRO HG3  1 1 
        1    66 1 1  4 PRO N    N  -3.309   7.043  -0.794 1.00 . A A .  4 PRO N    1 1 
        1    67 1 1  4 PRO O    O  -3.038   8.227   2.392 1.00 . A A .  4 PRO O    1 1 
        1    68 1 1  5 LYS C    C  -4.422  11.195   2.569 1.00 . A A .  5 LYS C    1 1 
        1    69 1 1  5 LYS CA   C  -3.463  10.812   1.432 1.00 . A A .  5 LYS CA   1 1 
        1    70 1 1  5 LYS CB   C  -3.465  11.942   0.400 1.00 . A A .  5 LYS CB   1 1 
        1    71 1 1  5 LYS CD   C  -2.213  12.944  -1.524 1.00 . A A .  5 LYS CD   1 1 
        1    72 1 1  5 LYS CE   C  -3.451  13.098  -2.418 1.00 . A A .  5 LYS CE   1 1 
        1    73 1 1  5 LYS CG   C  -2.352  11.710  -0.625 1.00 . A A .  5 LYS CG   1 1 
        1    74 1 1  5 LYS H    H  -4.337   9.605  -0.079 1.00 . A A .  5 LYS H    1 1 
        1    75 1 1  5 LYS HA   H  -2.456  10.711   1.808 1.00 . A A .  5 LYS HA   1 1 
        1    76 1 1  5 LYS HB2  H  -4.421  11.962  -0.105 1.00 . A A .  5 LYS HB2  1 1 
        1    77 1 1  5 LYS HB3  H  -3.303  12.886   0.898 1.00 . A A .  5 LYS HB3  1 1 
        1    78 1 1  5 LYS HD2  H  -2.105  13.825  -0.906 1.00 . A A .  5 LYS HD2  1 1 
        1    79 1 1  5 LYS HD3  H  -1.335  12.836  -2.146 1.00 . A A .  5 LYS HD3  1 1 
        1    80 1 1  5 LYS HE2  H  -3.195  13.685  -3.289 1.00 . A A .  5 LYS HE2  1 1 
        1    81 1 1  5 LYS HE3  H  -3.802  12.126  -2.732 1.00 . A A .  5 LYS HE3  1 1 
        1    82 1 1  5 LYS HG2  H  -1.418  11.536  -0.108 1.00 . A A .  5 LYS HG2  1 1 
        1    83 1 1  5 LYS HG3  H  -2.591  10.848  -1.230 1.00 . A A .  5 LYS HG3  1 1 
        1    84 1 1  5 LYS HZ1  H  -4.921  14.563  -2.236 1.00 . A A .  5 LYS HZ1  1 1 
        1    85 1 1  5 LYS HZ2  H  -4.132  14.187  -0.778 1.00 . A A .  5 LYS HZ2  1 1 
        1    86 1 1  5 LYS HZ3  H  -5.283  13.118  -1.427 1.00 . A A .  5 LYS HZ3  1 1 
        1    87 1 1  5 LYS N    N  -3.844   9.564   0.766 1.00 . A A .  5 LYS N    1 1 
        1    88 1 1  5 LYS NZ   N  -4.528  13.794  -1.657 1.00 . A A .  5 LYS NZ   1 1 
        1    89 1 1  5 LYS O    O  -4.015  11.455   3.701 1.00 . A A .  5 LYS O    1 1 
        1    90 1 1  6 THR C    C  -7.071  10.191   4.035 1.00 . A A .  6 THR C    1 1 
        1    91 1 1  6 THR CA   C  -6.803  11.427   3.172 1.00 . A A .  6 THR CA   1 1 
        1    92 1 1  6 THR CB   C  -8.075  11.806   2.409 1.00 . A A .  6 THR CB   1 1 
        1    93 1 1  6 THR CG2  C  -7.817  13.057   1.567 1.00 . A A .  6 THR CG2  1 1 
        1    94 1 1  6 THR H    H  -5.935  10.806   1.346 1.00 . A A .  6 THR H    1 1 
        1    95 1 1  6 THR HA   H  -6.533  12.229   3.827 1.00 . A A .  6 THR HA   1 1 
        1    96 1 1  6 THR HB   H  -8.870  12.007   3.110 1.00 . A A .  6 THR HB   1 1 
        1    97 1 1  6 THR HG1  H  -9.199  10.282   1.962 1.00 . A A .  6 THR HG1  1 1 
        1    98 1 1  6 THR HG21 H  -8.704  13.297   0.999 1.00 . A A .  6 THR HG21 1 1 
        1    99 1 1  6 THR HG22 H  -6.994  12.874   0.891 1.00 . A A .  6 THR HG22 1 1 
        1   100 1 1  6 THR HG23 H  -7.571  13.884   2.217 1.00 . A A .  6 THR HG23 1 1 
        1   101 1 1  6 THR N    N  -5.709  11.158   2.232 1.00 . A A .  6 THR N    1 1 
        1   102 1 1  6 THR O    O  -7.485  10.273   5.191 1.00 . A A .  6 THR O    1 1 
        1   103 1 1  6 THR OG1  O  -8.451  10.731   1.559 1.00 . A A .  6 THR OG1  1 1 
        1   104 1 1  7 LEU C    C  -5.973   7.715   5.319 1.00 . A A .  7 LEU C    1 1 
        1   105 1 1  7 LEU CA   C  -6.916   7.774   4.100 1.00 . A A .  7 LEU CA   1 1 
        1   106 1 1  7 LEU CB   C  -6.603   6.637   3.124 1.00 . A A .  7 LEU CB   1 1 
        1   107 1 1  7 LEU CD1  C  -8.969   5.723   3.008 1.00 . A A .  7 LEU CD1  1 1 
        1   108 1 1  7 LEU CD2  C  -8.279   7.674   1.573 1.00 . A A .  7 LEU CD2  1 1 
        1   109 1 1  7 LEU CG   C  -7.812   6.359   2.211 1.00 . A A .  7 LEU CG   1 1 
        1   110 1 1  7 LEU H    H  -6.333   9.190   2.562 1.00 . A A .  7 LEU H    1 1 
        1   111 1 1  7 LEU HA   H  -7.932   7.674   4.449 1.00 . A A .  7 LEU HA   1 1 
        1   112 1 1  7 LEU HB2  H  -5.768   6.931   2.514 1.00 . A A .  7 LEU HB2  1 1 
        1   113 1 1  7 LEU HB3  H  -6.350   5.742   3.672 1.00 . A A .  7 LEU HB3  1 1 
        1   114 1 1  7 LEU HD11 H  -9.546   5.090   2.350 1.00 . A A .  7 LEU HD11 1 1 
        1   115 1 1  7 LEU HD12 H  -9.611   6.492   3.412 1.00 . A A .  7 LEU HD12 1 1 
        1   116 1 1  7 LEU HD13 H  -8.575   5.125   3.818 1.00 . A A .  7 LEU HD13 1 1 
        1   117 1 1  7 LEU HD21 H  -8.931   7.457   0.741 1.00 . A A .  7 LEU HD21 1 1 
        1   118 1 1  7 LEU HD22 H  -7.421   8.229   1.222 1.00 . A A .  7 LEU HD22 1 1 
        1   119 1 1  7 LEU HD23 H  -8.812   8.261   2.307 1.00 . A A .  7 LEU HD23 1 1 
        1   120 1 1  7 LEU HG   H  -7.509   5.675   1.431 1.00 . A A .  7 LEU HG   1 1 
        1   121 1 1  7 LEU N    N  -6.774   9.063   3.428 1.00 . A A .  7 LEU N    1 1 
        1   122 1 1  7 LEU O    O  -6.377   7.326   6.411 1.00 . A A .  7 LEU O    1 1 
        1   123 1 1  8 LEU C    C  -3.860   9.437   7.078 1.00 . A A .  8 LEU C    1 1 
        1   124 1 1  8 LEU CA   C  -3.678   8.230   6.144 1.00 . A A .  8 LEU CA   1 1 
        1   125 1 1  8 LEU CB   C  -2.303   8.347   5.475 1.00 . A A .  8 LEU CB   1 1 
        1   126 1 1  8 LEU CD1  C  -0.677   7.243   3.933 1.00 . A A .  8 LEU CD1  1 1 
        1   127 1 1  8 LEU CD2  C  -1.632   5.933   5.859 1.00 . A A .  8 LEU CD2  1 1 
        1   128 1 1  8 LEU CG   C  -1.923   7.022   4.800 1.00 . A A .  8 LEU CG   1 1 
        1   129 1 1  8 LEU H    H  -4.482   8.498   4.231 1.00 . A A .  8 LEU H    1 1 
        1   130 1 1  8 LEU HA   H  -3.701   7.306   6.698 1.00 . A A .  8 LEU HA   1 1 
        1   131 1 1  8 LEU HB2  H  -2.338   9.128   4.730 1.00 . A A .  8 LEU HB2  1 1 
        1   132 1 1  8 LEU HB3  H  -1.559   8.599   6.217 1.00 . A A .  8 LEU HB3  1 1 
        1   133 1 1  8 LEU HD11 H  -0.853   8.064   3.254 1.00 . A A .  8 LEU HD11 1 1 
        1   134 1 1  8 LEU HD12 H  -0.469   6.347   3.367 1.00 . A A .  8 LEU HD12 1 1 
        1   135 1 1  8 LEU HD13 H   0.166   7.473   4.567 1.00 . A A .  8 LEU HD13 1 1 
        1   136 1 1  8 LEU HD21 H  -0.913   5.225   5.469 1.00 . A A .  8 LEU HD21 1 1 
        1   137 1 1  8 LEU HD22 H  -2.546   5.409   6.094 1.00 . A A .  8 LEU HD22 1 1 
        1   138 1 1  8 LEU HD23 H  -1.236   6.384   6.757 1.00 . A A .  8 LEU HD23 1 1 
        1   139 1 1  8 LEU HG   H  -2.738   6.702   4.174 1.00 . A A .  8 LEU HG   1 1 
        1   140 1 1  8 LEU N    N  -4.730   8.150   5.112 1.00 . A A .  8 LEU N    1 1 
        1   141 1 1  8 LEU O    O  -3.358   9.477   8.200 1.00 . A A .  8 LEU O    1 1 
        1   142 1 1  9 ARG C    C  -5.778  11.424   8.489 1.00 . A A .  9 ARG C    1 1 
        1   143 1 1  9 ARG CA   C  -4.891  11.653   7.263 1.00 . A A .  9 ARG CA   1 1 
        1   144 1 1  9 ARG CB   C  -5.579  12.641   6.332 1.00 . A A .  9 ARG CB   1 1 
        1   145 1 1  9 ARG CD   C  -6.230  15.031   6.033 1.00 . A A .  9 ARG CD   1 1 
        1   146 1 1  9 ARG CG   C  -5.718  13.992   7.032 1.00 . A A .  9 ARG CG   1 1 
        1   147 1 1  9 ARG CZ   C  -5.505  16.000   3.924 1.00 . A A .  9 ARG CZ   1 1 
        1   148 1 1  9 ARG H    H  -5.079  10.150   5.739 1.00 . A A .  9 ARG H    1 1 
        1   149 1 1  9 ARG HA   H  -3.958  12.089   7.585 1.00 . A A .  9 ARG HA   1 1 
        1   150 1 1  9 ARG HB2  H  -4.990  12.759   5.435 1.00 . A A .  9 ARG HB2  1 1 
        1   151 1 1  9 ARG HB3  H  -6.559  12.268   6.084 1.00 . A A .  9 ARG HB3  1 1 
        1   152 1 1  9 ARG HD2  H  -7.153  14.683   5.595 1.00 . A A .  9 ARG HD2  1 1 
        1   153 1 1  9 ARG HD3  H  -6.407  15.964   6.548 1.00 . A A .  9 ARG HD3  1 1 
        1   154 1 1  9 ARG HE   H  -4.365  14.805   5.053 1.00 . A A .  9 ARG HE   1 1 
        1   155 1 1  9 ARG HG2  H  -6.417  13.901   7.849 1.00 . A A .  9 ARG HG2  1 1 
        1   156 1 1  9 ARG HG3  H  -4.757  14.303   7.412 1.00 . A A .  9 ARG HG3  1 1 
        1   157 1 1  9 ARG HH11 H  -7.365  16.444   4.516 1.00 . A A .  9 ARG HH11 1 1 
        1   158 1 1  9 ARG HH12 H  -6.868  17.153   3.016 1.00 . A A .  9 ARG HH12 1 1 
        1   159 1 1  9 ARG HH21 H  -3.705  15.734   3.090 1.00 . A A .  9 ARG HH21 1 1 
        1   160 1 1  9 ARG HH22 H  -4.795  16.750   2.209 1.00 . A A .  9 ARG HH22 1 1 
        1   161 1 1  9 ARG N    N  -4.594  10.405   6.551 1.00 . A A .  9 ARG N    1 1 
        1   162 1 1  9 ARG NE   N  -5.243  15.236   4.979 1.00 . A A .  9 ARG NE   1 1 
        1   163 1 1  9 ARG NH1  N  -6.670  16.577   3.810 1.00 . A A .  9 ARG NH1  1 1 
        1   164 1 1  9 ARG NH2  N  -4.597  16.175   3.003 1.00 . A A .  9 ARG NH2  1 1 
        1   165 1 1  9 ARG O    O  -5.644  12.115   9.499 1.00 . A A .  9 ARG O    1 1 
        1   166 1 1 10 VAL C    C  -6.838   9.589  10.715 1.00 . A A . 10 VAL C    1 1 
        1   167 1 1 10 VAL CA   C  -7.585  10.129   9.497 1.00 . A A . 10 VAL CA   1 1 
        1   168 1 1 10 VAL CB   C  -8.642   9.111   9.036 1.00 . A A . 10 VAL CB   1 1 
        1   169 1 1 10 VAL CG1  C  -8.019   7.707   8.940 1.00 . A A . 10 VAL CG1  1 1 
        1   170 1 1 10 VAL CG2  C  -9.808   9.089  10.033 1.00 . A A . 10 VAL CG2  1 1 
        1   171 1 1 10 VAL H    H  -6.712   9.902   7.584 1.00 . A A . 10 VAL H    1 1 
        1   172 1 1 10 VAL HA   H  -8.089  11.013   9.858 1.00 . A A . 10 VAL HA   1 1 
        1   173 1 1 10 VAL HB   H  -9.010   9.403   8.061 1.00 . A A . 10 VAL HB   1 1 
        1   174 1 1 10 VAL HG11 H  -8.026   7.237   9.914 1.00 . A A . 10 VAL HG11 1 1 
        1   175 1 1 10 VAL HG12 H  -7.002   7.785   8.591 1.00 . A A . 10 VAL HG12 1 1 
        1   176 1 1 10 VAL HG13 H  -8.592   7.107   8.248 1.00 . A A . 10 VAL HG13 1 1 
        1   177 1 1 10 VAL HG21 H  -9.452   8.755  10.997 1.00 . A A . 10 VAL HG21 1 1 
        1   178 1 1 10 VAL HG22 H -10.573   8.415   9.679 1.00 . A A . 10 VAL HG22 1 1 
        1   179 1 1 10 VAL HG23 H -10.221  10.083  10.127 1.00 . A A . 10 VAL HG23 1 1 
        1   180 1 1 10 VAL N    N  -6.678  10.451   8.395 1.00 . A A . 10 VAL N    1 1 
        1   181 1 1 10 VAL O    O  -7.269   9.831  11.843 1.00 . A A . 10 VAL O    1 1 
        1   182 1 1 11 SER C    C  -4.447   9.555  12.513 1.00 . A A . 11 SER C    1 1 
        1   183 1 1 11 SER CA   C  -4.999   8.391  11.694 1.00 . A A . 11 SER CA   1 1 
        1   184 1 1 11 SER CB   C  -3.855   7.480  11.249 1.00 . A A . 11 SER CB   1 1 
        1   185 1 1 11 SER H    H  -5.366   8.715   9.637 1.00 . A A . 11 SER H    1 1 
        1   186 1 1 11 SER HA   H  -5.648   7.841  12.359 1.00 . A A . 11 SER HA   1 1 
        1   187 1 1 11 SER HB2  H  -3.325   7.113  12.112 1.00 . A A . 11 SER HB2  1 1 
        1   188 1 1 11 SER HB3  H  -4.259   6.642  10.695 1.00 . A A . 11 SER HB3  1 1 
        1   189 1 1 11 SER HG   H  -2.074   8.109  10.784 1.00 . A A . 11 SER HG   1 1 
        1   190 1 1 11 SER N    N  -5.727   8.887  10.532 1.00 . A A . 11 SER N    1 1 
        1   191 1 1 11 SER O    O  -4.664   9.608  13.693 1.00 . A A . 11 SER O    1 1 
        1   192 1 1 11 SER OG   O  -2.958   8.218  10.429 1.00 . A A . 11 SER OG   1 1 
        1   193 1 1 12 ILE C    C  -4.236  12.341  13.431 1.00 . A A . 12 ILE C    1 1 
        1   194 1 1 12 ILE CA   C  -3.146  11.591  12.642 1.00 . A A . 12 ILE CA   1 1 
        1   195 1 1 12 ILE CB   C  -2.482  12.558  11.654 1.00 . A A . 12 ILE CB   1 1 
        1   196 1 1 12 ILE CD1  C  -0.755  12.712   9.850 1.00 . A A . 12 ILE CD1  1 1 
        1   197 1 1 12 ILE CG1  C  -1.262  11.877  11.028 1.00 . A A . 12 ILE CG1  1 1 
        1   198 1 1 12 ILE CG2  C  -2.030  13.823  12.390 1.00 . A A . 12 ILE CG2  1 1 
        1   199 1 1 12 ILE H    H  -3.554  10.311  10.939 1.00 . A A . 12 ILE H    1 1 
        1   200 1 1 12 ILE HA   H  -2.389  11.217  13.310 1.00 . A A . 12 ILE HA   1 1 
        1   201 1 1 12 ILE HB   H  -3.186  12.824  10.879 1.00 . A A . 12 ILE HB   1 1 
        1   202 1 1 12 ILE HD11 H  -1.440  12.616   9.020 1.00 . A A . 12 ILE HD11 1 1 
        1   203 1 1 12 ILE HD12 H   0.222  12.359   9.554 1.00 . A A . 12 ILE HD12 1 1 
        1   204 1 1 12 ILE HD13 H  -0.690  13.748  10.145 1.00 . A A . 12 ILE HD13 1 1 
        1   205 1 1 12 ILE HG12 H  -0.481  11.786  11.768 1.00 . A A . 12 ILE HG12 1 1 
        1   206 1 1 12 ILE HG13 H  -1.541  10.895  10.676 1.00 . A A . 12 ILE HG13 1 1 
        1   207 1 1 12 ILE HG21 H  -1.525  13.547  13.304 1.00 . A A . 12 ILE HG21 1 1 
        1   208 1 1 12 ILE HG22 H  -2.892  14.430  12.626 1.00 . A A . 12 ILE HG22 1 1 
        1   209 1 1 12 ILE HG23 H  -1.355  14.385  11.760 1.00 . A A . 12 ILE HG23 1 1 
        1   210 1 1 12 ILE N    N  -3.734  10.466  11.889 1.00 . A A . 12 ILE N    1 1 
        1   211 1 1 12 ILE O    O  -4.112  12.639  14.617 1.00 . A A . 12 ILE O    1 1 
        1   212 1 1 13 ILE C    C  -7.060  12.505  14.485 1.00 . A A . 13 ILE C    1 1 
        1   213 1 1 13 ILE CA   C  -6.456  13.287  13.279 1.00 . A A . 13 ILE CA   1 1 
        1   214 1 1 13 ILE CB   C  -7.531  13.514  12.205 1.00 . A A . 13 ILE CB   1 1 
        1   215 1 1 13 ILE CD1  C  -7.973  14.587   9.991 1.00 . A A . 13 ILE CD1  1 1 
        1   216 1 1 13 ILE CG1  C  -7.025  14.543  11.190 1.00 . A A . 13 ILE CG1  1 1 
        1   217 1 1 13 ILE CG2  C  -8.816  14.038  12.859 1.00 . A A . 13 ILE CG2  1 1 
        1   218 1 1 13 ILE H    H  -5.203  12.223  11.813 1.00 . A A . 13 ILE H    1 1 
        1   219 1 1 13 ILE HA   H  -6.135  14.245  13.661 1.00 . A A . 13 ILE HA   1 1 
        1   220 1 1 13 ILE HB   H  -7.738  12.581  11.702 1.00 . A A . 13 ILE HB   1 1 
        1   221 1 1 13 ILE HD11 H  -8.959  14.874  10.323 1.00 . A A . 13 ILE HD11 1 1 
        1   222 1 1 13 ILE HD12 H  -8.019  13.611   9.532 1.00 . A A . 13 ILE HD12 1 1 
        1   223 1 1 13 ILE HD13 H  -7.613  15.307   9.271 1.00 . A A . 13 ILE HD13 1 1 
        1   224 1 1 13 ILE HG12 H  -6.986  15.518  11.656 1.00 . A A . 13 ILE HG12 1 1 
        1   225 1 1 13 ILE HG13 H  -6.037  14.265  10.856 1.00 . A A . 13 ILE HG13 1 1 
        1   226 1 1 13 ILE HG21 H  -9.308  13.232  13.382 1.00 . A A . 13 ILE HG21 1 1 
        1   227 1 1 13 ILE HG22 H  -9.476  14.430  12.101 1.00 . A A . 13 ILE HG22 1 1 
        1   228 1 1 13 ILE HG23 H  -8.567  14.823  13.560 1.00 . A A . 13 ILE HG23 1 1 
        1   229 1 1 13 ILE N    N  -5.291  12.597  12.714 1.00 . A A . 13 ILE N    1 1 
        1   230 1 1 13 ILE O    O  -7.320  13.091  15.536 1.00 . A A . 13 ILE O    1 1 
        1   231 1 1 14 GLY C    C  -6.564   9.882  16.411 1.00 . A A . 14 GLY C    1 1 
        1   232 1 1 14 GLY CA   C  -7.706  10.340  15.459 1.00 . A A . 14 GLY CA   1 1 
        1   233 1 1 14 GLY H    H  -6.834  10.801  13.525 1.00 . A A . 14 GLY H    1 1 
        1   234 1 1 14 GLY HA2  H  -8.430  10.901  16.029 1.00 . A A . 14 GLY HA2  1 1 
        1   235 1 1 14 GLY HA3  H  -8.188   9.465  15.047 1.00 . A A . 14 GLY HA3  1 1 
        1   236 1 1 14 GLY N    N  -7.210  11.190  14.343 1.00 . A A . 14 GLY N    1 1 
        1   237 1 1 14 GLY O    O  -6.760   9.630  17.601 1.00 . A A . 14 GLY O    1 1 
        1   238 1 1 15 THR C    C  -3.568  10.454  17.391 1.00 . A A . 15 THR C    1 1 
        1   239 1 1 15 THR CA   C  -4.151   9.361  16.496 1.00 . A A . 15 THR CA   1 1 
        1   240 1 1 15 THR CB   C  -3.070   8.865  15.529 1.00 . A A . 15 THR CB   1 1 
        1   241 1 1 15 THR CG2  C  -1.875   8.330  16.325 1.00 . A A . 15 THR CG2  1 1 
        1   242 1 1 15 THR H    H  -5.441  10.082  14.884 1.00 . A A . 15 THR H    1 1 
        1   243 1 1 15 THR HA   H  -4.415   8.535  17.141 1.00 . A A . 15 THR HA   1 1 
        1   244 1 1 15 THR HB   H  -2.737   9.675  14.910 1.00 . A A . 15 THR HB   1 1 
        1   245 1 1 15 THR HG1  H  -2.987   7.671  13.995 1.00 . A A . 15 THR HG1  1 1 
        1   246 1 1 15 THR HG21 H  -1.273   7.704  15.684 1.00 . A A . 15 THR HG21 1 1 
        1   247 1 1 15 THR HG22 H  -2.226   7.749  17.165 1.00 . A A . 15 THR HG22 1 1 
        1   248 1 1 15 THR HG23 H  -1.280   9.157  16.680 1.00 . A A . 15 THR HG23 1 1 
        1   249 1 1 15 THR N    N  -5.395   9.787  15.812 1.00 . A A . 15 THR N    1 1 
        1   250 1 1 15 THR O    O  -2.911  10.154  18.389 1.00 . A A . 15 THR O    1 1 
        1   251 1 1 15 THR OG1  O  -3.594   7.817  14.725 1.00 . A A . 15 THR OG1  1 1 
        1   252 1 1 16 THR C    C  -4.174  13.016  19.124 1.00 . A A . 16 THR C    1 1 
        1   253 1 1 16 THR CA   C  -3.342  12.836  17.859 1.00 . A A . 16 THR CA   1 1 
        1   254 1 1 16 THR CB   C  -3.350  14.129  17.035 1.00 . A A . 16 THR CB   1 1 
        1   255 1 1 16 THR CG2  C  -2.255  14.083  15.955 1.00 . A A . 16 THR CG2  1 1 
        1   256 1 1 16 THR H    H  -4.421  11.912  16.305 1.00 . A A . 16 THR H    1 1 
        1   257 1 1 16 THR HA   H  -2.325  12.629  18.158 1.00 . A A . 16 THR HA   1 1 
        1   258 1 1 16 THR HB   H  -3.164  14.966  17.692 1.00 . A A . 16 THR HB   1 1 
        1   259 1 1 16 THR HG1  H  -4.564  13.986  15.521 1.00 . A A . 16 THR HG1  1 1 
        1   260 1 1 16 THR HG21 H  -2.568  14.667  15.102 1.00 . A A . 16 THR HG21 1 1 
        1   261 1 1 16 THR HG22 H  -2.079  13.063  15.646 1.00 . A A . 16 THR HG22 1 1 
        1   262 1 1 16 THR HG23 H  -1.337  14.495  16.353 1.00 . A A . 16 THR HG23 1 1 
        1   263 1 1 16 THR N    N  -3.824  11.712  17.057 1.00 . A A . 16 THR N    1 1 
        1   264 1 1 16 THR O    O  -3.691  13.526  20.134 1.00 . A A . 16 THR O    1 1 
        1   265 1 1 16 THR OG1  O  -4.624  14.294  16.429 1.00 . A A . 16 THR OG1  1 1 
        1   266 1 1 17 LEU C    C  -6.190  11.797  21.297 1.00 . A A . 17 LEU C    1 1 
        1   267 1 1 17 LEU CA   C  -6.406  12.760  20.128 1.00 . A A . 17 LEU CA   1 1 
        1   268 1 1 17 LEU CB   C  -7.825  12.568  19.567 1.00 . A A . 17 LEU CB   1 1 
        1   269 1 1 17 LEU CD1  C  -9.012  14.711  20.225 1.00 . A A . 17 LEU CD1  1 1 
        1   270 1 1 17 LEU CD2  C -10.235  12.516  20.293 1.00 . A A . 17 LEU CD2  1 1 
        1   271 1 1 17 LEU CG   C  -8.876  13.200  20.507 1.00 . A A . 17 LEU CG   1 1 
        1   272 1 1 17 LEU H    H  -5.797  12.232  18.216 1.00 . A A . 17 LEU H    1 1 
        1   273 1 1 17 LEU HA   H  -6.336  13.749  20.545 1.00 . A A . 17 LEU HA   1 1 
        1   274 1 1 17 LEU HB2  H  -7.887  13.035  18.594 1.00 . A A . 17 LEU HB2  1 1 
        1   275 1 1 17 LEU HB3  H  -8.022  11.510  19.466 1.00 . A A . 17 LEU HB3  1 1 
        1   276 1 1 17 LEU HD11 H  -8.057  15.120  19.929 1.00 . A A . 17 LEU HD11 1 1 
        1   277 1 1 17 LEU HD12 H  -9.350  15.211  21.120 1.00 . A A . 17 LEU HD12 1 1 
        1   278 1 1 17 LEU HD13 H  -9.729  14.873  19.433 1.00 . A A . 17 LEU HD13 1 1 
        1   279 1 1 17 LEU HD21 H -10.991  13.031  20.866 1.00 . A A . 17 LEU HD21 1 1 
        1   280 1 1 17 LEU HD22 H -10.176  11.488  20.619 1.00 . A A . 17 LEU HD22 1 1 
        1   281 1 1 17 LEU HD23 H -10.493  12.546  19.244 1.00 . A A . 17 LEU HD23 1 1 
        1   282 1 1 17 LEU HG   H  -8.569  13.061  21.533 1.00 . A A . 17 LEU HG   1 1 
        1   283 1 1 17 LEU N    N  -5.441  12.628  19.040 1.00 . A A . 17 LEU N    1 1 
        1   284 1 1 17 LEU O    O  -6.631  12.096  22.407 1.00 . A A . 17 LEU O    1 1 
        1   285 1 1 18 VAL C    C  -4.648  10.402  23.353 1.00 . A A . 18 VAL C    1 1 
        1   286 1 1 18 VAL CA   C  -5.433   9.726  22.228 1.00 . A A . 18 VAL CA   1 1 
        1   287 1 1 18 VAL CB   C  -4.726   8.436  21.787 1.00 . A A . 18 VAL CB   1 1 
        1   288 1 1 18 VAL CG1  C  -5.576   7.729  20.725 1.00 . A A . 18 VAL CG1  1 1 
        1   289 1 1 18 VAL CG2  C  -3.341   8.763  21.203 1.00 . A A . 18 VAL CG2  1 1 
        1   290 1 1 18 VAL H    H  -5.201  10.393  20.222 1.00 . A A . 18 VAL H    1 1 
        1   291 1 1 18 VAL HA   H  -6.443   9.481  22.523 1.00 . A A . 18 VAL HA   1 1 
        1   292 1 1 18 VAL HB   H  -4.611   7.784  22.642 1.00 . A A . 18 VAL HB   1 1 
        1   293 1 1 18 VAL HG11 H  -5.531   8.284  19.799 1.00 . A A . 18 VAL HG11 1 1 
        1   294 1 1 18 VAL HG12 H  -6.602   7.673  21.060 1.00 . A A . 18 VAL HG12 1 1 
        1   295 1 1 18 VAL HG13 H  -5.196   6.732  20.565 1.00 . A A . 18 VAL HG13 1 1 
        1   296 1 1 18 VAL HG21 H  -2.629   8.872  22.007 1.00 . A A . 18 VAL HG21 1 1 
        1   297 1 1 18 VAL HG22 H  -3.391   9.683  20.639 1.00 . A A . 18 VAL HG22 1 1 
        1   298 1 1 18 VAL HG23 H  -3.022   7.962  20.550 1.00 . A A . 18 VAL HG23 1 1 
        1   299 1 1 18 VAL N    N  -5.571  10.638  21.096 1.00 . A A . 18 VAL N    1 1 
        1   300 1 1 18 VAL O    O  -5.081  10.457  24.504 1.00 . A A . 18 VAL O    1 1 
        1   301 1 1 19 ALA C    C  -3.165  12.755  24.582 1.00 . A A . 19 ALA C    1 1 
        1   302 1 1 19 ALA CA   C  -2.542  11.540  23.903 1.00 . A A . 19 ALA CA   1 1 
        1   303 1 1 19 ALA CB   C  -1.290  11.980  23.144 1.00 . A A . 19 ALA CB   1 1 
        1   304 1 1 19 ALA H    H  -3.183  10.735  22.055 1.00 . A A . 19 ALA H    1 1 
        1   305 1 1 19 ALA HA   H  -2.245  10.827  24.655 1.00 . A A . 19 ALA HA   1 1 
        1   306 1 1 19 ALA HB1  H  -1.577  12.566  22.284 1.00 . A A . 19 ALA HB1  1 1 
        1   307 1 1 19 ALA HB2  H  -0.741  11.107  22.819 1.00 . A A . 19 ALA HB2  1 1 
        1   308 1 1 19 ALA HB3  H  -0.666  12.575  23.793 1.00 . A A . 19 ALA HB3  1 1 
        1   309 1 1 19 ALA N    N  -3.466  10.886  22.980 1.00 . A A . 19 ALA N    1 1 
        1   310 1 1 19 ALA O    O  -2.849  13.060  25.732 1.00 . A A . 19 ALA O    1 1 
        1   311 1 1 20 LEU C    C  -5.638  14.183  25.590 1.00 . A A . 20 LEU C    1 1 
        1   312 1 1 20 LEU CA   C  -4.700  14.613  24.463 1.00 . A A . 20 LEU CA   1 1 
        1   313 1 1 20 LEU CB   C  -5.473  15.401  23.403 1.00 . A A . 20 LEU CB   1 1 
        1   314 1 1 20 LEU CD1  C  -5.312  16.641  21.230 1.00 . A A . 20 LEU CD1  1 1 
        1   315 1 1 20 LEU CD2  C  -3.477  16.875  22.935 1.00 . A A . 20 LEU CD2  1 1 
        1   316 1 1 20 LEU CG   C  -4.512  15.914  22.319 1.00 . A A . 20 LEU CG   1 1 
        1   317 1 1 20 LEU H    H  -4.294  13.123  22.982 1.00 . A A . 20 LEU H    1 1 
        1   318 1 1 20 LEU HA   H  -3.948  15.243  24.909 1.00 . A A . 20 LEU HA   1 1 
        1   319 1 1 20 LEU HB2  H  -6.215  14.760  22.950 1.00 . A A . 20 LEU HB2  1 1 
        1   320 1 1 20 LEU HB3  H  -5.965  16.242  23.869 1.00 . A A . 20 LEU HB3  1 1 
        1   321 1 1 20 LEU HD11 H  -4.717  16.705  20.331 1.00 . A A . 20 LEU HD11 1 1 
        1   322 1 1 20 LEU HD12 H  -5.559  17.637  21.568 1.00 . A A . 20 LEU HD12 1 1 
        1   323 1 1 20 LEU HD13 H  -6.222  16.098  21.020 1.00 . A A . 20 LEU HD13 1 1 
        1   324 1 1 20 LEU HD21 H  -3.930  17.437  23.739 1.00 . A A . 20 LEU HD21 1 1 
        1   325 1 1 20 LEU HD22 H  -3.116  17.559  22.179 1.00 . A A . 20 LEU HD22 1 1 
        1   326 1 1 20 LEU HD23 H  -2.643  16.305  23.321 1.00 . A A . 20 LEU HD23 1 1 
        1   327 1 1 20 LEU HG   H  -4.000  15.071  21.877 1.00 . A A . 20 LEU HG   1 1 
        1   328 1 1 20 LEU N    N  -4.054  13.443  23.878 1.00 . A A . 20 LEU N    1 1 
        1   329 1 1 20 LEU O    O  -5.643  14.793  26.659 1.00 . A A . 20 LEU O    1 1 
        1   330 1 1 21 SER C    C  -6.638  11.812  27.446 1.00 . A A . 21 SER C    1 1 
        1   331 1 1 21 SER CA   C  -7.350  12.648  26.383 1.00 . A A . 21 SER CA   1 1 
        1   332 1 1 21 SER CB   C  -8.443  11.806  25.725 1.00 . A A . 21 SER CB   1 1 
        1   333 1 1 21 SER H    H  -6.406  12.681  24.492 1.00 . A A . 21 SER H    1 1 
        1   334 1 1 21 SER HA   H  -7.815  13.504  26.848 1.00 . A A . 21 SER HA   1 1 
        1   335 1 1 21 SER HB2  H  -7.995  11.018  25.144 1.00 . A A . 21 SER HB2  1 1 
        1   336 1 1 21 SER HB3  H  -9.072  11.372  26.492 1.00 . A A . 21 SER HB3  1 1 
        1   337 1 1 21 SER HG   H -10.147  12.483  25.073 1.00 . A A . 21 SER HG   1 1 
        1   338 1 1 21 SER N    N  -6.425  13.135  25.361 1.00 . A A . 21 SER N    1 1 
        1   339 1 1 21 SER O    O  -7.113  11.681  28.562 1.00 . A A . 21 SER O    1 1 
        1   340 1 1 21 SER OG   O  -9.221  12.633  24.871 1.00 . A A . 21 SER OG   1 1 
        1   341 1 1 22 SER C    C  -3.770  11.093  28.843 1.00 . A A . 22 SER C    1 1 
        1   342 1 1 22 SER CA   C  -4.750  10.331  27.938 1.00 . A A . 22 SER CA   1 1 
        1   343 1 1 22 SER CB   C  -3.978   9.303  27.113 1.00 . A A . 22 SER CB   1 1 
        1   344 1 1 22 SER H    H  -5.255  11.374  26.116 1.00 . A A . 22 SER H    1 1 
        1   345 1 1 22 SER HA   H  -5.438   9.798  28.575 1.00 . A A . 22 SER HA   1 1 
        1   346 1 1 22 SER HB2  H  -3.342   9.809  26.411 1.00 . A A . 22 SER HB2  1 1 
        1   347 1 1 22 SER HB3  H  -3.371   8.697  27.772 1.00 . A A . 22 SER HB3  1 1 
        1   348 1 1 22 SER HG   H  -4.969   7.647  26.875 1.00 . A A . 22 SER HG   1 1 
        1   349 1 1 22 SER N    N  -5.524  11.210  27.044 1.00 . A A . 22 SER N    1 1 
        1   350 1 1 22 SER O    O  -3.308  10.551  29.847 1.00 . A A . 22 SER O    1 1 
        1   351 1 1 22 SER OG   O  -4.898   8.482  26.405 1.00 . A A . 22 SER OG   1 1 
        1   352 1 1 23 PHE C    C  -3.295  13.724  30.603 1.00 . A A . 23 PHE C    1 1 
        1   353 1 1 23 PHE CA   C  -2.554  13.115  29.380 1.00 . A A . 23 PHE CA   1 1 
        1   354 1 1 23 PHE CB   C  -1.839  14.216  28.571 1.00 . A A . 23 PHE CB   1 1 
        1   355 1 1 23 PHE CD1  C  -0.377  12.411  27.550 1.00 . A A . 23 PHE CD1  1 1 
        1   356 1 1 23 PHE CD2  C   0.588  14.591  27.995 1.00 . A A . 23 PHE CD2  1 1 
        1   357 1 1 23 PHE CE1  C   0.849  11.972  27.036 1.00 . A A . 23 PHE CE1  1 1 
        1   358 1 1 23 PHE CE2  C   1.815  14.152  27.481 1.00 . A A . 23 PHE CE2  1 1 
        1   359 1 1 23 PHE CG   C  -0.508  13.720  28.030 1.00 . A A . 23 PHE CG   1 1 
        1   360 1 1 23 PHE CZ   C   1.945  12.843  27.001 1.00 . A A . 23 PHE CZ   1 1 
        1   361 1 1 23 PHE H    H  -3.937  12.713  27.731 1.00 . A A . 23 PHE H    1 1 
        1   362 1 1 23 PHE HA   H  -1.825  12.450  29.824 1.00 . A A . 23 PHE HA   1 1 
        1   363 1 1 23 PHE HB2  H  -2.467  14.507  27.742 1.00 . A A . 23 PHE HB2  1 1 
        1   364 1 1 23 PHE HB3  H  -1.664  15.078  29.201 1.00 . A A . 23 PHE HB3  1 1 
        1   365 1 1 23 PHE HD1  H  -1.222  11.739  27.577 1.00 . A A . 23 PHE HD1  1 1 
        1   366 1 1 23 PHE HD2  H   0.488  15.600  28.364 1.00 . A A . 23 PHE HD2  1 1 
        1   367 1 1 23 PHE HE1  H   0.950  10.963  26.667 1.00 . A A . 23 PHE HE1  1 1 
        1   368 1 1 23 PHE HE2  H   2.660  14.823  27.454 1.00 . A A . 23 PHE HE2  1 1 
        1   369 1 1 23 PHE HZ   H   2.891  12.509  26.606 1.00 . A A . 23 PHE HZ   1 1 
        1   370 1 1 23 PHE N    N  -3.472  12.348  28.512 1.00 . A A . 23 PHE N    1 1 
        1   371 1 1 23 PHE O    O  -2.733  13.722  31.699 1.00 . A A . 23 PHE O    1 1 
        1   372 1 1 24 THR C    C  -5.683  13.996  32.696 1.00 . A A . 24 THR C    1 1 
        1   373 1 1 24 THR CA   C  -5.177  14.947  31.591 1.00 . A A . 24 THR CA   1 1 
        1   374 1 1 24 THR CB   C  -6.353  15.803  31.086 1.00 . A A . 24 THR CB   1 1 
        1   375 1 1 24 THR CG2  C  -6.042  16.331  29.682 1.00 . A A . 24 THR CG2  1 1 
        1   376 1 1 24 THR H    H  -4.872  14.453  29.555 1.00 . A A . 24 THR H    1 1 
        1   377 1 1 24 THR HA   H  -4.464  15.617  32.048 1.00 . A A . 24 THR HA   1 1 
        1   378 1 1 24 THR HB   H  -6.505  16.641  31.752 1.00 . A A . 24 THR HB   1 1 
        1   379 1 1 24 THR HG1  H  -7.678  14.647  31.914 1.00 . A A . 24 THR HG1  1 1 
        1   380 1 1 24 THR HG21 H  -6.699  17.157  29.455 1.00 . A A . 24 THR HG21 1 1 
        1   381 1 1 24 THR HG22 H  -6.194  15.541  28.961 1.00 . A A . 24 THR HG22 1 1 
        1   382 1 1 24 THR HG23 H  -5.016  16.665  29.640 1.00 . A A . 24 THR HG23 1 1 
        1   383 1 1 24 THR N    N  -4.494  14.297  30.446 1.00 . A A . 24 THR N    1 1 
        1   384 1 1 24 THR O    O  -5.680  14.360  33.873 1.00 . A A . 24 THR O    1 1 
        1   385 1 1 24 THR OG1  O  -7.536  15.020  31.042 1.00 . A A . 24 THR OG1  1 1 
        1   386 1 1 25 PRO C    C  -5.944  11.579  34.567 1.00 . A A . 25 PRO C    1 1 
        1   387 1 1 25 PRO CA   C  -6.778  11.863  33.318 1.00 . A A . 25 PRO CA   1 1 
        1   388 1 1 25 PRO CB   C  -6.945  10.590  32.485 1.00 . A A . 25 PRO CB   1 1 
        1   389 1 1 25 PRO CD   C  -6.221  12.315  30.980 1.00 . A A . 25 PRO CD   1 1 
        1   390 1 1 25 PRO CG   C  -7.125  11.084  31.096 1.00 . A A . 25 PRO CG   1 1 
        1   391 1 1 25 PRO HA   H  -7.754  12.210  33.614 1.00 . A A . 25 PRO HA   1 1 
        1   392 1 1 25 PRO HB2  H  -6.058   9.971  32.557 1.00 . A A . 25 PRO HB2  1 1 
        1   393 1 1 25 PRO HB3  H  -7.818  10.038  32.802 1.00 . A A . 25 PRO HB3  1 1 
        1   394 1 1 25 PRO HD2  H  -5.239  12.024  30.664 1.00 . A A . 25 PRO HD2  1 1 
        1   395 1 1 25 PRO HD3  H  -6.639  13.046  30.314 1.00 . A A . 25 PRO HD3  1 1 
        1   396 1 1 25 PRO HG2  H  -6.822  10.320  30.393 1.00 . A A . 25 PRO HG2  1 1 
        1   397 1 1 25 PRO HG3  H  -8.152  11.368  30.925 1.00 . A A . 25 PRO HG3  1 1 
        1   398 1 1 25 PRO N    N  -6.178  12.841  32.348 1.00 . A A . 25 PRO N    1 1 
        1   399 1 1 25 PRO O    O  -6.500  11.166  35.585 1.00 . A A . 25 PRO O    1 1 
        1   400 1 1 26 VAL C    C  -4.240  12.433  36.863 1.00 . A A . 26 VAL C    1 1 
        1   401 1 1 26 VAL CA   C  -3.821  11.527  35.703 1.00 . A A . 26 VAL CA   1 1 
        1   402 1 1 26 VAL CB   C  -2.343  11.754  35.366 1.00 . A A . 26 VAL CB   1 1 
        1   403 1 1 26 VAL CG1  C  -1.495  11.688  36.640 1.00 . A A . 26 VAL CG1  1 1 
        1   404 1 1 26 VAL CG2  C  -1.878  10.672  34.388 1.00 . A A . 26 VAL CG2  1 1 
        1   405 1 1 26 VAL H    H  -4.195  12.157  33.730 1.00 . A A . 26 VAL H    1 1 
        1   406 1 1 26 VAL HA   H  -3.955  10.498  36.003 1.00 . A A . 26 VAL HA   1 1 
        1   407 1 1 26 VAL HB   H  -2.228  12.727  34.909 1.00 . A A . 26 VAL HB   1 1 
        1   408 1 1 26 VAL HG11 H  -1.792  10.832  37.227 1.00 . A A . 26 VAL HG11 1 1 
        1   409 1 1 26 VAL HG12 H  -1.642  12.589  37.218 1.00 . A A . 26 VAL HG12 1 1 
        1   410 1 1 26 VAL HG13 H  -0.452  11.598  36.372 1.00 . A A . 26 VAL HG13 1 1 
        1   411 1 1 26 VAL HG21 H  -0.926  10.955  33.965 1.00 . A A . 26 VAL HG21 1 1 
        1   412 1 1 26 VAL HG22 H  -2.607  10.566  33.597 1.00 . A A . 26 VAL HG22 1 1 
        1   413 1 1 26 VAL HG23 H  -1.776   9.734  34.912 1.00 . A A . 26 VAL HG23 1 1 
        1   414 1 1 26 VAL N    N  -4.635  11.789  34.524 1.00 . A A . 26 VAL N    1 1 
        1   415 1 1 26 VAL O    O  -4.362  11.978  38.001 1.00 . A A . 26 VAL O    1 1 
        1   416 1 1 27 LEU C    C  -5.948  14.276  38.460 1.00 . A A . 27 LEU C    1 1 
        1   417 1 1 27 LEU CA   C  -4.757  14.708  37.604 1.00 . A A . 27 LEU CA   1 1 
        1   418 1 1 27 LEU CB   C  -5.124  16.026  36.908 1.00 . A A . 27 LEU CB   1 1 
        1   419 1 1 27 LEU CD1  C  -3.838  17.568  38.453 1.00 . A A . 27 LEU CD1  1 1 
        1   420 1 1 27 LEU CD2  C  -5.891  18.379  37.257 1.00 . A A . 27 LEU CD2  1 1 
        1   421 1 1 27 LEU CG   C  -5.230  17.172  37.931 1.00 . A A . 27 LEU CG   1 1 
        1   422 1 1 27 LEU H    H  -4.238  14.065  35.679 1.00 . A A . 27 LEU H    1 1 
        1   423 1 1 27 LEU HA   H  -3.878  14.878  38.201 1.00 . A A . 27 LEU HA   1 1 
        1   424 1 1 27 LEU HB2  H  -4.368  16.265  36.175 1.00 . A A . 27 LEU HB2  1 1 
        1   425 1 1 27 LEU HB3  H  -6.075  15.909  36.410 1.00 . A A . 27 LEU HB3  1 1 
        1   426 1 1 27 LEU HD11 H  -3.875  18.571  38.855 1.00 . A A . 27 LEU HD11 1 1 
        1   427 1 1 27 LEU HD12 H  -3.122  17.535  37.646 1.00 . A A . 27 LEU HD12 1 1 
        1   428 1 1 27 LEU HD13 H  -3.533  16.887  39.232 1.00 . A A . 27 LEU HD13 1 1 
        1   429 1 1 27 LEU HD21 H  -6.928  18.154  37.058 1.00 . A A . 27 LEU HD21 1 1 
        1   430 1 1 27 LEU HD22 H  -5.384  18.597  36.329 1.00 . A A . 27 LEU HD22 1 1 
        1   431 1 1 27 LEU HD23 H  -5.828  19.236  37.912 1.00 . A A . 27 LEU HD23 1 1 
        1   432 1 1 27 LEU HG   H  -5.840  16.852  38.762 1.00 . A A . 27 LEU HG   1 1 
        1   433 1 1 27 LEU N    N  -4.411  13.722  36.580 1.00 . A A . 27 LEU N    1 1 
        1   434 1 1 27 LEU O    O  -6.069  14.678  39.618 1.00 . A A . 27 LEU O    1 1 
        1   435 1 1 28 VAL C    C  -7.701  11.983  39.663 1.00 . A A . 28 VAL C    1 1 
        1   436 1 1 28 VAL CA   C  -8.030  13.004  38.578 1.00 . A A . 28 VAL CA   1 1 
        1   437 1 1 28 VAL CB   C  -8.994  12.377  37.564 1.00 . A A . 28 VAL CB   1 1 
        1   438 1 1 28 VAL CG1  C -10.190  11.758  38.294 1.00 . A A . 28 VAL CG1  1 1 
        1   439 1 1 28 VAL CG2  C  -9.492  13.459  36.604 1.00 . A A . 28 VAL CG2  1 1 
        1   440 1 1 28 VAL H    H  -6.699  13.160  36.963 1.00 . A A . 28 VAL H    1 1 
        1   441 1 1 28 VAL HA   H  -8.519  13.855  39.025 1.00 . A A . 28 VAL HA   1 1 
        1   442 1 1 28 VAL HB   H  -8.477  11.609  37.006 1.00 . A A . 28 VAL HB   1 1 
        1   443 1 1 28 VAL HG11 H  -9.881  10.845  38.781 1.00 . A A . 28 VAL HG11 1 1 
        1   444 1 1 28 VAL HG12 H -10.973  11.540  37.582 1.00 . A A . 28 VAL HG12 1 1 
        1   445 1 1 28 VAL HG13 H -10.559  12.454  39.032 1.00 . A A . 28 VAL HG13 1 1 
        1   446 1 1 28 VAL HG21 H  -8.653  13.881  36.070 1.00 . A A . 28 VAL HG21 1 1 
        1   447 1 1 28 VAL HG22 H  -9.989  14.237  37.165 1.00 . A A . 28 VAL HG22 1 1 
        1   448 1 1 28 VAL HG23 H -10.185  13.025  35.899 1.00 . A A . 28 VAL HG23 1 1 
        1   449 1 1 28 VAL N    N  -6.834  13.473  37.881 1.00 . A A . 28 VAL N    1 1 
        1   450 1 1 28 VAL O    O  -8.363  11.924  40.699 1.00 . A A . 28 VAL O    1 1 
        1   451 1 1 29 ILE C    C  -5.830  10.749  41.682 1.00 . A A . 29 ILE C    1 1 
        1   452 1 1 29 ILE CA   C  -6.269  10.144  40.349 1.00 . A A . 29 ILE CA   1 1 
        1   453 1 1 29 ILE CB   C  -5.120   9.322  39.756 1.00 . A A . 29 ILE CB   1 1 
        1   454 1 1 29 ILE CD1  C  -6.792   7.690  38.751 1.00 . A A . 29 ILE CD1  1 1 
        1   455 1 1 29 ILE CG1  C  -5.589   8.606  38.474 1.00 . A A . 29 ILE CG1  1 1 
        1   456 1 1 29 ILE CG2  C  -4.630   8.293  40.780 1.00 . A A . 29 ILE CG2  1 1 
        1   457 1 1 29 ILE H    H  -6.167  11.299  38.582 1.00 . A A . 29 ILE H    1 1 
        1   458 1 1 29 ILE HA   H  -7.098   9.490  40.562 1.00 . A A . 29 ILE HA   1 1 
        1   459 1 1 29 ILE HB   H  -4.304   9.988  39.512 1.00 . A A . 29 ILE HB   1 1 
        1   460 1 1 29 ILE HD11 H  -6.725   7.275  39.746 1.00 . A A . 29 ILE HD11 1 1 
        1   461 1 1 29 ILE HD12 H  -6.803   6.887  38.031 1.00 . A A . 29 ILE HD12 1 1 
        1   462 1 1 29 ILE HD13 H  -7.705   8.262  38.661 1.00 . A A . 29 ILE HD13 1 1 
        1   463 1 1 29 ILE HG12 H  -5.870   9.346  37.740 1.00 . A A . 29 ILE HG12 1 1 
        1   464 1 1 29 ILE HG13 H  -4.775   8.012  38.083 1.00 . A A . 29 ILE HG13 1 1 
        1   465 1 1 29 ILE HG21 H  -3.968   7.590  40.295 1.00 . A A . 29 ILE HG21 1 1 
        1   466 1 1 29 ILE HG22 H  -5.476   7.765  41.192 1.00 . A A . 29 ILE HG22 1 1 
        1   467 1 1 29 ILE HG23 H  -4.099   8.798  41.573 1.00 . A A . 29 ILE HG23 1 1 
        1   468 1 1 29 ILE N    N  -6.682  11.175  39.407 1.00 . A A . 29 ILE N    1 1 
        1   469 1 1 29 ILE O    O  -6.144  10.199  42.735 1.00 . A A . 29 ILE O    1 1 
        1   470 1 1 30 LEU C    C  -5.818  12.802  43.821 1.00 . A A . 30 LEU C    1 1 
        1   471 1 1 30 LEU CA   C  -4.639  12.447  42.914 1.00 . A A . 30 LEU CA   1 1 
        1   472 1 1 30 LEU CB   C  -3.814  13.705  42.630 1.00 . A A . 30 LEU CB   1 1 
        1   473 1 1 30 LEU CD1  C  -1.770  14.600  41.500 1.00 . A A . 30 LEU CD1  1 1 
        1   474 1 1 30 LEU CD2  C  -1.577  12.570  42.974 1.00 . A A . 30 LEU CD2  1 1 
        1   475 1 1 30 LEU CG   C  -2.478  13.325  41.972 1.00 . A A . 30 LEU CG   1 1 
        1   476 1 1 30 LEU H    H  -4.844  12.271  40.807 1.00 . A A . 30 LEU H    1 1 
        1   477 1 1 30 LEU HA   H  -4.031  11.744  43.459 1.00 . A A . 30 LEU HA   1 1 
        1   478 1 1 30 LEU HB2  H  -4.370  14.349  41.963 1.00 . A A . 30 LEU HB2  1 1 
        1   479 1 1 30 LEU HB3  H  -3.626  14.229  43.555 1.00 . A A . 30 LEU HB3  1 1 
        1   480 1 1 30 LEU HD11 H  -0.922  14.334  40.885 1.00 . A A . 30 LEU HD11 1 1 
        1   481 1 1 30 LEU HD12 H  -1.429  15.161  42.357 1.00 . A A . 30 LEU HD12 1 1 
        1   482 1 1 30 LEU HD13 H  -2.456  15.203  40.924 1.00 . A A . 30 LEU HD13 1 1 
        1   483 1 1 30 LEU HD21 H  -1.749  12.937  43.975 1.00 . A A . 30 LEU HD21 1 1 
        1   484 1 1 30 LEU HD22 H  -0.537  12.718  42.714 1.00 . A A . 30 LEU HD22 1 1 
        1   485 1 1 30 LEU HD23 H  -1.801  11.515  42.934 1.00 . A A . 30 LEU HD23 1 1 
        1   486 1 1 30 LEU HG   H  -2.673  12.692  41.118 1.00 . A A . 30 LEU HG   1 1 
        1   487 1 1 30 LEU N    N  -5.096  11.856  41.658 1.00 . A A . 30 LEU N    1 1 
        1   488 1 1 30 LEU O    O  -5.798  12.460  45.002 1.00 . A A . 30 LEU O    1 1 
        1   489 1 1 31 LEU C    C  -8.610  12.675  44.788 1.00 . A A . 31 LEU C    1 1 
        1   490 1 1 31 LEU CA   C  -7.936  13.903  44.179 1.00 . A A . 31 LEU CA   1 1 
        1   491 1 1 31 LEU CB   C  -8.971  14.661  43.343 1.00 . A A . 31 LEU CB   1 1 
        1   492 1 1 31 LEU CD1  C  -9.367  16.660  41.893 1.00 . A A . 31 LEU CD1  1 1 
        1   493 1 1 31 LEU CD2  C  -8.277  16.966  44.141 1.00 . A A . 31 LEU CD2  1 1 
        1   494 1 1 31 LEU CG   C  -8.417  16.031  42.918 1.00 . A A . 31 LEU CG   1 1 
        1   495 1 1 31 LEU H    H  -6.793  13.862  42.403 1.00 . A A . 31 LEU H    1 1 
        1   496 1 1 31 LEU HA   H  -7.558  14.572  44.935 1.00 . A A . 31 LEU HA   1 1 
        1   497 1 1 31 LEU HB2  H  -9.204  14.083  42.460 1.00 . A A . 31 LEU HB2  1 1 
        1   498 1 1 31 LEU HB3  H  -9.871  14.801  43.922 1.00 . A A . 31 LEU HB3  1 1 
        1   499 1 1 31 LEU HD11 H -10.387  16.547  42.229 1.00 . A A . 31 LEU HD11 1 1 
        1   500 1 1 31 LEU HD12 H  -9.244  16.168  40.940 1.00 . A A . 31 LEU HD12 1 1 
        1   501 1 1 31 LEU HD13 H  -9.137  17.710  41.787 1.00 . A A . 31 LEU HD13 1 1 
        1   502 1 1 31 LEU HD21 H  -8.377  17.996  43.827 1.00 . A A . 31 LEU HD21 1 1 
        1   503 1 1 31 LEU HD22 H  -7.305  16.830  44.589 1.00 . A A . 31 LEU HD22 1 1 
        1   504 1 1 31 LEU HD23 H  -9.043  16.740  44.870 1.00 . A A . 31 LEU HD23 1 1 
        1   505 1 1 31 LEU HG   H  -7.445  15.892  42.462 1.00 . A A . 31 LEU HG   1 1 
        1   506 1 1 31 LEU N    N  -6.822  13.512  43.319 1.00 . A A . 31 LEU N    1 1 
        1   507 1 1 31 LEU O    O  -8.959  12.653  45.969 1.00 . A A . 31 LEU O    1 1 
        1   508 1 1 32 GLY C    C  -8.503   9.765  45.499 1.00 . A A . 32 GLY C    1 1 
        1   509 1 1 32 GLY CA   C  -9.358  10.394  44.404 1.00 . A A . 32 GLY CA   1 1 
        1   510 1 1 32 GLY H    H  -8.405  11.748  43.050 1.00 . A A . 32 GLY H    1 1 
        1   511 1 1 32 GLY HA2  H -10.351  10.588  44.788 1.00 . A A . 32 GLY HA2  1 1 
        1   512 1 1 32 GLY HA3  H  -9.424   9.713  43.569 1.00 . A A . 32 GLY HA3  1 1 
        1   513 1 1 32 GLY N    N  -8.757  11.649  43.960 1.00 . A A . 32 GLY N    1 1 
        1   514 1 1 32 GLY O    O  -9.005   9.322  46.529 1.00 . A A . 32 GLY O    1 1 
        1   515 1 1 33 VAL C    C  -6.553  10.023  47.578 1.00 . A A . 33 VAL C    1 1 
        1   516 1 1 33 VAL CA   C  -6.271   9.264  46.279 1.00 . A A . 33 VAL CA   1 1 
        1   517 1 1 33 VAL CB   C  -4.811   9.454  45.846 1.00 . A A . 33 VAL CB   1 1 
        1   518 1 1 33 VAL CG1  C  -3.882   9.152  47.028 1.00 . A A . 33 VAL CG1  1 1 
        1   519 1 1 33 VAL CG2  C  -4.486   8.493  44.692 1.00 . A A . 33 VAL CG2  1 1 
        1   520 1 1 33 VAL H    H  -6.910  10.228  44.445 1.00 . A A . 33 VAL H    1 1 
        1   521 1 1 33 VAL HA   H  -6.469   8.213  46.439 1.00 . A A . 33 VAL HA   1 1 
        1   522 1 1 33 VAL HB   H  -4.661  10.474  45.522 1.00 . A A . 33 VAL HB   1 1 
        1   523 1 1 33 VAL HG11 H  -2.864   9.076  46.675 1.00 . A A . 33 VAL HG11 1 1 
        1   524 1 1 33 VAL HG12 H  -4.174   8.219  47.487 1.00 . A A . 33 VAL HG12 1 1 
        1   525 1 1 33 VAL HG13 H  -3.953   9.948  47.755 1.00 . A A . 33 VAL HG13 1 1 
        1   526 1 1 33 VAL HG21 H  -4.279   7.507  45.086 1.00 . A A . 33 VAL HG21 1 1 
        1   527 1 1 33 VAL HG22 H  -3.620   8.854  44.158 1.00 . A A . 33 VAL HG22 1 1 
        1   528 1 1 33 VAL HG23 H  -5.326   8.436  44.017 1.00 . A A . 33 VAL HG23 1 1 
        1   529 1 1 33 VAL N    N  -7.195   9.787  45.273 1.00 . A A . 33 VAL N    1 1 
        1   530 1 1 33 VAL O    O  -6.723   9.421  48.639 1.00 . A A . 33 VAL O    1 1 
        1   531 1 1 34 VAL C    C  -8.206  11.833  49.246 1.00 . A A . 34 VAL C    1 1 
        1   532 1 1 34 VAL CA   C  -6.839  12.184  48.652 1.00 . A A . 34 VAL CA   1 1 
        1   533 1 1 34 VAL CB   C  -6.813  13.663  48.250 1.00 . A A . 34 VAL CB   1 1 
        1   534 1 1 34 VAL CG1  C  -7.283  14.529  49.423 1.00 . A A . 34 VAL CG1  1 1 
        1   535 1 1 34 VAL CG2  C  -5.385  14.058  47.869 1.00 . A A . 34 VAL CG2  1 1 
        1   536 1 1 34 VAL H    H  -6.358  11.757  46.619 1.00 . A A . 34 VAL H    1 1 
        1   537 1 1 34 VAL HA   H  -6.039  12.000  49.353 1.00 . A A . 34 VAL HA   1 1 
        1   538 1 1 34 VAL HB   H  -7.468  13.818  47.405 1.00 . A A . 34 VAL HB   1 1 
        1   539 1 1 34 VAL HG11 H  -8.353  14.434  49.535 1.00 . A A . 34 VAL HG11 1 1 
        1   540 1 1 34 VAL HG12 H  -7.031  15.562  49.231 1.00 . A A . 34 VAL HG12 1 1 
        1   541 1 1 34 VAL HG13 H  -6.796  14.201  50.329 1.00 . A A . 34 VAL HG13 1 1 
        1   542 1 1 34 VAL HG21 H  -4.759  14.038  48.749 1.00 . A A . 34 VAL HG21 1 1 
        1   543 1 1 34 VAL HG22 H  -5.385  15.053  47.449 1.00 . A A . 34 VAL HG22 1 1 
        1   544 1 1 34 VAL HG23 H  -5.001  13.360  47.139 1.00 . A A . 34 VAL HG23 1 1 
        1   545 1 1 34 VAL N    N  -6.590  11.348  47.480 1.00 . A A . 34 VAL N    1 1 
        1   546 1 1 34 VAL O    O  -8.383  11.728  50.456 1.00 . A A . 34 VAL O    1 1 
        1   547 1 1 35 GLY C    C -10.508  10.009  49.537 1.00 . A A . 35 GLY C    1 1 
        1   548 1 1 35 GLY CA   C -10.525  11.317  48.750 1.00 . A A . 35 GLY CA   1 1 
        1   549 1 1 35 GLY H    H  -8.901  11.772  47.409 1.00 . A A . 35 GLY H    1 1 
        1   550 1 1 35 GLY HA2  H -10.925  12.108  49.369 1.00 . A A . 35 GLY HA2  1 1 
        1   551 1 1 35 GLY HA3  H -11.142  11.198  47.873 1.00 . A A . 35 GLY HA3  1 1 
        1   552 1 1 35 GLY N    N  -9.163  11.660  48.347 1.00 . A A . 35 GLY N    1 1 
        1   553 1 1 35 GLY O    O -11.114   9.897  50.602 1.00 . A A . 35 GLY O    1 1 
        1   554 1 1 36 LEU C    C  -8.815   7.836  50.921 1.00 . A A . 36 LEU C    1 1 
        1   555 1 1 36 LEU CA   C  -9.638   7.727  49.636 1.00 . A A . 36 LEU CA   1 1 
        1   556 1 1 36 LEU CB   C  -8.938   6.761  48.675 1.00 . A A . 36 LEU CB   1 1 
        1   557 1 1 36 LEU CD1  C  -9.062   5.647  46.434 1.00 . A A . 36 LEU CD1  1 1 
        1   558 1 1 36 LEU CD2  C -11.078   5.618  47.940 1.00 . A A . 36 LEU CD2  1 1 
        1   559 1 1 36 LEU CG   C  -9.855   6.442  47.480 1.00 . A A . 36 LEU CG   1 1 
        1   560 1 1 36 LEU H    H  -9.321   9.203  48.156 1.00 . A A . 36 LEU H    1 1 
        1   561 1 1 36 LEU HA   H -10.619   7.340  49.861 1.00 . A A . 36 LEU HA   1 1 
        1   562 1 1 36 LEU HB2  H  -8.027   7.218  48.316 1.00 . A A . 36 LEU HB2  1 1 
        1   563 1 1 36 LEU HB3  H  -8.696   5.846  49.196 1.00 . A A . 36 LEU HB3  1 1 
        1   564 1 1 36 LEU HD11 H  -8.109   6.125  46.262 1.00 . A A . 36 LEU HD11 1 1 
        1   565 1 1 36 LEU HD12 H  -9.618   5.615  45.510 1.00 . A A . 36 LEU HD12 1 1 
        1   566 1 1 36 LEU HD13 H  -8.901   4.641  46.792 1.00 . A A . 36 LEU HD13 1 1 
        1   567 1 1 36 LEU HD21 H -10.808   4.989  48.777 1.00 . A A . 36 LEU HD21 1 1 
        1   568 1 1 36 LEU HD22 H -11.429   4.997  47.127 1.00 . A A . 36 LEU HD22 1 1 
        1   569 1 1 36 LEU HD23 H -11.871   6.288  48.236 1.00 . A A . 36 LEU HD23 1 1 
        1   570 1 1 36 LEU HG   H -10.192   7.367  47.037 1.00 . A A . 36 LEU HG   1 1 
        1   571 1 1 36 LEU N    N  -9.785   9.035  49.002 1.00 . A A . 36 LEU N    1 1 
        1   572 1 1 36 LEU O    O  -9.004   7.080  51.865 1.00 . A A . 36 LEU O    1 1 
        1   573 1 1 37 SER C    C  -8.009   9.327  53.317 1.00 . A A . 37 SER C    1 1 
        1   574 1 1 37 SER CA   C  -7.090   9.025  52.130 1.00 . A A . 37 SER CA   1 1 
        1   575 1 1 37 SER CB   C  -6.114  10.179  51.924 1.00 . A A . 37 SER CB   1 1 
        1   576 1 1 37 SER H    H  -7.902   9.413  50.172 1.00 . A A . 37 SER H    1 1 
        1   577 1 1 37 SER HA   H  -6.540   8.127  52.370 1.00 . A A . 37 SER HA   1 1 
        1   578 1 1 37 SER HB2  H  -5.319  10.111  52.644 1.00 . A A . 37 SER HB2  1 1 
        1   579 1 1 37 SER HB3  H  -5.698  10.123  50.927 1.00 . A A . 37 SER HB3  1 1 
        1   580 1 1 37 SER HG   H  -6.695  11.924  51.290 1.00 . A A . 37 SER HG   1 1 
        1   581 1 1 37 SER N    N  -7.916   8.807  50.942 1.00 . A A . 37 SER N    1 1 
        1   582 1 1 37 SER O    O  -7.673   9.077  54.451 1.00 . A A . 37 SER O    1 1 
        1   583 1 1 37 SER OG   O  -6.801  11.410  52.094 1.00 . A A . 37 SER OG   1 1 
        1   584 1 1 38 ALA C    C -10.355   8.961  54.984 1.00 . A A . 38 ALA C    1 1 
        1   585 1 1 38 ALA CA   C -10.083  10.220  54.134 1.00 . A A . 38 ALA CA   1 1 
        1   586 1 1 38 ALA CB   C -11.401  10.743  53.558 1.00 . A A . 38 ALA CB   1 1 
        1   587 1 1 38 ALA H    H  -9.321  10.118  52.107 1.00 . A A . 38 ALA H    1 1 
        1   588 1 1 38 ALA HA   H  -9.628  10.997  54.730 1.00 . A A . 38 ALA HA   1 1 
        1   589 1 1 38 ALA HB1  H -11.824  10.002  52.895 1.00 . A A . 38 ALA HB1  1 1 
        1   590 1 1 38 ALA HB2  H -11.218  11.654  53.009 1.00 . A A . 38 ALA HB2  1 1 
        1   591 1 1 38 ALA HB3  H -12.093  10.940  54.363 1.00 . A A . 38 ALA HB3  1 1 
        1   592 1 1 38 ALA N    N  -9.160   9.886  53.045 1.00 . A A . 38 ALA N    1 1 
        1   593 1 1 38 ALA O    O -10.580   9.021  56.193 1.00 . A A . 38 ALA O    1 1 
        1   594 1 1 39 LEU C    C  -9.272   6.042  55.715 1.00 . A A . 39 LEU C    1 1 
        1   595 1 1 39 LEU CA   C -10.521   6.521  54.927 1.00 . A A . 39 LEU CA   1 1 
        1   596 1 1 39 LEU CB   C -10.896   5.462  53.868 1.00 . A A . 39 LEU CB   1 1 
        1   597 1 1 39 LEU CD1  C -12.692   6.950  52.962 1.00 . A A . 39 LEU CD1  1 1 
        1   598 1 1 39 LEU CD2  C -12.749   4.497  52.492 1.00 . A A . 39 LEU CD2  1 1 
        1   599 1 1 39 LEU CG   C -12.388   5.562  53.531 1.00 . A A . 39 LEU CG   1 1 
        1   600 1 1 39 LEU H    H -10.054   7.980  53.353 1.00 . A A . 39 LEU H    1 1 
        1   601 1 1 39 LEU HA   H -11.355   6.624  55.608 1.00 . A A . 39 LEU HA   1 1 
        1   602 1 1 39 LEU HB2  H -10.319   5.621  52.977 1.00 . A A . 39 LEU HB2  1 1 
        1   603 1 1 39 LEU HB3  H -10.689   4.475  54.253 1.00 . A A . 39 LEU HB3  1 1 
        1   604 1 1 39 LEU HD11 H -12.685   7.675  53.762 1.00 . A A . 39 LEU HD11 1 1 
        1   605 1 1 39 LEU HD12 H -13.665   6.942  52.492 1.00 . A A . 39 LEU HD12 1 1 
        1   606 1 1 39 LEU HD13 H -11.942   7.212  52.231 1.00 . A A . 39 LEU HD13 1 1 
        1   607 1 1 39 LEU HD21 H -12.313   3.551  52.780 1.00 . A A . 39 LEU HD21 1 1 
        1   608 1 1 39 LEU HD22 H -12.364   4.791  51.527 1.00 . A A . 39 LEU HD22 1 1 
        1   609 1 1 39 LEU HD23 H -13.822   4.396  52.437 1.00 . A A . 39 LEU HD23 1 1 
        1   610 1 1 39 LEU HG   H -12.971   5.406  54.427 1.00 . A A . 39 LEU HG   1 1 
        1   611 1 1 39 LEU N    N -10.305   7.834  54.289 1.00 . A A . 39 LEU N    1 1 
        1   612 1 1 39 LEU O    O  -9.373   5.605  56.862 1.00 . A A . 39 LEU O    1 1 
        1   613 1 1 40 THR C    C  -5.928   6.740  56.131 1.00 . A A . 40 THR C    1 1 
        1   614 1 1 40 THR CA   C  -6.839   5.607  55.628 1.00 . A A . 40 THR CA   1 1 
        1   615 1 1 40 THR CB   C  -6.069   4.891  54.516 1.00 . A A . 40 THR CB   1 1 
        1   616 1 1 40 THR CG2  C  -6.890   3.708  53.999 1.00 . A A . 40 THR CG2  1 1 
        1   617 1 1 40 THR H    H  -8.166   6.401  54.122 1.00 . A A . 40 THR H    1 1 
        1   618 1 1 40 THR HA   H  -7.044   4.862  56.384 1.00 . A A . 40 THR HA   1 1 
        1   619 1 1 40 THR HB   H  -5.130   4.528  54.904 1.00 . A A . 40 THR HB   1 1 
        1   620 1 1 40 THR HG1  H  -6.300   5.490  52.680 1.00 . A A . 40 THR HG1  1 1 
        1   621 1 1 40 THR HG21 H  -6.909   2.929  54.747 1.00 . A A . 40 THR HG21 1 1 
        1   622 1 1 40 THR HG22 H  -6.440   3.327  53.094 1.00 . A A . 40 THR HG22 1 1 
        1   623 1 1 40 THR HG23 H  -7.899   4.033  53.791 1.00 . A A . 40 THR HG23 1 1 
        1   624 1 1 40 THR N    N  -8.118   6.084  55.048 1.00 . A A . 40 THR N    1 1 
        1   625 1 1 40 THR O    O  -4.925   6.513  56.808 1.00 . A A . 40 THR O    1 1 
        1   626 1 1 40 THR OG1  O  -5.822   5.800  53.452 1.00 . A A . 40 THR OG1  1 1 
        1   627 1 1 41 GLY C    C  -4.152   9.122  55.916 1.00 . A A . 41 GLY C    1 1 
        1   628 1 1 41 GLY CA   C  -5.637   9.160  56.264 1.00 . A A . 41 GLY CA   1 1 
        1   629 1 1 41 GLY H    H  -7.241   8.003  55.441 1.00 . A A . 41 GLY H    1 1 
        1   630 1 1 41 GLY HA2  H  -6.081  10.026  55.798 1.00 . A A . 41 GLY HA2  1 1 
        1   631 1 1 41 GLY HA3  H  -5.739   9.250  57.336 1.00 . A A . 41 GLY HA3  1 1 
        1   632 1 1 41 GLY N    N  -6.343   7.949  55.823 1.00 . A A . 41 GLY N    1 1 
        1   633 1 1 41 GLY O    O  -3.315   9.564  56.703 1.00 . A A . 41 GLY O    1 1 
        1   634 1 1 42 TYR C    C  -2.117   9.621  53.266 1.00 . A A . 42 TYR C    1 1 
        1   635 1 1 42 TYR CA   C  -2.434   8.529  54.293 1.00 . A A . 42 TYR CA   1 1 
        1   636 1 1 42 TYR CB   C  -2.137   7.102  53.787 1.00 . A A . 42 TYR CB   1 1 
        1   637 1 1 42 TYR CD1  C  -3.429   7.390  51.618 1.00 . A A . 42 TYR CD1  1 1 
        1   638 1 1 42 TYR CD2  C  -1.252   6.324  51.561 1.00 . A A . 42 TYR CD2  1 1 
        1   639 1 1 42 TYR CE1  C  -3.564   7.188  50.240 1.00 . A A . 42 TYR CE1  1 1 
        1   640 1 1 42 TYR CE2  C  -1.388   6.123  50.183 1.00 . A A . 42 TYR CE2  1 1 
        1   641 1 1 42 TYR CG   C  -2.273   6.958  52.280 1.00 . A A . 42 TYR CG   1 1 
        1   642 1 1 42 TYR CZ   C  -2.544   6.555  49.522 1.00 . A A . 42 TYR CZ   1 1 
        1   643 1 1 42 TYR H    H  -4.514   8.286  54.123 1.00 . A A . 42 TYR H    1 1 
        1   644 1 1 42 TYR HA   H  -1.721   8.761  55.076 1.00 . A A . 42 TYR HA   1 1 
        1   645 1 1 42 TYR HB2  H  -1.135   6.821  54.079 1.00 . A A . 42 TYR HB2  1 1 
        1   646 1 1 42 TYR HB3  H  -2.831   6.422  54.262 1.00 . A A . 42 TYR HB3  1 1 
        1   647 1 1 42 TYR HD1  H  -4.216   7.879  52.173 1.00 . A A . 42 TYR HD1  1 1 
        1   648 1 1 42 TYR HD2  H  -0.359   5.990  52.068 1.00 . A A . 42 TYR HD2  1 1 
        1   649 1 1 42 TYR HE1  H  -4.456   7.521  49.730 1.00 . A A . 42 TYR HE1  1 1 
        1   650 1 1 42 TYR HE2  H  -0.599   5.633  49.629 1.00 . A A . 42 TYR HE2  1 1 
        1   651 1 1 42 TYR HH   H  -2.640   5.411  47.997 1.00 . A A . 42 TYR HH   1 1 
        1   652 1 1 42 TYR N    N  -3.823   8.606  54.739 1.00 . A A . 42 TYR N    1 1 
        1   653 1 1 42 TYR O    O  -1.127   9.535  52.541 1.00 . A A . 42 TYR O    1 1 
        1   654 1 1 42 TYR OH   O  -2.676   6.356  48.163 1.00 . A A . 42 TYR OH   1 1 
        1   655 1 1 43 LEU C    C  -1.439  12.335  52.339 1.00 . A A . 43 LEU C    1 1 
        1   656 1 1 43 LEU CA   C  -2.805  11.666  52.167 1.00 . A A . 43 LEU CA   1 1 
        1   657 1 1 43 LEU CB   C  -3.942  12.704  52.175 1.00 . A A . 43 LEU CB   1 1 
        1   658 1 1 43 LEU CD1  C  -3.324  13.359  54.522 1.00 . A A . 43 LEU CD1  1 1 
        1   659 1 1 43 LEU CD2  C  -5.569  13.967  53.586 1.00 . A A . 43 LEU CD2  1 1 
        1   660 1 1 43 LEU CG   C  -4.465  12.903  53.602 1.00 . A A . 43 LEU CG   1 1 
        1   661 1 1 43 LEU H    H  -3.864  10.515  53.622 1.00 . A A . 43 LEU H    1 1 
        1   662 1 1 43 LEU HA   H  -2.828  11.093  51.251 1.00 . A A . 43 LEU HA   1 1 
        1   663 1 1 43 LEU HB2  H  -3.575  13.648  51.795 1.00 . A A . 43 LEU HB2  1 1 
        1   664 1 1 43 LEU HB3  H  -4.747  12.361  51.546 1.00 . A A . 43 LEU HB3  1 1 
        1   665 1 1 43 LEU HD11 H  -2.679  14.046  53.991 1.00 . A A . 43 LEU HD11 1 1 
        1   666 1 1 43 LEU HD12 H  -2.752  12.499  54.836 1.00 . A A . 43 LEU HD12 1 1 
        1   667 1 1 43 LEU HD13 H  -3.732  13.851  55.394 1.00 . A A . 43 LEU HD13 1 1 
        1   668 1 1 43 LEU HD21 H  -6.066  13.984  54.544 1.00 . A A . 43 LEU HD21 1 1 
        1   669 1 1 43 LEU HD22 H  -6.285  13.730  52.814 1.00 . A A . 43 LEU HD22 1 1 
        1   670 1 1 43 LEU HD23 H  -5.133  14.935  53.388 1.00 . A A . 43 LEU HD23 1 1 
        1   671 1 1 43 LEU HG   H  -4.869  11.973  53.972 1.00 . A A . 43 LEU HG   1 1 
        1   672 1 1 43 LEU N    N  -2.999  10.616  53.171 1.00 . A A . 43 LEU N    1 1 
        1   673 1 1 43 LEU O    O  -0.967  13.055  51.465 1.00 . A A . 43 LEU O    1 1 
        1   674 1 1 44 ASP C    C   1.502  12.174  52.742 1.00 . A A . 44 ASP C    1 1 
        1   675 1 1 44 ASP CA   C   0.487  12.656  53.780 1.00 . A A . 44 ASP CA   1 1 
        1   676 1 1 44 ASP CB   C   0.927  12.274  55.194 1.00 . A A . 44 ASP CB   1 1 
        1   677 1 1 44 ASP CG   C   2.267  12.912  55.543 1.00 . A A . 44 ASP CG   1 1 
        1   678 1 1 44 ASP H    H  -1.259  11.469  54.110 1.00 . A A . 44 ASP H    1 1 
        1   679 1 1 44 ASP HA   H   0.421  13.728  53.682 1.00 . A A . 44 ASP HA   1 1 
        1   680 1 1 44 ASP HB2  H   0.181  12.609  55.900 1.00 . A A . 44 ASP HB2  1 1 
        1   681 1 1 44 ASP HB3  H   1.019  11.201  55.257 1.00 . A A . 44 ASP HB3  1 1 
        1   682 1 1 44 ASP N    N  -0.824  12.085  53.485 1.00 . A A . 44 ASP N    1 1 
        1   683 1 1 44 ASP O    O   2.359  12.941  52.301 1.00 . A A . 44 ASP O    1 1 
        1   684 1 1 44 ASP OD1  O   2.803  13.637  54.720 1.00 . A A . 44 ASP OD1  1 1 
        1   685 1 1 44 ASP OD2  O   2.739  12.659  56.639 1.00 . A A . 44 ASP OD2  1 1 
        1   686 1 1 45 TYR C    C   2.319  11.089  50.069 1.00 . A A . 45 TYR C    1 1 
        1   687 1 1 45 TYR CA   C   2.357  10.340  51.404 1.00 . A A . 45 TYR CA   1 1 
        1   688 1 1 45 TYR CB   C   2.044   8.859  51.162 1.00 . A A . 45 TYR CB   1 1 
        1   689 1 1 45 TYR CD1  C   3.791   7.510  52.379 1.00 . A A . 45 TYR CD1  1 1 
        1   690 1 1 45 TYR CD2  C   1.606   7.775  53.397 1.00 . A A . 45 TYR CD2  1 1 
        1   691 1 1 45 TYR CE1  C   4.204   6.731  53.466 1.00 . A A . 45 TYR CE1  1 1 
        1   692 1 1 45 TYR CE2  C   2.018   6.995  54.484 1.00 . A A . 45 TYR CE2  1 1 
        1   693 1 1 45 TYR CG   C   2.493   8.033  52.344 1.00 . A A . 45 TYR CG   1 1 
        1   694 1 1 45 TYR CZ   C   3.317   6.473  54.519 1.00 . A A . 45 TYR CZ   1 1 
        1   695 1 1 45 TYR H    H   0.753  10.323  52.801 1.00 . A A . 45 TYR H    1 1 
        1   696 1 1 45 TYR HA   H   3.358  10.418  51.802 1.00 . A A . 45 TYR HA   1 1 
        1   697 1 1 45 TYR HB2  H   0.980   8.737  51.023 1.00 . A A . 45 TYR HB2  1 1 
        1   698 1 1 45 TYR HB3  H   2.560   8.521  50.275 1.00 . A A . 45 TYR HB3  1 1 
        1   699 1 1 45 TYR HD1  H   4.475   7.709  51.567 1.00 . A A . 45 TYR HD1  1 1 
        1   700 1 1 45 TYR HD2  H   0.608   8.179  53.370 1.00 . A A . 45 TYR HD2  1 1 
        1   701 1 1 45 TYR HE1  H   5.205   6.328  53.493 1.00 . A A . 45 TYR HE1  1 1 
        1   702 1 1 45 TYR HE2  H   1.335   6.796  55.296 1.00 . A A . 45 TYR HE2  1 1 
        1   703 1 1 45 TYR HH   H   3.187   4.908  55.605 1.00 . A A . 45 TYR HH   1 1 
        1   704 1 1 45 TYR N    N   1.417  10.901  52.371 1.00 . A A . 45 TYR N    1 1 
        1   705 1 1 45 TYR O    O   3.371  11.304  49.481 1.00 . A A . 45 TYR O    1 1 
        1   706 1 1 45 TYR OH   O   3.724   5.704  55.590 1.00 . A A . 45 TYR OH   1 1 
        1   707 1 1 46 VAL C    C   2.208  12.651  47.661 1.00 . A A . 46 VAL C    1 1 
        1   708 1 1 46 VAL CA   C   0.914  12.138  48.297 1.00 . A A . 46 VAL CA   1 1 
        1   709 1 1 46 VAL CB   C  -0.048  13.318  48.478 1.00 . A A . 46 VAL CB   1 1 
        1   710 1 1 46 VAL CG1  C  -1.444  12.795  48.864 1.00 . A A . 46 VAL CG1  1 1 
        1   711 1 1 46 VAL CG2  C   0.493  14.268  49.565 1.00 . A A . 46 VAL CG2  1 1 
        1   712 1 1 46 VAL H    H   0.311  11.189  50.102 1.00 . A A . 46 VAL H    1 1 
        1   713 1 1 46 VAL HA   H   0.463  11.448  47.600 1.00 . A A . 46 VAL HA   1 1 
        1   714 1 1 46 VAL HB   H  -0.121  13.855  47.541 1.00 . A A . 46 VAL HB   1 1 
        1   715 1 1 46 VAL HG11 H  -1.349  11.917  49.487 1.00 . A A . 46 VAL HG11 1 1 
        1   716 1 1 46 VAL HG12 H  -1.991  12.537  47.969 1.00 . A A . 46 VAL HG12 1 1 
        1   717 1 1 46 VAL HG13 H  -1.985  13.561  49.403 1.00 . A A . 46 VAL HG13 1 1 
        1   718 1 1 46 VAL HG21 H  -0.321  14.844  49.982 1.00 . A A . 46 VAL HG21 1 1 
        1   719 1 1 46 VAL HG22 H   1.216  14.940  49.126 1.00 . A A . 46 VAL HG22 1 1 
        1   720 1 1 46 VAL HG23 H   0.970  13.700  50.350 1.00 . A A . 46 VAL HG23 1 1 
        1   721 1 1 46 VAL N    N   1.110  11.444  49.596 1.00 . A A . 46 VAL N    1 1 
        1   722 1 1 46 VAL O    O   2.444  12.421  46.475 1.00 . A A . 46 VAL O    1 1 
        1   723 1 1 47 LEU C    C   5.077  12.742  47.191 1.00 . A A . 47 LEU C    1 1 
        1   724 1 1 47 LEU CA   C   4.275  13.869  47.859 1.00 . A A . 47 LEU CA   1 1 
        1   725 1 1 47 LEU CB   C   5.110  14.481  48.994 1.00 . A A . 47 LEU CB   1 1 
        1   726 1 1 47 LEU CD1  C   6.195  16.109  47.403 1.00 . A A . 47 LEU CD1  1 1 
        1   727 1 1 47 LEU CD2  C   7.243  15.613  49.626 1.00 . A A . 47 LEU CD2  1 1 
        1   728 1 1 47 LEU CG   C   6.447  15.020  48.458 1.00 . A A . 47 LEU CG   1 1 
        1   729 1 1 47 LEU H    H   2.796  13.541  49.349 1.00 . A A . 47 LEU H    1 1 
        1   730 1 1 47 LEU HA   H   4.032  14.653  47.159 1.00 . A A . 47 LEU HA   1 1 
        1   731 1 1 47 LEU HB2  H   4.556  15.291  49.445 1.00 . A A . 47 LEU HB2  1 1 
        1   732 1 1 47 LEU HB3  H   5.306  13.724  49.739 1.00 . A A . 47 LEU HB3  1 1 
        1   733 1 1 47 LEU HD11 H   7.065  16.745  47.321 1.00 . A A . 47 LEU HD11 1 1 
        1   734 1 1 47 LEU HD12 H   5.342  16.706  47.691 1.00 . A A . 47 LEU HD12 1 1 
        1   735 1 1 47 LEU HD13 H   6.003  15.645  46.446 1.00 . A A . 47 LEU HD13 1 1 
        1   736 1 1 47 LEU HD21 H   8.265  15.778  49.317 1.00 . A A . 47 LEU HD21 1 1 
        1   737 1 1 47 LEU HD22 H   7.226  14.927  50.460 1.00 . A A . 47 LEU HD22 1 1 
        1   738 1 1 47 LEU HD23 H   6.801  16.552  49.923 1.00 . A A . 47 LEU HD23 1 1 
        1   739 1 1 47 LEU HG   H   7.013  14.215  48.013 1.00 . A A . 47 LEU HG   1 1 
        1   740 1 1 47 LEU N    N   3.036  13.346  48.420 1.00 . A A . 47 LEU N    1 1 
        1   741 1 1 47 LEU O    O   5.556  12.880  46.065 1.00 . A A . 47 LEU O    1 1 
        1   742 1 1 48 LEU C    C   5.333   9.877  46.139 1.00 . A A . 48 LEU C    1 1 
        1   743 1 1 48 LEU CA   C   5.970  10.477  47.417 1.00 . A A . 48 LEU CA   1 1 
        1   744 1 1 48 LEU CB   C   6.147   9.422  48.539 1.00 . A A . 48 LEU CB   1 1 
        1   745 1 1 48 LEU CD1  C   7.642  10.935  49.872 1.00 . A A . 48 LEU CD1  1 1 
        1   746 1 1 48 LEU CD2  C   7.688   8.465  50.263 1.00 . A A . 48 LEU CD2  1 1 
        1   747 1 1 48 LEU CG   C   7.525   9.561  49.205 1.00 . A A . 48 LEU CG   1 1 
        1   748 1 1 48 LEU H    H   4.805  11.623  48.804 1.00 . A A . 48 LEU H    1 1 
        1   749 1 1 48 LEU HA   H   6.947  10.835  47.125 1.00 . A A . 48 LEU HA   1 1 
        1   750 1 1 48 LEU HB2  H   5.393   9.582  49.294 1.00 . A A . 48 LEU HB2  1 1 
        1   751 1 1 48 LEU HB3  H   6.045   8.427  48.131 1.00 . A A . 48 LEU HB3  1 1 
        1   752 1 1 48 LEU HD11 H   7.804  11.690  49.118 1.00 . A A . 48 LEU HD11 1 1 
        1   753 1 1 48 LEU HD12 H   8.473  10.932  50.562 1.00 . A A . 48 LEU HD12 1 1 
        1   754 1 1 48 LEU HD13 H   6.730  11.153  50.410 1.00 . A A . 48 LEU HD13 1 1 
        1   755 1 1 48 LEU HD21 H   7.056   8.686  51.109 1.00 . A A . 48 LEU HD21 1 1 
        1   756 1 1 48 LEU HD22 H   8.719   8.425  50.582 1.00 . A A . 48 LEU HD22 1 1 
        1   757 1 1 48 LEU HD23 H   7.405   7.512  49.840 1.00 . A A . 48 LEU HD23 1 1 
        1   758 1 1 48 LEU HG   H   8.298   9.459  48.456 1.00 . A A . 48 LEU HG   1 1 
        1   759 1 1 48 LEU N    N   5.219  11.633  47.918 1.00 . A A . 48 LEU N    1 1 
        1   760 1 1 48 LEU O    O   5.974   9.899  45.088 1.00 . A A . 48 LEU O    1 1 
        1   761 1 1 49 PRO C    C   3.569   9.804  43.736 1.00 . A A . 49 PRO C    1 1 
        1   762 1 1 49 PRO CA   C   3.467   8.832  44.914 1.00 . A A . 49 PRO CA   1 1 
        1   763 1 1 49 PRO CB   C   2.005   8.625  45.323 1.00 . A A . 49 PRO CB   1 1 
        1   764 1 1 49 PRO CD   C   3.197   9.242  47.311 1.00 . A A . 49 PRO CD   1 1 
        1   765 1 1 49 PRO CG   C   2.072   8.350  46.782 1.00 . A A . 49 PRO CG   1 1 
        1   766 1 1 49 PRO HA   H   3.907   7.883  44.653 1.00 . A A . 49 PRO HA   1 1 
        1   767 1 1 49 PRO HB2  H   1.425   9.520  45.131 1.00 . A A . 49 PRO HB2  1 1 
        1   768 1 1 49 PRO HB3  H   1.578   7.779  44.803 1.00 . A A . 49 PRO HB3  1 1 
        1   769 1 1 49 PRO HD2  H   2.805  10.193  47.602 1.00 . A A . 49 PRO HD2  1 1 
        1   770 1 1 49 PRO HD3  H   3.693   8.760  48.129 1.00 . A A . 49 PRO HD3  1 1 
        1   771 1 1 49 PRO HG2  H   1.131   8.603  47.254 1.00 . A A . 49 PRO HG2  1 1 
        1   772 1 1 49 PRO HG3  H   2.314   7.313  46.958 1.00 . A A . 49 PRO HG3  1 1 
        1   773 1 1 49 PRO N    N   4.107   9.379  46.155 1.00 . A A . 49 PRO N    1 1 
        1   774 1 1 49 PRO O    O   3.589   9.385  42.579 1.00 . A A . 49 PRO O    1 1 
        1   775 1 1 50 ALA C    C   5.210  12.049  42.380 1.00 . A A . 50 ALA C    1 1 
        1   776 1 1 50 ALA CA   C   3.823  12.121  43.008 1.00 . A A . 50 ALA CA   1 1 
        1   777 1 1 50 ALA CB   C   3.599  13.510  43.609 1.00 . A A . 50 ALA CB   1 1 
        1   778 1 1 50 ALA H    H   3.717  11.396  44.970 1.00 . A A . 50 ALA H    1 1 
        1   779 1 1 50 ALA HA   H   3.126  11.969  42.200 1.00 . A A . 50 ALA HA   1 1 
        1   780 1 1 50 ALA HB1  H   2.737  13.485  44.260 1.00 . A A . 50 ALA HB1  1 1 
        1   781 1 1 50 ALA HB2  H   3.430  14.222  42.815 1.00 . A A . 50 ALA HB2  1 1 
        1   782 1 1 50 ALA HB3  H   4.470  13.801  44.176 1.00 . A A . 50 ALA HB3  1 1 
        1   783 1 1 50 ALA N    N   3.675  11.097  44.037 1.00 . A A . 50 ALA N    1 1 
        1   784 1 1 50 ALA O    O   5.372  12.351  41.198 1.00 . A A . 50 ALA O    1 1 
        1   785 1 1 51 LEU C    C   7.547  10.440  41.522 1.00 . A A . 51 LEU C    1 1 
        1   786 1 1 51 LEU CA   C   7.548  11.503  42.612 1.00 . A A . 51 LEU CA   1 1 
        1   787 1 1 51 LEU CB   C   8.528  11.094  43.716 1.00 . A A . 51 LEU CB   1 1 
        1   788 1 1 51 LEU CD1  C   9.526  11.739  45.918 1.00 . A A . 51 LEU CD1  1 1 
        1   789 1 1 51 LEU CD2  C   9.420  13.439  44.066 1.00 . A A . 51 LEU CD2  1 1 
        1   790 1 1 51 LEU CG   C   8.702  12.240  44.725 1.00 . A A . 51 LEU CG   1 1 
        1   791 1 1 51 LEU H    H   6.027  11.358  44.076 1.00 . A A . 51 LEU H    1 1 
        1   792 1 1 51 LEU HA   H   7.855  12.451  42.201 1.00 . A A . 51 LEU HA   1 1 
        1   793 1 1 51 LEU HB2  H   8.143  10.223  44.227 1.00 . A A . 51 LEU HB2  1 1 
        1   794 1 1 51 LEU HB3  H   9.485  10.854  43.277 1.00 . A A . 51 LEU HB3  1 1 
        1   795 1 1 51 LEU HD11 H   9.122  10.802  46.269 1.00 . A A . 51 LEU HD11 1 1 
        1   796 1 1 51 LEU HD12 H   9.486  12.468  46.714 1.00 . A A . 51 LEU HD12 1 1 
        1   797 1 1 51 LEU HD13 H  10.552  11.598  45.612 1.00 . A A . 51 LEU HD13 1 1 
        1   798 1 1 51 LEU HD21 H   9.955  14.004  44.817 1.00 . A A . 51 LEU HD21 1 1 
        1   799 1 1 51 LEU HD22 H   8.690  14.082  43.597 1.00 . A A . 51 LEU HD22 1 1 
        1   800 1 1 51 LEU HD23 H  10.118  13.086  43.321 1.00 . A A . 51 LEU HD23 1 1 
        1   801 1 1 51 LEU HG   H   7.728  12.553  45.075 1.00 . A A . 51 LEU HG   1 1 
        1   802 1 1 51 LEU N    N   6.203  11.627  43.151 1.00 . A A . 51 LEU N    1 1 
        1   803 1 1 51 LEU O    O   8.184  10.583  40.481 1.00 . A A . 51 LEU O    1 1 
        1   804 1 1 52 ALA C    C   6.064   8.829  39.517 1.00 . A A . 52 ALA C    1 1 
        1   805 1 1 52 ALA CA   C   6.653   8.295  40.821 1.00 . A A . 52 ALA CA   1 1 
        1   806 1 1 52 ALA CB   C   5.757   7.191  41.386 1.00 . A A . 52 ALA CB   1 1 
        1   807 1 1 52 ALA H    H   6.273   9.391  42.615 1.00 . A A . 52 ALA H    1 1 
        1   808 1 1 52 ALA HA   H   7.629   7.886  40.606 1.00 . A A . 52 ALA HA   1 1 
        1   809 1 1 52 ALA HB1  H   6.146   6.866  42.340 1.00 . A A . 52 ALA HB1  1 1 
        1   810 1 1 52 ALA HB2  H   5.738   6.356  40.702 1.00 . A A . 52 ALA HB2  1 1 
        1   811 1 1 52 ALA HB3  H   4.755   7.571  41.517 1.00 . A A . 52 ALA HB3  1 1 
        1   812 1 1 52 ALA N    N   6.784   9.384  41.779 1.00 . A A . 52 ALA N    1 1 
        1   813 1 1 52 ALA O    O   6.531   8.486  38.431 1.00 . A A . 52 ALA O    1 1 
        1   814 1 1 53 ILE C    C   5.444  11.129  37.675 1.00 . A A . 53 ILE C    1 1 
        1   815 1 1 53 ILE CA   C   4.434  10.275  38.442 1.00 . A A . 53 ILE CA   1 1 
        1   816 1 1 53 ILE CB   C   3.219  11.121  38.846 1.00 . A A . 53 ILE CB   1 1 
        1   817 1 1 53 ILE CD1  C   0.996  11.028  40.011 1.00 . A A . 53 ILE CD1  1 1 
        1   818 1 1 53 ILE CG1  C   2.120  10.196  39.384 1.00 . A A . 53 ILE CG1  1 1 
        1   819 1 1 53 ILE CG2  C   2.682  11.889  37.633 1.00 . A A . 53 ILE CG2  1 1 
        1   820 1 1 53 ILE H    H   4.721   9.933  40.517 1.00 . A A . 53 ILE H    1 1 
        1   821 1 1 53 ILE HA   H   4.114   9.513  37.748 1.00 . A A . 53 ILE HA   1 1 
        1   822 1 1 53 ILE HB   H   3.511  11.822  39.614 1.00 . A A . 53 ILE HB   1 1 
        1   823 1 1 53 ILE HD11 H   1.418  11.806  40.626 1.00 . A A . 53 ILE HD11 1 1 
        1   824 1 1 53 ILE HD12 H   0.373  10.389  40.619 1.00 . A A . 53 ILE HD12 1 1 
        1   825 1 1 53 ILE HD13 H   0.398  11.473  39.228 1.00 . A A . 53 ILE HD13 1 1 
        1   826 1 1 53 ILE HG12 H   1.720   9.606  38.573 1.00 . A A . 53 ILE HG12 1 1 
        1   827 1 1 53 ILE HG13 H   2.538   9.540  40.132 1.00 . A A . 53 ILE HG13 1 1 
        1   828 1 1 53 ILE HG21 H   1.728  12.329  37.878 1.00 . A A . 53 ILE HG21 1 1 
        1   829 1 1 53 ILE HG22 H   2.561  11.210  36.803 1.00 . A A . 53 ILE HG22 1 1 
        1   830 1 1 53 ILE HG23 H   3.378  12.670  37.361 1.00 . A A . 53 ILE HG23 1 1 
        1   831 1 1 53 ILE N    N   5.051   9.687  39.628 1.00 . A A . 53 ILE N    1 1 
        1   832 1 1 53 ILE O    O   5.599  10.951  36.471 1.00 . A A . 53 ILE O    1 1 
        1   833 1 1 54 PHE C    C   8.190  12.004  36.992 1.00 . A A . 54 PHE C    1 1 
        1   834 1 1 54 PHE CA   C   7.114  12.878  37.633 1.00 . A A . 54 PHE CA   1 1 
        1   835 1 1 54 PHE CB   C   7.751  13.873  38.604 1.00 . A A . 54 PHE CB   1 1 
        1   836 1 1 54 PHE CD1  C   8.156  15.860  37.113 1.00 . A A . 54 PHE CD1  1 1 
        1   837 1 1 54 PHE CD2  C  10.067  14.603  37.916 1.00 . A A . 54 PHE CD2  1 1 
        1   838 1 1 54 PHE CE1  C   9.016  16.728  36.427 1.00 . A A . 54 PHE CE1  1 1 
        1   839 1 1 54 PHE CE2  C  10.927  15.470  37.230 1.00 . A A . 54 PHE CE2  1 1 
        1   840 1 1 54 PHE CG   C   8.682  14.798  37.857 1.00 . A A . 54 PHE CG   1 1 
        1   841 1 1 54 PHE CZ   C  10.401  16.532  36.486 1.00 . A A . 54 PHE CZ   1 1 
        1   842 1 1 54 PHE H    H   6.002  12.204  39.294 1.00 . A A . 54 PHE H    1 1 
        1   843 1 1 54 PHE HA   H   6.621  13.420  36.840 1.00 . A A . 54 PHE HA   1 1 
        1   844 1 1 54 PHE HB2  H   6.976  14.453  39.082 1.00 . A A . 54 PHE HB2  1 1 
        1   845 1 1 54 PHE HB3  H   8.308  13.332  39.356 1.00 . A A . 54 PHE HB3  1 1 
        1   846 1 1 54 PHE HD1  H   7.088  16.011  37.067 1.00 . A A . 54 PHE HD1  1 1 
        1   847 1 1 54 PHE HD2  H  10.473  13.783  38.490 1.00 . A A . 54 PHE HD2  1 1 
        1   848 1 1 54 PHE HE1  H   8.610  17.547  35.852 1.00 . A A . 54 PHE HE1  1 1 
        1   849 1 1 54 PHE HE2  H  11.995  15.319  37.275 1.00 . A A . 54 PHE HE2  1 1 
        1   850 1 1 54 PHE HZ   H  11.063  17.202  35.957 1.00 . A A . 54 PHE HZ   1 1 
        1   851 1 1 54 PHE N    N   6.138  12.048  38.337 1.00 . A A . 54 PHE N    1 1 
        1   852 1 1 54 PHE O    O   8.601  12.248  35.858 1.00 . A A . 54 PHE O    1 1 
        1   853 1 1 55 ILE C    C   9.051   9.288  35.977 1.00 . A A . 55 ILE C    1 1 
        1   854 1 1 55 ILE CA   C   9.618  10.051  37.175 1.00 . A A . 55 ILE CA   1 1 
        1   855 1 1 55 ILE CB   C  10.026   9.057  38.272 1.00 . A A . 55 ILE CB   1 1 
        1   856 1 1 55 ILE CD1  C  10.962   8.903  40.586 1.00 . A A . 55 ILE CD1  1 1 
        1   857 1 1 55 ILE CG1  C  10.830   9.792  39.348 1.00 . A A . 55 ILE CG1  1 1 
        1   858 1 1 55 ILE CG2  C  10.892   7.943  37.672 1.00 . A A . 55 ILE CG2  1 1 
        1   859 1 1 55 ILE H    H   8.229  10.803  38.589 1.00 . A A . 55 ILE H    1 1 
        1   860 1 1 55 ILE HA   H  10.497  10.617  36.897 1.00 . A A . 55 ILE HA   1 1 
        1   861 1 1 55 ILE HB   H   9.140   8.625  38.713 1.00 . A A . 55 ILE HB   1 1 
        1   862 1 1 55 ILE HD11 H   9.997   8.801  41.061 1.00 . A A . 55 ILE HD11 1 1 
        1   863 1 1 55 ILE HD12 H  11.658   9.351  41.279 1.00 . A A . 55 ILE HD12 1 1 
        1   864 1 1 55 ILE HD13 H  11.323   7.929  40.293 1.00 . A A . 55 ILE HD13 1 1 
        1   865 1 1 55 ILE HG12 H  11.814  10.021  38.964 1.00 . A A . 55 ILE HG12 1 1 
        1   866 1 1 55 ILE HG13 H  10.329  10.709  39.614 1.00 . A A . 55 ILE HG13 1 1 
        1   867 1 1 55 ILE HG21 H  11.380   7.398  38.467 1.00 . A A . 55 ILE HG21 1 1 
        1   868 1 1 55 ILE HG22 H  11.638   8.376  37.023 1.00 . A A . 55 ILE HG22 1 1 
        1   869 1 1 55 ILE HG23 H  10.267   7.269  37.104 1.00 . A A . 55 ILE HG23 1 1 
        1   870 1 1 55 ILE N    N   8.618  10.972  37.705 1.00 . A A . 55 ILE N    1 1 
        1   871 1 1 55 ILE O    O   9.718   9.078  34.966 1.00 . A A . 55 ILE O    1 1 
        1   872 1 1 56 GLY C    C   6.777   8.976  33.872 1.00 . A A . 56 GLY C    1 1 
        1   873 1 1 56 GLY CA   C   7.093   8.121  35.103 1.00 . A A . 56 GLY CA   1 1 
        1   874 1 1 56 GLY H    H   7.352   9.113  36.976 1.00 . A A . 56 GLY H    1 1 
        1   875 1 1 56 GLY HA2  H   7.706   7.285  34.800 1.00 . A A . 56 GLY HA2  1 1 
        1   876 1 1 56 GLY HA3  H   6.168   7.746  35.513 1.00 . A A . 56 GLY HA3  1 1 
        1   877 1 1 56 GLY N    N   7.799   8.872  36.137 1.00 . A A . 56 GLY N    1 1 
        1   878 1 1 56 GLY O    O   6.939   8.525  32.738 1.00 . A A . 56 GLY O    1 1 
        1   879 1 1 57 LEU C    C   7.165  11.614  32.268 1.00 . A A . 57 LEU C    1 1 
        1   880 1 1 57 LEU CA   C   5.926  11.072  32.987 1.00 . A A . 57 LEU CA   1 1 
        1   881 1 1 57 LEU CB   C   5.055  12.239  33.511 1.00 . A A . 57 LEU CB   1 1 
        1   882 1 1 57 LEU CD1  C   3.253  10.572  34.101 1.00 . A A . 57 LEU CD1  1 1 
        1   883 1 1 57 LEU CD2  C   2.735  13.026  34.011 1.00 . A A . 57 LEU CD2  1 1 
        1   884 1 1 57 LEU CG   C   3.559  11.897  33.384 1.00 . A A . 57 LEU CG   1 1 
        1   885 1 1 57 LEU H    H   6.161  10.481  35.027 1.00 . A A . 57 LEU H    1 1 
        1   886 1 1 57 LEU HA   H   5.348  10.492  32.283 1.00 . A A . 57 LEU HA   1 1 
        1   887 1 1 57 LEU HB2  H   5.290  12.417  34.549 1.00 . A A . 57 LEU HB2  1 1 
        1   888 1 1 57 LEU HB3  H   5.259  13.138  32.944 1.00 . A A . 57 LEU HB3  1 1 
        1   889 1 1 57 LEU HD11 H   3.848  10.495  34.996 1.00 . A A . 57 LEU HD11 1 1 
        1   890 1 1 57 LEU HD12 H   3.485   9.747  33.445 1.00 . A A . 57 LEU HD12 1 1 
        1   891 1 1 57 LEU HD13 H   2.204  10.532  34.361 1.00 . A A . 57 LEU HD13 1 1 
        1   892 1 1 57 LEU HD21 H   1.683  12.830  33.863 1.00 . A A . 57 LEU HD21 1 1 
        1   893 1 1 57 LEU HD22 H   2.994  13.965  33.544 1.00 . A A . 57 LEU HD22 1 1 
        1   894 1 1 57 LEU HD23 H   2.944  13.082  35.070 1.00 . A A . 57 LEU HD23 1 1 
        1   895 1 1 57 LEU HG   H   3.302  11.804  32.339 1.00 . A A . 57 LEU HG   1 1 
        1   896 1 1 57 LEU N    N   6.294  10.196  34.101 1.00 . A A . 57 LEU N    1 1 
        1   897 1 1 57 LEU O    O   7.263  11.518  31.044 1.00 . A A . 57 LEU O    1 1 
        1   898 1 1 58 THR C    C   9.942  11.766  31.475 1.00 . A A . 58 THR C    1 1 
        1   899 1 1 58 THR CA   C   9.280  12.785  32.394 1.00 . A A . 58 THR CA   1 1 
        1   900 1 1 58 THR CB   C  10.271  13.231  33.478 1.00 . A A . 58 THR CB   1 1 
        1   901 1 1 58 THR CG2  C  10.903  12.011  34.150 1.00 . A A . 58 THR CG2  1 1 
        1   902 1 1 58 THR H    H   7.946  12.329  33.975 1.00 . A A . 58 THR H    1 1 
        1   903 1 1 58 THR HA   H   8.982  13.656  31.829 1.00 . A A . 58 THR HA   1 1 
        1   904 1 1 58 THR HB   H   9.750  13.815  34.222 1.00 . A A . 58 THR HB   1 1 
        1   905 1 1 58 THR HG1  H  12.133  13.747  33.249 1.00 . A A . 58 THR HG1  1 1 
        1   906 1 1 58 THR HG21 H  10.146  11.265  34.322 1.00 . A A . 58 THR HG21 1 1 
        1   907 1 1 58 THR HG22 H  11.340  12.305  35.094 1.00 . A A . 58 THR HG22 1 1 
        1   908 1 1 58 THR HG23 H  11.672  11.605  33.510 1.00 . A A . 58 THR HG23 1 1 
        1   909 1 1 58 THR N    N   8.090  12.211  33.014 1.00 . A A . 58 THR N    1 1 
        1   910 1 1 58 THR O    O  10.394  12.096  30.378 1.00 . A A . 58 THR O    1 1 
        1   911 1 1 58 THR OG1  O  11.289  14.026  32.885 1.00 . A A . 58 THR OG1  1 1 
        1   912 1 1 59 ILE C    C   9.666   9.238  29.873 1.00 . A A . 59 ILE C    1 1 
        1   913 1 1 59 ILE CA   C  10.511   9.433  31.129 1.00 . A A . 59 ILE CA   1 1 
        1   914 1 1 59 ILE CB   C  10.555   8.137  31.957 1.00 . A A . 59 ILE CB   1 1 
        1   915 1 1 59 ILE CD1  C  13.044   8.041  32.537 1.00 . A A . 59 ILE CD1  1 1 
        1   916 1 1 59 ILE CG1  C  11.613   8.255  33.075 1.00 . A A . 59 ILE CG1  1 1 
        1   917 1 1 59 ILE CG2  C  10.883   6.944  31.052 1.00 . A A . 59 ILE CG2  1 1 
        1   918 1 1 59 ILE H    H   9.524  10.323  32.783 1.00 . A A . 59 ILE H    1 1 
        1   919 1 1 59 ILE HA   H  11.505   9.702  30.820 1.00 . A A . 59 ILE HA   1 1 
        1   920 1 1 59 ILE HB   H   9.584   7.979  32.406 1.00 . A A . 59 ILE HB   1 1 
        1   921 1 1 59 ILE HD11 H  13.340   7.018  32.719 1.00 . A A . 59 ILE HD11 1 1 
        1   922 1 1 59 ILE HD12 H  13.721   8.704  33.054 1.00 . A A . 59 ILE HD12 1 1 
        1   923 1 1 59 ILE HD13 H  13.087   8.242  31.480 1.00 . A A . 59 ILE HD13 1 1 
        1   924 1 1 59 ILE HG12 H  11.552   9.239  33.516 1.00 . A A . 59 ILE HG12 1 1 
        1   925 1 1 59 ILE HG13 H  11.407   7.515  33.835 1.00 . A A . 59 ILE HG13 1 1 
        1   926 1 1 59 ILE HG21 H  11.694   7.206  30.388 1.00 . A A . 59 ILE HG21 1 1 
        1   927 1 1 59 ILE HG22 H  10.012   6.682  30.470 1.00 . A A . 59 ILE HG22 1 1 
        1   928 1 1 59 ILE HG23 H  11.175   6.101  31.661 1.00 . A A . 59 ILE HG23 1 1 
        1   929 1 1 59 ILE N    N   9.952  10.517  31.924 1.00 . A A . 59 ILE N    1 1 
        1   930 1 1 59 ILE O    O  10.197   9.019  28.785 1.00 . A A . 59 ILE O    1 1 
        1   931 1 1 60 TYR C    C   7.609  10.044  27.775 1.00 . A A . 60 TYR C    1 1 
        1   932 1 1 60 TYR CA   C   7.427   9.053  28.924 1.00 . A A . 60 TYR CA   1 1 
        1   933 1 1 60 TYR CB   C   5.984   9.123  29.423 1.00 . A A . 60 TYR CB   1 1 
        1   934 1 1 60 TYR CD1  C   4.731   7.469  27.986 1.00 . A A . 60 TYR CD1  1 1 
        1   935 1 1 60 TYR CD2  C   4.491   9.838  27.525 1.00 . A A . 60 TYR CD2  1 1 
        1   936 1 1 60 TYR CE1  C   3.863   7.175  26.927 1.00 . A A . 60 TYR CE1  1 1 
        1   937 1 1 60 TYR CE2  C   3.623   9.544  26.467 1.00 . A A . 60 TYR CE2  1 1 
        1   938 1 1 60 TYR CG   C   5.045   8.801  28.284 1.00 . A A . 60 TYR CG   1 1 
        1   939 1 1 60 TYR CZ   C   3.308   8.213  26.168 1.00 . A A . 60 TYR CZ   1 1 
        1   940 1 1 60 TYR H    H   7.956   9.381  30.928 1.00 . A A . 60 TYR H    1 1 
        1   941 1 1 60 TYR HA   H   7.597   8.061  28.537 1.00 . A A . 60 TYR HA   1 1 
        1   942 1 1 60 TYR HB2  H   5.844   8.409  30.221 1.00 . A A . 60 TYR HB2  1 1 
        1   943 1 1 60 TYR HB3  H   5.777  10.118  29.789 1.00 . A A . 60 TYR HB3  1 1 
        1   944 1 1 60 TYR HD1  H   5.158   6.669  28.572 1.00 . A A . 60 TYR HD1  1 1 
        1   945 1 1 60 TYR HD2  H   4.733  10.865  27.755 1.00 . A A . 60 TYR HD2  1 1 
        1   946 1 1 60 TYR HE1  H   3.621   6.149  26.697 1.00 . A A . 60 TYR HE1  1 1 
        1   947 1 1 60 TYR HE2  H   3.197  10.341  25.878 1.00 . A A . 60 TYR HE2  1 1 
        1   948 1 1 60 TYR HH   H   2.979   7.608  24.387 1.00 . A A . 60 TYR HH   1 1 
        1   949 1 1 60 TYR N    N   8.346   9.273  30.036 1.00 . A A . 60 TYR N    1 1 
        1   950 1 1 60 TYR O    O   7.451   9.663  26.621 1.00 . A A . 60 TYR O    1 1 
        1   951 1 1 60 TYR OH   O   2.452   7.923  25.125 1.00 . A A . 60 TYR OH   1 1 
        1   952 1 1 61 ALA C    C   9.170  11.721  26.024 1.00 . A A . 61 ALA C    1 1 
        1   953 1 1 61 ALA CA   C   8.056  12.238  26.929 1.00 . A A . 61 ALA CA   1 1 
        1   954 1 1 61 ALA CB   C   8.406  13.637  27.439 1.00 . A A . 61 ALA CB   1 1 
        1   955 1 1 61 ALA H    H   8.030  11.607  28.973 1.00 . A A . 61 ALA H    1 1 
        1   956 1 1 61 ALA HA   H   7.104  12.269  26.418 1.00 . A A . 61 ALA HA   1 1 
        1   957 1 1 61 ALA HB1  H   9.290  13.584  28.058 1.00 . A A . 61 ALA HB1  1 1 
        1   958 1 1 61 ALA HB2  H   7.582  14.026  28.020 1.00 . A A . 61 ALA HB2  1 1 
        1   959 1 1 61 ALA HB3  H   8.595  14.289  26.599 1.00 . A A . 61 ALA HB3  1 1 
        1   960 1 1 61 ALA N    N   7.913  11.309  28.048 1.00 . A A . 61 ALA N    1 1 
        1   961 1 1 61 ALA O    O   9.038  11.640  24.803 1.00 . A A . 61 ALA O    1 1 
        1   962 1 1 62 ILE C    C  11.213   9.820  25.059 1.00 . A A . 62 ILE C    1 1 
        1   963 1 1 62 ILE CA   C  11.500  10.992  26.002 1.00 . A A . 62 ILE CA   1 1 
        1   964 1 1 62 ILE CB   C  12.544  10.572  27.043 1.00 . A A . 62 ILE CB   1 1 
        1   965 1 1 62 ILE CD1  C  13.834  11.375  29.030 1.00 . A A . 62 ILE CD1  1 1 
        1   966 1 1 62 ILE CG1  C  13.009  11.808  27.817 1.00 . A A . 62 ILE CG1  1 1 
        1   967 1 1 62 ILE CG2  C  13.751   9.935  26.344 1.00 . A A . 62 ILE CG2  1 1 
        1   968 1 1 62 ILE H    H  10.303  11.677  27.627 1.00 . A A . 62 ILE H    1 1 
        1   969 1 1 62 ILE HA   H  11.901  11.820  25.439 1.00 . A A . 62 ILE HA   1 1 
        1   970 1 1 62 ILE HB   H  12.109   9.859  27.726 1.00 . A A . 62 ILE HB   1 1 
        1   971 1 1 62 ILE HD11 H  13.276  10.651  29.605 1.00 . A A . 62 ILE HD11 1 1 
        1   972 1 1 62 ILE HD12 H  14.047  12.236  29.646 1.00 . A A . 62 ILE HD12 1 1 
        1   973 1 1 62 ILE HD13 H  14.761  10.932  28.696 1.00 . A A . 62 ILE HD13 1 1 
        1   974 1 1 62 ILE HG12 H  13.614  12.430  27.173 1.00 . A A . 62 ILE HG12 1 1 
        1   975 1 1 62 ILE HG13 H  12.148  12.368  28.151 1.00 . A A . 62 ILE HG13 1 1 
        1   976 1 1 62 ILE HG21 H  14.575   9.866  27.038 1.00 . A A . 62 ILE HG21 1 1 
        1   977 1 1 62 ILE HG22 H  14.041  10.544  25.500 1.00 . A A . 62 ILE HG22 1 1 
        1   978 1 1 62 ILE HG23 H  13.487   8.946  26.000 1.00 . A A . 62 ILE HG23 1 1 
        1   979 1 1 62 ILE N    N  10.288  11.439  26.677 1.00 . A A . 62 ILE N    1 1 
        1   980 1 1 62 ILE O    O  11.782   9.746  23.970 1.00 . A A . 62 ILE O    1 1 
        1   981 1 1 63 GLN C    C   9.264   8.290  23.354 1.00 . A A . 63 GLN C    1 1 
        1   982 1 1 63 GLN CA   C   9.998   7.782  24.603 1.00 . A A . 63 GLN CA   1 1 
        1   983 1 1 63 GLN CB   C   9.145   6.743  25.388 1.00 . A A . 63 GLN CB   1 1 
        1   984 1 1 63 GLN CD   C   7.241   6.251  23.831 1.00 . A A . 63 GLN CD   1 1 
        1   985 1 1 63 GLN CG   C   7.626   6.926  25.146 1.00 . A A . 63 GLN CG   1 1 
        1   986 1 1 63 GLN H    H   9.876   9.032  26.324 1.00 . A A . 63 GLN H    1 1 
        1   987 1 1 63 GLN HA   H  10.918   7.313  24.279 1.00 . A A . 63 GLN HA   1 1 
        1   988 1 1 63 GLN HB2  H   9.433   5.744  25.089 1.00 . A A . 63 GLN HB2  1 1 
        1   989 1 1 63 GLN HB3  H   9.346   6.858  26.443 1.00 . A A . 63 GLN HB3  1 1 
        1   990 1 1 63 GLN HE21 H   6.196   7.796  23.149 1.00 . A A . 63 GLN HE21 1 1 
        1   991 1 1 63 GLN HE22 H   6.259   6.449  22.117 1.00 . A A . 63 GLN HE22 1 1 
        1   992 1 1 63 GLN HG2  H   7.079   6.466  25.956 1.00 . A A . 63 GLN HG2  1 1 
        1   993 1 1 63 GLN HG3  H   7.380   7.968  25.100 1.00 . A A . 63 GLN HG3  1 1 
        1   994 1 1 63 GLN N    N  10.328   8.916  25.463 1.00 . A A . 63 GLN N    1 1 
        1   995 1 1 63 GLN NE2  N   6.504   6.885  22.959 1.00 . A A . 63 GLN NE2  1 1 
        1   996 1 1 63 GLN O    O   9.454   7.779  22.250 1.00 . A A . 63 GLN O    1 1 
        1   997 1 1 63 GLN OE1  O   7.661   5.121  23.581 1.00 . A A . 63 GLN OE1  1 1 
        1   998 1 1 64 ARG C    C   8.580  10.947  21.688 1.00 . A A . 64 ARG C    1 1 
        1   999 1 1 64 ARG CA   C   7.701   9.991  22.495 1.00 . A A . 64 ARG CA   1 1 
        1  1000 1 1 64 ARG CB   C   6.533  10.772  23.110 1.00 . A A . 64 ARG CB   1 1 
        1  1001 1 1 64 ARG CD   C   4.450  12.062  22.575 1.00 . A A . 64 ARG CD   1 1 
        1  1002 1 1 64 ARG CG   C   5.724  11.444  21.996 1.00 . A A . 64 ARG CG   1 1 
        1  1003 1 1 64 ARG CZ   C   2.942  12.114  20.671 1.00 . A A . 64 ARG CZ   1 1 
        1  1004 1 1 64 ARG H    H   8.388   9.733  24.440 1.00 . A A . 64 ARG H    1 1 
        1  1005 1 1 64 ARG HA   H   7.295   9.229  21.847 1.00 . A A . 64 ARG HA   1 1 
        1  1006 1 1 64 ARG HB2  H   5.896  10.094  23.659 1.00 . A A . 64 ARG HB2  1 1 
        1  1007 1 1 64 ARG HB3  H   6.916  11.527  23.778 1.00 . A A . 64 ARG HB3  1 1 
        1  1008 1 1 64 ARG HD2  H   3.824  11.283  22.983 1.00 . A A . 64 ARG HD2  1 1 
        1  1009 1 1 64 ARG HD3  H   4.714  12.756  23.360 1.00 . A A . 64 ARG HD3  1 1 
        1  1010 1 1 64 ARG HE   H   3.835  13.736  21.430 1.00 . A A . 64 ARG HE   1 1 
        1  1011 1 1 64 ARG HG2  H   6.317  12.220  21.538 1.00 . A A . 64 ARG HG2  1 1 
        1  1012 1 1 64 ARG HG3  H   5.457  10.709  21.252 1.00 . A A . 64 ARG HG3  1 1 
        1  1013 1 1 64 ARG HH11 H   3.208  10.336  21.553 1.00 . A A . 64 ARG HH11 1 1 
        1  1014 1 1 64 ARG HH12 H   2.173  10.337  20.165 1.00 . A A . 64 ARG HH12 1 1 
        1  1015 1 1 64 ARG HH21 H   2.498  13.741  19.595 1.00 . A A . 64 ARG HH21 1 1 
        1  1016 1 1 64 ARG HH22 H   1.770  12.265  19.057 1.00 . A A . 64 ARG HH22 1 1 
        1  1017 1 1 64 ARG N    N   8.459   9.327  23.551 1.00 . A A . 64 ARG N    1 1 
        1  1018 1 1 64 ARG NE   N   3.724  12.768  21.524 1.00 . A A . 64 ARG NE   1 1 
        1  1019 1 1 64 ARG NH1  N   2.760  10.829  20.807 1.00 . A A . 64 ARG NH1  1 1 
        1  1020 1 1 64 ARG NH2  N   2.358  12.757  19.698 1.00 . A A . 64 ARG NH2  1 1 
        1  1021 1 1 64 ARG O    O   8.246  11.332  20.570 1.00 . A A . 64 ARG O    1 1 
        1  1022 1 1 65 LYS C    C  11.502  11.691  20.615 1.00 . A A . 65 LYS C    1 1 
        1  1023 1 1 65 LYS CA   C  10.633  12.301  21.718 1.00 . A A . 65 LYS CA   1 1 
        1  1024 1 1 65 LYS CB   C  11.589  12.748  22.830 1.00 . A A . 65 LYS CB   1 1 
        1  1025 1 1 65 LYS CD   C  13.416  14.345  23.445 1.00 . A A . 65 LYS CD   1 1 
        1  1026 1 1 65 LYS CE   C  14.383  15.401  22.907 1.00 . A A . 65 LYS CE   1 1 
        1  1027 1 1 65 LYS CG   C  12.516  13.854  22.309 1.00 . A A . 65 LYS CG   1 1 
        1  1028 1 1 65 LYS H    H   9.922  10.940  23.162 1.00 . A A . 65 LYS H    1 1 
        1  1029 1 1 65 LYS HA   H  10.082  13.180  21.423 1.00 . A A . 65 LYS HA   1 1 
        1  1030 1 1 65 LYS HB2  H  11.017  13.122  23.668 1.00 . A A . 65 LYS HB2  1 1 
        1  1031 1 1 65 LYS HB3  H  12.184  11.906  23.145 1.00 . A A . 65 LYS HB3  1 1 
        1  1032 1 1 65 LYS HD2  H  12.807  14.776  24.226 1.00 . A A . 65 LYS HD2  1 1 
        1  1033 1 1 65 LYS HD3  H  13.978  13.514  23.843 1.00 . A A . 65 LYS HD3  1 1 
        1  1034 1 1 65 LYS HE2  H  15.042  15.724  23.698 1.00 . A A . 65 LYS HE2  1 1 
        1  1035 1 1 65 LYS HE3  H  14.965  14.979  22.101 1.00 . A A . 65 LYS HE3  1 1 
        1  1036 1 1 65 LYS HG2  H  13.131  13.468  21.510 1.00 . A A . 65 LYS HG2  1 1 
        1  1037 1 1 65 LYS HG3  H  11.923  14.678  21.942 1.00 . A A . 65 LYS HG3  1 1 
        1  1038 1 1 65 LYS HZ1  H  13.005  16.943  23.159 1.00 . A A . 65 LYS HZ1  1 1 
        1  1039 1 1 65 LYS HZ2  H  13.014  16.269  21.600 1.00 . A A . 65 LYS HZ2  1 1 
        1  1040 1 1 65 LYS HZ3  H  14.264  17.311  22.085 1.00 . A A . 65 LYS HZ3  1 1 
        1  1041 1 1 65 LYS N    N   9.687  11.351  22.304 1.00 . A A . 65 LYS N    1 1 
        1  1042 1 1 65 LYS NZ   N  13.608  16.569  22.399 1.00 . A A . 65 LYS NZ   1 1 
        1  1043 1 1 65 LYS O    O  11.822  12.317  19.605 1.00 . A A . 65 LYS O    1 1 
        1  1044 1 1 66 ARG C    C  11.612   9.094  18.775 1.00 . A A . 66 ARG C    1 1 
        1  1045 1 1 66 ARG CA   C  12.543   9.603  19.876 1.00 . A A . 66 ARG CA   1 1 
        1  1046 1 1 66 ARG CB   C  13.199   8.418  20.589 1.00 . A A . 66 ARG CB   1 1 
        1  1047 1 1 66 ARG CD   C  14.822   7.761  22.371 1.00 . A A . 66 ARG CD   1 1 
        1  1048 1 1 66 ARG CG   C  14.249   8.934  21.575 1.00 . A A . 66 ARG CG   1 1 
        1  1049 1 1 66 ARG CZ   C  16.102   5.743  21.941 1.00 . A A . 66 ARG CZ   1 1 
        1  1050 1 1 66 ARG H    H  11.271   9.984  21.542 1.00 . A A . 66 ARG H    1 1 
        1  1051 1 1 66 ARG HA   H  13.312  10.209  19.419 1.00 . A A . 66 ARG HA   1 1 
        1  1052 1 1 66 ARG HB2  H  12.445   7.858  21.123 1.00 . A A . 66 ARG HB2  1 1 
        1  1053 1 1 66 ARG HB3  H  13.675   7.778  19.862 1.00 . A A . 66 ARG HB3  1 1 
        1  1054 1 1 66 ARG HD2  H  15.473   8.138  23.147 1.00 . A A . 66 ARG HD2  1 1 
        1  1055 1 1 66 ARG HD3  H  14.012   7.207  22.824 1.00 . A A . 66 ARG HD3  1 1 
        1  1056 1 1 66 ARG HE   H  15.719   7.136  20.556 1.00 . A A . 66 ARG HE   1 1 
        1  1057 1 1 66 ARG HG2  H  15.044   9.422  21.030 1.00 . A A . 66 ARG HG2  1 1 
        1  1058 1 1 66 ARG HG3  H  13.791   9.639  22.253 1.00 . A A . 66 ARG HG3  1 1 
        1  1059 1 1 66 ARG HH11 H  15.393   5.973  23.799 1.00 . A A . 66 ARG HH11 1 1 
        1  1060 1 1 66 ARG HH12 H  16.312   4.532  23.521 1.00 . A A . 66 ARG HH12 1 1 
        1  1061 1 1 66 ARG HH21 H  16.931   5.251  20.186 1.00 . A A . 66 ARG HH21 1 1 
        1  1062 1 1 66 ARG HH22 H  17.183   4.123  21.475 1.00 . A A . 66 ARG HH22 1 1 
        1  1063 1 1 66 ARG N    N  11.795  10.415  20.834 1.00 . A A . 66 ARG N    1 1 
        1  1064 1 1 66 ARG NE   N  15.583   6.881  21.492 1.00 . A A . 66 ARG NE   1 1 
        1  1065 1 1 66 ARG NH1  N  15.921   5.389  23.184 1.00 . A A . 66 ARG NH1  1 1 
        1  1066 1 1 66 ARG NH2  N  16.793   4.979  21.138 1.00 . A A . 66 ARG NH2  1 1 
        1  1067 1 1 66 ARG O    O  11.968   9.028  17.598 1.00 . A A . 66 ARG O    1 1 
        1  1068 1 1 67 GLN C    C   8.568   9.603  17.748 1.00 . A A . 67 GLN C    1 1 
        1  1069 1 1 67 GLN CA   C   9.294   8.389  18.324 1.00 . A A . 67 GLN CA   1 1 
        1  1070 1 1 67 GLN CB   C   8.328   7.480  19.094 1.00 . A A . 67 GLN CB   1 1 
        1  1071 1 1 67 GLN CD   C   8.215   5.243  20.267 1.00 . A A . 67 GLN CD   1 1 
        1  1072 1 1 67 GLN CG   C   9.054   6.164  19.388 1.00 . A A . 67 GLN CG   1 1 
        1  1073 1 1 67 GLN H    H  10.173   9.064  20.124 1.00 . A A . 67 GLN H    1 1 
        1  1074 1 1 67 GLN HA   H   9.718   7.823  17.506 1.00 . A A . 67 GLN HA   1 1 
        1  1075 1 1 67 GLN HB2  H   8.041   7.957  20.020 1.00 . A A . 67 GLN HB2  1 1 
        1  1076 1 1 67 GLN HB3  H   7.452   7.285  18.494 1.00 . A A . 67 GLN HB3  1 1 
        1  1077 1 1 67 GLN HE21 H   9.208   3.619  19.704 1.00 . A A . 67 GLN HE21 1 1 
        1  1078 1 1 67 GLN HE22 H   7.958   3.353  20.822 1.00 . A A . 67 GLN HE22 1 1 
        1  1079 1 1 67 GLN HG2  H   9.264   5.663  18.456 1.00 . A A . 67 GLN HG2  1 1 
        1  1080 1 1 67 GLN HG3  H   9.985   6.380  19.889 1.00 . A A . 67 GLN HG3  1 1 
        1  1081 1 1 67 GLN N    N  10.386   8.814  19.200 1.00 . A A . 67 GLN N    1 1 
        1  1082 1 1 67 GLN NE2  N   8.482   3.965  20.264 1.00 . A A . 67 GLN NE2  1 1 
        1  1083 1 1 67 GLN O    O   7.716   9.491  16.877 1.00 . A A . 67 GLN O    1 1 
        1  1084 1 1 67 GLN OE1  O   7.314   5.683  20.981 1.00 . A A . 67 GLN OE1  1 1 
        1  1085 1 1 68 ALA C    C   8.051  12.055  16.445 1.00 . A A . 68 ALA C    1 1 
        1  1086 1 1 68 ALA CA   C   8.183  11.994  17.975 1.00 . A A . 68 ALA CA   1 1 
        1  1087 1 1 68 ALA CB   C   8.996  13.203  18.450 1.00 . A A . 68 ALA CB   1 1 
        1  1088 1 1 68 ALA H    H   9.546  10.671  19.043 1.00 . A A . 68 ALA H    1 1 
        1  1089 1 1 68 ALA HA   H   7.223  12.006  18.469 1.00 . A A . 68 ALA HA   1 1 
        1  1090 1 1 68 ALA HB1  H   8.682  14.086  17.913 1.00 . A A . 68 ALA HB1  1 1 
        1  1091 1 1 68 ALA HB2  H  10.045  13.026  18.268 1.00 . A A . 68 ALA HB2  1 1 
        1  1092 1 1 68 ALA HB3  H   8.833  13.351  19.505 1.00 . A A . 68 ALA HB3  1 1 
        1  1093 1 1 68 ALA N    N   8.869  10.749  18.340 1.00 . A A . 68 ALA N    1 1 
        1  1094 1 1 68 ALA O    O   6.991  12.391  15.918 1.00 . A A . 68 ALA O    1 1 
        1  1095 1 1 69 ASP C    C   7.946  10.576  13.899 1.00 . A A . 69 ASP C    1 1 
        1  1096 1 1 69 ASP CA   C   9.057  11.551  14.288 1.00 . A A . 69 ASP CA   1 1 
        1  1097 1 1 69 ASP CB   C  10.396  11.019  13.769 1.00 . A A . 69 ASP CB   1 1 
        1  1098 1 1 69 ASP CG   C  11.465  12.098  13.900 1.00 . A A . 69 ASP CG   1 1 
        1  1099 1 1 69 ASP H    H   9.895  11.317  16.233 1.00 . A A . 69 ASP H    1 1 
        1  1100 1 1 69 ASP HA   H   8.863  12.504  13.815 1.00 . A A . 69 ASP HA   1 1 
        1  1101 1 1 69 ASP HB2  H  10.686  10.153  14.347 1.00 . A A . 69 ASP HB2  1 1 
        1  1102 1 1 69 ASP HB3  H  10.294  10.740  12.731 1.00 . A A . 69 ASP HB3  1 1 
        1  1103 1 1 69 ASP N    N   9.106  11.636  15.747 1.00 . A A . 69 ASP N    1 1 
        1  1104 1 1 69 ASP O    O   7.089  10.880  13.070 1.00 . A A . 69 ASP O    1 1 
        1  1105 1 1 69 ASP OD1  O  11.097  13.241  14.110 1.00 . A A . 69 ASP OD1  1 1 
        1  1106 1 1 69 ASP OD2  O  12.632  11.772  13.761 1.00 . A A . 69 ASP OD2  1 1 
        1  1107 1 1 70 ALA C    C   5.595   8.835  14.600 1.00 . A A . 70 ALA C    1 1 
        1  1108 1 1 70 ALA CA   C   6.998   8.356  14.237 1.00 . A A . 70 ALA CA   1 1 
        1  1109 1 1 70 ALA CB   C   7.329   7.081  15.019 1.00 . A A . 70 ALA CB   1 1 
        1  1110 1 1 70 ALA H    H   8.746   9.219  15.106 1.00 . A A . 70 ALA H    1 1 
        1  1111 1 1 70 ALA HA   H   7.022   8.129  13.182 1.00 . A A . 70 ALA HA   1 1 
        1  1112 1 1 70 ALA HB1  H   6.489   6.403  14.973 1.00 . A A . 70 ALA HB1  1 1 
        1  1113 1 1 70 ALA HB2  H   7.533   7.328  16.049 1.00 . A A . 70 ALA HB2  1 1 
        1  1114 1 1 70 ALA HB3  H   8.197   6.607  14.585 1.00 . A A . 70 ALA HB3  1 1 
        1  1115 1 1 70 ALA N    N   7.987   9.397  14.511 1.00 . A A . 70 ALA N    1 1 
        1  1116 1 1 70 ALA O    O   4.631   8.554  13.888 1.00 . A A . 70 ALA O    1 1 
        1  1117 1 1 71 SER C    C   3.226   8.925  16.408 1.00 . A A . 71 SER C    1 1 
        1  1118 1 1 71 SER CA   C   4.200  10.072  16.154 1.00 . A A . 71 SER CA   1 1 
        1  1119 1 1 71 SER CB   C   3.625  11.026  15.106 1.00 . A A . 71 SER CB   1 1 
        1  1120 1 1 71 SER H    H   6.288   9.753  16.234 1.00 . A A . 71 SER H    1 1 
        1  1121 1 1 71 SER HA   H   4.343  10.616  17.076 1.00 . A A . 71 SER HA   1 1 
        1  1122 1 1 71 SER HB2  H   4.384  11.723  14.797 1.00 . A A . 71 SER HB2  1 1 
        1  1123 1 1 71 SER HB3  H   3.290  10.460  14.247 1.00 . A A . 71 SER HB3  1 1 
        1  1124 1 1 71 SER HG   H   2.048  11.143  16.240 1.00 . A A . 71 SER HG   1 1 
        1  1125 1 1 71 SER N    N   5.488   9.559  15.709 1.00 . A A . 71 SER N    1 1 
        1  1126 1 1 71 SER O    O   3.006   8.528  17.552 1.00 . A A . 71 SER O    1 1 
        1  1127 1 1 71 SER OG   O   2.535  11.743  15.672 1.00 . A A . 71 SER OG   1 1 
        1  1128 1 1 72 SER C    C   2.394   6.006  15.838 1.00 . A A . 72 SER C    1 1 
        1  1129 1 1 72 SER CA   C   1.688   7.304  15.461 1.00 . A A . 72 SER CA   1 1 
        1  1130 1 1 72 SER CB   C   0.936   7.114  14.144 1.00 . A A . 72 SER CB   1 1 
        1  1131 1 1 72 SER H    H   2.849   8.756  14.449 1.00 . A A . 72 SER H    1 1 
        1  1132 1 1 72 SER HA   H   0.977   7.549  16.234 1.00 . A A . 72 SER HA   1 1 
        1  1133 1 1 72 SER HB2  H   0.131   6.412  14.283 1.00 . A A . 72 SER HB2  1 1 
        1  1134 1 1 72 SER HB3  H   0.532   8.065  13.822 1.00 . A A . 72 SER HB3  1 1 
        1  1135 1 1 72 SER HG   H   2.466   6.040  13.603 1.00 . A A . 72 SER HG   1 1 
        1  1136 1 1 72 SER N    N   2.640   8.400  15.337 1.00 . A A . 72 SER N    1 1 
        1  1137 1 1 72 SER O    O   3.608   5.876  15.679 1.00 . A A . 72 SER O    1 1 
        1  1138 1 1 72 SER OG   O   1.832   6.610  13.162 1.00 . A A . 72 SER OG   1 1 
        1  1139 1 1 73 THR C    C   2.798   3.047  15.532 1.00 . A A . 73 THR C    1 1 
        1  1140 1 1 73 THR CA   C   2.169   3.759  16.741 1.00 . A A . 73 THR CA   1 1 
        1  1141 1 1 73 THR CB   C   1.057   2.885  17.324 1.00 . A A . 73 THR CB   1 1 
        1  1142 1 1 73 THR CG2  C   0.058   2.521  16.223 1.00 . A A . 73 THR CG2  1 1 
        1  1143 1 1 73 THR H    H   0.661   5.214  16.443 1.00 . A A . 73 THR H    1 1 
        1  1144 1 1 73 THR HA   H   2.907   3.928  17.500 1.00 . A A . 73 THR HA   1 1 
        1  1145 1 1 73 THR HB   H   0.543   3.427  18.103 1.00 . A A . 73 THR HB   1 1 
        1  1146 1 1 73 THR HG1  H   2.058   1.928  18.689 1.00 . A A . 73 THR HG1  1 1 
        1  1147 1 1 73 THR HG21 H  -0.834   2.106  16.668 1.00 . A A . 73 THR HG21 1 1 
        1  1148 1 1 73 THR HG22 H   0.501   1.792  15.561 1.00 . A A . 73 THR HG22 1 1 
        1  1149 1 1 73 THR HG23 H  -0.199   3.408  15.662 1.00 . A A . 73 THR HG23 1 1 
        1  1150 1 1 73 THR N    N   1.621   5.049  16.340 1.00 . A A . 73 THR N    1 1 
        1  1151 1 1 73 THR O    O   2.227   3.081  14.442 1.00 . A A . 73 THR O    1 1 
        1  1152 1 1 73 THR OG1  O   1.623   1.699  17.865 1.00 . A A . 73 THR OG1  1 1 
        1  1153 1 1 74 PRO C    C   3.585   0.785  13.785 1.00 . A A . 74 PRO C    1 1 
        1  1154 1 1 74 PRO CA   C   4.582   1.678  14.527 1.00 . A A . 74 PRO CA   1 1 
        1  1155 1 1 74 PRO CB   C   5.666   0.827  15.202 1.00 . A A . 74 PRO CB   1 1 
        1  1156 1 1 74 PRO CD   C   4.759   2.269  16.907 1.00 . A A . 74 PRO CD   1 1 
        1  1157 1 1 74 PRO CG   C   6.046   1.598  16.418 1.00 . A A . 74 PRO CG   1 1 
        1  1158 1 1 74 PRO HA   H   5.038   2.380  13.850 1.00 . A A . 74 PRO HA   1 1 
        1  1159 1 1 74 PRO HB2  H   5.271  -0.145  15.476 1.00 . A A . 74 PRO HB2  1 1 
        1  1160 1 1 74 PRO HB3  H   6.520   0.715  14.550 1.00 . A A . 74 PRO HB3  1 1 
        1  1161 1 1 74 PRO HD2  H   4.260   1.650  17.642 1.00 . A A . 74 PRO HD2  1 1 
        1  1162 1 1 74 PRO HD3  H   4.984   3.242  17.312 1.00 . A A . 74 PRO HD3  1 1 
        1  1163 1 1 74 PRO HG2  H   6.435   0.929  17.177 1.00 . A A . 74 PRO HG2  1 1 
        1  1164 1 1 74 PRO HG3  H   6.781   2.350  16.172 1.00 . A A . 74 PRO HG3  1 1 
        1  1165 1 1 74 PRO N    N   3.941   2.395  15.675 1.00 . A A . 74 PRO N    1 1 
        1  1166 1 1 74 PRO O    O   2.745   0.130  14.399 1.00 . A A . 74 PRO O    1 1 
        1  1167 1 1 75 LYS C    C   2.953  -1.514  11.968 1.00 . A A . 75 LYS C    1 1 
        1  1168 1 1 75 LYS CA   C   2.790  -0.034  11.639 1.00 . A A . 75 LYS CA   1 1 
        1  1169 1 1 75 LYS CB   C   3.098   0.195  10.153 1.00 . A A . 75 LYS CB   1 1 
        1  1170 1 1 75 LYS CD   C   1.189   1.685   9.430 1.00 . A A . 75 LYS CD   1 1 
        1  1171 1 1 75 LYS CE   C   0.848   3.067   8.871 1.00 . A A . 75 LYS CE   1 1 
        1  1172 1 1 75 LYS CG   C   2.692   1.617   9.729 1.00 . A A . 75 LYS CG   1 1 
        1  1173 1 1 75 LYS H    H   4.374   1.320  12.025 1.00 . A A . 75 LYS H    1 1 
        1  1174 1 1 75 LYS HA   H   1.774   0.257  11.840 1.00 . A A . 75 LYS HA   1 1 
        1  1175 1 1 75 LYS HB2  H   4.158   0.062   9.987 1.00 . A A . 75 LYS HB2  1 1 
        1  1176 1 1 75 LYS HB3  H   2.553  -0.525   9.561 1.00 . A A . 75 LYS HB3  1 1 
        1  1177 1 1 75 LYS HD2  H   0.930   0.929   8.702 1.00 . A A . 75 LYS HD2  1 1 
        1  1178 1 1 75 LYS HD3  H   0.626   1.521  10.334 1.00 . A A . 75 LYS HD3  1 1 
        1  1179 1 1 75 LYS HE2  H   1.096   3.822   9.603 1.00 . A A . 75 LYS HE2  1 1 
        1  1180 1 1 75 LYS HE3  H   1.414   3.240   7.969 1.00 . A A . 75 LYS HE3  1 1 
        1  1181 1 1 75 LYS HG2  H   2.930   2.310  10.524 1.00 . A A . 75 LYS HG2  1 1 
        1  1182 1 1 75 LYS HG3  H   3.242   1.893   8.842 1.00 . A A . 75 LYS HG3  1 1 
        1  1183 1 1 75 LYS HZ1  H  -0.882   4.123   8.391 1.00 . A A . 75 LYS HZ1  1 1 
        1  1184 1 1 75 LYS HZ2  H  -1.151   2.762   9.371 1.00 . A A . 75 LYS HZ2  1 1 
        1  1185 1 1 75 LYS HZ3  H  -0.813   2.568   7.718 1.00 . A A . 75 LYS HZ3  1 1 
        1  1186 1 1 75 LYS N    N   3.687   0.773  12.460 1.00 . A A . 75 LYS N    1 1 
        1  1187 1 1 75 LYS NZ   N  -0.609   3.135   8.564 1.00 . A A . 75 LYS NZ   1 1 
        1  1188 1 1 75 LYS O    O   1.975  -2.260  12.019 1.00 . A A . 75 LYS O    1 1 
        1  1189 1 1 76 PHE C    C   3.801  -3.714  13.834 1.00 . A A . 76 PHE C    1 1 
        1  1190 1 1 76 PHE CA   C   4.468  -3.330  12.516 1.00 . A A . 76 PHE CA   1 1 
        1  1191 1 1 76 PHE CB   C   5.977  -3.557  12.624 1.00 . A A . 76 PHE CB   1 1 
        1  1192 1 1 76 PHE CD1  C   6.680  -4.640  10.459 1.00 . A A . 76 PHE CD1  1 1 
        1  1193 1 1 76 PHE CD2  C   7.098  -2.272  10.767 1.00 . A A . 76 PHE CD2  1 1 
        1  1194 1 1 76 PHE CE1  C   7.259  -4.577   9.186 1.00 . A A . 76 PHE CE1  1 1 
        1  1195 1 1 76 PHE CE2  C   7.677  -2.208   9.494 1.00 . A A . 76 PHE CE2  1 1 
        1  1196 1 1 76 PHE CG   C   6.600  -3.488  11.250 1.00 . A A . 76 PHE CG   1 1 
        1  1197 1 1 76 PHE CZ   C   7.757  -3.361   8.704 1.00 . A A . 76 PHE CZ   1 1 
        1  1198 1 1 76 PHE H    H   4.937  -1.297  12.139 1.00 . A A . 76 PHE H    1 1 
        1  1199 1 1 76 PHE HA   H   4.076  -3.957  11.730 1.00 . A A . 76 PHE HA   1 1 
        1  1200 1 1 76 PHE HB2  H   6.412  -2.796  13.255 1.00 . A A . 76 PHE HB2  1 1 
        1  1201 1 1 76 PHE HB3  H   6.165  -4.530  13.052 1.00 . A A . 76 PHE HB3  1 1 
        1  1202 1 1 76 PHE HD1  H   6.295  -5.578  10.831 1.00 . A A . 76 PHE HD1  1 1 
        1  1203 1 1 76 PHE HD2  H   7.036  -1.382  11.377 1.00 . A A . 76 PHE HD2  1 1 
        1  1204 1 1 76 PHE HE1  H   7.321  -5.466   8.576 1.00 . A A . 76 PHE HE1  1 1 
        1  1205 1 1 76 PHE HE2  H   8.061  -1.270   9.122 1.00 . A A . 76 PHE HE2  1 1 
        1  1206 1 1 76 PHE HZ   H   8.204  -3.312   7.721 1.00 . A A . 76 PHE HZ   1 1 
        1  1207 1 1 76 PHE N    N   4.194  -1.935  12.192 1.00 . A A . 76 PHE N    1 1 
        1  1208 1 1 76 PHE O    O   3.273  -4.817  13.974 1.00 . A A . 76 PHE O    1 1 
        1  1209 1 1 77 ASN C    C   1.745  -2.682  16.088 1.00 . A A . 77 ASN C    1 1 
        1  1210 1 1 77 ASN CA   C   3.226  -3.045  16.103 1.00 . A A . 77 ASN CA   1 1 
        1  1211 1 1 77 ASN CB   C   3.940  -2.221  17.176 1.00 . A A . 77 ASN CB   1 1 
        1  1212 1 1 77 ASN CG   C   3.450  -2.635  18.560 1.00 . A A . 77 ASN CG   1 1 
        1  1213 1 1 77 ASN H    H   4.267  -1.935  14.627 1.00 . A A . 77 ASN H    1 1 
        1  1214 1 1 77 ASN HA   H   3.326  -4.093  16.347 1.00 . A A . 77 ASN HA   1 1 
        1  1215 1 1 77 ASN HB2  H   5.005  -2.389  17.107 1.00 . A A . 77 ASN HB2  1 1 
        1  1216 1 1 77 ASN HB3  H   3.732  -1.173  17.022 1.00 . A A . 77 ASN HB3  1 1 
        1  1217 1 1 77 ASN HD21 H   3.550  -0.799  19.308 1.00 . A A . 77 ASN HD21 1 1 
        1  1218 1 1 77 ASN HD22 H   3.012  -1.994  20.386 1.00 . A A . 77 ASN HD22 1 1 
        1  1219 1 1 77 ASN N    N   3.830  -2.795  14.797 1.00 . A A . 77 ASN N    1 1 
        1  1220 1 1 77 ASN ND2  N   3.327  -1.735  19.495 1.00 . A A . 77 ASN ND2  1 1 
        1  1221 1 1 77 ASN O    O   1.384  -1.506  16.025 1.00 . A A . 77 ASN O    1 1 
        1  1222 1 1 77 ASN OD1  O   3.163  -3.810  18.790 1.00 . A A . 77 ASN OD1  1 1 
        1  1223 1 1 78 GLY C    C  -1.292  -4.711  16.639 1.00 . A A . 78 GLY C    1 1 
        1  1224 1 1 78 GLY CA   C  -0.550  -3.477  16.139 1.00 . A A . 78 GLY CA   1 1 
        1  1225 1 1 78 GLY H    H   1.237  -4.614  16.195 1.00 . A A . 78 GLY H    1 1 
        1  1226 1 1 78 GLY HA2  H  -0.783  -2.636  16.779 1.00 . A A . 78 GLY HA2  1 1 
        1  1227 1 1 78 GLY HA3  H  -0.871  -3.256  15.132 1.00 . A A . 78 GLY HA3  1 1 
        1  1228 1 1 78 GLY N    N   0.891  -3.699  16.146 1.00 . A A . 78 GLY N    1 1 
        1  1229 1 1 78 GLY O    O  -0.693  -5.769  16.836 1.00 . A A . 78 GLY O    1 1 
        1  1230 1 1 79 VAL C    C  -4.695  -5.808  16.487 1.00 . A A . 79 VAL C    1 1 
        1  1231 1 1 79 VAL CA   C  -3.429  -5.677  17.329 1.00 . A A . 79 VAL CA   1 1 
        1  1232 1 1 79 VAL CB   C  -3.814  -5.439  18.790 1.00 . A A . 79 VAL CB   1 1 
        1  1233 1 1 79 VAL CG1  C  -2.549  -5.369  19.646 1.00 . A A . 79 VAL CG1  1 1 
        1  1234 1 1 79 VAL CG2  C  -4.580  -4.119  18.905 1.00 . A A . 79 VAL CG2  1 1 
        1  1235 1 1 79 VAL H    H  -3.021  -3.700  16.673 1.00 . A A . 79 VAL H    1 1 
        1  1236 1 1 79 VAL HA   H  -2.873  -6.603  17.263 1.00 . A A . 79 VAL HA   1 1 
        1  1237 1 1 79 VAL HB   H  -4.437  -6.251  19.135 1.00 . A A . 79 VAL HB   1 1 
        1  1238 1 1 79 VAL HG11 H  -1.883  -4.620  19.244 1.00 . A A . 79 VAL HG11 1 1 
        1  1239 1 1 79 VAL HG12 H  -2.056  -6.330  19.640 1.00 . A A . 79 VAL HG12 1 1 
        1  1240 1 1 79 VAL HG13 H  -2.813  -5.108  20.660 1.00 . A A . 79 VAL HG13 1 1 
        1  1241 1 1 79 VAL HG21 H  -4.058  -3.350  18.356 1.00 . A A . 79 VAL HG21 1 1 
        1  1242 1 1 79 VAL HG22 H  -4.652  -3.834  19.945 1.00 . A A . 79 VAL HG22 1 1 
        1  1243 1 1 79 VAL HG23 H  -5.572  -4.243  18.497 1.00 . A A . 79 VAL HG23 1 1 
        1  1244 1 1 79 VAL N    N  -2.601  -4.569  16.846 1.00 . A A . 79 VAL N    1 1 
        1  1245 1 1 79 VAL O    O  -5.108  -4.860  15.818 1.00 . A A . 79 VAL O    1 1 
        1  1246 1 1 80 LYS C    C  -7.643  -6.312  16.232 1.00 . A A . 80 LYS C    1 1 
        1  1247 1 1 80 LYS CA   C  -6.523  -7.234  15.763 1.00 . A A . 80 LYS CA   1 1 
        1  1248 1 1 80 LYS CB   C  -6.957  -8.692  15.928 1.00 . A A . 80 LYS CB   1 1 
        1  1249 1 1 80 LYS CD   C  -6.395 -11.063  15.373 1.00 . A A . 80 LYS CD   1 1 
        1  1250 1 1 80 LYS CE   C  -5.391 -11.977  14.669 1.00 . A A . 80 LYS CE   1 1 
        1  1251 1 1 80 LYS CG   C  -5.964  -9.605  15.205 1.00 . A A . 80 LYS CG   1 1 
        1  1252 1 1 80 LYS H    H  -4.928  -7.705  17.076 1.00 . A A . 80 LYS H    1 1 
        1  1253 1 1 80 LYS HA   H  -6.327  -7.045  14.719 1.00 . A A . 80 LYS HA   1 1 
        1  1254 1 1 80 LYS HB2  H  -6.979  -8.944  16.978 1.00 . A A . 80 LYS HB2  1 1 
        1  1255 1 1 80 LYS HB3  H  -7.940  -8.826  15.504 1.00 . A A . 80 LYS HB3  1 1 
        1  1256 1 1 80 LYS HD2  H  -6.432 -11.308  16.425 1.00 . A A . 80 LYS HD2  1 1 
        1  1257 1 1 80 LYS HD3  H  -7.373 -11.202  14.937 1.00 . A A . 80 LYS HD3  1 1 
        1  1258 1 1 80 LYS HE2  H  -4.403 -11.803  15.069 1.00 . A A . 80 LYS HE2  1 1 
        1  1259 1 1 80 LYS HE3  H  -5.667 -13.009  14.833 1.00 . A A . 80 LYS HE3  1 1 
        1  1260 1 1 80 LYS HG2  H  -5.944  -9.354  14.154 1.00 . A A . 80 LYS HG2  1 1 
        1  1261 1 1 80 LYS HG3  H  -4.979  -9.472  15.627 1.00 . A A . 80 LYS HG3  1 1 
        1  1262 1 1 80 LYS HZ1  H  -5.068 -10.713  13.047 1.00 . A A . 80 LYS HZ1  1 1 
        1  1263 1 1 80 LYS HZ2  H  -6.360 -11.797  12.835 1.00 . A A . 80 LYS HZ2  1 1 
        1  1264 1 1 80 LYS HZ3  H  -4.757 -12.348  12.721 1.00 . A A . 80 LYS HZ3  1 1 
        1  1265 1 1 80 LYS N    N  -5.304  -6.988  16.525 1.00 . A A . 80 LYS N    1 1 
        1  1266 1 1 80 LYS NZ   N  -5.395 -11.686  13.208 1.00 . A A . 80 LYS NZ   1 1 
        1  1267 1 1 80 LYS O    O  -8.423  -5.805  15.424 1.00 . A A . 80 LYS O    1 1 
        1  1268 1 1 81 LYS C    C  -8.189  -4.458  19.311 1.00 . A A . 81 LYS C    1 1 
        1  1269 1 1 81 LYS CA   C  -8.750  -5.235  18.124 1.00 . A A . 81 LYS CA   1 1 
        1  1270 1 1 81 LYS CB   C  -9.942  -6.084  18.582 1.00 . A A . 81 LYS CB   1 1 
        1  1271 1 1 81 LYS CD   C -12.318  -5.979  19.412 1.00 . A A . 81 LYS CD   1 1 
        1  1272 1 1 81 LYS CE   C -12.951  -6.925  18.386 1.00 . A A . 81 LYS CE   1 1 
        1  1273 1 1 81 LYS CG   C -11.172  -5.186  18.771 1.00 . A A . 81 LYS CG   1 1 
        1  1274 1 1 81 LYS H    H  -7.070  -6.531  18.138 1.00 . A A . 81 LYS H    1 1 
        1  1275 1 1 81 LYS HA   H  -9.088  -4.531  17.375 1.00 . A A . 81 LYS HA   1 1 
        1  1276 1 1 81 LYS HB2  H -10.149  -6.831  17.832 1.00 . A A . 81 LYS HB2  1 1 
        1  1277 1 1 81 LYS HB3  H  -9.703  -6.567  19.517 1.00 . A A . 81 LYS HB3  1 1 
        1  1278 1 1 81 LYS HD2  H -11.934  -6.556  20.241 1.00 . A A . 81 LYS HD2  1 1 
        1  1279 1 1 81 LYS HD3  H -13.068  -5.293  19.774 1.00 . A A . 81 LYS HD3  1 1 
        1  1280 1 1 81 LYS HE2  H -13.225  -6.368  17.503 1.00 . A A . 81 LYS HE2  1 1 
        1  1281 1 1 81 LYS HE3  H -12.248  -7.698  18.121 1.00 . A A . 81 LYS HE3  1 1 
        1  1282 1 1 81 LYS HG2  H -10.912  -4.353  19.409 1.00 . A A . 81 LYS HG2  1 1 
        1  1283 1 1 81 LYS HG3  H -11.491  -4.812  17.809 1.00 . A A . 81 LYS HG3  1 1 
        1  1284 1 1 81 LYS HZ1  H -13.954  -8.526  19.263 1.00 . A A . 81 LYS HZ1  1 1 
        1  1285 1 1 81 LYS HZ2  H -14.934  -7.554  18.272 1.00 . A A . 81 LYS HZ2  1 1 
        1  1286 1 1 81 LYS HZ3  H -14.468  -7.005  19.812 1.00 . A A . 81 LYS HZ3  1 1 
        1  1287 1 1 81 LYS N    N  -7.719  -6.099  17.545 1.00 . A A . 81 LYS N    1 1 
        1  1288 1 1 81 LYS NZ   N -14.168  -7.549  18.977 1.00 . A A . 81 LYS NZ   1 1 
        1  1289 1 1 81 LYS O    O  -7.719  -5.094  20.241 1.00 . A A . 81 LYS O    1 1 
        1  1290 1 1 81 LYS OXT  O  -8.236  -3.240  19.272 1.00 . A A . 81 LYS OXT  1 1 
        2  1291 1 1  1 MET C    C  -9.883   5.417  -4.912 1.00 . A A .  1 MET C    1 1 
        2  1292 1 1  1 MET CA   C -10.828   5.299  -6.103 1.00 . A A .  1 MET CA   1 1 
        2  1293 1 1  1 MET CB   C -12.188   5.912  -5.757 1.00 . A A .  1 MET CB   1 1 
        2  1294 1 1  1 MET CE   C -14.448   7.941  -6.749 1.00 . A A .  1 MET CE   1 1 
        2  1295 1 1  1 MET CG   C -12.038   7.424  -5.565 1.00 . A A .  1 MET CG   1 1 
        2  1296 1 1  1 MET H1   H -10.520   3.651  -7.339 1.00 . A A .  1 MET H1   1 1 
        2  1297 1 1  1 MET H2   H -12.024   3.653  -6.547 1.00 . A A .  1 MET H2   1 1 
        2  1298 1 1  1 MET H3   H -10.609   3.270  -5.688 1.00 . A A .  1 MET H3   1 1 
        2  1299 1 1  1 MET HA   H -10.405   5.819  -6.951 1.00 . A A .  1 MET HA   1 1 
        2  1300 1 1  1 MET HB2  H -12.883   5.716  -6.559 1.00 . A A .  1 MET HB2  1 1 
        2  1301 1 1  1 MET HB3  H -12.558   5.470  -4.843 1.00 . A A .  1 MET HB3  1 1 
        2  1302 1 1  1 MET HE1  H -13.726   8.101  -7.538 1.00 . A A .  1 MET HE1  1 1 
        2  1303 1 1  1 MET HE2  H -15.247   8.659  -6.848 1.00 . A A .  1 MET HE2  1 1 
        2  1304 1 1  1 MET HE3  H -14.855   6.942  -6.824 1.00 . A A .  1 MET HE3  1 1 
        2  1305 1 1  1 MET HG2  H -11.336   7.617  -4.769 1.00 . A A .  1 MET HG2  1 1 
        2  1306 1 1  1 MET HG3  H -11.673   7.868  -6.479 1.00 . A A .  1 MET HG3  1 1 
        2  1307 1 1  1 MET N    N -11.009   3.860  -6.445 1.00 . A A .  1 MET N    1 1 
        2  1308 1 1  1 MET O    O -10.300   5.751  -3.805 1.00 . A A .  1 MET O    1 1 
        2  1309 1 1  1 MET SD   S -13.644   8.146  -5.139 1.00 . A A .  1 MET SD   1 1 
        2  1310 1 1  2 LYS C    C  -7.223   6.664  -3.820 1.00 . A A .  2 LYS C    1 1 
        2  1311 1 1  2 LYS CA   C  -7.611   5.212  -4.081 1.00 . A A .  2 LYS CA   1 1 
        2  1312 1 1  2 LYS CB   C  -6.367   4.411  -4.472 1.00 . A A .  2 LYS CB   1 1 
        2  1313 1 1  2 LYS CD   C  -5.471   2.125  -4.928 1.00 . A A .  2 LYS CD   1 1 
        2  1314 1 1  2 LYS CE   C  -5.802   0.631  -4.937 1.00 . A A .  2 LYS CE   1 1 
        2  1315 1 1  2 LYS CG   C  -6.714   2.923  -4.530 1.00 . A A .  2 LYS CG   1 1 
        2  1316 1 1  2 LYS H    H  -8.327   4.869  -6.047 1.00 . A A .  2 LYS H    1 1 
        2  1317 1 1  2 LYS HA   H  -8.028   4.792  -3.180 1.00 . A A .  2 LYS HA   1 1 
        2  1318 1 1  2 LYS HB2  H  -6.018   4.739  -5.440 1.00 . A A .  2 LYS HB2  1 1 
        2  1319 1 1  2 LYS HB3  H  -5.591   4.570  -3.738 1.00 . A A .  2 LYS HB3  1 1 
        2  1320 1 1  2 LYS HD2  H  -5.148   2.430  -5.912 1.00 . A A .  2 LYS HD2  1 1 
        2  1321 1 1  2 LYS HD3  H  -4.681   2.311  -4.216 1.00 . A A .  2 LYS HD3  1 1 
        2  1322 1 1  2 LYS HE2  H  -4.912   0.068  -5.180 1.00 . A A .  2 LYS HE2  1 1 
        2  1323 1 1  2 LYS HE3  H  -6.162   0.334  -3.963 1.00 . A A .  2 LYS HE3  1 1 
        2  1324 1 1  2 LYS HG2  H  -7.059   2.595  -3.559 1.00 . A A .  2 LYS HG2  1 1 
        2  1325 1 1  2 LYS HG3  H  -7.492   2.762  -5.261 1.00 . A A .  2 LYS HG3  1 1 
        2  1326 1 1  2 LYS HZ1  H  -6.661  -0.549  -6.422 1.00 . A A .  2 LYS HZ1  1 1 
        2  1327 1 1  2 LYS HZ2  H  -6.847   1.121  -6.671 1.00 . A A .  2 LYS HZ2  1 1 
        2  1328 1 1  2 LYS HZ3  H  -7.783   0.324  -5.498 1.00 . A A .  2 LYS HZ3  1 1 
        2  1329 1 1  2 LYS N    N  -8.605   5.134  -5.146 1.00 . A A .  2 LYS N    1 1 
        2  1330 1 1  2 LYS NZ   N  -6.853   0.362  -5.959 1.00 . A A .  2 LYS NZ   1 1 
        2  1331 1 1  2 LYS O    O  -7.013   7.438  -4.753 1.00 . A A .  2 LYS O    1 1 
        2  1332 1 1  3 ASP C    C  -5.691   8.373  -1.053 1.00 . A A .  3 ASP C    1 1 
        2  1333 1 1  3 ASP CA   C  -6.759   8.393  -2.149 1.00 . A A .  3 ASP CA   1 1 
        2  1334 1 1  3 ASP CB   C  -8.001   9.133  -1.652 1.00 . A A .  3 ASP CB   1 1 
        2  1335 1 1  3 ASP CG   C  -9.056   9.157  -2.752 1.00 . A A .  3 ASP CG   1 1 
        2  1336 1 1  3 ASP H    H  -7.304   6.364  -1.841 1.00 . A A .  3 ASP H    1 1 
        2  1337 1 1  3 ASP HA   H  -6.363   8.919  -3.008 1.00 . A A .  3 ASP HA   1 1 
        2  1338 1 1  3 ASP HB2  H  -8.395   8.630  -0.782 1.00 . A A .  3 ASP HB2  1 1 
        2  1339 1 1  3 ASP HB3  H  -7.732  10.145  -1.393 1.00 . A A .  3 ASP HB3  1 1 
        2  1340 1 1  3 ASP N    N  -7.126   7.028  -2.539 1.00 . A A .  3 ASP N    1 1 
        2  1341 1 1  3 ASP O    O  -5.978   8.665   0.106 1.00 . A A .  3 ASP O    1 1 
        2  1342 1 1  3 ASP OD1  O  -8.699   8.897  -3.889 1.00 . A A .  3 ASP OD1  1 1 
        2  1343 1 1  3 ASP OD2  O -10.207   9.418  -2.441 1.00 . A A .  3 ASP OD2  1 1 
        2  1344 1 1  4 PRO C    C  -3.138   9.257   0.364 1.00 . A A .  4 PRO C    1 1 
        2  1345 1 1  4 PRO CA   C  -3.335   7.961  -0.429 1.00 . A A .  4 PRO CA   1 1 
        2  1346 1 1  4 PRO CB   C  -2.121   7.688  -1.335 1.00 . A A .  4 PRO CB   1 1 
        2  1347 1 1  4 PRO CD   C  -4.048   7.670  -2.761 1.00 . A A .  4 PRO CD   1 1 
        2  1348 1 1  4 PRO CG   C  -2.692   7.012  -2.534 1.00 . A A .  4 PRO CG   1 1 
        2  1349 1 1  4 PRO HA   H  -3.469   7.130   0.242 1.00 . A A .  4 PRO HA   1 1 
        2  1350 1 1  4 PRO HB2  H  -1.640   8.618  -1.618 1.00 . A A .  4 PRO HB2  1 1 
        2  1351 1 1  4 PRO HB3  H  -1.416   7.035  -0.840 1.00 . A A .  4 PRO HB3  1 1 
        2  1352 1 1  4 PRO HD2  H  -3.946   8.550  -3.381 1.00 . A A .  4 PRO HD2  1 1 
        2  1353 1 1  4 PRO HD3  H  -4.741   6.972  -3.199 1.00 . A A .  4 PRO HD3  1 1 
        2  1354 1 1  4 PRO HG2  H  -2.048   7.164  -3.392 1.00 . A A .  4 PRO HG2  1 1 
        2  1355 1 1  4 PRO HG3  H  -2.824   5.958  -2.346 1.00 . A A .  4 PRO HG3  1 1 
        2  1356 1 1  4 PRO N    N  -4.478   8.032  -1.400 1.00 . A A .  4 PRO N    1 1 
        2  1357 1 1  4 PRO O    O  -2.583   9.245   1.461 1.00 . A A .  4 PRO O    1 1 
        2  1358 1 1  5 LYS C    C  -4.507  11.869   1.573 1.00 . A A .  5 LYS C    1 1 
        2  1359 1 1  5 LYS CA   C  -3.474  11.667   0.456 1.00 . A A .  5 LYS CA   1 1 
        2  1360 1 1  5 LYS CB   C  -3.665  12.767  -0.596 1.00 . A A .  5 LYS CB   1 1 
        2  1361 1 1  5 LYS CD   C  -3.598  15.228  -1.031 1.00 . A A .  5 LYS CD   1 1 
        2  1362 1 1  5 LYS CE   C  -3.381  16.604  -0.397 1.00 . A A .  5 LYS CE   1 1 
        2  1363 1 1  5 LYS CG   C  -3.478  14.148   0.045 1.00 . A A .  5 LYS CG   1 1 
        2  1364 1 1  5 LYS H    H  -4.070  10.313  -1.057 1.00 . A A .  5 LYS H    1 1 
        2  1365 1 1  5 LYS HA   H  -2.473  11.760   0.849 1.00 . A A .  5 LYS HA   1 1 
        2  1366 1 1  5 LYS HB2  H  -2.939  12.637  -1.385 1.00 . A A .  5 LYS HB2  1 1 
        2  1367 1 1  5 LYS HB3  H  -4.659  12.697  -1.009 1.00 . A A .  5 LYS HB3  1 1 
        2  1368 1 1  5 LYS HD2  H  -2.852  15.060  -1.795 1.00 . A A .  5 LYS HD2  1 1 
        2  1369 1 1  5 LYS HD3  H  -4.581  15.189  -1.473 1.00 . A A .  5 LYS HD3  1 1 
        2  1370 1 1  5 LYS HE2  H  -2.424  16.623   0.102 1.00 . A A .  5 LYS HE2  1 1 
        2  1371 1 1  5 LYS HE3  H  -3.399  17.361  -1.167 1.00 . A A .  5 LYS HE3  1 1 
        2  1372 1 1  5 LYS HG2  H  -4.239  14.306   0.795 1.00 . A A .  5 LYS HG2  1 1 
        2  1373 1 1  5 LYS HG3  H  -2.502  14.204   0.503 1.00 . A A .  5 LYS HG3  1 1 
        2  1374 1 1  5 LYS HZ1  H  -4.353  17.833   0.974 1.00 . A A .  5 LYS HZ1  1 1 
        2  1375 1 1  5 LYS HZ2  H  -4.405  16.180   1.365 1.00 . A A .  5 LYS HZ2  1 1 
        2  1376 1 1  5 LYS HZ3  H  -5.388  16.793   0.123 1.00 . A A .  5 LYS HZ3  1 1 
        2  1377 1 1  5 LYS N    N  -3.598  10.367  -0.200 1.00 . A A .  5 LYS N    1 1 
        2  1378 1 1  5 LYS NZ   N  -4.464  16.872   0.590 1.00 . A A .  5 LYS NZ   1 1 
        2  1379 1 1  5 LYS O    O  -4.172  12.205   2.707 1.00 . A A .  5 LYS O    1 1 
        2  1380 1 1  6 THR C    C  -7.021  10.417   2.998 1.00 . A A .  6 THR C    1 1 
        2  1381 1 1  6 THR CA   C  -6.912  11.678   2.126 1.00 . A A .  6 THR CA   1 1 
        2  1382 1 1  6 THR CB   C  -8.202  11.836   1.319 1.00 . A A .  6 THR CB   1 1 
        2  1383 1 1  6 THR CG2  C  -9.391  11.950   2.274 1.00 . A A .  6 THR CG2  1 1 
        2  1384 1 1  6 THR H    H  -5.904  11.207   0.328 1.00 . A A .  6 THR H    1 1 
        2  1385 1 1  6 THR HA   H  -6.807  12.532   2.766 1.00 . A A .  6 THR HA   1 1 
        2  1386 1 1  6 THR HB   H  -8.339  10.974   0.687 1.00 . A A .  6 THR HB   1 1 
        2  1387 1 1  6 THR HG1  H  -8.843  13.589   0.771 1.00 . A A .  6 THR HG1  1 1 
        2  1388 1 1  6 THR HG21 H  -9.150  12.640   3.069 1.00 . A A .  6 THR HG21 1 1 
        2  1389 1 1  6 THR HG22 H  -9.610  10.979   2.694 1.00 . A A .  6 THR HG22 1 1 
        2  1390 1 1  6 THR HG23 H -10.253  12.311   1.733 1.00 . A A .  6 THR HG23 1 1 
        2  1391 1 1  6 THR N    N  -5.762  11.603   1.213 1.00 . A A .  6 THR N    1 1 
        2  1392 1 1  6 THR O    O  -7.459  10.453   4.143 1.00 . A A .  6 THR O    1 1 
        2  1393 1 1  6 THR OG1  O  -8.121  13.008   0.520 1.00 . A A .  6 THR OG1  1 1 
        2  1394 1 1  7 LEU C    C  -5.636   8.002   4.281 1.00 . A A .  7 LEU C    1 1 
        2  1395 1 1  7 LEU CA   C  -6.596   8.020   3.076 1.00 . A A .  7 LEU CA   1 1 
        2  1396 1 1  7 LEU CB   C  -6.219   6.905   2.091 1.00 . A A .  7 LEU CB   1 1 
        2  1397 1 1  7 LEU CD1  C  -7.607   5.229   3.369 1.00 . A A .  7 LEU CD1  1 1 
        2  1398 1 1  7 LEU CD2  C  -5.833   4.457   1.775 1.00 . A A .  7 LEU CD2  1 1 
        2  1399 1 1  7 LEU CG   C  -6.214   5.537   2.794 1.00 . A A .  7 LEU CG   1 1 
        2  1400 1 1  7 LEU H    H  -6.148   9.499   1.541 1.00 . A A .  7 LEU H    1 1 
        2  1401 1 1  7 LEU HA   H  -7.598   7.836   3.430 1.00 . A A .  7 LEU HA   1 1 
        2  1402 1 1  7 LEU HB2  H  -6.936   6.885   1.283 1.00 . A A .  7 LEU HB2  1 1 
        2  1403 1 1  7 LEU HB3  H  -5.239   7.102   1.694 1.00 . A A .  7 LEU HB3  1 1 
        2  1404 1 1  7 LEU HD11 H  -7.726   4.161   3.487 1.00 . A A .  7 LEU HD11 1 1 
        2  1405 1 1  7 LEU HD12 H  -8.368   5.602   2.699 1.00 . A A .  7 LEU HD12 1 1 
        2  1406 1 1  7 LEU HD13 H  -7.711   5.706   4.333 1.00 . A A .  7 LEU HD13 1 1 
        2  1407 1 1  7 LEU HD21 H  -6.404   4.598   0.869 1.00 . A A .  7 LEU HD21 1 1 
        2  1408 1 1  7 LEU HD22 H  -6.047   3.481   2.187 1.00 . A A .  7 LEU HD22 1 1 
        2  1409 1 1  7 LEU HD23 H  -4.778   4.529   1.551 1.00 . A A .  7 LEU HD23 1 1 
        2  1410 1 1  7 LEU HG   H  -5.489   5.541   3.595 1.00 . A A .  7 LEU HG   1 1 
        2  1411 1 1  7 LEU N    N  -6.588   9.324   2.400 1.00 . A A .  7 LEU N    1 1 
        2  1412 1 1  7 LEU O    O  -6.010   7.604   5.384 1.00 . A A .  7 LEU O    1 1 
        2  1413 1 1  8 LEU C    C  -3.468   9.735   5.999 1.00 . A A .  8 LEU C    1 1 
        2  1414 1 1  8 LEU CA   C  -3.327   8.535   5.049 1.00 . A A .  8 LEU CA   1 1 
        2  1415 1 1  8 LEU CB   C  -1.980   8.631   4.317 1.00 . A A .  8 LEU CB   1 1 
        2  1416 1 1  8 LEU CD1  C  -0.804   7.238   6.067 1.00 . A A .  8 LEU CD1  1 1 
        2  1417 1 1  8 LEU CD2  C   0.503   8.749   4.542 1.00 . A A .  8 LEU CD2  1 1 
        2  1418 1 1  8 LEU CG   C  -0.810   8.583   5.315 1.00 . A A .  8 LEU CG   1 1 
        2  1419 1 1  8 LEU H    H  -4.161   8.793   3.163 1.00 . A A .  8 LEU H    1 1 
        2  1420 1 1  8 LEU HA   H  -3.334   7.618   5.615 1.00 . A A .  8 LEU HA   1 1 
        2  1421 1 1  8 LEU HB2  H  -1.893   7.805   3.627 1.00 . A A .  8 LEU HB2  1 1 
        2  1422 1 1  8 LEU HB3  H  -1.940   9.559   3.766 1.00 . A A .  8 LEU HB3  1 1 
        2  1423 1 1  8 LEU HD11 H   0.201   7.005   6.394 1.00 . A A .  8 LEU HD11 1 1 
        2  1424 1 1  8 LEU HD12 H  -1.158   6.453   5.415 1.00 . A A .  8 LEU HD12 1 1 
        2  1425 1 1  8 LEU HD13 H  -1.450   7.307   6.930 1.00 . A A .  8 LEU HD13 1 1 
        2  1426 1 1  8 LEU HD21 H   0.523   9.720   4.069 1.00 . A A .  8 LEU HD21 1 1 
        2  1427 1 1  8 LEU HD22 H   0.578   7.980   3.788 1.00 . A A .  8 LEU HD22 1 1 
        2  1428 1 1  8 LEU HD23 H   1.336   8.665   5.225 1.00 . A A .  8 LEU HD23 1 1 
        2  1429 1 1  8 LEU HG   H  -0.909   9.389   6.026 1.00 . A A .  8 LEU HG   1 1 
        2  1430 1 1  8 LEU N    N  -4.404   8.448   4.048 1.00 . A A .  8 LEU N    1 1 
        2  1431 1 1  8 LEU O    O  -2.960   9.741   7.119 1.00 . A A .  8 LEU O    1 1 
        2  1432 1 1  9 ARG C    C  -5.346  11.717   7.472 1.00 . A A .  9 ARG C    1 1 
        2  1433 1 1  9 ARG CA   C  -4.432  11.962   6.264 1.00 . A A .  9 ARG CA   1 1 
        2  1434 1 1  9 ARG CB   C  -5.057  13.033   5.347 1.00 . A A .  9 ARG CB   1 1 
        2  1435 1 1  9 ARG CD   C  -3.672  15.079   5.783 1.00 . A A .  9 ARG CD   1 1 
        2  1436 1 1  9 ARG CG   C  -3.966  13.964   4.770 1.00 . A A .  9 ARG CG   1 1 
        2  1437 1 1  9 ARG CZ   C  -1.945  16.685   6.309 1.00 . A A .  9 ARG CZ   1 1 
        2  1438 1 1  9 ARG H    H  -4.691  10.510   4.699 1.00 . A A .  9 ARG H    1 1 
        2  1439 1 1  9 ARG HA   H  -3.477  12.329   6.613 1.00 . A A .  9 ARG HA   1 1 
        2  1440 1 1  9 ARG HB2  H  -5.556  12.537   4.545 1.00 . A A .  9 ARG HB2  1 1 
        2  1441 1 1  9 ARG HB3  H  -5.777  13.625   5.899 1.00 . A A .  9 ARG HB3  1 1 
        2  1442 1 1  9 ARG HD2  H  -4.471  15.804   5.751 1.00 . A A .  9 ARG HD2  1 1 
        2  1443 1 1  9 ARG HD3  H  -3.623  14.655   6.777 1.00 . A A .  9 ARG HD3  1 1 
        2  1444 1 1  9 ARG HE   H  -1.906  15.510   4.682 1.00 . A A .  9 ARG HE   1 1 
        2  1445 1 1  9 ARG HG2  H  -3.064  13.399   4.581 1.00 . A A .  9 ARG HG2  1 1 
        2  1446 1 1  9 ARG HG3  H  -4.317  14.403   3.848 1.00 . A A .  9 ARG HG3  1 1 
        2  1447 1 1  9 ARG HH11 H  -3.498  16.568   7.568 1.00 . A A .  9 ARG HH11 1 1 
        2  1448 1 1  9 ARG HH12 H  -2.274  17.718   7.992 1.00 . A A .  9 ARG HH12 1 1 
        2  1449 1 1  9 ARG HH21 H  -0.286  17.017   5.238 1.00 . A A .  9 ARG HH21 1 1 
        2  1450 1 1  9 ARG HH22 H  -0.455  17.972   6.673 1.00 . A A .  9 ARG HH22 1 1 
        2  1451 1 1  9 ARG N    N  -4.181  10.732   5.505 1.00 . A A .  9 ARG N    1 1 
        2  1452 1 1  9 ARG NE   N  -2.413  15.753   5.485 1.00 . A A .  9 ARG NE   1 1 
        2  1453 1 1  9 ARG NH1  N  -2.625  17.016   7.372 1.00 . A A .  9 ARG NH1  1 1 
        2  1454 1 1  9 ARG NH2  N  -0.807  17.270   6.054 1.00 . A A .  9 ARG NH2  1 1 
        2  1455 1 1  9 ARG O    O  -5.226  12.393   8.491 1.00 . A A .  9 ARG O    1 1 
        2  1456 1 1 10 VAL C    C  -6.446   9.832   9.664 1.00 . A A . 10 VAL C    1 1 
        2  1457 1 1 10 VAL CA   C  -7.164  10.414   8.447 1.00 . A A . 10 VAL CA   1 1 
        2  1458 1 1 10 VAL CB   C  -8.248   9.443   7.955 1.00 . A A . 10 VAL CB   1 1 
        2  1459 1 1 10 VAL CG1  C  -9.071   8.925   9.141 1.00 . A A . 10 VAL CG1  1 1 
        2  1460 1 1 10 VAL CG2  C  -9.178  10.180   6.990 1.00 . A A . 10 VAL CG2  1 1 
        2  1461 1 1 10 VAL H    H  -6.272  10.185   6.554 1.00 . A A . 10 VAL H    1 1 
        2  1462 1 1 10 VAL HA   H  -7.650  11.305   8.817 1.00 . A A . 10 VAL HA   1 1 
        2  1463 1 1 10 VAL HB   H  -7.782   8.612   7.447 1.00 . A A . 10 VAL HB   1 1 
        2  1464 1 1 10 VAL HG11 H  -8.490   8.199   9.691 1.00 . A A . 10 VAL HG11 1 1 
        2  1465 1 1 10 VAL HG12 H  -9.976   8.461   8.778 1.00 . A A . 10 VAL HG12 1 1 
        2  1466 1 1 10 VAL HG13 H  -9.324   9.750   9.790 1.00 . A A . 10 VAL HG13 1 1 
        2  1467 1 1 10 VAL HG21 H  -8.609  10.549   6.153 1.00 . A A . 10 VAL HG21 1 1 
        2  1468 1 1 10 VAL HG22 H  -9.642  11.011   7.501 1.00 . A A . 10 VAL HG22 1 1 
        2  1469 1 1 10 VAL HG23 H  -9.941   9.504   6.636 1.00 . A A . 10 VAL HG23 1 1 
        2  1470 1 1 10 VAL N    N  -6.245  10.744   7.358 1.00 . A A . 10 VAL N    1 1 
        2  1471 1 1 10 VAL O    O  -6.804  10.170  10.793 1.00 . A A . 10 VAL O    1 1 
        2  1472 1 1 11 SER C    C  -4.076   9.545  11.444 1.00 . A A . 11 SER C    1 1 
        2  1473 1 1 11 SER CA   C  -4.765   8.436  10.654 1.00 . A A . 11 SER CA   1 1 
        2  1474 1 1 11 SER CB   C  -3.739   7.387  10.223 1.00 . A A . 11 SER CB   1 1 
        2  1475 1 1 11 SER H    H  -5.132   8.725   8.592 1.00 . A A . 11 SER H    1 1 
        2  1476 1 1 11 SER HA   H  -5.466   7.978  11.335 1.00 . A A . 11 SER HA   1 1 
        2  1477 1 1 11 SER HB2  H  -4.243   6.575   9.725 1.00 . A A . 11 SER HB2  1 1 
        2  1478 1 1 11 SER HB3  H  -3.027   7.837   9.544 1.00 . A A . 11 SER HB3  1 1 
        2  1479 1 1 11 SER HG   H  -2.149   7.152  11.321 1.00 . A A . 11 SER HG   1 1 
        2  1480 1 1 11 SER N    N  -5.447   8.978   9.485 1.00 . A A . 11 SER N    1 1 
        2  1481 1 1 11 SER O    O  -4.274   9.648  12.624 1.00 . A A . 11 SER O    1 1 
        2  1482 1 1 11 SER OG   O  -3.070   6.885  11.372 1.00 . A A . 11 SER OG   1 1 
        2  1483 1 1 12 ILE C    C  -3.548  12.295  12.323 1.00 . A A . 12 ILE C    1 1 
        2  1484 1 1 12 ILE CA   C  -2.552  11.410  11.551 1.00 . A A . 12 ILE CA   1 1 
        2  1485 1 1 12 ILE CB   C  -1.782  12.285  10.554 1.00 . A A . 12 ILE CB   1 1 
        2  1486 1 1 12 ILE CD1  C   0.269  10.796  10.801 1.00 . A A . 12 ILE CD1  1 1 
        2  1487 1 1 12 ILE CG1  C  -0.721  11.444   9.816 1.00 . A A . 12 ILE CG1  1 1 
        2  1488 1 1 12 ILE CG2  C  -1.110  13.448  11.290 1.00 . A A . 12 ILE CG2  1 1 
        2  1489 1 1 12 ILE H    H  -3.093  10.171   9.861 1.00 . A A . 12 ILE H    1 1 
        2  1490 1 1 12 ILE HA   H  -1.846  10.950  12.222 1.00 . A A . 12 ILE HA   1 1 
        2  1491 1 1 12 ILE HB   H  -2.480  12.687   9.832 1.00 . A A . 12 ILE HB   1 1 
        2  1492 1 1 12 ILE HD11 H  -0.113   9.835  11.111 1.00 . A A . 12 ILE HD11 1 1 
        2  1493 1 1 12 ILE HD12 H   0.401  11.425  11.667 1.00 . A A . 12 ILE HD12 1 1 
        2  1494 1 1 12 ILE HD13 H   1.222  10.658  10.312 1.00 . A A . 12 ILE HD13 1 1 
        2  1495 1 1 12 ILE HG12 H  -1.215  10.668   9.252 1.00 . A A . 12 ILE HG12 1 1 
        2  1496 1 1 12 ILE HG13 H  -0.175  12.082   9.135 1.00 . A A . 12 ILE HG13 1 1 
        2  1497 1 1 12 ILE HG21 H  -0.626  13.079  12.181 1.00 . A A . 12 ILE HG21 1 1 
        2  1498 1 1 12 ILE HG22 H  -1.853  14.182  11.561 1.00 . A A . 12 ILE HG22 1 1 
        2  1499 1 1 12 ILE HG23 H  -0.373  13.903  10.643 1.00 . A A . 12 ILE HG23 1 1 
        2  1500 1 1 12 ILE N    N  -3.265  10.357  10.808 1.00 . A A . 12 ILE N    1 1 
        2  1501 1 1 12 ILE O    O  -3.393  12.590  13.504 1.00 . A A . 12 ILE O    1 1 
        2  1502 1 1 13 ILE C    C  -6.340  12.792  13.340 1.00 . A A . 13 ILE C    1 1 
        2  1503 1 1 13 ILE CA   C  -5.655  13.490  12.130 1.00 . A A . 13 ILE CA   1 1 
        2  1504 1 1 13 ILE CB   C  -6.692  13.802  11.043 1.00 . A A . 13 ILE CB   1 1 
        2  1505 1 1 13 ILE CD1  C  -6.999  14.826   8.784 1.00 . A A . 13 ILE CD1  1 1 
        2  1506 1 1 13 ILE CG1  C  -6.085  14.755  10.010 1.00 . A A . 13 ILE CG1  1 1 
        2  1507 1 1 13 ILE CG2  C  -7.924  14.462  11.671 1.00 . A A . 13 ILE CG2  1 1 
        2  1508 1 1 13 ILE H    H  -4.525  12.265  10.697 1.00 . A A . 13 ILE H    1 1 
        2  1509 1 1 13 ILE HA   H  -5.237  14.416  12.498 1.00 . A A . 13 ILE HA   1 1 
        2  1510 1 1 13 ILE HB   H  -6.987  12.883  10.555 1.00 . A A . 13 ILE HB   1 1 
        2  1511 1 1 13 ILE HD11 H  -7.988  15.133   9.089 1.00 . A A . 13 ILE HD11 1 1 
        2  1512 1 1 13 ILE HD12 H  -7.052  13.853   8.320 1.00 . A A . 13 ILE HD12 1 1 
        2  1513 1 1 13 ILE HD13 H  -6.601  15.540   8.078 1.00 . A A . 13 ILE HD13 1 1 
        2  1514 1 1 13 ILE HG12 H  -5.991  15.740  10.444 1.00 . A A . 13 ILE HG12 1 1 
        2  1515 1 1 13 ILE HG13 H  -5.111  14.399   9.713 1.00 . A A . 13 ILE HG13 1 1 
        2  1516 1 1 13 ILE HG21 H  -8.534  14.903  10.898 1.00 . A A . 13 ILE HG21 1 1 
        2  1517 1 1 13 ILE HG22 H  -7.607  15.229  12.363 1.00 . A A . 13 ILE HG22 1 1 
        2  1518 1 1 13 ILE HG23 H  -8.498  13.716  12.202 1.00 . A A . 13 ILE HG23 1 1 
        2  1519 1 1 13 ILE N    N  -4.567  12.663  11.592 1.00 . A A . 13 ILE N    1 1 
        2  1520 1 1 13 ILE O    O  -6.576  13.419  14.373 1.00 . A A . 13 ILE O    1 1 
        2  1521 1 1 14 GLY C    C  -6.030  10.276  15.337 1.00 . A A . 14 GLY C    1 1 
        2  1522 1 1 14 GLY CA   C  -7.146  10.707  14.349 1.00 . A A . 14 GLY CA   1 1 
        2  1523 1 1 14 GLY H    H  -6.214  11.064  12.418 1.00 . A A . 14 GLY H    1 1 
        2  1524 1 1 14 GLY HA2  H  -7.871  11.314  14.872 1.00 . A A . 14 GLY HA2  1 1 
        2  1525 1 1 14 GLY HA3  H  -7.632   9.826  13.960 1.00 . A A . 14 GLY HA3  1 1 
        2  1526 1 1 14 GLY N    N  -6.576  11.491  13.222 1.00 . A A . 14 GLY N    1 1 
        2  1527 1 1 14 GLY O    O  -6.127  10.415  16.556 1.00 . A A . 14 GLY O    1 1 
        2  1528 1 1 15 THR C    C  -3.098  10.172  16.260 1.00 . A A . 15 THR C    1 1 
        2  1529 1 1 15 THR CA   C  -3.829   9.145  15.396 1.00 . A A . 15 THR CA   1 1 
        2  1530 1 1 15 THR CB   C  -2.831   8.535  14.405 1.00 . A A . 15 THR CB   1 1 
        2  1531 1 1 15 THR CG2  C  -1.728   7.813  15.181 1.00 . A A . 15 THR CG2  1 1 
        2  1532 1 1 15 THR H    H  -5.179   9.627  13.761 1.00 . A A . 15 THR H    1 1 
        2  1533 1 1 15 THR HA   H  -4.169   8.360  16.054 1.00 . A A . 15 THR HA   1 1 
        2  1534 1 1 15 THR HB   H  -2.383   9.313  13.807 1.00 . A A . 15 THR HB   1 1 
        2  1535 1 1 15 THR HG1  H  -4.444   7.796  13.612 1.00 . A A . 15 THR HG1  1 1 
        2  1536 1 1 15 THR HG21 H  -2.172   7.157  15.915 1.00 . A A . 15 THR HG21 1 1 
        2  1537 1 1 15 THR HG22 H  -1.107   8.543  15.680 1.00 . A A . 15 THR HG22 1 1 
        2  1538 1 1 15 THR HG23 H  -1.125   7.234  14.498 1.00 . A A . 15 THR HG23 1 1 
        2  1539 1 1 15 THR N    N  -5.016   9.707  14.719 1.00 . A A . 15 THR N    1 1 
        2  1540 1 1 15 THR O    O  -2.467   9.803  17.250 1.00 . A A . 15 THR O    1 1 
        2  1541 1 1 15 THR OG1  O  -3.504   7.603  13.572 1.00 . A A . 15 THR OG1  1 1 
        2  1542 1 1 16 THR C    C  -3.319  12.816  17.976 1.00 . A A . 16 THR C    1 1 
        2  1543 1 1 16 THR CA   C  -2.533  12.496  16.709 1.00 . A A . 16 THR CA   1 1 
        2  1544 1 1 16 THR CB   C  -2.361  13.776  15.885 1.00 . A A . 16 THR CB   1 1 
        2  1545 1 1 16 THR CG2  C  -3.733  14.380  15.566 1.00 . A A . 16 THR CG2  1 1 
        2  1546 1 1 16 THR H    H  -3.743  11.738  15.164 1.00 . A A . 16 THR H    1 1 
        2  1547 1 1 16 THR HA   H  -1.554  12.145  17.002 1.00 . A A . 16 THR HA   1 1 
        2  1548 1 1 16 THR HB   H  -1.845  13.550  14.966 1.00 . A A . 16 THR HB   1 1 
        2  1549 1 1 16 THR HG1  H  -1.499  14.367  17.524 1.00 . A A . 16 THR HG1  1 1 
        2  1550 1 1 16 THR HG21 H  -3.649  15.030  14.708 1.00 . A A . 16 THR HG21 1 1 
        2  1551 1 1 16 THR HG22 H  -4.080  14.949  16.416 1.00 . A A . 16 THR HG22 1 1 
        2  1552 1 1 16 THR HG23 H  -4.437  13.589  15.351 1.00 . A A . 16 THR HG23 1 1 
        2  1553 1 1 16 THR N    N  -3.187  11.454  15.918 1.00 . A A . 16 THR N    1 1 
        2  1554 1 1 16 THR O    O  -2.750  13.244  18.981 1.00 . A A . 16 THR O    1 1 
        2  1555 1 1 16 THR OG1  O  -1.599  14.713  16.634 1.00 . A A . 16 THR OG1  1 1 
        2  1556 1 1 17 LEU C    C  -5.538  11.984  20.162 1.00 . A A . 17 LEU C    1 1 
        2  1557 1 1 17 LEU CA   C  -5.548  12.971  18.996 1.00 . A A . 17 LEU CA   1 1 
        2  1558 1 1 17 LEU CB   C  -6.974  13.079  18.448 1.00 . A A . 17 LEU CB   1 1 
        2  1559 1 1 17 LEU CD1  C  -8.461  14.227  16.800 1.00 . A A . 17 LEU CD1  1 1 
        2  1560 1 1 17 LEU CD2  C  -6.818  15.585  18.135 1.00 . A A . 17 LEU CD2  1 1 
        2  1561 1 1 17 LEU CG   C  -7.066  14.231  17.436 1.00 . A A . 17 LEU CG   1 1 
        2  1562 1 1 17 LEU H    H  -5.069  12.334  17.084 1.00 . A A . 17 LEU H    1 1 
        2  1563 1 1 17 LEU HA   H  -5.281  13.926  19.414 1.00 . A A . 17 LEU HA   1 1 
        2  1564 1 1 17 LEU HB2  H  -7.239  12.151  17.959 1.00 . A A . 17 LEU HB2  1 1 
        2  1565 1 1 17 LEU HB3  H  -7.659  13.261  19.263 1.00 . A A . 17 LEU HB3  1 1 
        2  1566 1 1 17 LEU HD11 H  -8.603  15.140  16.240 1.00 . A A . 17 LEU HD11 1 1 
        2  1567 1 1 17 LEU HD12 H  -9.211  14.161  17.576 1.00 . A A . 17 LEU HD12 1 1 
        2  1568 1 1 17 LEU HD13 H  -8.552  13.380  16.137 1.00 . A A . 17 LEU HD13 1 1 
        2  1569 1 1 17 LEU HD21 H  -7.333  16.373  17.604 1.00 . A A . 17 LEU HD21 1 1 
        2  1570 1 1 17 LEU HD22 H  -5.760  15.797  18.138 1.00 . A A . 17 LEU HD22 1 1 
        2  1571 1 1 17 LEU HD23 H  -7.179  15.545  19.153 1.00 . A A . 17 LEU HD23 1 1 
        2  1572 1 1 17 LEU HG   H  -6.325  14.083  16.665 1.00 . A A . 17 LEU HG   1 1 
        2  1573 1 1 17 LEU N    N  -4.636  12.656  17.901 1.00 . A A . 17 LEU N    1 1 
        2  1574 1 1 17 LEU O    O  -5.915  12.370  21.269 1.00 . A A . 17 LEU O    1 1 
        2  1575 1 1 18 VAL C    C  -4.328  10.333  22.220 1.00 . A A . 18 VAL C    1 1 
        2  1576 1 1 18 VAL CA   C  -5.235   9.813  21.108 1.00 . A A . 18 VAL CA   1 1 
        2  1577 1 1 18 VAL CB   C  -4.785   8.412  20.679 1.00 . A A . 18 VAL CB   1 1 
        2  1578 1 1 18 VAL CG1  C  -4.640   7.510  21.910 1.00 . A A . 18 VAL CG1  1 1 
        2  1579 1 1 18 VAL CG2  C  -5.829   7.815  19.733 1.00 . A A . 18 VAL CG2  1 1 
        2  1580 1 1 18 VAL H    H  -4.860  10.398  19.096 1.00 . A A . 18 VAL H    1 1 
        2  1581 1 1 18 VAL HA   H  -6.269   9.771  21.412 1.00 . A A . 18 VAL HA   1 1 
        2  1582 1 1 18 VAL HB   H  -3.835   8.479  20.171 1.00 . A A . 18 VAL HB   1 1 
        2  1583 1 1 18 VAL HG11 H  -4.606   6.476  21.599 1.00 . A A . 18 VAL HG11 1 1 
        2  1584 1 1 18 VAL HG12 H  -5.485   7.660  22.567 1.00 . A A . 18 VAL HG12 1 1 
        2  1585 1 1 18 VAL HG13 H  -3.730   7.760  22.434 1.00 . A A . 18 VAL HG13 1 1 
        2  1586 1 1 18 VAL HG21 H  -6.083   8.538  18.971 1.00 . A A . 18 VAL HG21 1 1 
        2  1587 1 1 18 VAL HG22 H  -6.717   7.556  20.292 1.00 . A A . 18 VAL HG22 1 1 
        2  1588 1 1 18 VAL HG23 H  -5.427   6.927  19.266 1.00 . A A . 18 VAL HG23 1 1 
        2  1589 1 1 18 VAL N    N  -5.172  10.721  19.968 1.00 . A A . 18 VAL N    1 1 
        2  1590 1 1 18 VAL O    O  -4.731  10.460  23.376 1.00 . A A . 18 VAL O    1 1 
        2  1591 1 1 19 ALA C    C  -2.455  12.389  23.438 1.00 . A A . 19 ALA C    1 1 
        2  1592 1 1 19 ALA CA   C  -2.058  11.082  22.756 1.00 . A A . 19 ALA CA   1 1 
        2  1593 1 1 19 ALA CB   C  -0.748  11.292  21.994 1.00 . A A . 19 ALA CB   1 1 
        2  1594 1 1 19 ALA H    H  -2.827  10.401  20.913 1.00 . A A . 19 ALA H    1 1 
        2  1595 1 1 19 ALA HA   H  -1.892  10.330  23.507 1.00 . A A . 19 ALA HA   1 1 
        2  1596 1 1 19 ALA HB1  H  -0.927  11.925  21.137 1.00 . A A . 19 ALA HB1  1 1 
        2  1597 1 1 19 ALA HB2  H  -0.368  10.337  21.664 1.00 . A A . 19 ALA HB2  1 1 
        2  1598 1 1 19 ALA HB3  H  -0.025  11.762  22.644 1.00 . A A . 19 ALA HB3  1 1 
        2  1599 1 1 19 ALA N    N  -3.084  10.603  21.836 1.00 . A A . 19 ALA N    1 1 
        2  1600 1 1 19 ALA O    O  -2.082  12.633  24.585 1.00 . A A . 19 ALA O    1 1 
        2  1601 1 1 20 LEU C    C  -4.647  14.244  24.458 1.00 . A A . 20 LEU C    1 1 
        2  1602 1 1 20 LEU CA   C  -3.656  14.484  23.317 1.00 . A A . 20 LEU CA   1 1 
        2  1603 1 1 20 LEU CB   C  -4.276  15.378  22.234 1.00 . A A . 20 LEU CB   1 1 
        2  1604 1 1 20 LEU CD1  C  -3.553  17.465  23.454 1.00 . A A . 20 LEU CD1  1 1 
        2  1605 1 1 20 LEU CD2  C  -5.369  17.564  21.722 1.00 . A A . 20 LEU CD2  1 1 
        2  1606 1 1 20 LEU CG   C  -4.744  16.713  22.835 1.00 . A A . 20 LEU CG   1 1 
        2  1607 1 1 20 LEU H    H  -3.527  12.945  21.850 1.00 . A A . 20 LEU H    1 1 
        2  1608 1 1 20 LEU HA   H  -2.801  14.981  23.745 1.00 . A A . 20 LEU HA   1 1 
        2  1609 1 1 20 LEU HB2  H  -3.536  15.573  21.470 1.00 . A A . 20 LEU HB2  1 1 
        2  1610 1 1 20 LEU HB3  H  -5.119  14.871  21.792 1.00 . A A . 20 LEU HB3  1 1 
        2  1611 1 1 20 LEU HD11 H  -3.387  17.109  24.460 1.00 . A A . 20 LEU HD11 1 1 
        2  1612 1 1 20 LEU HD12 H  -3.768  18.525  23.485 1.00 . A A . 20 LEU HD12 1 1 
        2  1613 1 1 20 LEU HD13 H  -2.666  17.297  22.860 1.00 . A A . 20 LEU HD13 1 1 
        2  1614 1 1 20 LEU HD21 H  -4.697  17.598  20.877 1.00 . A A . 20 LEU HD21 1 1 
        2  1615 1 1 20 LEU HD22 H  -5.539  18.565  22.089 1.00 . A A . 20 LEU HD22 1 1 
        2  1616 1 1 20 LEU HD23 H  -6.308  17.126  21.419 1.00 . A A . 20 LEU HD23 1 1 
        2  1617 1 1 20 LEU HG   H  -5.485  16.526  23.598 1.00 . A A . 20 LEU HG   1 1 
        2  1618 1 1 20 LEU N    N  -3.218  13.218  22.739 1.00 . A A . 20 LEU N    1 1 
        2  1619 1 1 20 LEU O    O  -4.521  14.843  25.527 1.00 . A A . 20 LEU O    1 1 
        2  1620 1 1 21 SER C    C  -6.080  12.129  26.339 1.00 . A A . 21 SER C    1 1 
        2  1621 1 1 21 SER CA   C  -6.627  13.074  25.268 1.00 . A A . 21 SER CA   1 1 
        2  1622 1 1 21 SER CB   C  -7.860  12.447  24.617 1.00 . A A . 21 SER CB   1 1 
        2  1623 1 1 21 SER H    H  -5.711  12.916  23.377 1.00 . A A . 21 SER H    1 1 
        2  1624 1 1 21 SER HA   H  -6.922  14.004  25.729 1.00 . A A . 21 SER HA   1 1 
        2  1625 1 1 21 SER HB2  H  -8.263  13.125  23.883 1.00 . A A . 21 SER HB2  1 1 
        2  1626 1 1 21 SER HB3  H  -7.579  11.521  24.133 1.00 . A A . 21 SER HB3  1 1 
        2  1627 1 1 21 SER HG   H  -9.218  13.042  25.877 1.00 . A A . 21 SER HG   1 1 
        2  1628 1 1 21 SER N    N  -5.630  13.374  24.240 1.00 . A A . 21 SER N    1 1 
        2  1629 1 1 21 SER O    O  -6.568  12.090  27.454 1.00 . A A . 21 SER O    1 1 
        2  1630 1 1 21 SER OG   O  -8.844  12.198  25.613 1.00 . A A . 21 SER OG   1 1 
        2  1631 1 1 22 SER C    C  -3.632  11.004  27.925 1.00 . A A . 22 SER C    1 1 
        2  1632 1 1 22 SER CA   C  -4.515  10.341  26.855 1.00 . A A . 22 SER CA   1 1 
        2  1633 1 1 22 SER CB   C  -3.651   9.368  26.057 1.00 . A A . 22 SER CB   1 1 
        2  1634 1 1 22 SER H    H  -4.805  11.440  25.020 1.00 . A A . 22 SER H    1 1 
        2  1635 1 1 22 SER HA   H  -5.331   9.781  27.287 1.00 . A A . 22 SER HA   1 1 
        2  1636 1 1 22 SER HB2  H  -2.889   9.912  25.533 1.00 . A A . 22 SER HB2  1 1 
        2  1637 1 1 22 SER HB3  H  -3.186   8.665  26.735 1.00 . A A . 22 SER HB3  1 1 
        2  1638 1 1 22 SER HG   H  -4.928   9.323  24.590 1.00 . A A . 22 SER HG   1 1 
        2  1639 1 1 22 SER N    N  -5.101  11.333  25.948 1.00 . A A . 22 SER N    1 1 
        2  1640 1 1 22 SER O    O  -3.277  10.393  28.933 1.00 . A A . 22 SER O    1 1 
        2  1641 1 1 22 SER OG   O  -4.466   8.673  25.123 1.00 . A A . 22 SER OG   1 1 
        2  1642 1 1 23 PHE C    C  -3.304  13.586  29.827 1.00 . A A . 23 PHE C    1 1 
        2  1643 1 1 23 PHE CA   C  -2.483  13.033  28.631 1.00 . A A . 23 PHE CA   1 1 
        2  1644 1 1 23 PHE CB   C  -1.719  14.160  27.906 1.00 . A A . 23 PHE CB   1 1 
        2  1645 1 1 23 PHE CD1  C  -0.293  12.403  26.781 1.00 . A A . 23 PHE CD1  1 1 
        2  1646 1 1 23 PHE CD2  C   0.787  14.397  27.642 1.00 . A A . 23 PHE CD2  1 1 
        2  1647 1 1 23 PHE CE1  C   0.948  11.918  26.350 1.00 . A A . 23 PHE CE1  1 1 
        2  1648 1 1 23 PHE CE2  C   2.027  13.912  27.211 1.00 . A A . 23 PHE CE2  1 1 
        2  1649 1 1 23 PHE CG   C  -0.373  13.643  27.427 1.00 . A A . 23 PHE CG   1 1 
        2  1650 1 1 23 PHE CZ   C   2.108  12.672  26.565 1.00 . A A . 23 PHE CZ   1 1 
        2  1651 1 1 23 PHE H    H  -3.753  12.654  26.890 1.00 . A A . 23 PHE H    1 1 
        2  1652 1 1 23 PHE HA   H  -1.772  12.362  29.096 1.00 . A A . 23 PHE HA   1 1 
        2  1653 1 1 23 PHE HB2  H  -2.296  14.494  27.056 1.00 . A A . 23 PHE HB2  1 1 
        2  1654 1 1 23 PHE HB3  H  -1.563  14.990  28.582 1.00 . A A . 23 PHE HB3  1 1 
        2  1655 1 1 23 PHE HD1  H  -1.187  11.821  26.616 1.00 . A A . 23 PHE HD1  1 1 
        2  1656 1 1 23 PHE HD2  H   0.726  15.354  28.140 1.00 . A A . 23 PHE HD2  1 1 
        2  1657 1 1 23 PHE HE1  H   1.010  10.962  25.852 1.00 . A A . 23 PHE HE1  1 1 
        2  1658 1 1 23 PHE HE2  H   2.922  14.494  27.376 1.00 . A A . 23 PHE HE2  1 1 
        2  1659 1 1 23 PHE HZ   H   3.065  12.297  26.232 1.00 . A A . 23 PHE HZ   1 1 
        2  1660 1 1 23 PHE N    N  -3.310  12.271  27.676 1.00 . A A . 23 PHE N    1 1 
        2  1661 1 1 23 PHE O    O  -2.787  13.591  30.943 1.00 . A A . 23 PHE O    1 1 
        2  1662 1 1 24 THR C    C  -5.687  13.659  31.874 1.00 . A A . 24 THR C    1 1 
        2  1663 1 1 24 THR CA   C  -5.272  14.675  30.779 1.00 . A A . 24 THR CA   1 1 
        2  1664 1 1 24 THR CB   C  -6.498  15.463  30.273 1.00 . A A . 24 THR CB   1 1 
        2  1665 1 1 24 THR CG2  C  -7.362  15.906  31.459 1.00 . A A . 24 THR CG2  1 1 
        2  1666 1 1 24 THR H    H  -4.897  14.231  28.741 1.00 . A A . 24 THR H    1 1 
        2  1667 1 1 24 THR HA   H  -4.609  15.393  31.239 1.00 . A A . 24 THR HA   1 1 
        2  1668 1 1 24 THR HB   H  -7.088  14.854  29.614 1.00 . A A . 24 THR HB   1 1 
        2  1669 1 1 24 THR HG1  H  -6.674  17.324  29.736 1.00 . A A . 24 THR HG1  1 1 
        2  1670 1 1 24 THR HG21 H  -8.068  16.655  31.132 1.00 . A A . 24 THR HG21 1 1 
        2  1671 1 1 24 THR HG22 H  -6.729  16.321  32.231 1.00 . A A . 24 THR HG22 1 1 
        2  1672 1 1 24 THR HG23 H  -7.898  15.055  31.852 1.00 . A A . 24 THR HG23 1 1 
        2  1673 1 1 24 THR N    N  -4.528  14.097  29.638 1.00 . A A . 24 THR N    1 1 
        2  1674 1 1 24 THR O    O  -5.665  13.990  33.059 1.00 . A A . 24 THR O    1 1 
        2  1675 1 1 24 THR OG1  O  -6.051  16.613  29.570 1.00 . A A . 24 THR OG1  1 1 
        2  1676 1 1 25 PRO C    C  -5.694  11.230  33.712 1.00 . A A . 25 PRO C    1 1 
        2  1677 1 1 25 PRO CA   C  -6.571  11.419  32.476 1.00 . A A . 25 PRO CA   1 1 
        2  1678 1 1 25 PRO CB   C  -6.585  10.147  31.629 1.00 . A A . 25 PRO CB   1 1 
        2  1679 1 1 25 PRO CD   C  -6.187  11.977  30.132 1.00 . A A . 25 PRO CD   1 1 
        2  1680 1 1 25 PRO CG   C  -6.901  10.630  30.260 1.00 . A A . 25 PRO CG   1 1 
        2  1681 1 1 25 PRO HA   H  -7.580  11.640  32.782 1.00 . A A . 25 PRO HA   1 1 
        2  1682 1 1 25 PRO HB2  H  -5.613   9.668  31.649 1.00 . A A . 25 PRO HB2  1 1 
        2  1683 1 1 25 PRO HB3  H  -7.350   9.466  31.972 1.00 . A A . 25 PRO HB3  1 1 
        2  1684 1 1 25 PRO HD2  H  -5.210  11.842  29.715 1.00 . A A . 25 PRO HD2  1 1 
        2  1685 1 1 25 PRO HD3  H  -6.767  12.655  29.544 1.00 . A A . 25 PRO HD3  1 1 
        2  1686 1 1 25 PRO HG2  H  -6.531   9.931  29.521 1.00 . A A . 25 PRO HG2  1 1 
        2  1687 1 1 25 PRO HG3  H  -7.966  10.769  30.147 1.00 . A A . 25 PRO HG3  1 1 
        2  1688 1 1 25 PRO N    N  -6.098  12.468  31.512 1.00 . A A . 25 PRO N    1 1 
        2  1689 1 1 25 PRO O    O  -6.186  10.758  34.736 1.00 . A A . 25 PRO O    1 1 
        2  1690 1 1 26 VAL C    C  -4.152  12.307  35.982 1.00 . A A . 26 VAL C    1 1 
        2  1691 1 1 26 VAL CA   C  -3.584  11.457  34.845 1.00 . A A . 26 VAL CA   1 1 
        2  1692 1 1 26 VAL CB   C  -2.148  11.890  34.530 1.00 . A A . 26 VAL CB   1 1 
        2  1693 1 1 26 VAL CG1  C  -1.324  11.940  35.819 1.00 . A A . 26 VAL CG1  1 1 
        2  1694 1 1 26 VAL CG2  C  -1.517  10.885  33.564 1.00 . A A . 26 VAL CG2  1 1 
        2  1695 1 1 26 VAL H    H  -4.033  12.033  32.870 1.00 . A A . 26 VAL H    1 1 
        2  1696 1 1 26 VAL HA   H  -3.581  10.426  35.165 1.00 . A A . 26 VAL HA   1 1 
        2  1697 1 1 26 VAL HB   H  -2.161  12.869  34.075 1.00 . A A . 26 VAL HB   1 1 
        2  1698 1 1 26 VAL HG11 H  -1.496  11.041  36.392 1.00 . A A . 26 VAL HG11 1 1 
        2  1699 1 1 26 VAL HG12 H  -1.620  12.799  36.403 1.00 . A A . 26 VAL HG12 1 1 
        2  1700 1 1 26 VAL HG13 H  -0.275  12.015  35.575 1.00 . A A . 26 VAL HG13 1 1 
        2  1701 1 1 26 VAL HG21 H  -0.596  11.290  33.173 1.00 . A A . 26 VAL HG21 1 1 
        2  1702 1 1 26 VAL HG22 H  -2.200  10.693  32.749 1.00 . A A . 26 VAL HG22 1 1 
        2  1703 1 1 26 VAL HG23 H  -1.312   9.963  34.087 1.00 . A A . 26 VAL HG23 1 1 
        2  1704 1 1 26 VAL N    N  -4.421  11.606  33.662 1.00 . A A . 26 VAL N    1 1 
        2  1705 1 1 26 VAL O    O  -4.224  11.857  37.122 1.00 . A A . 26 VAL O    1 1 
        2  1706 1 1 27 LEU C    C  -6.127  13.872  37.537 1.00 . A A . 27 LEU C    1 1 
        2  1707 1 1 27 LEU CA   C  -5.023  14.486  36.673 1.00 . A A . 27 LEU CA   1 1 
        2  1708 1 1 27 LEU CB   C  -5.606  15.700  35.938 1.00 . A A . 27 LEU CB   1 1 
        2  1709 1 1 27 LEU CD1  C  -4.642  17.463  37.478 1.00 . A A . 27 LEU CD1  1 1 
        2  1710 1 1 27 LEU CD2  C  -6.759  17.903  36.199 1.00 . A A . 27 LEU CD2  1 1 
        2  1711 1 1 27 LEU CG   C  -5.932  16.834  36.925 1.00 . A A . 27 LEU CG   1 1 
        2  1712 1 1 27 LEU H    H  -4.368  13.899  34.770 1.00 . A A . 27 LEU H    1 1 
        2  1713 1 1 27 LEU HA   H  -4.193  14.820  37.271 1.00 . A A . 27 LEU HA   1 1 
        2  1714 1 1 27 LEU HB2  H  -4.892  16.051  35.209 1.00 . A A . 27 LEU HB2  1 1 
        2  1715 1 1 27 LEU HB3  H  -6.512  15.403  35.429 1.00 . A A . 27 LEU HB3  1 1 
        2  1716 1 1 27 LEU HD11 H  -4.845  18.468  37.820 1.00 . A A . 27 LEU HD11 1 1 
        2  1717 1 1 27 LEU HD12 H  -3.889  17.496  36.705 1.00 . A A . 27 LEU HD12 1 1 
        2  1718 1 1 27 LEU HD13 H  -4.280  16.875  38.305 1.00 . A A . 27 LEU HD13 1 1 
        2  1719 1 1 27 LEU HD21 H  -6.770  18.811  36.784 1.00 . A A . 27 LEU HD21 1 1 
        2  1720 1 1 27 LEU HD22 H  -7.770  17.548  36.067 1.00 . A A . 27 LEU HD22 1 1 
        2  1721 1 1 27 LEU HD23 H  -6.319  18.104  35.232 1.00 . A A . 27 LEU HD23 1 1 
        2  1722 1 1 27 LEU HG   H  -6.511  16.436  37.746 1.00 . A A . 27 LEU HG   1 1 
        2  1723 1 1 27 LEU N    N  -4.512  13.548  35.674 1.00 . A A . 27 LEU N    1 1 
        2  1724 1 1 27 LEU O    O  -6.329  14.277  38.682 1.00 . A A . 27 LEU O    1 1 
        2  1725 1 1 28 VAL C    C  -7.446  11.323  38.802 1.00 . A A . 28 VAL C    1 1 
        2  1726 1 1 28 VAL CA   C  -7.940  12.236  37.676 1.00 . A A . 28 VAL CA   1 1 
        2  1727 1 1 28 VAL CB   C  -8.748  11.409  36.668 1.00 . A A . 28 VAL CB   1 1 
        2  1728 1 1 28 VAL CG1  C  -9.815  10.589  37.399 1.00 . A A . 28 VAL CG1  1 1 
        2  1729 1 1 28 VAL CG2  C  -9.426  12.350  35.669 1.00 . A A . 28 VAL CG2  1 1 
        2  1730 1 1 28 VAL H    H  -6.632  12.596  36.073 1.00 . A A . 28 VAL H    1 1 
        2  1731 1 1 28 VAL HA   H  -8.592  12.991  38.089 1.00 . A A . 28 VAL HA   1 1 
        2  1732 1 1 28 VAL HB   H  -8.084  10.741  36.140 1.00 . A A . 28 VAL HB   1 1 
        2  1733 1 1 28 VAL HG11 H  -9.346   9.764  37.914 1.00 . A A . 28 VAL HG11 1 1 
        2  1734 1 1 28 VAL HG12 H -10.529  10.208  36.684 1.00 . A A . 28 VAL HG12 1 1 
        2  1735 1 1 28 VAL HG13 H -10.325  11.217  38.115 1.00 . A A . 28 VAL HG13 1 1 
        2  1736 1 1 28 VAL HG21 H  -9.985  13.103  36.206 1.00 . A A . 28 VAL HG21 1 1 
        2  1737 1 1 28 VAL HG22 H -10.099  11.783  35.043 1.00 . A A . 28 VAL HG22 1 1 
        2  1738 1 1 28 VAL HG23 H  -8.676  12.826  35.056 1.00 . A A . 28 VAL HG23 1 1 
        2  1739 1 1 28 VAL N    N  -6.844  12.906  36.978 1.00 . A A . 28 VAL N    1 1 
        2  1740 1 1 28 VAL O    O  -8.111  11.171  39.828 1.00 . A A . 28 VAL O    1 1 
        2  1741 1 1 29 ILE C    C  -5.479  10.533  40.931 1.00 . A A . 29 ILE C    1 1 
        2  1742 1 1 29 ILE CA   C  -5.711   9.816  39.600 1.00 . A A . 29 ILE CA   1 1 
        2  1743 1 1 29 ILE CB   C  -4.403   9.175  39.091 1.00 . A A . 29 ILE CB   1 1 
        2  1744 1 1 29 ILE CD1  C  -2.381   9.884  40.456 1.00 . A A . 29 ILE CD1  1 1 
        2  1745 1 1 29 ILE CG1  C  -3.213  10.174  39.198 1.00 . A A . 29 ILE CG1  1 1 
        2  1746 1 1 29 ILE CG2  C  -4.589   8.731  37.631 1.00 . A A . 29 ILE CG2  1 1 
        2  1747 1 1 29 ILE H    H  -5.777  10.933  37.788 1.00 . A A . 29 ILE H    1 1 
        2  1748 1 1 29 ILE HA   H  -6.418   9.028  39.813 1.00 . A A . 29 ILE HA   1 1 
        2  1749 1 1 29 ILE HB   H  -4.195   8.297  39.689 1.00 . A A . 29 ILE HB   1 1 
        2  1750 1 1 29 ILE HD11 H  -1.726  10.720  40.654 1.00 . A A . 29 ILE HD11 1 1 
        2  1751 1 1 29 ILE HD12 H  -1.790   8.995  40.298 1.00 . A A . 29 ILE HD12 1 1 
        2  1752 1 1 29 ILE HD13 H  -3.038   9.733  41.299 1.00 . A A . 29 ILE HD13 1 1 
        2  1753 1 1 29 ILE HG12 H  -2.574  10.077  38.331 1.00 . A A . 29 ILE HG12 1 1 
        2  1754 1 1 29 ILE HG13 H  -3.583  11.185  39.248 1.00 . A A . 29 ILE HG13 1 1 
        2  1755 1 1 29 ILE HG21 H  -5.341   7.960  37.584 1.00 . A A . 29 ILE HG21 1 1 
        2  1756 1 1 29 ILE HG22 H  -3.654   8.345  37.253 1.00 . A A . 29 ILE HG22 1 1 
        2  1757 1 1 29 ILE HG23 H  -4.897   9.572  37.030 1.00 . A A . 29 ILE HG23 1 1 
        2  1758 1 1 29 ILE N    N  -6.282  10.717  38.599 1.00 . A A . 29 ILE N    1 1 
        2  1759 1 1 29 ILE O    O  -5.618   9.917  41.987 1.00 . A A . 29 ILE O    1 1 
        2  1760 1 1 30 LEU C    C  -6.181  12.502  43.022 1.00 . A A . 30 LEU C    1 1 
        2  1761 1 1 30 LEU CA   C  -4.916  12.525  42.168 1.00 . A A . 30 LEU CA   1 1 
        2  1762 1 1 30 LEU CB   C  -4.496  13.973  41.904 1.00 . A A . 30 LEU CB   1 1 
        2  1763 1 1 30 LEU CD1  C  -2.764  15.445  40.868 1.00 . A A . 30 LEU CD1  1 1 
        2  1764 1 1 30 LEU CD2  C  -2.041  13.559  42.364 1.00 . A A . 30 LEU CD2  1 1 
        2  1765 1 1 30 LEU CG   C  -3.077  14.014  41.314 1.00 . A A . 30 LEU CG   1 1 
        2  1766 1 1 30 LEU H    H  -5.028  12.289  40.057 1.00 . A A . 30 LEU H    1 1 
        2  1767 1 1 30 LEU HA   H  -4.152  12.037  42.750 1.00 . A A . 30 LEU HA   1 1 
        2  1768 1 1 30 LEU HB2  H  -5.187  14.420  41.204 1.00 . A A . 30 LEU HB2  1 1 
        2  1769 1 1 30 LEU HB3  H  -4.517  14.529  42.829 1.00 . A A . 30 LEU HB3  1 1 
        2  1770 1 1 30 LEU HD11 H  -1.843  15.453  40.303 1.00 . A A . 30 LEU HD11 1 1 
        2  1771 1 1 30 LEU HD12 H  -2.658  16.078  41.736 1.00 . A A . 30 LEU HD12 1 1 
        2  1772 1 1 30 LEU HD13 H  -3.568  15.813  40.252 1.00 . A A . 30 LEU HD13 1 1 
        2  1773 1 1 30 LEU HD21 H  -1.931  12.486  42.319 1.00 . A A . 30 LEU HD21 1 1 
        2  1774 1 1 30 LEU HD22 H  -2.366  13.845  43.354 1.00 . A A . 30 LEU HD22 1 1 
        2  1775 1 1 30 LEU HD23 H  -1.083  14.019  42.157 1.00 . A A . 30 LEU HD23 1 1 
        2  1776 1 1 30 LEU HG   H  -3.032  13.357  40.456 1.00 . A A . 30 LEU HG   1 1 
        2  1777 1 1 30 LEU N    N  -5.137  11.817  40.910 1.00 . A A . 30 LEU N    1 1 
        2  1778 1 1 30 LEU O    O  -6.110  12.184  44.207 1.00 . A A . 30 LEU O    1 1 
        2  1779 1 1 31 LEU C    C  -8.762  11.507  43.914 1.00 . A A . 31 LEU C    1 1 
        2  1780 1 1 31 LEU CA   C  -8.545  12.879  43.275 1.00 . A A . 31 LEU CA   1 1 
        2  1781 1 1 31 LEU CB   C  -9.750  13.205  42.376 1.00 . A A . 31 LEU CB   1 1 
        2  1782 1 1 31 LEU CD1  C  -8.529  15.159  41.390 1.00 . A A . 31 LEU CD1  1 1 
        2  1783 1 1 31 LEU CD2  C -11.018  15.015  41.209 1.00 . A A . 31 LEU CD2  1 1 
        2  1784 1 1 31 LEU CG   C  -9.810  14.712  42.099 1.00 . A A . 31 LEU CG   1 1 
        2  1785 1 1 31 LEU H    H  -7.372  13.194  41.546 1.00 . A A . 31 LEU H    1 1 
        2  1786 1 1 31 LEU HA   H  -8.444  13.665  44.010 1.00 . A A . 31 LEU HA   1 1 
        2  1787 1 1 31 LEU HB2  H  -9.655  12.673  41.441 1.00 . A A . 31 LEU HB2  1 1 
        2  1788 1 1 31 LEU HB3  H -10.663  12.900  42.870 1.00 . A A . 31 LEU HB3  1 1 
        2  1789 1 1 31 LEU HD11 H  -7.721  15.211  42.104 1.00 . A A . 31 LEU HD11 1 1 
        2  1790 1 1 31 LEU HD12 H  -8.681  16.133  40.948 1.00 . A A . 31 LEU HD12 1 1 
        2  1791 1 1 31 LEU HD13 H  -8.279  14.448  40.614 1.00 . A A . 31 LEU HD13 1 1 
        2  1792 1 1 31 LEU HD21 H -10.809  14.701  40.197 1.00 . A A . 31 LEU HD21 1 1 
        2  1793 1 1 31 LEU HD22 H -11.218  16.076  41.222 1.00 . A A . 31 LEU HD22 1 1 
        2  1794 1 1 31 LEU HD23 H -11.882  14.482  41.579 1.00 . A A . 31 LEU HD23 1 1 
        2  1795 1 1 31 LEU HG   H  -9.907  15.245  43.034 1.00 . A A . 31 LEU HG   1 1 
        2  1796 1 1 31 LEU N    N  -7.332  12.861  42.466 1.00 . A A . 31 LEU N    1 1 
        2  1797 1 1 31 LEU O    O  -9.126  11.386  45.083 1.00 . A A . 31 LEU O    1 1 
        2  1798 1 1 32 GLY C    C  -7.620   8.839  44.701 1.00 . A A . 32 GLY C    1 1 
        2  1799 1 1 32 GLY CA   C  -8.612   9.102  43.570 1.00 . A A . 32 GLY CA   1 1 
        2  1800 1 1 32 GLY H    H  -8.157  10.696  42.217 1.00 . A A . 32 GLY H    1 1 
        2  1801 1 1 32 GLY HA2  H  -9.618   8.929  43.927 1.00 . A A . 32 GLY HA2  1 1 
        2  1802 1 1 32 GLY HA3  H  -8.403   8.431  42.751 1.00 . A A . 32 GLY HA3  1 1 
        2  1803 1 1 32 GLY N    N  -8.493  10.482  43.112 1.00 . A A . 32 GLY N    1 1 
        2  1804 1 1 32 GLY O    O  -7.967   8.272  45.732 1.00 . A A . 32 GLY O    1 1 
        2  1805 1 1 33 VAL C    C  -5.972   9.818  46.822 1.00 . A A . 33 VAL C    1 1 
        2  1806 1 1 33 VAL CA   C  -5.384   9.186  45.557 1.00 . A A . 33 VAL CA   1 1 
        2  1807 1 1 33 VAL CB   C  -4.072   9.879  45.165 1.00 . A A . 33 VAL CB   1 1 
        2  1808 1 1 33 VAL CG1  C  -3.151   9.964  46.388 1.00 . A A . 33 VAL CG1  1 1 
        2  1809 1 1 33 VAL CG2  C  -3.371   9.070  44.069 1.00 . A A . 33 VAL CG2  1 1 
        2  1810 1 1 33 VAL H    H  -6.265   9.825  43.676 1.00 . A A . 33 VAL H    1 1 
        2  1811 1 1 33 VAL HA   H  -5.199   8.139  45.753 1.00 . A A . 33 VAL HA   1 1 
        2  1812 1 1 33 VAL HB   H  -4.282  10.874  44.803 1.00 . A A . 33 VAL HB   1 1 
        2  1813 1 1 33 VAL HG11 H  -2.155  10.232  46.071 1.00 . A A . 33 VAL HG11 1 1 
        2  1814 1 1 33 VAL HG12 H  -3.127   9.008  46.888 1.00 . A A . 33 VAL HG12 1 1 
        2  1815 1 1 33 VAL HG13 H  -3.528  10.716  47.067 1.00 . A A . 33 VAL HG13 1 1 
        2  1816 1 1 33 VAL HG21 H  -2.612   9.680  43.603 1.00 . A A . 33 VAL HG21 1 1 
        2  1817 1 1 33 VAL HG22 H  -4.092   8.763  43.327 1.00 . A A . 33 VAL HG22 1 1 
        2  1818 1 1 33 VAL HG23 H  -2.911   8.194  44.505 1.00 . A A . 33 VAL HG23 1 1 
        2  1819 1 1 33 VAL N    N  -6.396   9.323  44.506 1.00 . A A . 33 VAL N    1 1 
        2  1820 1 1 33 VAL O    O  -5.959   9.214  47.894 1.00 . A A . 33 VAL O    1 1 
        2  1821 1 1 34 VAL C    C  -8.211  10.915  48.389 1.00 . A A . 34 VAL C    1 1 
        2  1822 1 1 34 VAL CA   C  -7.056  11.745  47.827 1.00 . A A . 34 VAL CA   1 1 
        2  1823 1 1 34 VAL CB   C  -7.570  13.121  47.387 1.00 . A A . 34 VAL CB   1 1 
        2  1824 1 1 34 VAL CG1  C  -8.367  13.763  48.527 1.00 . A A . 34 VAL CG1  1 1 
        2  1825 1 1 34 VAL CG2  C  -6.384  14.019  47.030 1.00 . A A . 34 VAL CG2  1 1 
        2  1826 1 1 34 VAL H    H  -6.361  11.491  45.822 1.00 . A A . 34 VAL H    1 1 
        2  1827 1 1 34 VAL HA   H  -6.268  11.881  48.554 1.00 . A A . 34 VAL HA   1 1 
        2  1828 1 1 34 VAL HB   H  -8.209  13.006  46.525 1.00 . A A . 34 VAL HB   1 1 
        2  1829 1 1 34 VAL HG11 H  -9.327  13.277  48.615 1.00 . A A . 34 VAL HG11 1 1 
        2  1830 1 1 34 VAL HG12 H  -8.514  14.813  48.319 1.00 . A A . 34 VAL HG12 1 1 
        2  1831 1 1 34 VAL HG13 H  -7.822  13.652  49.453 1.00 . A A . 34 VAL HG13 1 1 
        2  1832 1 1 34 VAL HG21 H  -5.804  14.218  47.919 1.00 . A A . 34 VAL HG21 1 1 
        2  1833 1 1 34 VAL HG22 H  -6.748  14.951  46.622 1.00 . A A . 34 VAL HG22 1 1 
        2  1834 1 1 34 VAL HG23 H  -5.764  13.523  46.298 1.00 . A A . 34 VAL HG23 1 1 
        2  1835 1 1 34 VAL N    N  -6.476  11.041  46.684 1.00 . A A . 34 VAL N    1 1 
        2  1836 1 1 34 VAL O    O  -8.381  10.763  49.598 1.00 . A A . 34 VAL O    1 1 
        2  1837 1 1 35 GLY C    C  -9.649   8.346  48.630 1.00 . A A . 35 GLY C    1 1 
        2  1838 1 1 35 GLY CA   C -10.135   9.550  47.822 1.00 . A A . 35 GLY CA   1 1 
        2  1839 1 1 35 GLY H    H  -8.746  10.577  46.534 1.00 . A A . 35 GLY H    1 1 
        2  1840 1 1 35 GLY HA2  H -10.829  10.130  48.415 1.00 . A A . 35 GLY HA2  1 1 
        2  1841 1 1 35 GLY HA3  H -10.627   9.202  46.927 1.00 . A A . 35 GLY HA3  1 1 
        2  1842 1 1 35 GLY N    N  -8.992  10.382  47.463 1.00 . A A . 35 GLY N    1 1 
        2  1843 1 1 35 GLY O    O -10.203   8.012  49.677 1.00 . A A . 35 GLY O    1 1 
        2  1844 1 1 36 LEU C    C  -7.262   7.006  50.071 1.00 . A A . 36 LEU C    1 1 
        2  1845 1 1 36 LEU CA   C  -7.971   6.574  48.787 1.00 . A A . 36 LEU CA   1 1 
        2  1846 1 1 36 LEU CB   C  -6.948   5.928  47.848 1.00 . A A . 36 LEU CB   1 1 
        2  1847 1 1 36 LEU CD1  C  -6.610   4.846  45.622 1.00 . A A . 36 LEU CD1  1 1 
        2  1848 1 1 36 LEU CD2  C  -8.478   4.048  47.107 1.00 . A A . 36 LEU CD2  1 1 
        2  1849 1 1 36 LEU CG   C  -7.660   5.278  46.652 1.00 . A A . 36 LEU CG   1 1 
        2  1850 1 1 36 LEU H    H  -8.200   8.063  47.302 1.00 . A A . 36 LEU H    1 1 
        2  1851 1 1 36 LEU HA   H  -8.737   5.851  49.014 1.00 . A A . 36 LEU HA   1 1 
        2  1852 1 1 36 LEU HB2  H  -6.268   6.687  47.488 1.00 . A A . 36 LEU HB2  1 1 
        2  1853 1 1 36 LEU HB3  H  -6.390   5.178  48.386 1.00 . A A . 36 LEU HB3  1 1 
        2  1854 1 1 36 LEU HD11 H  -5.874   4.216  46.100 1.00 . A A . 36 LEU HD11 1 1 
        2  1855 1 1 36 LEU HD12 H  -6.125   5.721  45.215 1.00 . A A . 36 LEU HD12 1 1 
        2  1856 1 1 36 LEU HD13 H  -7.091   4.299  44.824 1.00 . A A . 36 LEU HD13 1 1 
        2  1857 1 1 36 LEU HD21 H  -8.563   3.343  46.292 1.00 . A A . 36 LEU HD21 1 1 
        2  1858 1 1 36 LEU HD22 H  -9.467   4.366  47.401 1.00 . A A . 36 LEU HD22 1 1 
        2  1859 1 1 36 LEU HD23 H  -7.992   3.569  47.946 1.00 . A A . 36 LEU HD23 1 1 
        2  1860 1 1 36 LEU HG   H  -8.323   6.001  46.198 1.00 . A A . 36 LEU HG   1 1 
        2  1861 1 1 36 LEU N    N  -8.587   7.726  48.133 1.00 . A A . 36 LEU N    1 1 
        2  1862 1 1 36 LEU O    O  -7.213   6.268  51.056 1.00 . A A . 36 LEU O    1 1 
        2  1863 1 1 37 SER C    C  -7.110   8.864  52.363 1.00 . A A . 37 SER C    1 1 
        2  1864 1 1 37 SER CA   C  -6.096   8.802  51.225 1.00 . A A . 37 SER CA   1 1 
        2  1865 1 1 37 SER CB   C  -5.532  10.195  50.938 1.00 . A A . 37 SER CB   1 1 
        2  1866 1 1 37 SER H    H  -6.941   8.785  49.259 1.00 . A A . 37 SER H    1 1 
        2  1867 1 1 37 SER HA   H  -5.296   8.149  51.538 1.00 . A A . 37 SER HA   1 1 
        2  1868 1 1 37 SER HB2  H  -4.821  10.140  50.130 1.00 . A A . 37 SER HB2  1 1 
        2  1869 1 1 37 SER HB3  H  -6.335  10.860  50.662 1.00 . A A . 37 SER HB3  1 1 
        2  1870 1 1 37 SER HG   H  -4.524  11.550  51.905 1.00 . A A . 37 SER HG   1 1 
        2  1871 1 1 37 SER N    N  -6.757   8.237  50.049 1.00 . A A . 37 SER N    1 1 
        2  1872 1 1 37 SER O    O  -6.804   8.563  53.489 1.00 . A A . 37 SER O    1 1 
        2  1873 1 1 37 SER OG   O  -4.882  10.681  52.104 1.00 . A A . 37 SER OG   1 1 
        2  1874 1 1 38 ALA C    C  -9.586   7.928  53.699 1.00 . A A . 38 ALA C    1 1 
        2  1875 1 1 38 ALA CA   C  -9.387   9.304  53.042 1.00 . A A . 38 ALA CA   1 1 
        2  1876 1 1 38 ALA CB   C -10.694   9.780  52.408 1.00 . A A . 38 ALA CB   1 1 
        2  1877 1 1 38 ALA H    H  -8.479   9.460  51.094 1.00 . A A . 38 ALA H    1 1 
        2  1878 1 1 38 ALA HA   H  -9.114   9.969  53.848 1.00 . A A . 38 ALA HA   1 1 
        2  1879 1 1 38 ALA HB1  H -10.517  10.690  51.855 1.00 . A A . 38 ALA HB1  1 1 
        2  1880 1 1 38 ALA HB2  H -11.424   9.966  53.183 1.00 . A A . 38 ALA HB2  1 1 
        2  1881 1 1 38 ALA HB3  H -11.068   9.019  51.738 1.00 . A A . 38 ALA HB3  1 1 
        2  1882 1 1 38 ALA N    N  -8.324   9.234  52.035 1.00 . A A . 38 ALA N    1 1 
        2  1883 1 1 38 ALA O    O  -9.843   7.841  54.900 1.00 . A A . 38 ALA O    1 1 
        2  1884 1 1 39 LEU C    C  -8.373   5.097  54.305 1.00 . A A . 39 LEU C    1 1 
        2  1885 1 1 39 LEU CA   C  -9.614   5.522  53.484 1.00 . A A . 39 LEU CA   1 1 
        2  1886 1 1 39 LEU CB   C  -9.846   4.512  52.356 1.00 . A A . 39 LEU CB   1 1 
        2  1887 1 1 39 LEU CD1  C -11.271   3.910  50.393 1.00 . A A . 39 LEU CD1  1 1 
        2  1888 1 1 39 LEU CD2  C -12.348   4.819  52.472 1.00 . A A . 39 LEU CD2  1 1 
        2  1889 1 1 39 LEU CG   C -11.106   4.886  51.562 1.00 . A A . 39 LEU CG   1 1 
        2  1890 1 1 39 LEU H    H  -9.217   7.049  51.985 1.00 . A A . 39 LEU H    1 1 
        2  1891 1 1 39 LEU HA   H -10.471   5.515  54.139 1.00 . A A . 39 LEU HA   1 1 
        2  1892 1 1 39 LEU HB2  H  -8.991   4.512  51.695 1.00 . A A . 39 LEU HB2  1 1 
        2  1893 1 1 39 LEU HB3  H  -9.972   3.526  52.779 1.00 . A A . 39 LEU HB3  1 1 
        2  1894 1 1 39 LEU HD11 H -10.407   3.971  49.749 1.00 . A A . 39 LEU HD11 1 1 
        2  1895 1 1 39 LEU HD12 H -12.157   4.168  49.832 1.00 . A A . 39 LEU HD12 1 1 
        2  1896 1 1 39 LEU HD13 H -11.367   2.905  50.774 1.00 . A A . 39 LEU HD13 1 1 
        2  1897 1 1 39 LEU HD21 H -12.234   4.021  53.191 1.00 . A A . 39 LEU HD21 1 1 
        2  1898 1 1 39 LEU HD22 H -13.230   4.637  51.874 1.00 . A A . 39 LEU HD22 1 1 
        2  1899 1 1 39 LEU HD23 H -12.463   5.759  52.992 1.00 . A A . 39 LEU HD23 1 1 
        2  1900 1 1 39 LEU HG   H -10.996   5.890  51.176 1.00 . A A . 39 LEU HG   1 1 
        2  1901 1 1 39 LEU N    N  -9.455   6.870  52.920 1.00 . A A . 39 LEU N    1 1 
        2  1902 1 1 39 LEU O    O  -8.493   4.650  55.447 1.00 . A A . 39 LEU O    1 1 
        2  1903 1 1 40 THR C    C  -5.212   6.012  55.002 1.00 . A A . 40 THR C    1 1 
        2  1904 1 1 40 THR CA   C  -5.925   4.820  54.340 1.00 . A A . 40 THR CA   1 1 
        2  1905 1 1 40 THR CB   C  -4.999   4.201  53.280 1.00 . A A . 40 THR CB   1 1 
        2  1906 1 1 40 THR CG2  C  -3.938   3.322  53.950 1.00 . A A . 40 THR CG2  1 1 
        2  1907 1 1 40 THR H    H  -7.231   5.537  52.767 1.00 . A A . 40 THR H    1 1 
        2  1908 1 1 40 THR HA   H  -6.134   4.071  55.090 1.00 . A A . 40 THR HA   1 1 
        2  1909 1 1 40 THR HB   H  -4.512   4.986  52.722 1.00 . A A . 40 THR HB   1 1 
        2  1910 1 1 40 THR HG1  H  -6.408   3.978  51.956 1.00 . A A . 40 THR HG1  1 1 
        2  1911 1 1 40 THR HG21 H  -3.330   3.925  54.607 1.00 . A A . 40 THR HG21 1 1 
        2  1912 1 1 40 THR HG22 H  -3.312   2.874  53.193 1.00 . A A . 40 THR HG22 1 1 
        2  1913 1 1 40 THR HG23 H  -4.424   2.545  54.522 1.00 . A A . 40 THR HG23 1 1 
        2  1914 1 1 40 THR N    N  -7.198   5.218  53.693 1.00 . A A . 40 THR N    1 1 
        2  1915 1 1 40 THR O    O  -4.156   5.862  55.615 1.00 . A A . 40 THR O    1 1 
        2  1916 1 1 40 THR OG1  O  -5.773   3.405  52.393 1.00 . A A . 40 THR OG1  1 1 
        2  1917 1 1 41 GLY C    C  -3.928   8.747  55.234 1.00 . A A . 41 GLY C    1 1 
        2  1918 1 1 41 GLY CA   C  -5.343   8.351  55.641 1.00 . A A . 41 GLY CA   1 1 
        2  1919 1 1 41 GLY H    H  -6.782   7.141  54.624 1.00 . A A . 41 GLY H    1 1 
        2  1920 1 1 41 GLY HA2  H  -6.000   9.187  55.462 1.00 . A A . 41 GLY HA2  1 1 
        2  1921 1 1 41 GLY HA3  H  -5.344   8.147  56.703 1.00 . A A . 41 GLY HA3  1 1 
        2  1922 1 1 41 GLY N    N  -5.859   7.160  54.953 1.00 . A A . 41 GLY N    1 1 
        2  1923 1 1 41 GLY O    O  -3.001   8.628  56.037 1.00 . A A . 41 GLY O    1 1 
        2  1924 1 1 42 TYR C    C  -2.412  11.192  53.400 1.00 . A A . 42 TYR C    1 1 
        2  1925 1 1 42 TYR CA   C  -2.426   9.665  53.538 1.00 . A A . 42 TYR CA   1 1 
        2  1926 1 1 42 TYR CB   C  -2.140   9.000  52.162 1.00 . A A . 42 TYR CB   1 1 
        2  1927 1 1 42 TYR CD1  C  -0.972   7.012  53.208 1.00 . A A . 42 TYR CD1  1 1 
        2  1928 1 1 42 TYR CD2  C   0.132   8.190  51.399 1.00 . A A . 42 TYR CD2  1 1 
        2  1929 1 1 42 TYR CE1  C   0.114   6.133  53.298 1.00 . A A . 42 TYR CE1  1 1 
        2  1930 1 1 42 TYR CE2  C   1.218   7.311  51.488 1.00 . A A . 42 TYR CE2  1 1 
        2  1931 1 1 42 TYR CG   C  -0.963   8.040  52.258 1.00 . A A . 42 TYR CG   1 1 
        2  1932 1 1 42 TYR CZ   C   1.210   6.283  52.438 1.00 . A A . 42 TYR CZ   1 1 
        2  1933 1 1 42 TYR H    H  -4.483   9.325  53.370 1.00 . A A . 42 TYR H    1 1 
        2  1934 1 1 42 TYR HA   H  -1.653   9.371  54.238 1.00 . A A . 42 TYR HA   1 1 
        2  1935 1 1 42 TYR HB2  H  -3.013   8.446  51.855 1.00 . A A . 42 TYR HB2  1 1 
        2  1936 1 1 42 TYR HB3  H  -1.926   9.756  51.418 1.00 . A A . 42 TYR HB3  1 1 
        2  1937 1 1 42 TYR HD1  H  -1.816   6.896  53.872 1.00 . A A . 42 TYR HD1  1 1 
        2  1938 1 1 42 TYR HD2  H   0.139   8.981  50.666 1.00 . A A . 42 TYR HD2  1 1 
        2  1939 1 1 42 TYR HE1  H   0.108   5.339  54.031 1.00 . A A . 42 TYR HE1  1 1 
        2  1940 1 1 42 TYR HE2  H   2.062   7.427  50.825 1.00 . A A . 42 TYR HE2  1 1 
        2  1941 1 1 42 TYR HH   H   2.460   5.076  51.647 1.00 . A A . 42 TYR HH   1 1 
        2  1942 1 1 42 TYR N    N  -3.744   9.236  54.008 1.00 . A A . 42 TYR N    1 1 
        2  1943 1 1 42 TYR O    O  -1.587  11.754  52.680 1.00 . A A . 42 TYR O    1 1 
        2  1944 1 1 42 TYR OH   O   2.280   5.417  52.526 1.00 . A A . 42 TYR OH   1 1 
        2  1945 1 1 43 LEU C    C  -2.128  14.007  54.201 1.00 . A A . 43 LEU C    1 1 
        2  1946 1 1 43 LEU CA   C  -3.473  13.302  54.046 1.00 . A A . 43 LEU CA   1 1 
        2  1947 1 1 43 LEU CB   C  -4.305  13.680  55.286 1.00 . A A . 43 LEU CB   1 1 
        2  1948 1 1 43 LEU CD1  C  -5.250  15.729  54.139 1.00 . A A . 43 LEU CD1  1 1 
        2  1949 1 1 43 LEU CD2  C  -5.335  15.514  56.637 1.00 . A A . 43 LEU CD2  1 1 
        2  1950 1 1 43 LEU CG   C  -4.509  15.205  55.381 1.00 . A A . 43 LEU CG   1 1 
        2  1951 1 1 43 LEU H    H  -3.983  11.355  54.642 1.00 . A A . 43 LEU H    1 1 
        2  1952 1 1 43 LEU HA   H  -4.049  13.642  53.200 1.00 . A A . 43 LEU HA   1 1 
        2  1953 1 1 43 LEU HB2  H  -5.270  13.198  55.226 1.00 . A A . 43 LEU HB2  1 1 
        2  1954 1 1 43 LEU HB3  H  -3.794  13.336  56.173 1.00 . A A . 43 LEU HB3  1 1 
        2  1955 1 1 43 LEU HD11 H  -5.973  14.995  53.810 1.00 . A A . 43 LEU HD11 1 1 
        2  1956 1 1 43 LEU HD12 H  -4.538  15.911  53.348 1.00 . A A . 43 LEU HD12 1 1 
        2  1957 1 1 43 LEU HD13 H  -5.758  16.652  54.378 1.00 . A A . 43 LEU HD13 1 1 
        2  1958 1 1 43 LEU HD21 H  -4.944  14.952  57.472 1.00 . A A . 43 LEU HD21 1 1 
        2  1959 1 1 43 LEU HD22 H  -6.365  15.238  56.467 1.00 . A A . 43 LEU HD22 1 1 
        2  1960 1 1 43 LEU HD23 H  -5.278  16.570  56.855 1.00 . A A . 43 LEU HD23 1 1 
        2  1961 1 1 43 LEU HG   H  -3.551  15.698  55.460 1.00 . A A . 43 LEU HG   1 1 
        2  1962 1 1 43 LEU N    N  -3.344  11.848  54.086 1.00 . A A . 43 LEU N    1 1 
        2  1963 1 1 43 LEU O    O  -1.692  14.756  53.327 1.00 . A A . 43 LEU O    1 1 
        2  1964 1 1 44 ASP C    C   0.854  13.819  54.614 1.00 . A A . 44 ASP C    1 1 
        2  1965 1 1 44 ASP CA   C  -0.178  14.325  55.616 1.00 . A A . 44 ASP CA   1 1 
        2  1966 1 1 44 ASP CB   C   0.262  14.008  57.047 1.00 . A A . 44 ASP CB   1 1 
        2  1967 1 1 44 ASP CG   C   1.592  14.687  57.354 1.00 . A A . 44 ASP CG   1 1 
        2  1968 1 1 44 ASP H    H  -1.897  13.099  55.946 1.00 . A A . 44 ASP H    1 1 
        2  1969 1 1 44 ASP HA   H  -0.252  15.392  55.477 1.00 . A A . 44 ASP HA   1 1 
        2  1970 1 1 44 ASP HB2  H  -0.489  14.360  57.739 1.00 . A A . 44 ASP HB2  1 1 
        2  1971 1 1 44 ASP HB3  H   0.375  12.940  57.155 1.00 . A A . 44 ASP HB3  1 1 
        2  1972 1 1 44 ASP N    N  -1.482  13.737  55.329 1.00 . A A . 44 ASP N    1 1 
        2  1973 1 1 44 ASP O    O   1.707  14.579  54.155 1.00 . A A . 44 ASP O    1 1 
        2  1974 1 1 44 ASP OD1  O   1.597  15.895  57.530 1.00 . A A . 44 ASP OD1  1 1 
        2  1975 1 1 44 ASP OD2  O   2.586  13.983  57.427 1.00 . A A . 44 ASP OD2  1 1 
        2  1976 1 1 45 TYR C    C   1.705  12.666  52.001 1.00 . A A . 45 TYR C    1 1 
        2  1977 1 1 45 TYR CA   C   1.747  11.957  53.356 1.00 . A A . 45 TYR CA   1 1 
        2  1978 1 1 45 TYR CB   C   1.456  10.460  53.160 1.00 . A A . 45 TYR CB   1 1 
        2  1979 1 1 45 TYR CD1  C   1.221   9.442  55.462 1.00 . A A . 45 TYR CD1  1 1 
        2  1980 1 1 45 TYR CD2  C   3.292   9.118  54.243 1.00 . A A . 45 TYR CD2  1 1 
        2  1981 1 1 45 TYR CE1  C   1.728   8.683  56.525 1.00 . A A . 45 TYR CE1  1 1 
        2  1982 1 1 45 TYR CE2  C   3.799   8.360  55.305 1.00 . A A . 45 TYR CE2  1 1 
        2  1983 1 1 45 TYR CG   C   2.003   9.659  54.322 1.00 . A A . 45 TYR CG   1 1 
        2  1984 1 1 45 TYR CZ   C   3.017   8.143  56.445 1.00 . A A . 45 TYR CZ   1 1 
        2  1985 1 1 45 TYR H    H   0.118  11.963  54.717 1.00 . A A . 45 TYR H    1 1 
        2  1986 1 1 45 TYR HA   H   2.743  12.067  53.757 1.00 . A A . 45 TYR HA   1 1 
        2  1987 1 1 45 TYR HB2  H   0.390  10.308  53.095 1.00 . A A . 45 TYR HB2  1 1 
        2  1988 1 1 45 TYR HB3  H   1.921  10.117  52.246 1.00 . A A . 45 TYR HB3  1 1 
        2  1989 1 1 45 TYR HD1  H   0.228   9.859  55.525 1.00 . A A . 45 TYR HD1  1 1 
        2  1990 1 1 45 TYR HD2  H   3.895   9.286  53.363 1.00 . A A . 45 TYR HD2  1 1 
        2  1991 1 1 45 TYR HE1  H   1.126   8.515  57.405 1.00 . A A . 45 TYR HE1  1 1 
        2  1992 1 1 45 TYR HE2  H   4.794   7.942  55.245 1.00 . A A . 45 TYR HE2  1 1 
        2  1993 1 1 45 TYR HH   H   4.046   6.684  57.124 1.00 . A A . 45 TYR HH   1 1 
        2  1994 1 1 45 TYR N    N   0.789  12.535  54.290 1.00 . A A . 45 TYR N    1 1 
        2  1995 1 1 45 TYR O    O   2.761  12.922  51.430 1.00 . A A . 45 TYR O    1 1 
        2  1996 1 1 45 TYR OH   O   3.517   7.395  57.493 1.00 . A A . 45 TYR OH   1 1 
        2  1997 1 1 46 VAL C    C   1.573  14.177  49.553 1.00 . A A . 46 VAL C    1 1 
        2  1998 1 1 46 VAL CA   C   0.297  13.599  50.173 1.00 . A A . 46 VAL CA   1 1 
        2  1999 1 1 46 VAL CB   C  -0.744  14.712  50.314 1.00 . A A . 46 VAL CB   1 1 
        2  2000 1 1 46 VAL CG1  C  -0.194  15.831  51.206 1.00 . A A . 46 VAL CG1  1 1 
        2  2001 1 1 46 VAL CG2  C  -1.079  15.277  48.931 1.00 . A A . 46 VAL CG2  1 1 
        2  2002 1 1 46 VAL H    H  -0.316  12.680  51.969 1.00 . A A . 46 VAL H    1 1 
        2  2003 1 1 46 VAL HA   H  -0.099  12.864  49.489 1.00 . A A . 46 VAL HA   1 1 
        2  2004 1 1 46 VAL HB   H  -1.640  14.307  50.764 1.00 . A A . 46 VAL HB   1 1 
        2  2005 1 1 46 VAL HG11 H   0.506  16.431  50.643 1.00 . A A . 46 VAL HG11 1 1 
        2  2006 1 1 46 VAL HG12 H   0.307  15.399  52.059 1.00 . A A . 46 VAL HG12 1 1 
        2  2007 1 1 46 VAL HG13 H  -1.009  16.454  51.544 1.00 . A A . 46 VAL HG13 1 1 
        2  2008 1 1 46 VAL HG21 H  -1.333  14.467  48.264 1.00 . A A . 46 VAL HG21 1 1 
        2  2009 1 1 46 VAL HG22 H  -0.222  15.808  48.542 1.00 . A A . 46 VAL HG22 1 1 
        2  2010 1 1 46 VAL HG23 H  -1.916  15.955  49.013 1.00 . A A . 46 VAL HG23 1 1 
        2  2011 1 1 46 VAL N    N   0.495  12.949  51.488 1.00 . A A . 46 VAL N    1 1 
        2  2012 1 1 46 VAL O    O   1.840  13.953  48.373 1.00 . A A . 46 VAL O    1 1 
        2  2013 1 1 47 LEU C    C   4.488  14.487  49.153 1.00 . A A . 47 LEU C    1 1 
        2  2014 1 1 47 LEU CA   C   3.555  15.538  49.780 1.00 . A A . 47 LEU CA   1 1 
        2  2015 1 1 47 LEU CB   C   4.293  16.241  50.929 1.00 . A A . 47 LEU CB   1 1 
        2  2016 1 1 47 LEU CD1  C   5.299  17.913  49.332 1.00 . A A . 47 LEU CD1  1 1 
        2  2017 1 1 47 LEU CD2  C   6.286  17.578  51.611 1.00 . A A . 47 LEU CD2  1 1 
        2  2018 1 1 47 LEU CG   C   5.600  16.881  50.430 1.00 . A A . 47 LEU CG   1 1 
        2  2019 1 1 47 LEU H    H   2.066  15.127  51.238 1.00 . A A . 47 LEU H    1 1 
        2  2020 1 1 47 LEU HA   H   3.270  16.290  49.060 1.00 . A A . 47 LEU HA   1 1 
        2  2021 1 1 47 LEU HB2  H   3.656  17.009  51.343 1.00 . A A . 47 LEU HB2  1 1 
        2  2022 1 1 47 LEU HB3  H   4.523  15.518  51.697 1.00 . A A . 47 LEU HB3  1 1 
        2  2023 1 1 47 LEU HD11 H   6.115  18.620  49.263 1.00 . A A . 47 LEU HD11 1 1 
        2  2024 1 1 47 LEU HD12 H   4.387  18.442  49.568 1.00 . A A . 47 LEU HD12 1 1 
        2  2025 1 1 47 LEU HD13 H   5.188  17.407  48.384 1.00 . A A . 47 LEU HD13 1 1 
        2  2026 1 1 47 LEU HD21 H   6.670  16.834  52.294 1.00 . A A . 47 LEU HD21 1 1 
        2  2027 1 1 47 LEU HD22 H   5.571  18.203  52.124 1.00 . A A . 47 LEU HD22 1 1 
        2  2028 1 1 47 LEU HD23 H   7.101  18.186  51.246 1.00 . A A . 47 LEU HD23 1 1 
        2  2029 1 1 47 LEU HG   H   6.255  16.118  50.038 1.00 . A A . 47 LEU HG   1 1 
        2  2030 1 1 47 LEU N    N   2.342  14.931  50.317 1.00 . A A . 47 LEU N    1 1 
        2  2031 1 1 47 LEU O    O   4.984  14.672  48.045 1.00 . A A . 47 LEU O    1 1 
        2  2032 1 1 48 LEU C    C   5.140  11.669  48.110 1.00 . A A . 48 LEU C    1 1 
        2  2033 1 1 48 LEU CA   C   5.635  12.340  49.418 1.00 . A A . 48 LEU CA   1 1 
        2  2034 1 1 48 LEU CB   C   5.901  11.307  50.539 1.00 . A A . 48 LEU CB   1 1 
        2  2035 1 1 48 LEU CD1  C   7.001  13.040  51.972 1.00 . A A . 48 LEU CD1  1 1 
        2  2036 1 1 48 LEU CD2  C   7.436  10.617  52.390 1.00 . A A . 48 LEU CD2  1 1 
        2  2037 1 1 48 LEU CG   C   7.174  11.671  51.312 1.00 . A A . 48 LEU CG   1 1 
        2  2038 1 1 48 LEU H    H   4.298  13.353  50.768 1.00 . A A . 48 LEU H    1 1 
        2  2039 1 1 48 LEU HA   H   6.569  12.809  49.147 1.00 . A A . 48 LEU HA   1 1 
        2  2040 1 1 48 LEU HB2  H   5.074  11.311  51.230 1.00 . A A . 48 LEU HB2  1 1 
        2  2041 1 1 48 LEU HB3  H   6.011  10.319  50.114 1.00 . A A . 48 LEU HB3  1 1 
        2  2042 1 1 48 LEU HD11 H   7.779  13.188  52.706 1.00 . A A . 48 LEU HD11 1 1 
        2  2043 1 1 48 LEU HD12 H   6.036  13.087  52.456 1.00 . A A . 48 LEU HD12 1 1 
        2  2044 1 1 48 LEU HD13 H   7.063  13.813  51.220 1.00 . A A . 48 LEU HD13 1 1 
        2  2045 1 1 48 LEU HD21 H   8.438  10.737  52.774 1.00 . A A . 48 LEU HD21 1 1 
        2  2046 1 1 48 LEU HD22 H   7.330   9.630  51.964 1.00 . A A . 48 LEU HD22 1 1 
        2  2047 1 1 48 LEU HD23 H   6.725  10.740  53.194 1.00 . A A . 48 LEU HD23 1 1 
        2  2048 1 1 48 LEU HG   H   8.012  11.705  50.629 1.00 . A A . 48 LEU HG   1 1 
        2  2049 1 1 48 LEU N    N   4.733  13.404  49.892 1.00 . A A . 48 LEU N    1 1 
        2  2050 1 1 48 LEU O    O   5.862  11.704  47.115 1.00 . A A . 48 LEU O    1 1 
        2  2051 1 1 49 PRO C    C   3.623  11.395  45.569 1.00 . A A . 49 PRO C    1 1 
        2  2052 1 1 49 PRO CA   C   3.447  10.476  46.782 1.00 . A A . 49 PRO CA   1 1 
        2  2053 1 1 49 PRO CB   C   1.962  10.245  47.074 1.00 . A A . 49 PRO CB   1 1 
        2  2054 1 1 49 PRO CD   C   2.983  10.942  49.142 1.00 . A A . 49 PRO CD   1 1 
        2  2055 1 1 49 PRO CG   C   1.902  10.035  48.546 1.00 . A A . 49 PRO CG   1 1 
        2  2056 1 1 49 PRO HA   H   3.933   9.529  46.609 1.00 . A A . 49 PRO HA   1 1 
        2  2057 1 1 49 PRO HB2  H   1.380  11.115  46.790 1.00 . A A . 49 PRO HB2  1 1 
        2  2058 1 1 49 PRO HB3  H   1.604   9.367  46.557 1.00 . A A . 49 PRO HB3  1 1 
        2  2059 1 1 49 PRO HD2  H   2.567  11.887  49.413 1.00 . A A . 49 PRO HD2  1 1 
        2  2060 1 1 49 PRO HD3  H   3.441  10.467  49.988 1.00 . A A . 49 PRO HD3  1 1 
        2  2061 1 1 49 PRO HG2  H   0.924  10.313  48.921 1.00 . A A . 49 PRO HG2  1 1 
        2  2062 1 1 49 PRO HG3  H   2.115   9.003  48.788 1.00 . A A . 49 PRO HG3  1 1 
        2  2063 1 1 49 PRO N    N   3.957  11.098  48.048 1.00 . A A . 49 PRO N    1 1 
        2  2064 1 1 49 PRO O    O   3.730  10.927  44.435 1.00 . A A . 49 PRO O    1 1 
        2  2065 1 1 50 ALA C    C   5.286  13.547  44.152 1.00 . A A . 50 ALA C    1 1 
        2  2066 1 1 50 ALA CA   C   3.892  13.686  44.762 1.00 . A A . 50 ALA CA   1 1 
        2  2067 1 1 50 ALA CB   C   3.708  15.101  45.317 1.00 . A A . 50 ALA CB   1 1 
        2  2068 1 1 50 ALA H    H   3.665  13.023  46.745 1.00 . A A . 50 ALA H    1 1 
        2  2069 1 1 50 ALA HA   H   3.190  13.532  43.957 1.00 . A A . 50 ALA HA   1 1 
        2  2070 1 1 50 ALA HB1  H   4.600  15.400  45.847 1.00 . A A . 50 ALA HB1  1 1 
        2  2071 1 1 50 ALA HB2  H   2.865  15.114  45.991 1.00 . A A . 50 ALA HB2  1 1 
        2  2072 1 1 50 ALA HB3  H   3.527  15.786  44.501 1.00 . A A . 50 ALA HB3  1 1 
        2  2073 1 1 50 ALA N    N   3.686  12.699  45.820 1.00 . A A . 50 ALA N    1 1 
        2  2074 1 1 50 ALA O    O   5.476  13.823  42.967 1.00 . A A . 50 ALA O    1 1 
        2  2075 1 1 51 LEU C    C   7.616  11.823  43.375 1.00 . A A . 51 LEU C    1 1 
        2  2076 1 1 51 LEU CA   C   7.607  12.922  44.436 1.00 . A A . 51 LEU CA   1 1 
        2  2077 1 1 51 LEU CB   C   8.557  12.537  45.582 1.00 . A A . 51 LEU CB   1 1 
        2  2078 1 1 51 LEU CD1  C   7.727  14.580  46.774 1.00 . A A . 51 LEU CD1  1 1 
        2  2079 1 1 51 LEU CD2  C   9.748  13.370  47.616 1.00 . A A . 51 LEU CD2  1 1 
        2  2080 1 1 51 LEU CG   C   8.972  13.789  46.364 1.00 . A A . 51 LEU CG   1 1 
        2  2081 1 1 51 LEU H    H   6.045  12.858  45.873 1.00 . A A . 51 LEU H    1 1 
        2  2082 1 1 51 LEU HA   H   7.944  13.852  44.001 1.00 . A A . 51 LEU HA   1 1 
        2  2083 1 1 51 LEU HB2  H   8.055  11.851  46.249 1.00 . A A . 51 LEU HB2  1 1 
        2  2084 1 1 51 LEU HB3  H   9.440  12.062  45.179 1.00 . A A . 51 LEU HB3  1 1 
        2  2085 1 1 51 LEU HD11 H   7.354  15.129  45.922 1.00 . A A . 51 LEU HD11 1 1 
        2  2086 1 1 51 LEU HD12 H   7.979  15.271  47.564 1.00 . A A . 51 LEU HD12 1 1 
        2  2087 1 1 51 LEU HD13 H   6.969  13.896  47.121 1.00 . A A . 51 LEU HD13 1 1 
        2  2088 1 1 51 LEU HD21 H  10.589  12.755  47.330 1.00 . A A . 51 LEU HD21 1 1 
        2  2089 1 1 51 LEU HD22 H   9.097  12.809  48.270 1.00 . A A . 51 LEU HD22 1 1 
        2  2090 1 1 51 LEU HD23 H  10.104  14.250  48.130 1.00 . A A . 51 LEU HD23 1 1 
        2  2091 1 1 51 LEU HG   H   9.601  14.409  45.740 1.00 . A A . 51 LEU HG   1 1 
        2  2092 1 1 51 LEU N    N   6.252  13.104  44.947 1.00 . A A . 51 LEU N    1 1 
        2  2093 1 1 51 LEU O    O   8.267  11.940  42.340 1.00 . A A . 51 LEU O    1 1 
        2  2094 1 1 52 ALA C    C   6.178  10.150  41.389 1.00 . A A . 52 ALA C    1 1 
        2  2095 1 1 52 ALA CA   C   6.754   9.656  42.713 1.00 . A A . 52 ALA CA   1 1 
        2  2096 1 1 52 ALA CB   C   5.869   8.552  43.292 1.00 . A A . 52 ALA CB   1 1 
        2  2097 1 1 52 ALA H    H   6.334  10.786  44.476 1.00 . A A . 52 ALA H    1 1 
        2  2098 1 1 52 ALA HA   H   7.739   9.257  42.516 1.00 . A A . 52 ALA HA   1 1 
        2  2099 1 1 52 ALA HB1  H   4.866   8.930  43.431 1.00 . A A . 52 ALA HB1  1 1 
        2  2100 1 1 52 ALA HB2  H   6.267   8.232  44.244 1.00 . A A . 52 ALA HB2  1 1 
        2  2101 1 1 52 ALA HB3  H   5.846   7.713  42.612 1.00 . A A . 52 ALA HB3  1 1 
        2  2102 1 1 52 ALA N    N   6.859  10.769  43.649 1.00 . A A . 52 ALA N    1 1 
        2  2103 1 1 52 ALA O    O   6.674   9.799  40.319 1.00 . A A . 52 ALA O    1 1 
        2  2104 1 1 53 ILE C    C   5.528  12.387  39.484 1.00 . A A . 53 ILE C    1 1 
        2  2105 1 1 53 ILE CA   C   4.531  11.520  40.252 1.00 . A A . 53 ILE CA   1 1 
        2  2106 1 1 53 ILE CB   C   3.288  12.342  40.615 1.00 . A A . 53 ILE CB   1 1 
        2  2107 1 1 53 ILE CD1  C   1.078  12.236  41.778 1.00 . A A . 53 ILE CD1  1 1 
        2  2108 1 1 53 ILE CG1  C   2.203  11.407  41.157 1.00 . A A . 53 ILE CG1  1 1 
        2  2109 1 1 53 ILE CG2  C   2.760  13.060  39.370 1.00 . A A . 53 ILE CG2  1 1 
        2  2110 1 1 53 ILE H    H   4.784  11.226  42.342 1.00 . A A . 53 ILE H    1 1 
        2  2111 1 1 53 ILE HA   H   4.242  10.730  39.575 1.00 . A A . 53 ILE HA   1 1 
        2  2112 1 1 53 ILE HB   H   3.547  13.071  41.369 1.00 . A A . 53 ILE HB   1 1 
        2  2113 1 1 53 ILE HD11 H   0.220  11.604  41.955 1.00 . A A . 53 ILE HD11 1 1 
        2  2114 1 1 53 ILE HD12 H   0.804  13.033  41.102 1.00 . A A . 53 ILE HD12 1 1 
        2  2115 1 1 53 ILE HD13 H   1.414  12.658  42.713 1.00 . A A . 53 ILE HD13 1 1 
        2  2116 1 1 53 ILE HG12 H   1.807  10.809  40.350 1.00 . A A . 53 ILE HG12 1 1 
        2  2117 1 1 53 ILE HG13 H   2.629  10.761  41.910 1.00 . A A . 53 ILE HG13 1 1 
        2  2118 1 1 53 ILE HG21 H   3.416  13.881  39.122 1.00 . A A . 53 ILE HG21 1 1 
        2  2119 1 1 53 ILE HG22 H   1.768  13.439  39.565 1.00 . A A . 53 ILE HG22 1 1 
        2  2120 1 1 53 ILE HG23 H   2.722  12.367  38.542 1.00 . A A . 53 ILE HG23 1 1 
        2  2121 1 1 53 ILE N    N   5.140  10.977  41.464 1.00 . A A . 53 ILE N    1 1 
        2  2122 1 1 53 ILE O    O   5.716  12.182  38.287 1.00 . A A . 53 ILE O    1 1 
        2  2123 1 1 54 PHE C    C   8.252  13.361  38.836 1.00 . A A . 54 PHE C    1 1 
        2  2124 1 1 54 PHE CA   C   7.135  14.200  39.447 1.00 . A A . 54 PHE CA   1 1 
        2  2125 1 1 54 PHE CB   C   7.721  15.222  40.422 1.00 . A A . 54 PHE CB   1 1 
        2  2126 1 1 54 PHE CD1  C   8.149  17.201  38.922 1.00 . A A . 54 PHE CD1  1 1 
        2  2127 1 1 54 PHE CD2  C  10.048  15.965  39.786 1.00 . A A . 54 PHE CD2  1 1 
        2  2128 1 1 54 PHE CE1  C   9.019  18.068  38.250 1.00 . A A . 54 PHE CE1  1 1 
        2  2129 1 1 54 PHE CE2  C  10.918  16.833  39.114 1.00 . A A . 54 PHE CE2  1 1 
        2  2130 1 1 54 PHE CG   C   8.664  16.150  39.690 1.00 . A A . 54 PHE CG   1 1 
        2  2131 1 1 54 PHE CZ   C  10.403  17.884  38.346 1.00 . A A . 54 PHE CZ   1 1 
        2  2132 1 1 54 PHE H    H   6.009  13.517  41.091 1.00 . A A . 54 PHE H    1 1 
        2  2133 1 1 54 PHE HA   H   6.638  14.720  38.643 1.00 . A A . 54 PHE HA   1 1 
        2  2134 1 1 54 PHE HB2  H   6.920  15.800  40.860 1.00 . A A . 54 PHE HB2  1 1 
        2  2135 1 1 54 PHE HB3  H   8.260  14.707  41.203 1.00 . A A . 54 PHE HB3  1 1 
        2  2136 1 1 54 PHE HD1  H   7.080  17.343  38.848 1.00 . A A . 54 PHE HD1  1 1 
        2  2137 1 1 54 PHE HD2  H  10.446  15.154  40.378 1.00 . A A . 54 PHE HD2  1 1 
        2  2138 1 1 54 PHE HE1  H   8.621  18.879  37.658 1.00 . A A . 54 PHE HE1  1 1 
        2  2139 1 1 54 PHE HE2  H  11.985  16.691  39.188 1.00 . A A . 54 PHE HE2  1 1 
        2  2140 1 1 54 PHE HZ   H  11.073  18.553  37.827 1.00 . A A . 54 PHE HZ   1 1 
        2  2141 1 1 54 PHE N    N   6.173  13.346  40.141 1.00 . A A . 54 PHE N    1 1 
        2  2142 1 1 54 PHE O    O   8.663  13.597  37.702 1.00 . A A . 54 PHE O    1 1 
        2  2143 1 1 55 ILE C    C   9.214  10.703  37.848 1.00 . A A . 55 ILE C    1 1 
        2  2144 1 1 55 ILE CA   C   9.748  11.473  39.057 1.00 . A A . 55 ILE CA   1 1 
        2  2145 1 1 55 ILE CB   C  10.183  10.490  40.152 1.00 . A A . 55 ILE CB   1 1 
        2  2146 1 1 55 ILE CD1  C  11.109  10.363  42.471 1.00 . A A . 55 ILE CD1  1 1 
        2  2147 1 1 55 ILE CG1  C  10.953  11.250  41.235 1.00 . A A . 55 ILE CG1  1 1 
        2  2148 1 1 55 ILE CG2  C  11.089   9.410  39.554 1.00 . A A . 55 ILE CG2  1 1 
        2  2149 1 1 55 ILE H    H   8.311  12.185  40.446 1.00 . A A . 55 ILE H    1 1 
        2  2150 1 1 55 ILE HA   H  10.606  12.068  38.774 1.00 . A A . 55 ILE HA   1 1 
        2  2151 1 1 55 ILE HB   H   9.309  10.028  40.586 1.00 . A A . 55 ILE HB   1 1 
        2  2152 1 1 55 ILE HD11 H  11.615   9.450  42.198 1.00 . A A . 55 ILE HD11 1 1 
        2  2153 1 1 55 ILE HD12 H  10.133  10.127  42.870 1.00 . A A . 55 ILE HD12 1 1 
        2  2154 1 1 55 ILE HD13 H  11.686  10.885  43.219 1.00 . A A . 55 ILE HD13 1 1 
        2  2155 1 1 55 ILE HG12 H  11.932  11.513  40.858 1.00 . A A . 55 ILE HG12 1 1 
        2  2156 1 1 55 ILE HG13 H  10.421  12.148  41.500 1.00 . A A . 55 ILE HG13 1 1 
        2  2157 1 1 55 ILE HG21 H  10.492   8.719  38.976 1.00 . A A . 55 ILE HG21 1 1 
        2  2158 1 1 55 ILE HG22 H  11.587   8.876  40.350 1.00 . A A . 55 ILE HG22 1 1 
        2  2159 1 1 55 ILE HG23 H  11.826   9.872  38.914 1.00 . A A . 55 ILE HG23 1 1 
        2  2160 1 1 55 ILE N    N   8.712  12.360  39.569 1.00 . A A . 55 ILE N    1 1 
        2  2161 1 1 55 ILE O    O   9.893  10.534  36.839 1.00 . A A . 55 ILE O    1 1 
        2  2162 1 1 56 GLY C    C   7.091  10.399  35.678 1.00 . A A . 56 GLY C    1 1 
        2  2163 1 1 56 GLY CA   C   7.283   9.529  36.923 1.00 . A A . 56 GLY CA   1 1 
        2  2164 1 1 56 GLY H    H   7.495  10.503  38.809 1.00 . A A . 56 GLY H    1 1 
        2  2165 1 1 56 GLY HA2  H   7.867   8.659  36.663 1.00 . A A . 56 GLY HA2  1 1 
        2  2166 1 1 56 GLY HA3  H   6.314   9.212  37.281 1.00 . A A . 56 GLY HA3  1 1 
        2  2167 1 1 56 GLY N    N   7.967  10.265  37.984 1.00 . A A . 56 GLY N    1 1 
        2  2168 1 1 56 GLY O    O   7.255   9.933  34.550 1.00 . A A . 56 GLY O    1 1 
        2  2169 1 1 57 LEU C    C   7.785  12.929  34.040 1.00 . A A . 57 LEU C    1 1 
        2  2170 1 1 57 LEU CA   C   6.503  12.611  34.808 1.00 . A A . 57 LEU CA   1 1 
        2  2171 1 1 57 LEU CB   C   5.907  13.913  35.359 1.00 . A A . 57 LEU CB   1 1 
        2  2172 1 1 57 LEU CD1  C   3.990  14.918  36.605 1.00 . A A . 57 LEU CD1  1 1 
        2  2173 1 1 57 LEU CD2  C   3.528  13.460  34.610 1.00 . A A . 57 LEU CD2  1 1 
        2  2174 1 1 57 LEU CG   C   4.459  13.687  35.823 1.00 . A A . 57 LEU CG   1 1 
        2  2175 1 1 57 LEU H    H   6.616  11.969  36.823 1.00 . A A . 57 LEU H    1 1 
        2  2176 1 1 57 LEU HA   H   5.793  12.174  34.127 1.00 . A A . 57 LEU HA   1 1 
        2  2177 1 1 57 LEU HB2  H   6.502  14.244  36.198 1.00 . A A . 57 LEU HB2  1 1 
        2  2178 1 1 57 LEU HB3  H   5.926  14.671  34.591 1.00 . A A . 57 LEU HB3  1 1 
        2  2179 1 1 57 LEU HD11 H   2.992  14.749  36.979 1.00 . A A . 57 LEU HD11 1 1 
        2  2180 1 1 57 LEU HD12 H   3.988  15.779  35.952 1.00 . A A . 57 LEU HD12 1 1 
        2  2181 1 1 57 LEU HD13 H   4.661  15.096  37.432 1.00 . A A . 57 LEU HD13 1 1 
        2  2182 1 1 57 LEU HD21 H   2.521  13.768  34.861 1.00 . A A . 57 LEU HD21 1 1 
        2  2183 1 1 57 LEU HD22 H   3.519  12.412  34.353 1.00 . A A . 57 LEU HD22 1 1 
        2  2184 1 1 57 LEU HD23 H   3.875  14.033  33.763 1.00 . A A . 57 LEU HD23 1 1 
        2  2185 1 1 57 LEU HG   H   4.422  12.821  36.467 1.00 . A A . 57 LEU HG   1 1 
        2  2186 1 1 57 LEU N    N   6.735  11.662  35.899 1.00 . A A . 57 LEU N    1 1 
        2  2187 1 1 57 LEU O    O   7.741  13.219  32.845 1.00 . A A . 57 LEU O    1 1 
        2  2188 1 1 58 THR C    C  10.551  11.963  33.124 1.00 . A A . 58 THR C    1 1 
        2  2189 1 1 58 THR CA   C  10.196  13.115  34.060 1.00 . A A . 58 THR CA   1 1 
        2  2190 1 1 58 THR CB   C  11.309  13.290  35.101 1.00 . A A . 58 THR CB   1 1 
        2  2191 1 1 58 THR CG2  C  11.044  14.539  35.953 1.00 . A A . 58 THR CG2  1 1 
        2  2192 1 1 58 THR H    H   8.899  12.549  35.651 1.00 . A A . 58 THR H    1 1 
        2  2193 1 1 58 THR HA   H  10.108  14.031  33.496 1.00 . A A . 58 THR HA   1 1 
        2  2194 1 1 58 THR HB   H  12.254  13.404  34.592 1.00 . A A . 58 THR HB   1 1 
        2  2195 1 1 58 THR HG1  H  12.135  12.224  36.500 1.00 . A A . 58 THR HG1  1 1 
        2  2196 1 1 58 THR HG21 H  11.441  15.410  35.451 1.00 . A A . 58 THR HG21 1 1 
        2  2197 1 1 58 THR HG22 H  11.528  14.427  36.912 1.00 . A A . 58 THR HG22 1 1 
        2  2198 1 1 58 THR HG23 H   9.982  14.664  36.102 1.00 . A A . 58 THR HG23 1 1 
        2  2199 1 1 58 THR N    N   8.921  12.852  34.719 1.00 . A A . 58 THR N    1 1 
        2  2200 1 1 58 THR O    O  11.077  12.166  32.032 1.00 . A A . 58 THR O    1 1 
        2  2201 1 1 58 THR OG1  O  11.364  12.142  35.933 1.00 . A A . 58 THR OG1  1 1 
        2  2202 1 1 59 ILE C    C   9.602   9.562  31.516 1.00 . A A . 59 ILE C    1 1 
        2  2203 1 1 59 ILE CA   C  10.474   9.556  32.771 1.00 . A A . 59 ILE CA   1 1 
        2  2204 1 1 59 ILE CB   C  10.205   8.291  33.595 1.00 . A A . 59 ILE CB   1 1 
        2  2205 1 1 59 ILE CD1  C  12.649   8.203  34.299 1.00 . A A . 59 ILE CD1  1 1 
        2  2206 1 1 59 ILE CG1  C  11.188   8.210  34.780 1.00 . A A . 59 ILE CG1  1 1 
        2  2207 1 1 59 ILE CG2  C  10.349   7.050  32.709 1.00 . A A . 59 ILE CG2  1 1 
        2  2208 1 1 59 ILE H    H   9.761  10.694  34.430 1.00 . A A . 59 ILE H    1 1 
        2  2209 1 1 59 ILE HA   H  11.499   9.560  32.439 1.00 . A A . 59 ILE HA   1 1 
        2  2210 1 1 59 ILE HB   H   9.194   8.331  33.976 1.00 . A A . 59 ILE HB   1 1 
        2  2211 1 1 59 ILE HD11 H  12.726   7.705  33.345 1.00 . A A . 59 ILE HD11 1 1 
        2  2212 1 1 59 ILE HD12 H  13.260   7.685  35.022 1.00 . A A . 59 ILE HD12 1 1 
        2  2213 1 1 59 ILE HD13 H  12.998   9.222  34.201 1.00 . A A . 59 ILE HD13 1 1 
        2  2214 1 1 59 ILE HG12 H  11.034   9.061  35.424 1.00 . A A . 59 ILE HG12 1 1 
        2  2215 1 1 59 ILE HG13 H  10.995   7.305  35.338 1.00 . A A . 59 ILE HG13 1 1 
        2  2216 1 1 59 ILE HG21 H  11.271   7.114  32.148 1.00 . A A . 59 ILE HG21 1 1 
        2  2217 1 1 59 ILE HG22 H   9.515   6.997  32.025 1.00 . A A . 59 ILE HG22 1 1 
        2  2218 1 1 59 ILE HG23 H  10.365   6.166  33.327 1.00 . A A . 59 ILE HG23 1 1 
        2  2219 1 1 59 ILE N    N  10.223  10.754  33.568 1.00 . A A . 59 ILE N    1 1 
        2  2220 1 1 59 ILE O    O  10.077   9.231  30.429 1.00 . A A . 59 ILE O    1 1 
        2  2221 1 1 60 TYR C    C   7.895  10.804  29.393 1.00 . A A . 60 TYR C    1 1 
        2  2222 1 1 60 TYR CA   C   7.409   9.897  30.525 1.00 . A A . 60 TYR CA   1 1 
        2  2223 1 1 60 TYR CB   C   6.002  10.336  30.975 1.00 . A A . 60 TYR CB   1 1 
        2  2224 1 1 60 TYR CD1  C   4.909   8.072  30.766 1.00 . A A . 60 TYR CD1  1 1 
        2  2225 1 1 60 TYR CD2  C   4.869   9.179  32.923 1.00 . A A . 60 TYR CD2  1 1 
        2  2226 1 1 60 TYR CE1  C   4.195   6.995  31.306 1.00 . A A . 60 TYR CE1  1 1 
        2  2227 1 1 60 TYR CE2  C   4.156   8.103  33.462 1.00 . A A . 60 TYR CE2  1 1 
        2  2228 1 1 60 TYR CG   C   5.246   9.164  31.574 1.00 . A A . 60 TYR CG   1 1 
        2  2229 1 1 60 TYR CZ   C   3.818   7.011  32.654 1.00 . A A . 60 TYR CZ   1 1 
        2  2230 1 1 60 TYR H    H   7.963  10.099  32.554 1.00 . A A . 60 TYR H    1 1 
        2  2231 1 1 60 TYR HA   H   7.348   8.889  30.139 1.00 . A A . 60 TYR HA   1 1 
        2  2232 1 1 60 TYR HB2  H   6.093  11.119  31.714 1.00 . A A . 60 TYR HB2  1 1 
        2  2233 1 1 60 TYR HB3  H   5.448  10.714  30.126 1.00 . A A . 60 TYR HB3  1 1 
        2  2234 1 1 60 TYR HD1  H   5.198   8.060  29.725 1.00 . A A . 60 TYR HD1  1 1 
        2  2235 1 1 60 TYR HD2  H   5.128  10.020  33.546 1.00 . A A . 60 TYR HD2  1 1 
        2  2236 1 1 60 TYR HE1  H   3.935   6.152  30.682 1.00 . A A . 60 TYR HE1  1 1 
        2  2237 1 1 60 TYR HE2  H   3.866   8.115  34.502 1.00 . A A . 60 TYR HE2  1 1 
        2  2238 1 1 60 TYR HH   H   3.743   5.258  33.406 1.00 . A A . 60 TYR HH   1 1 
        2  2239 1 1 60 TYR N    N   8.324   9.901  31.664 1.00 . A A . 60 TYR N    1 1 
        2  2240 1 1 60 TYR O    O   7.755  10.451  28.226 1.00 . A A . 60 TYR O    1 1 
        2  2241 1 1 60 TYR OH   O   3.115   5.949  33.186 1.00 . A A . 60 TYR OH   1 1 
        2  2242 1 1 61 ALA C    C  10.247  12.324  28.016 1.00 . A A . 61 ALA C    1 1 
        2  2243 1 1 61 ALA CA   C   8.972  12.855  28.672 1.00 . A A . 61 ALA CA   1 1 
        2  2244 1 1 61 ALA CB   C   9.241  14.238  29.269 1.00 . A A . 61 ALA CB   1 1 
        2  2245 1 1 61 ALA H    H   8.614  12.245  30.631 1.00 . A A . 61 ALA H    1 1 
        2  2246 1 1 61 ALA HA   H   8.251  12.959  27.875 1.00 . A A . 61 ALA HA   1 1 
        2  2247 1 1 61 ALA HB1  H   9.780  14.839  28.553 1.00 . A A . 61 ALA HB1  1 1 
        2  2248 1 1 61 ALA HB2  H   9.829  14.134  30.168 1.00 . A A . 61 ALA HB2  1 1 
        2  2249 1 1 61 ALA HB3  H   8.301  14.716  29.506 1.00 . A A . 61 ALA HB3  1 1 
        2  2250 1 1 61 ALA N    N   8.469  11.956  29.705 1.00 . A A . 61 ALA N    1 1 
        2  2251 1 1 61 ALA O    O  10.515  12.640  26.856 1.00 . A A . 61 ALA O    1 1 
        2  2252 1 1 62 ILE C    C  11.982   9.869  27.133 1.00 . A A . 62 ILE C    1 1 
        2  2253 1 1 62 ILE CA   C  12.260  10.974  28.158 1.00 . A A . 62 ILE CA   1 1 
        2  2254 1 1 62 ILE CB   C  13.147  10.424  29.280 1.00 . A A . 62 ILE CB   1 1 
        2  2255 1 1 62 ILE CD1  C  14.286  11.055  31.430 1.00 . A A . 62 ILE CD1  1 1 
        2  2256 1 1 62 ILE CG1  C  13.619  11.589  30.157 1.00 . A A . 62 ILE CG1  1 1 
        2  2257 1 1 62 ILE CG2  C  14.370   9.721  28.680 1.00 . A A . 62 ILE CG2  1 1 
        2  2258 1 1 62 ILE H    H  10.777  11.237  29.632 1.00 . A A . 62 ILE H    1 1 
        2  2259 1 1 62 ILE HA   H  12.794  11.776  27.671 1.00 . A A . 62 ILE HA   1 1 
        2  2260 1 1 62 ILE HB   H  12.582   9.722  29.875 1.00 . A A . 62 ILE HB   1 1 
        2  2261 1 1 62 ILE HD11 H  14.342  11.845  32.164 1.00 . A A . 62 ILE HD11 1 1 
        2  2262 1 1 62 ILE HD12 H  15.283  10.712  31.195 1.00 . A A . 62 ILE HD12 1 1 
        2  2263 1 1 62 ILE HD13 H  13.709  10.235  31.828 1.00 . A A . 62 ILE HD13 1 1 
        2  2264 1 1 62 ILE HG12 H  14.331  12.185  29.605 1.00 . A A . 62 ILE HG12 1 1 
        2  2265 1 1 62 ILE HG13 H  12.774  12.201  30.427 1.00 . A A . 62 ILE HG13 1 1 
        2  2266 1 1 62 ILE HG21 H  15.107   9.558  29.452 1.00 . A A . 62 ILE HG21 1 1 
        2  2267 1 1 62 ILE HG22 H  14.793  10.338  27.902 1.00 . A A . 62 ILE HG22 1 1 
        2  2268 1 1 62 ILE HG23 H  14.070   8.771  28.262 1.00 . A A . 62 ILE HG23 1 1 
        2  2269 1 1 62 ILE N    N  11.031  11.521  28.728 1.00 . A A . 62 ILE N    1 1 
        2  2270 1 1 62 ILE O    O  12.600   9.821  26.070 1.00 . A A . 62 ILE O    1 1 
        2  2271 1 1 63 GLN C    C  10.108   8.410  25.286 1.00 . A A . 63 GLN C    1 1 
        2  2272 1 1 63 GLN CA   C  10.706   7.875  26.585 1.00 . A A . 63 GLN CA   1 1 
        2  2273 1 1 63 GLN CB   C   9.745   6.882  27.268 1.00 . A A . 63 GLN CB   1 1 
        2  2274 1 1 63 GLN CD   C   7.685   6.971  25.820 1.00 . A A . 63 GLN CD   1 1 
        2  2275 1 1 63 GLN CG   C   8.286   7.371  27.169 1.00 . A A . 63 GLN CG   1 1 
        2  2276 1 1 63 GLN H    H  10.582   9.115  28.327 1.00 . A A . 63 GLN H    1 1 
        2  2277 1 1 63 GLN HA   H  11.610   7.354  26.302 1.00 . A A . 63 GLN HA   1 1 
        2  2278 1 1 63 GLN HB2  H   9.834   5.914  26.795 1.00 . A A . 63 GLN HB2  1 1 
        2  2279 1 1 63 GLN HB3  H  10.016   6.791  28.309 1.00 . A A . 63 GLN HB3  1 1 
        2  2280 1 1 63 GLN HE21 H   6.006   7.997  26.092 1.00 . A A . 63 GLN HE21 1 1 
        2  2281 1 1 63 GLN HE22 H   6.113   7.157  24.621 1.00 . A A . 63 GLN HE22 1 1 
        2  2282 1 1 63 GLN HG2  H   7.704   6.930  27.965 1.00 . A A . 63 GLN HG2  1 1 
        2  2283 1 1 63 GLN HG3  H   8.263   8.442  27.261 1.00 . A A . 63 GLN HG3  1 1 
        2  2284 1 1 63 GLN N    N  11.051   8.982  27.477 1.00 . A A . 63 GLN N    1 1 
        2  2285 1 1 63 GLN NE2  N   6.504   7.412  25.483 1.00 . A A . 63 GLN NE2  1 1 
        2  2286 1 1 63 GLN O    O  10.398   7.886  24.210 1.00 . A A . 63 GLN O    1 1 
        2  2287 1 1 63 GLN OE1  O   8.309   6.231  25.060 1.00 . A A . 63 GLN OE1  1 1 
        2  2288 1 1 64 ARG C    C   9.985  10.532  23.294 1.00 . A A . 64 ARG C    1 1 
        2  2289 1 1 64 ARG CA   C   8.803  10.059  24.134 1.00 . A A . 64 ARG CA   1 1 
        2  2290 1 1 64 ARG CB   C   7.875  11.239  24.455 1.00 . A A . 64 ARG CB   1 1 
        2  2291 1 1 64 ARG CD   C   5.579  10.435  23.780 1.00 . A A . 64 ARG CD   1 1 
        2  2292 1 1 64 ARG CG   C   6.512  10.730  24.963 1.00 . A A . 64 ARG CG   1 1 
        2  2293 1 1 64 ARG CZ   C   4.538  11.676  21.966 1.00 . A A . 64 ARG CZ   1 1 
        2  2294 1 1 64 ARG H    H   9.179   9.906  26.233 1.00 . A A . 64 ARG H    1 1 
        2  2295 1 1 64 ARG HA   H   8.276   9.327  23.542 1.00 . A A . 64 ARG HA   1 1 
        2  2296 1 1 64 ARG HB2  H   8.335  11.852  25.217 1.00 . A A . 64 ARG HB2  1 1 
        2  2297 1 1 64 ARG HB3  H   7.730  11.832  23.563 1.00 . A A . 64 ARG HB3  1 1 
        2  2298 1 1 64 ARG HD2  H   6.064   9.762  23.092 1.00 . A A . 64 ARG HD2  1 1 
        2  2299 1 1 64 ARG HD3  H   4.672   9.976  24.147 1.00 . A A . 64 ARG HD3  1 1 
        2  2300 1 1 64 ARG HE   H   5.564  12.527  23.457 1.00 . A A . 64 ARG HE   1 1 
        2  2301 1 1 64 ARG HG2  H   6.653   9.828  25.541 1.00 . A A . 64 ARG HG2  1 1 
        2  2302 1 1 64 ARG HG3  H   6.059  11.487  25.589 1.00 . A A . 64 ARG HG3  1 1 
        2  2303 1 1 64 ARG HH11 H   4.317   9.687  21.925 1.00 . A A . 64 ARG HH11 1 1 
        2  2304 1 1 64 ARG HH12 H   3.573  10.550  20.621 1.00 . A A . 64 ARG HH12 1 1 
        2  2305 1 1 64 ARG HH21 H   4.594  13.665  21.750 1.00 . A A . 64 ARG HH21 1 1 
        2  2306 1 1 64 ARG HH22 H   3.730  12.803  20.522 1.00 . A A . 64 ARG HH22 1 1 
        2  2307 1 1 64 ARG N    N   9.331   9.483  25.362 1.00 . A A . 64 ARG N    1 1 
        2  2308 1 1 64 ARG NE   N   5.250  11.675  23.089 1.00 . A A . 64 ARG NE   1 1 
        2  2309 1 1 64 ARG NH1  N   4.109  10.550  21.465 1.00 . A A . 64 ARG NH1  1 1 
        2  2310 1 1 64 ARG NH2  N   4.266  12.802  21.366 1.00 . A A . 64 ARG NH2  1 1 
        2  2311 1 1 64 ARG O    O  10.086  10.201  22.144 1.00 . A A . 64 ARG O    1 1 
        2  2312 1 1 65 LYS C    C  12.847  10.831  22.415 1.00 . A A . 65 LYS C    1 1 
        2  2313 1 1 65 LYS CA   C  11.992  11.892  23.141 1.00 . A A . 65 LYS CA   1 1 
        2  2314 1 1 65 LYS CB   C  12.867  12.733  24.076 1.00 . A A . 65 LYS CB   1 1 
        2  2315 1 1 65 LYS CD   C  14.815  14.291  24.216 1.00 . A A . 65 LYS CD   1 1 
        2  2316 1 1 65 LYS CE   C  15.923  14.986  23.424 1.00 . A A . 65 LYS CE   1 1 
        2  2317 1 1 65 LYS CG   C  13.996  13.398  23.281 1.00 . A A . 65 LYS CG   1 1 
        2  2318 1 1 65 LYS H    H  10.615  11.666  24.768 1.00 . A A . 65 LYS H    1 1 
        2  2319 1 1 65 LYS HA   H  11.633  12.520  22.341 1.00 . A A . 65 LYS HA   1 1 
        2  2320 1 1 65 LYS HB2  H  12.262  13.495  24.545 1.00 . A A . 65 LYS HB2  1 1 
        2  2321 1 1 65 LYS HB3  H  13.293  12.097  24.836 1.00 . A A . 65 LYS HB3  1 1 
        2  2322 1 1 65 LYS HD2  H  14.167  15.034  24.658 1.00 . A A . 65 LYS HD2  1 1 
        2  2323 1 1 65 LYS HD3  H  15.255  13.688  24.995 1.00 . A A . 65 LYS HD3  1 1 
        2  2324 1 1 65 LYS HE2  H  15.487  15.547  22.611 1.00 . A A . 65 LYS HE2  1 1 
        2  2325 1 1 65 LYS HE3  H  16.462  15.658  24.076 1.00 . A A . 65 LYS HE3  1 1 
        2  2326 1 1 65 LYS HG2  H  14.638  12.640  22.857 1.00 . A A . 65 LYS HG2  1 1 
        2  2327 1 1 65 LYS HG3  H  13.574  13.999  22.490 1.00 . A A . 65 LYS HG3  1 1 
        2  2328 1 1 65 LYS HZ1  H  16.716  13.062  23.369 1.00 . A A . 65 LYS HZ1  1 1 
        2  2329 1 1 65 LYS HZ2  H  17.842  14.286  23.023 1.00 . A A . 65 LYS HZ2  1 1 
        2  2330 1 1 65 LYS HZ3  H  16.684  13.839  21.862 1.00 . A A . 65 LYS HZ3  1 1 
        2  2331 1 1 65 LYS N    N  10.846  11.333  23.876 1.00 . A A . 65 LYS N    1 1 
        2  2332 1 1 65 LYS NZ   N  16.862  13.966  22.878 1.00 . A A . 65 LYS NZ   1 1 
        2  2333 1 1 65 LYS O    O  13.435  11.146  21.380 1.00 . A A . 65 LYS O    1 1 
        2  2334 1 1 66 ARG C    C  12.778   7.943  20.955 1.00 . A A . 66 ARG C    1 1 
        2  2335 1 1 66 ARG CA   C  13.608   8.537  22.124 1.00 . A A . 66 ARG CA   1 1 
        2  2336 1 1 66 ARG CB   C  14.049   7.430  23.084 1.00 . A A . 66 ARG CB   1 1 
        2  2337 1 1 66 ARG CD   C  15.346   7.019  25.185 1.00 . A A . 66 ARG CD   1 1 
        2  2338 1 1 66 ARG CG   C  15.147   7.969  24.003 1.00 . A A . 66 ARG CG   1 1 
        2  2339 1 1 66 ARG CZ   C  15.840   4.680  25.576 1.00 . A A . 66 ARG CZ   1 1 
        2  2340 1 1 66 ARG H    H  12.269   9.329  23.596 1.00 . A A . 66 ARG H    1 1 
        2  2341 1 1 66 ARG HA   H  14.480   8.976  21.662 1.00 . A A . 66 ARG HA   1 1 
        2  2342 1 1 66 ARG HB2  H  13.205   7.107  23.677 1.00 . A A . 66 ARG HB2  1 1 
        2  2343 1 1 66 ARG HB3  H  14.433   6.595  22.518 1.00 . A A . 66 ARG HB3  1 1 
        2  2344 1 1 66 ARG HD2  H  16.093   7.429  25.847 1.00 . A A . 66 ARG HD2  1 1 
        2  2345 1 1 66 ARG HD3  H  14.413   6.923  25.723 1.00 . A A . 66 ARG HD3  1 1 
        2  2346 1 1 66 ARG HE   H  16.035   5.574  23.793 1.00 . A A . 66 ARG HE   1 1 
        2  2347 1 1 66 ARG HG2  H  16.070   8.051  23.449 1.00 . A A . 66 ARG HG2  1 1 
        2  2348 1 1 66 ARG HG3  H  14.863   8.943  24.372 1.00 . A A . 66 ARG HG3  1 1 
        2  2349 1 1 66 ARG HH11 H  15.198   5.744  27.147 1.00 . A A . 66 ARG HH11 1 1 
        2  2350 1 1 66 ARG HH12 H  15.546   4.076  27.462 1.00 . A A . 66 ARG HH12 1 1 
        2  2351 1 1 66 ARG HH21 H  16.496   3.383  24.201 1.00 . A A . 66 ARG HH21 1 1 
        2  2352 1 1 66 ARG HH22 H  16.280   2.740  25.794 1.00 . A A . 66 ARG HH22 1 1 
        2  2353 1 1 66 ARG N    N  12.870   9.585  22.865 1.00 . A A . 66 ARG N    1 1 
        2  2354 1 1 66 ARG NE   N  15.782   5.704  24.731 1.00 . A A . 66 ARG NE   1 1 
        2  2355 1 1 66 ARG NH1  N  15.501   4.847  26.826 1.00 . A A . 66 ARG NH1  1 1 
        2  2356 1 1 66 ARG NH2  N  16.236   3.510  25.157 1.00 . A A . 66 ARG NH2  1 1 
        2  2357 1 1 66 ARG O    O  13.222   7.888  19.808 1.00 . A A . 66 ARG O    1 1 
        2  2358 1 1 67 GLN C    C   9.772   8.180  19.645 1.00 . A A . 67 GLN C    1 1 
        2  2359 1 1 67 GLN CA   C  10.543   7.045  20.337 1.00 . A A . 67 GLN CA   1 1 
        2  2360 1 1 67 GLN CB   C   9.580   6.102  21.060 1.00 . A A . 67 GLN CB   1 1 
        2  2361 1 1 67 GLN CD   C  11.383   5.134  22.493 1.00 . A A . 67 GLN CD   1 1 
        2  2362 1 1 67 GLN CG   C  10.324   4.820  21.442 1.00 . A A . 67 GLN CG   1 1 
        2  2363 1 1 67 GLN H    H  11.269   7.812  22.194 1.00 . A A . 67 GLN H    1 1 
        2  2364 1 1 67 GLN HA   H  11.049   6.501  19.553 1.00 . A A . 67 GLN HA   1 1 
        2  2365 1 1 67 GLN HB2  H   9.203   6.582  21.952 1.00 . A A . 67 GLN HB2  1 1 
        2  2366 1 1 67 GLN HB3  H   8.756   5.856  20.406 1.00 . A A . 67 GLN HB3  1 1 
        2  2367 1 1 67 GLN HE21 H  12.873   4.359  21.433 1.00 . A A . 67 GLN HE21 1 1 
        2  2368 1 1 67 GLN HE22 H  13.313   5.007  22.940 1.00 . A A . 67 GLN HE22 1 1 
        2  2369 1 1 67 GLN HG2  H   9.622   4.103  21.841 1.00 . A A . 67 GLN HG2  1 1 
        2  2370 1 1 67 GLN HG3  H  10.801   4.405  20.566 1.00 . A A . 67 GLN HG3  1 1 
        2  2371 1 1 67 GLN N    N  11.550   7.574  21.286 1.00 . A A . 67 GLN N    1 1 
        2  2372 1 1 67 GLN NE2  N  12.626   4.805  22.271 1.00 . A A . 67 GLN NE2  1 1 
        2  2373 1 1 67 GLN O    O   8.954   7.961  18.757 1.00 . A A . 67 GLN O    1 1 
        2  2374 1 1 67 GLN OE1  O  11.077   5.732  23.525 1.00 . A A . 67 GLN OE1  1 1 
        2  2375 1 1 68 ALA C    C   9.144  10.534  18.183 1.00 . A A . 68 ALA C    1 1 
        2  2376 1 1 68 ALA CA   C   9.254  10.560  19.714 1.00 . A A . 68 ALA CA   1 1 
        2  2377 1 1 68 ALA CB   C  10.020  11.833  20.142 1.00 . A A . 68 ALA CB   1 1 
        2  2378 1 1 68 ALA H    H  10.660   9.362  20.875 1.00 . A A . 68 ALA H    1 1 
        2  2379 1 1 68 ALA HA   H   8.290  10.552  20.204 1.00 . A A . 68 ALA HA   1 1 
        2  2380 1 1 68 ALA HB1  H   9.915  12.605  19.388 1.00 . A A . 68 ALA HB1  1 1 
        2  2381 1 1 68 ALA HB2  H  11.065  11.598  20.264 1.00 . A A . 68 ALA HB2  1 1 
        2  2382 1 1 68 ALA HB3  H   9.626  12.202  21.080 1.00 . A A . 68 ALA HB3  1 1 
        2  2383 1 1 68 ALA N    N   9.987   9.366  20.164 1.00 . A A . 68 ALA N    1 1 
        2  2384 1 1 68 ALA O    O   8.084  10.819  17.626 1.00 . A A . 68 ALA O    1 1 
        2  2385 1 1 69 ASP C    C   9.116   8.936  15.710 1.00 . A A . 69 ASP C    1 1 
        2  2386 1 1 69 ASP CA   C  10.192   9.959  16.071 1.00 . A A . 69 ASP CA   1 1 
        2  2387 1 1 69 ASP CB   C  11.551   9.443  15.591 1.00 . A A . 69 ASP CB   1 1 
        2  2388 1 1 69 ASP CG   C  11.538   9.275  14.075 1.00 . A A . 69 ASP CG   1 1 
        2  2389 1 1 69 ASP H    H  11.008   9.833  18.030 1.00 . A A . 69 ASP H    1 1 
        2  2390 1 1 69 ASP HA   H   9.978  10.891  15.567 1.00 . A A . 69 ASP HA   1 1 
        2  2391 1 1 69 ASP HB2  H  12.321  10.149  15.867 1.00 . A A . 69 ASP HB2  1 1 
        2  2392 1 1 69 ASP HB3  H  11.756   8.490  16.054 1.00 . A A . 69 ASP HB3  1 1 
        2  2393 1 1 69 ASP N    N  10.217  10.110  17.523 1.00 . A A . 69 ASP N    1 1 
        2  2394 1 1 69 ASP O    O   8.256   9.186  14.865 1.00 . A A . 69 ASP O    1 1 
        2  2395 1 1 69 ASP OD1  O  10.477   9.431  13.492 1.00 . A A . 69 ASP OD1  1 1 
        2  2396 1 1 69 ASP OD2  O  12.582   8.970  13.523 1.00 . A A . 69 ASP OD2  1 1 
        2  2397 1 1 70 ALA C    C   6.818   7.139  16.457 1.00 . A A . 70 ALA C    1 1 
        2  2398 1 1 70 ALA CA   C   8.238   6.697  16.117 1.00 . A A . 70 ALA CA   1 1 
        2  2399 1 1 70 ALA CB   C   8.608   5.469  16.952 1.00 . A A . 70 ALA CB   1 1 
        2  2400 1 1 70 ALA H    H   9.939   7.644  16.979 1.00 . A A . 70 ALA H    1 1 
        2  2401 1 1 70 ALA HA   H   8.278   6.429  15.072 1.00 . A A . 70 ALA HA   1 1 
        2  2402 1 1 70 ALA HB1  H   9.506   5.019  16.553 1.00 . A A . 70 ALA HB1  1 1 
        2  2403 1 1 70 ALA HB2  H   7.801   4.753  16.916 1.00 . A A . 70 ALA HB2  1 1 
        2  2404 1 1 70 ALA HB3  H   8.779   5.766  17.975 1.00 . A A . 70 ALA HB3  1 1 
        2  2405 1 1 70 ALA N    N   9.191   7.779  16.360 1.00 . A A . 70 ALA N    1 1 
        2  2406 1 1 70 ALA O    O   5.869   6.804  15.748 1.00 . A A . 70 ALA O    1 1 
        2  2407 1 1 71 SER C    C   4.414   7.204  18.199 1.00 . A A . 71 SER C    1 1 
        2  2408 1 1 71 SER CA   C   5.370   8.373  17.969 1.00 . A A . 71 SER CA   1 1 
        2  2409 1 1 71 SER CB   C   4.794   9.321  16.914 1.00 . A A . 71 SER CB   1 1 
        2  2410 1 1 71 SER H    H   7.470   8.127  18.068 1.00 . A A . 71 SER H    1 1 
        2  2411 1 1 71 SER HA   H   5.484   8.916  18.895 1.00 . A A . 71 SER HA   1 1 
        2  2412 1 1 71 SER HB2  H   5.498  10.112  16.715 1.00 . A A . 71 SER HB2  1 1 
        2  2413 1 1 71 SER HB3  H   4.606   8.771  16.001 1.00 . A A . 71 SER HB3  1 1 
        2  2414 1 1 71 SER HG   H   3.796  10.437  18.157 1.00 . A A . 71 SER HG   1 1 
        2  2415 1 1 71 SER N    N   6.680   7.891  17.544 1.00 . A A . 71 SER N    1 1 
        2  2416 1 1 71 SER O    O   4.627   6.384  19.092 1.00 . A A . 71 SER O    1 1 
        2  2417 1 1 71 SER OG   O   3.583   9.885  17.401 1.00 . A A . 71 SER OG   1 1 
        2  2418 1 1 72 SER C    C   2.983   4.717  17.177 1.00 . A A . 72 SER C    1 1 
        2  2419 1 1 72 SER CA   C   2.372   6.071  17.527 1.00 . A A . 72 SER CA   1 1 
        2  2420 1 1 72 SER CB   C   1.182   6.348  16.610 1.00 . A A . 72 SER CB   1 1 
        2  2421 1 1 72 SER H    H   3.235   7.822  16.705 1.00 . A A . 72 SER H    1 1 
        2  2422 1 1 72 SER HA   H   2.022   6.042  18.548 1.00 . A A . 72 SER HA   1 1 
        2  2423 1 1 72 SER HB2  H   1.525   6.464  15.596 1.00 . A A . 72 SER HB2  1 1 
        2  2424 1 1 72 SER HB3  H   0.487   5.520  16.660 1.00 . A A . 72 SER HB3  1 1 
        2  2425 1 1 72 SER HG   H   0.947   8.279  16.555 1.00 . A A . 72 SER HG   1 1 
        2  2426 1 1 72 SER N    N   3.357   7.138  17.396 1.00 . A A . 72 SER N    1 1 
        2  2427 1 1 72 SER O    O   3.871   4.623  16.331 1.00 . A A . 72 SER O    1 1 
        2  2428 1 1 72 SER OG   O   0.542   7.547  17.026 1.00 . A A . 72 SER OG   1 1 
        2  2429 1 1 73 THR C    C   2.542   1.833  16.212 1.00 . A A . 73 THR C    1 1 
        2  2430 1 1 73 THR CA   C   2.991   2.321  17.596 1.00 . A A . 73 THR CA   1 1 
        2  2431 1 1 73 THR CB   C   2.440   1.392  18.683 1.00 . A A . 73 THR CB   1 1 
        2  2432 1 1 73 THR CG2  C   2.826   1.935  20.060 1.00 . A A . 73 THR CG2  1 1 
        2  2433 1 1 73 THR H    H   1.785   3.810  18.499 1.00 . A A . 73 THR H    1 1 
        2  2434 1 1 73 THR HA   H   4.067   2.329  17.649 1.00 . A A . 73 THR HA   1 1 
        2  2435 1 1 73 THR HB   H   2.848   0.404  18.565 1.00 . A A . 73 THR HB   1 1 
        2  2436 1 1 73 THR HG1  H   0.654   1.935  19.227 1.00 . A A . 73 THR HG1  1 1 
        2  2437 1 1 73 THR HG21 H   3.901   2.014  20.128 1.00 . A A . 73 THR HG21 1 1 
        2  2438 1 1 73 THR HG22 H   2.466   1.263  20.826 1.00 . A A . 73 THR HG22 1 1 
        2  2439 1 1 73 THR HG23 H   2.383   2.910  20.200 1.00 . A A . 73 THR HG23 1 1 
        2  2440 1 1 73 THR N    N   2.495   3.671  17.837 1.00 . A A . 73 THR N    1 1 
        2  2441 1 1 73 THR O    O   1.505   2.268  15.712 1.00 . A A . 73 THR O    1 1 
        2  2442 1 1 73 THR OG1  O   1.026   1.334  18.577 1.00 . A A . 73 THR OG1  1 1 
        2  2443 1 1 74 PRO C    C   1.788  -0.615  14.295 1.00 . A A . 74 PRO C    1 1 
        2  2444 1 1 74 PRO CA   C   2.917   0.418  14.232 1.00 . A A . 74 PRO CA   1 1 
        2  2445 1 1 74 PRO CB   C   4.224  -0.213  13.738 1.00 . A A . 74 PRO CB   1 1 
        2  2446 1 1 74 PRO CD   C   4.555   0.355  16.062 1.00 . A A . 74 PRO CD   1 1 
        2  2447 1 1 74 PRO CG   C   4.908  -0.674  14.982 1.00 . A A . 74 PRO CG   1 1 
        2  2448 1 1 74 PRO HA   H   2.641   1.229  13.578 1.00 . A A . 74 PRO HA   1 1 
        2  2449 1 1 74 PRO HB2  H   4.022  -1.049  13.078 1.00 . A A . 74 PRO HB2  1 1 
        2  2450 1 1 74 PRO HB3  H   4.831   0.524  13.234 1.00 . A A . 74 PRO HB3  1 1 
        2  2451 1 1 74 PRO HD2  H   4.421  -0.132  17.015 1.00 . A A . 74 PRO HD2  1 1 
        2  2452 1 1 74 PRO HD3  H   5.319   1.115  16.125 1.00 . A A . 74 PRO HD3  1 1 
        2  2453 1 1 74 PRO HG2  H   4.545  -1.656  15.263 1.00 . A A . 74 PRO HG2  1 1 
        2  2454 1 1 74 PRO HG3  H   5.978  -0.701  14.837 1.00 . A A . 74 PRO HG3  1 1 
        2  2455 1 1 74 PRO N    N   3.285   0.946  15.582 1.00 . A A . 74 PRO N    1 1 
        2  2456 1 1 74 PRO O    O   1.995  -1.794  14.008 1.00 . A A . 74 PRO O    1 1 
        2  2457 1 1 75 LYS C    C  -0.993  -1.484  13.347 1.00 . A A . 75 LYS C    1 1 
        2  2458 1 1 75 LYS CA   C  -0.562  -1.049  14.745 1.00 . A A . 75 LYS CA   1 1 
        2  2459 1 1 75 LYS CB   C  -1.732  -0.336  15.434 1.00 . A A . 75 LYS CB   1 1 
        2  2460 1 1 75 LYS CD   C  -1.386  -1.269  17.762 1.00 . A A . 75 LYS CD   1 1 
        2  2461 1 1 75 LYS CE   C  -1.320  -0.874  19.239 1.00 . A A . 75 LYS CE   1 1 
        2  2462 1 1 75 LYS CG   C  -1.398   0.002  16.898 1.00 . A A . 75 LYS CG   1 1 
        2  2463 1 1 75 LYS H    H   0.486   0.792  14.871 1.00 . A A . 75 LYS H    1 1 
        2  2464 1 1 75 LYS HA   H  -0.293  -1.925  15.307 1.00 . A A . 75 LYS HA   1 1 
        2  2465 1 1 75 LYS HB2  H  -1.953   0.578  14.902 1.00 . A A . 75 LYS HB2  1 1 
        2  2466 1 1 75 LYS HB3  H  -2.601  -0.978  15.408 1.00 . A A . 75 LYS HB3  1 1 
        2  2467 1 1 75 LYS HD2  H  -2.284  -1.840  17.580 1.00 . A A . 75 LYS HD2  1 1 
        2  2468 1 1 75 LYS HD3  H  -0.523  -1.867  17.525 1.00 . A A . 75 LYS HD3  1 1 
        2  2469 1 1 75 LYS HE2  H  -0.415  -0.316  19.423 1.00 . A A . 75 LYS HE2  1 1 
        2  2470 1 1 75 LYS HE3  H  -2.176  -0.263  19.487 1.00 . A A . 75 LYS HE3  1 1 
        2  2471 1 1 75 LYS HG2  H  -0.426   0.469  16.940 1.00 . A A . 75 LYS HG2  1 1 
        2  2472 1 1 75 LYS HG3  H  -2.140   0.686  17.282 1.00 . A A . 75 LYS HG3  1 1 
        2  2473 1 1 75 LYS HZ1  H  -0.437  -2.159  20.619 1.00 . A A . 75 LYS HZ1  1 1 
        2  2474 1 1 75 LYS HZ2  H  -1.419  -2.941  19.472 1.00 . A A . 75 LYS HZ2  1 1 
        2  2475 1 1 75 LYS HZ3  H  -2.126  -2.065  20.745 1.00 . A A . 75 LYS HZ3  1 1 
        2  2476 1 1 75 LYS N    N   0.595  -0.159  14.661 1.00 . A A . 75 LYS N    1 1 
        2  2477 1 1 75 LYS NZ   N  -1.326  -2.103  20.082 1.00 . A A . 75 LYS NZ   1 1 
        2  2478 1 1 75 LYS O    O  -1.659  -2.506  13.183 1.00 . A A . 75 LYS O    1 1 
        2  2479 1 1 76 PHE C    C  -0.377  -2.344  10.540 1.00 . A A . 76 PHE C    1 1 
        2  2480 1 1 76 PHE CA   C  -0.975  -1.007  10.966 1.00 . A A . 76 PHE CA   1 1 
        2  2481 1 1 76 PHE CB   C  -0.473   0.099  10.036 1.00 . A A . 76 PHE CB   1 1 
        2  2482 1 1 76 PHE CD1  C  -2.453   1.585   9.552 1.00 . A A . 76 PHE CD1  1 1 
        2  2483 1 1 76 PHE CD2  C  -0.842   2.292  11.221 1.00 . A A . 76 PHE CD2  1 1 
        2  2484 1 1 76 PHE CE1  C  -3.196   2.750   9.776 1.00 . A A . 76 PHE CE1  1 1 
        2  2485 1 1 76 PHE CE2  C  -1.585   3.457  11.444 1.00 . A A . 76 PHE CE2  1 1 
        2  2486 1 1 76 PHE CG   C  -1.276   1.356  10.274 1.00 . A A . 76 PHE CG   1 1 
        2  2487 1 1 76 PHE CZ   C  -2.762   3.686  10.722 1.00 . A A . 76 PHE CZ   1 1 
        2  2488 1 1 76 PHE H    H  -0.088   0.107  12.536 1.00 . A A . 76 PHE H    1 1 
        2  2489 1 1 76 PHE HA   H  -2.050  -1.064  10.890 1.00 . A A . 76 PHE HA   1 1 
        2  2490 1 1 76 PHE HB2  H   0.570   0.293  10.237 1.00 . A A . 76 PHE HB2  1 1 
        2  2491 1 1 76 PHE HB3  H  -0.591  -0.212   9.009 1.00 . A A . 76 PHE HB3  1 1 
        2  2492 1 1 76 PHE HD1  H  -2.788   0.863   8.822 1.00 . A A . 76 PHE HD1  1 1 
        2  2493 1 1 76 PHE HD2  H   0.066   2.115  11.778 1.00 . A A . 76 PHE HD2  1 1 
        2  2494 1 1 76 PHE HE1  H  -4.104   2.927   9.219 1.00 . A A . 76 PHE HE1  1 1 
        2  2495 1 1 76 PHE HE2  H  -1.250   4.179  12.175 1.00 . A A . 76 PHE HE2  1 1 
        2  2496 1 1 76 PHE HZ   H  -3.335   4.584  10.895 1.00 . A A . 76 PHE HZ   1 1 
        2  2497 1 1 76 PHE N    N  -0.614  -0.697  12.345 1.00 . A A . 76 PHE N    1 1 
        2  2498 1 1 76 PHE O    O  -1.020  -3.126   9.842 1.00 . A A . 76 PHE O    1 1 
        2  2499 1 1 77 ASN C    C   0.740  -5.040  11.179 1.00 . A A . 77 ASN C    1 1 
        2  2500 1 1 77 ASN CA   C   1.521  -3.854  10.622 1.00 . A A . 77 ASN CA   1 1 
        2  2501 1 1 77 ASN CB   C   2.944  -3.867  11.184 1.00 . A A . 77 ASN CB   1 1 
        2  2502 1 1 77 ASN CG   C   3.698  -5.078  10.647 1.00 . A A . 77 ASN CG   1 1 
        2  2503 1 1 77 ASN H    H   1.322  -1.944  11.524 1.00 . A A . 77 ASN H    1 1 
        2  2504 1 1 77 ASN HA   H   1.569  -3.939   9.546 1.00 . A A . 77 ASN HA   1 1 
        2  2505 1 1 77 ASN HB2  H   3.456  -2.964  10.888 1.00 . A A . 77 ASN HB2  1 1 
        2  2506 1 1 77 ASN HB3  H   2.902  -3.921  12.261 1.00 . A A . 77 ASN HB3  1 1 
        2  2507 1 1 77 ASN HD21 H   5.485  -4.387  11.169 1.00 . A A . 77 ASN HD21 1 1 
        2  2508 1 1 77 ASN HD22 H   5.489  -5.902  10.405 1.00 . A A . 77 ASN HD22 1 1 
        2  2509 1 1 77 ASN N    N   0.855  -2.602  10.967 1.00 . A A . 77 ASN N    1 1 
        2  2510 1 1 77 ASN ND2  N   4.999  -5.126  10.749 1.00 . A A . 77 ASN ND2  1 1 
        2  2511 1 1 77 ASN O    O   0.364  -5.050  12.352 1.00 . A A . 77 ASN O    1 1 
        2  2512 1 1 77 ASN OD1  O   3.086  -6.004  10.115 1.00 . A A . 77 ASN OD1  1 1 
        2  2513 1 1 78 GLY C    C  -1.748  -6.938  10.760 1.00 . A A . 78 GLY C    1 1 
        2  2514 1 1 78 GLY CA   C  -0.249  -7.216  10.755 1.00 . A A . 78 GLY CA   1 1 
        2  2515 1 1 78 GLY H    H   0.815  -5.970   9.409 1.00 . A A . 78 GLY H    1 1 
        2  2516 1 1 78 GLY HA2  H  -0.038  -8.029  10.075 1.00 . A A . 78 GLY HA2  1 1 
        2  2517 1 1 78 GLY HA3  H   0.061  -7.495  11.750 1.00 . A A . 78 GLY HA3  1 1 
        2  2518 1 1 78 GLY N    N   0.495  -6.034  10.332 1.00 . A A . 78 GLY N    1 1 
        2  2519 1 1 78 GLY O    O  -2.207  -5.955  10.178 1.00 . A A . 78 GLY O    1 1 
        2  2520 1 1 79 VAL C    C  -4.391  -7.353  12.931 1.00 . A A . 79 VAL C    1 1 
        2  2521 1 1 79 VAL CA   C  -3.965  -7.657  11.499 1.00 . A A . 79 VAL CA   1 1 
        2  2522 1 1 79 VAL CB   C  -4.646  -8.944  11.029 1.00 . A A . 79 VAL CB   1 1 
        2  2523 1 1 79 VAL CG1  C  -6.164  -8.786  11.132 1.00 . A A . 79 VAL CG1  1 1 
        2  2524 1 1 79 VAL CG2  C  -4.261  -9.223   9.575 1.00 . A A . 79 VAL CG2  1 1 
        2  2525 1 1 79 VAL H    H  -2.085  -8.575  11.864 1.00 . A A . 79 VAL H    1 1 
        2  2526 1 1 79 VAL HA   H  -4.282  -6.843  10.860 1.00 . A A . 79 VAL HA   1 1 
        2  2527 1 1 79 VAL HB   H  -4.327  -9.767  11.652 1.00 . A A . 79 VAL HB   1 1 
        2  2528 1 1 79 VAL HG11 H  -6.647  -9.619  10.642 1.00 . A A . 79 VAL HG11 1 1 
        2  2529 1 1 79 VAL HG12 H  -6.464  -7.865  10.655 1.00 . A A . 79 VAL HG12 1 1 
        2  2530 1 1 79 VAL HG13 H  -6.455  -8.764  12.172 1.00 . A A . 79 VAL HG13 1 1 
        2  2531 1 1 79 VAL HG21 H  -4.658 -10.181   9.275 1.00 . A A . 79 VAL HG21 1 1 
        2  2532 1 1 79 VAL HG22 H  -3.185  -9.234   9.483 1.00 . A A . 79 VAL HG22 1 1 
        2  2533 1 1 79 VAL HG23 H  -4.667  -8.449   8.939 1.00 . A A . 79 VAL HG23 1 1 
        2  2534 1 1 79 VAL N    N  -2.510  -7.811  11.420 1.00 . A A . 79 VAL N    1 1 
        2  2535 1 1 79 VAL O    O  -4.080  -8.103  13.856 1.00 . A A . 79 VAL O    1 1 
        2  2536 1 1 80 LYS C    C  -6.502  -6.921  15.000 1.00 . A A . 80 LYS C    1 1 
        2  2537 1 1 80 LYS CA   C  -5.575  -5.850  14.429 1.00 . A A . 80 LYS CA   1 1 
        2  2538 1 1 80 LYS CB   C  -6.319  -4.509  14.330 1.00 . A A . 80 LYS CB   1 1 
        2  2539 1 1 80 LYS CD   C  -5.533  -3.286  16.393 1.00 . A A . 80 LYS CD   1 1 
        2  2540 1 1 80 LYS CE   C  -5.985  -2.677  17.721 1.00 . A A . 80 LYS CE   1 1 
        2  2541 1 1 80 LYS CG   C  -6.721  -3.992  15.726 1.00 . A A . 80 LYS CG   1 1 
        2  2542 1 1 80 LYS H    H  -5.326  -5.689  12.331 1.00 . A A . 80 LYS H    1 1 
        2  2543 1 1 80 LYS HA   H  -4.724  -5.736  15.080 1.00 . A A . 80 LYS HA   1 1 
        2  2544 1 1 80 LYS HB2  H  -5.680  -3.782  13.849 1.00 . A A . 80 LYS HB2  1 1 
        2  2545 1 1 80 LYS HB3  H  -7.210  -4.642  13.733 1.00 . A A . 80 LYS HB3  1 1 
        2  2546 1 1 80 LYS HD2  H  -4.742  -3.996  16.577 1.00 . A A . 80 LYS HD2  1 1 
        2  2547 1 1 80 LYS HD3  H  -5.170  -2.501  15.747 1.00 . A A . 80 LYS HD3  1 1 
        2  2548 1 1 80 LYS HE2  H  -6.360  -3.458  18.366 1.00 . A A . 80 LYS HE2  1 1 
        2  2549 1 1 80 LYS HE3  H  -5.148  -2.189  18.198 1.00 . A A . 80 LYS HE3  1 1 
        2  2550 1 1 80 LYS HG2  H  -7.537  -3.292  15.624 1.00 . A A . 80 LYS HG2  1 1 
        2  2551 1 1 80 LYS HG3  H  -7.037  -4.816  16.345 1.00 . A A . 80 LYS HG3  1 1 
        2  2552 1 1 80 LYS HZ1  H  -6.807  -1.089  16.655 1.00 . A A . 80 LYS HZ1  1 1 
        2  2553 1 1 80 LYS HZ2  H  -7.184  -1.080  18.311 1.00 . A A . 80 LYS HZ2  1 1 
        2  2554 1 1 80 LYS HZ3  H  -7.955  -2.177  17.267 1.00 . A A . 80 LYS HZ3  1 1 
        2  2555 1 1 80 LYS N    N  -5.108  -6.247  13.106 1.00 . A A . 80 LYS N    1 1 
        2  2556 1 1 80 LYS NZ   N  -7.065  -1.680  17.469 1.00 . A A . 80 LYS NZ   1 1 
        2  2557 1 1 80 LYS O    O  -6.413  -7.269  16.177 1.00 . A A . 80 LYS O    1 1 
        2  2558 1 1 81 LYS C    C  -7.577  -9.713  15.041 1.00 . A A . 81 LYS C    1 1 
        2  2559 1 1 81 LYS CA   C  -8.331  -8.466  14.587 1.00 . A A . 81 LYS CA   1 1 
        2  2560 1 1 81 LYS CB   C  -9.276  -8.832  13.436 1.00 . A A . 81 LYS CB   1 1 
        2  2561 1 1 81 LYS CD   C -10.684  -6.758  13.753 1.00 . A A . 81 LYS CD   1 1 
        2  2562 1 1 81 LYS CE   C -11.355  -5.602  13.009 1.00 . A A . 81 LYS CE   1 1 
        2  2563 1 1 81 LYS CG   C  -9.834  -7.567  12.766 1.00 . A A . 81 LYS CG   1 1 
        2  2564 1 1 81 LYS H    H  -7.415  -7.120  13.230 1.00 . A A . 81 LYS H    1 1 
        2  2565 1 1 81 LYS HA   H  -8.910  -8.095  15.417 1.00 . A A . 81 LYS HA   1 1 
        2  2566 1 1 81 LYS HB2  H  -8.736  -9.412  12.703 1.00 . A A . 81 LYS HB2  1 1 
        2  2567 1 1 81 LYS HB3  H -10.095  -9.420  13.822 1.00 . A A . 81 LYS HB3  1 1 
        2  2568 1 1 81 LYS HD2  H -11.438  -7.394  14.190 1.00 . A A . 81 LYS HD2  1 1 
        2  2569 1 1 81 LYS HD3  H -10.055  -6.355  14.530 1.00 . A A . 81 LYS HD3  1 1 
        2  2570 1 1 81 LYS HE2  H -10.598  -4.972  12.565 1.00 . A A . 81 LYS HE2  1 1 
        2  2571 1 1 81 LYS HE3  H -11.995  -5.995  12.233 1.00 . A A . 81 LYS HE3  1 1 
        2  2572 1 1 81 LYS HG2  H  -9.014  -6.956  12.418 1.00 . A A . 81 LYS HG2  1 1 
        2  2573 1 1 81 LYS HG3  H -10.446  -7.853  11.923 1.00 . A A . 81 LYS HG3  1 1 
        2  2574 1 1 81 LYS HZ1  H -12.840  -4.207  13.438 1.00 . A A . 81 LYS HZ1  1 1 
        2  2575 1 1 81 LYS HZ2  H -11.540  -4.194  14.532 1.00 . A A . 81 LYS HZ2  1 1 
        2  2576 1 1 81 LYS HZ3  H -12.695  -5.439  14.594 1.00 . A A . 81 LYS HZ3  1 1 
        2  2577 1 1 81 LYS N    N  -7.390  -7.437  14.156 1.00 . A A . 81 LYS N    1 1 
        2  2578 1 1 81 LYS NZ   N -12.169  -4.799  13.965 1.00 . A A . 81 LYS NZ   1 1 
        2  2579 1 1 81 LYS O    O  -7.131  -9.731  16.177 1.00 . A A . 81 LYS O    1 1 
        2  2580 1 1 81 LYS OXT  O  -7.456 -10.632  14.249 1.00 . A A . 81 LYS OXT  1 1 
        3  2581 1 1  1 MET C    C -12.663   6.681   0.973 1.00 . A A .  1 MET C    1 1 
        3  2582 1 1  1 MET CA   C -13.104   8.102   1.313 1.00 . A A .  1 MET CA   1 1 
        3  2583 1 1  1 MET CB   C -14.086   8.084   2.486 1.00 . A A .  1 MET CB   1 1 
        3  2584 1 1  1 MET CE   C -13.280   7.535   6.488 1.00 . A A .  1 MET CE   1 1 
        3  2585 1 1  1 MET CG   C -13.331   7.808   3.788 1.00 . A A .  1 MET CG   1 1 
        3  2586 1 1  1 MET H1   H -13.861   7.986  -0.623 1.00 . A A .  1 MET H1   1 1 
        3  2587 1 1  1 MET H2   H -13.198   9.499  -0.229 1.00 . A A .  1 MET H2   1 1 
        3  2588 1 1  1 MET H3   H -14.714   9.047   0.389 1.00 . A A .  1 MET H3   1 1 
        3  2589 1 1  1 MET HA   H -12.240   8.693   1.577 1.00 . A A .  1 MET HA   1 1 
        3  2590 1 1  1 MET HB2  H -14.583   9.041   2.554 1.00 . A A .  1 MET HB2  1 1 
        3  2591 1 1  1 MET HB3  H -14.820   7.308   2.328 1.00 . A A .  1 MET HB3  1 1 
        3  2592 1 1  1 MET HE1  H -12.410   8.165   6.360 1.00 . A A .  1 MET HE1  1 1 
        3  2593 1 1  1 MET HE2  H -12.983   6.500   6.431 1.00 . A A .  1 MET HE2  1 1 
        3  2594 1 1  1 MET HE3  H -13.730   7.726   7.453 1.00 . A A .  1 MET HE3  1 1 
        3  2595 1 1  1 MET HG2  H -12.889   6.824   3.748 1.00 . A A .  1 MET HG2  1 1 
        3  2596 1 1  1 MET HG3  H -12.553   8.546   3.916 1.00 . A A .  1 MET HG3  1 1 
        3  2597 1 1  1 MET N    N -13.769   8.703   0.122 1.00 . A A .  1 MET N    1 1 
        3  2598 1 1  1 MET O    O -12.997   5.730   1.679 1.00 . A A .  1 MET O    1 1 
        3  2599 1 1  1 MET SD   S -14.481   7.895   5.183 1.00 . A A .  1 MET SD   1 1 
        3  2600 1 1  2 LYS C    C  -9.981   5.336  -1.031 1.00 . A A .  2 LYS C    1 1 
        3  2601 1 1  2 LYS CA   C -11.430   5.236  -0.563 1.00 . A A .  2 LYS CA   1 1 
        3  2602 1 1  2 LYS CB   C -12.307   4.720  -1.709 1.00 . A A .  2 LYS CB   1 1 
        3  2603 1 1  2 LYS CD   C -12.762   2.789  -3.231 1.00 . A A .  2 LYS CD   1 1 
        3  2604 1 1  2 LYS CE   C -12.266   1.417  -3.690 1.00 . A A .  2 LYS CE   1 1 
        3  2605 1 1  2 LYS CG   C -11.841   3.322  -2.132 1.00 . A A .  2 LYS CG   1 1 
        3  2606 1 1  2 LYS H    H -11.688   7.342  -0.645 1.00 . A A .  2 LYS H    1 1 
        3  2607 1 1  2 LYS HA   H -11.482   4.535   0.259 1.00 . A A .  2 LYS HA   1 1 
        3  2608 1 1  2 LYS HB2  H -13.335   4.673  -1.382 1.00 . A A .  2 LYS HB2  1 1 
        3  2609 1 1  2 LYS HB3  H -12.229   5.392  -2.551 1.00 . A A .  2 LYS HB3  1 1 
        3  2610 1 1  2 LYS HD2  H -13.768   2.699  -2.845 1.00 . A A .  2 LYS HD2  1 1 
        3  2611 1 1  2 LYS HD3  H -12.756   3.471  -4.068 1.00 . A A .  2 LYS HD3  1 1 
        3  2612 1 1  2 LYS HE2  H -12.892   1.059  -4.495 1.00 . A A .  2 LYS HE2  1 1 
        3  2613 1 1  2 LYS HE3  H -11.247   1.499  -4.036 1.00 . A A .  2 LYS HE3  1 1 
        3  2614 1 1  2 LYS HG2  H -10.831   3.376  -2.507 1.00 . A A .  2 LYS HG2  1 1 
        3  2615 1 1  2 LYS HG3  H -11.876   2.659  -1.281 1.00 . A A .  2 LYS HG3  1 1 
        3  2616 1 1  2 LYS HZ1  H -13.315   0.355  -2.238 1.00 . A A .  2 LYS HZ1  1 1 
        3  2617 1 1  2 LYS HZ2  H -11.751   0.820  -1.763 1.00 . A A .  2 LYS HZ2  1 1 
        3  2618 1 1  2 LYS HZ3  H -11.965  -0.466  -2.853 1.00 . A A .  2 LYS HZ3  1 1 
        3  2619 1 1  2 LYS N    N -11.916   6.545  -0.121 1.00 . A A .  2 LYS N    1 1 
        3  2620 1 1  2 LYS NZ   N -12.330   0.459  -2.550 1.00 . A A .  2 LYS NZ   1 1 
        3  2621 1 1  2 LYS O    O  -9.254   4.342  -1.048 1.00 . A A .  2 LYS O    1 1 
        3  2622 1 1  3 ASP C    C  -7.184   6.427  -0.781 1.00 . A A .  3 ASP C    1 1 
        3  2623 1 1  3 ASP CA   C  -8.207   6.746  -1.894 1.00 . A A .  3 ASP CA   1 1 
        3  2624 1 1  3 ASP CB   C  -8.034   8.198  -2.349 1.00 . A A .  3 ASP CB   1 1 
        3  2625 1 1  3 ASP CG   C  -6.636   8.393  -2.928 1.00 . A A .  3 ASP CG   1 1 
        3  2626 1 1  3 ASP H    H -10.191   7.294  -1.390 1.00 . A A .  3 ASP H    1 1 
        3  2627 1 1  3 ASP HA   H  -8.051   6.109  -2.740 1.00 . A A .  3 ASP HA   1 1 
        3  2628 1 1  3 ASP HB2  H  -8.771   8.426  -3.105 1.00 . A A .  3 ASP HB2  1 1 
        3  2629 1 1  3 ASP HB3  H  -8.167   8.859  -1.506 1.00 . A A .  3 ASP HB3  1 1 
        3  2630 1 1  3 ASP N    N  -9.568   6.538  -1.418 1.00 . A A .  3 ASP N    1 1 
        3  2631 1 1  3 ASP O    O  -7.337   6.907   0.342 1.00 . A A .  3 ASP O    1 1 
        3  2632 1 1  3 ASP OD1  O  -5.689   8.293  -2.167 1.00 . A A .  3 ASP OD1  1 1 
        3  2633 1 1  3 ASP OD2  O  -6.532   8.637  -4.119 1.00 . A A .  3 ASP OD2  1 1 
        3  2634 1 1  4 PRO C    C  -4.576   6.525   0.741 1.00 . A A .  4 PRO C    1 1 
        3  2635 1 1  4 PRO CA   C  -5.113   5.302  -0.014 1.00 . A A .  4 PRO CA   1 1 
        3  2636 1 1  4 PRO CB   C  -3.988   4.658  -0.835 1.00 . A A .  4 PRO CB   1 1 
        3  2637 1 1  4 PRO CD   C  -5.838   4.979  -2.342 1.00 . A A .  4 PRO CD   1 1 
        3  2638 1 1  4 PRO CG   C  -4.677   4.041  -2.000 1.00 . A A .  4 PRO CG   1 1 
        3  2639 1 1  4 PRO HA   H  -5.505   4.579   0.677 1.00 . A A .  4 PRO HA   1 1 
        3  2640 1 1  4 PRO HB2  H  -3.281   5.410  -1.169 1.00 . A A .  4 PRO HB2  1 1 
        3  2641 1 1  4 PRO HB3  H  -3.481   3.898  -0.257 1.00 . A A .  4 PRO HB3  1 1 
        3  2642 1 1  4 PRO HD2  H  -5.536   5.704  -3.087 1.00 . A A .  4 PRO HD2  1 1 
        3  2643 1 1  4 PRO HD3  H  -6.683   4.405  -2.684 1.00 . A A .  4 PRO HD3  1 1 
        3  2644 1 1  4 PRO HG2  H  -3.995   3.962  -2.839 1.00 . A A .  4 PRO HG2  1 1 
        3  2645 1 1  4 PRO HG3  H  -5.060   3.066  -1.738 1.00 . A A .  4 PRO HG3  1 1 
        3  2646 1 1  4 PRO N    N  -6.147   5.644  -1.049 1.00 . A A .  4 PRO N    1 1 
        3  2647 1 1  4 PRO O    O  -4.081   6.408   1.858 1.00 . A A .  4 PRO O    1 1 
        3  2648 1 1  5 LYS C    C  -5.217   9.351   1.883 1.00 . A A .  5 LYS C    1 1 
        3  2649 1 1  5 LYS CA   C  -4.243   8.921   0.783 1.00 . A A .  5 LYS CA   1 1 
        3  2650 1 1  5 LYS CB   C  -4.147  10.041  -0.255 1.00 . A A .  5 LYS CB   1 1 
        3  2651 1 1  5 LYS CD   C  -3.053  10.663  -2.443 1.00 . A A .  5 LYS CD   1 1 
        3  2652 1 1  5 LYS CE   C  -2.710  12.110  -2.064 1.00 . A A .  5 LYS CE   1 1 
        3  2653 1 1  5 LYS CG   C  -2.984   9.749  -1.211 1.00 . A A .  5 LYS CG   1 1 
        3  2654 1 1  5 LYS H    H  -5.165   7.736  -0.722 1.00 . A A .  5 LYS H    1 1 
        3  2655 1 1  5 LYS HA   H  -3.257   8.753   1.190 1.00 . A A .  5 LYS HA   1 1 
        3  2656 1 1  5 LYS HB2  H  -5.071  10.101  -0.811 1.00 . A A .  5 LYS HB2  1 1 
        3  2657 1 1  5 LYS HB3  H  -3.969  10.973   0.254 1.00 . A A .  5 LYS HB3  1 1 
        3  2658 1 1  5 LYS HD2  H  -2.350  10.314  -3.186 1.00 . A A .  5 LYS HD2  1 1 
        3  2659 1 1  5 LYS HD3  H  -4.051  10.632  -2.856 1.00 . A A .  5 LYS HD3  1 1 
        3  2660 1 1  5 LYS HE2  H  -2.739  12.725  -2.951 1.00 . A A .  5 LYS HE2  1 1 
        3  2661 1 1  5 LYS HE3  H  -3.424  12.483  -1.350 1.00 . A A .  5 LYS HE3  1 1 
        3  2662 1 1  5 LYS HG2  H  -2.050   9.916  -0.695 1.00 . A A .  5 LYS HG2  1 1 
        3  2663 1 1  5 LYS HG3  H  -3.035   8.719  -1.529 1.00 . A A .  5 LYS HG3  1 1 
        3  2664 1 1  5 LYS HZ1  H  -1.393  11.979  -0.456 1.00 . A A .  5 LYS HZ1  1 1 
        3  2665 1 1  5 LYS HZ2  H  -0.928  13.101  -1.643 1.00 . A A .  5 LYS HZ2  1 1 
        3  2666 1 1  5 LYS HZ3  H  -0.744  11.436  -1.927 1.00 . A A .  5 LYS HZ3  1 1 
        3  2667 1 1  5 LYS N    N  -4.698   7.694   0.136 1.00 . A A .  5 LYS N    1 1 
        3  2668 1 1  5 LYS NZ   N  -1.341  12.160  -1.478 1.00 . A A .  5 LYS NZ   1 1 
        3  2669 1 1  5 LYS O    O  -4.827   9.712   2.988 1.00 . A A .  5 LYS O    1 1 
        3  2670 1 1  6 THR C    C  -7.906   8.328   3.368 1.00 . A A .  6 THR C    1 1 
        3  2671 1 1  6 THR CA   C  -7.633   9.510   2.420 1.00 . A A .  6 THR CA   1 1 
        3  2672 1 1  6 THR CB   C  -8.883   9.778   1.580 1.00 . A A .  6 THR CB   1 1 
        3  2673 1 1  6 THR CG2  C -10.060  10.104   2.503 1.00 . A A .  6 THR CG2  1 1 
        3  2674 1 1  6 THR H    H  -6.678   8.793   0.676 1.00 . A A .  6 THR H    1 1 
        3  2675 1 1  6 THR HA   H  -7.425  10.383   3.008 1.00 . A A .  6 THR HA   1 1 
        3  2676 1 1  6 THR HB   H  -9.120   8.902   0.997 1.00 . A A .  6 THR HB   1 1 
        3  2677 1 1  6 THR HG1  H  -8.827  11.684   1.198 1.00 . A A .  6 THR HG1  1 1 
        3  2678 1 1  6 THR HG21 H -10.416   9.195   2.966 1.00 . A A .  6 THR HG21 1 1 
        3  2679 1 1  6 THR HG22 H -10.855  10.552   1.925 1.00 . A A .  6 THR HG22 1 1 
        3  2680 1 1  6 THR HG23 H  -9.738  10.796   3.268 1.00 . A A .  6 THR HG23 1 1 
        3  2681 1 1  6 THR N    N  -6.496   9.229   1.533 1.00 . A A .  6 THR N    1 1 
        3  2682 1 1  6 THR O    O  -8.388   8.485   4.491 1.00 . A A .  6 THR O    1 1 
        3  2683 1 1  6 THR OG1  O  -8.641  10.877   0.714 1.00 . A A .  6 THR OG1  1 1 
        3  2684 1 1  7 LEU C    C  -6.841   5.806   4.824 1.00 . A A .  7 LEU C    1 1 
        3  2685 1 1  7 LEU CA   C  -7.773   5.897   3.591 1.00 . A A .  7 LEU CA   1 1 
        3  2686 1 1  7 LEU CB   C  -7.516   4.695   2.661 1.00 . A A .  7 LEU CB   1 1 
        3  2687 1 1  7 LEU CD1  C  -8.084   2.309   2.162 1.00 . A A .  7 LEU CD1  1 1 
        3  2688 1 1  7 LEU CD2  C  -8.174   3.141   4.522 1.00 . A A .  7 LEU CD2  1 1 
        3  2689 1 1  7 LEU CG   C  -8.411   3.510   3.053 1.00 . A A .  7 LEU CG   1 1 
        3  2690 1 1  7 LEU H    H  -7.112   7.222   1.994 1.00 . A A .  7 LEU H    1 1 
        3  2691 1 1  7 LEU HA   H  -8.798   5.862   3.933 1.00 . A A .  7 LEU HA   1 1 
        3  2692 1 1  7 LEU HB2  H  -7.731   4.981   1.641 1.00 . A A .  7 LEU HB2  1 1 
        3  2693 1 1  7 LEU HB3  H  -6.482   4.394   2.737 1.00 . A A .  7 LEU HB3  1 1 
        3  2694 1 1  7 LEU HD11 H  -8.749   1.492   2.399 1.00 . A A .  7 LEU HD11 1 1 
        3  2695 1 1  7 LEU HD12 H  -7.062   2.003   2.333 1.00 . A A .  7 LEU HD12 1 1 
        3  2696 1 1  7 LEU HD13 H  -8.208   2.585   1.126 1.00 . A A .  7 LEU HD13 1 1 
        3  2697 1 1  7 LEU HD21 H  -8.694   3.843   5.155 1.00 . A A .  7 LEU HD21 1 1 
        3  2698 1 1  7 LEU HD22 H  -7.118   3.174   4.738 1.00 . A A .  7 LEU HD22 1 1 
        3  2699 1 1  7 LEU HD23 H  -8.549   2.144   4.711 1.00 . A A .  7 LEU HD23 1 1 
        3  2700 1 1  7 LEU HG   H  -9.448   3.783   2.913 1.00 . A A .  7 LEU HG   1 1 
        3  2701 1 1  7 LEU N    N  -7.580   7.154   2.852 1.00 . A A .  7 LEU N    1 1 
        3  2702 1 1  7 LEU O    O  -7.293   5.552   5.936 1.00 . A A .  7 LEU O    1 1 
        3  2703 1 1  8 LEU C    C  -4.481   7.296   6.495 1.00 . A A .  8 LEU C    1 1 
        3  2704 1 1  8 LEU CA   C  -4.498   6.018   5.635 1.00 . A A .  8 LEU CA   1 1 
        3  2705 1 1  8 LEU CB   C  -3.126   5.851   4.949 1.00 . A A .  8 LEU CB   1 1 
        3  2706 1 1  8 LEU CD1  C  -3.960   3.761   3.830 1.00 . A A .  8 LEU CD1  1 1 
        3  2707 1 1  8 LEU CD2  C  -1.512   4.245   3.917 1.00 . A A .  8 LEU CD2  1 1 
        3  2708 1 1  8 LEU CG   C  -2.837   4.366   4.673 1.00 . A A .  8 LEU CG   1 1 
        3  2709 1 1  8 LEU H    H  -5.240   6.275   3.703 1.00 . A A .  8 LEU H    1 1 
        3  2710 1 1  8 LEU HA   H  -4.669   5.154   6.261 1.00 . A A .  8 LEU HA   1 1 
        3  2711 1 1  8 LEU HB2  H  -3.130   6.390   4.014 1.00 . A A .  8 LEU HB2  1 1 
        3  2712 1 1  8 LEU HB3  H  -2.345   6.248   5.584 1.00 . A A .  8 LEU HB3  1 1 
        3  2713 1 1  8 LEU HD11 H  -3.689   2.757   3.540 1.00 . A A .  8 LEU HD11 1 1 
        3  2714 1 1  8 LEU HD12 H  -4.109   4.360   2.948 1.00 . A A .  8 LEU HD12 1 1 
        3  2715 1 1  8 LEU HD13 H  -4.871   3.735   4.408 1.00 . A A .  8 LEU HD13 1 1 
        3  2716 1 1  8 LEU HD21 H  -1.410   3.243   3.525 1.00 . A A .  8 LEU HD21 1 1 
        3  2717 1 1  8 LEU HD22 H  -0.693   4.452   4.590 1.00 . A A .  8 LEU HD22 1 1 
        3  2718 1 1  8 LEU HD23 H  -1.498   4.953   3.102 1.00 . A A .  8 LEU HD23 1 1 
        3  2719 1 1  8 LEU HG   H  -2.767   3.833   5.610 1.00 . A A .  8 LEU HG   1 1 
        3  2720 1 1  8 LEU N    N  -5.551   6.035   4.601 1.00 . A A .  8 LEU N    1 1 
        3  2721 1 1  8 LEU O    O  -3.977   7.318   7.618 1.00 . A A .  8 LEU O    1 1 
        3  2722 1 1  9 ARG C    C  -6.083   9.636   7.777 1.00 . A A .  9 ARG C    1 1 
        3  2723 1 1  9 ARG CA   C  -5.133   9.653   6.572 1.00 . A A .  9 ARG CA   1 1 
        3  2724 1 1  9 ARG CB   C  -5.597  10.718   5.559 1.00 . A A .  9 ARG CB   1 1 
        3  2725 1 1  9 ARG CD   C  -3.941  12.582   5.846 1.00 . A A .  9 ARG CD   1 1 
        3  2726 1 1  9 ARG CG   C  -4.382  11.434   4.925 1.00 . A A .  9 ARG CG   1 1 
        3  2727 1 1  9 ARG CZ   C  -1.982  13.895   6.353 1.00 . A A .  9 ARG CZ   1 1 
        3  2728 1 1  9 ARG H    H  -5.570   8.133   5.116 1.00 . A A .  9 ARG H    1 1 
        3  2729 1 1  9 ARG HA   H  -4.141   9.915   6.911 1.00 . A A .  9 ARG HA   1 1 
        3  2730 1 1  9 ARG HB2  H  -6.161  10.230   4.794 1.00 . A A .  9 ARG HB2  1 1 
        3  2731 1 1  9 ARG HB3  H  -6.228  11.451   6.047 1.00 . A A .  9 ARG HB3  1 1 
        3  2732 1 1  9 ARG HD2  H  -4.606  13.419   5.708 1.00 . A A .  9 ARG HD2  1 1 
        3  2733 1 1  9 ARG HD3  H  -3.998  12.254   6.876 1.00 . A A .  9 ARG HD3  1 1 
        3  2734 1 1  9 ARG HE   H  -2.099  12.646   4.784 1.00 . A A .  9 ARG HE   1 1 
        3  2735 1 1  9 ARG HG2  H  -3.569  10.734   4.800 1.00 . A A .  9 ARG HG2  1 1 
        3  2736 1 1  9 ARG HG3  H  -4.662  11.837   3.964 1.00 . A A .  9 ARG HG3  1 1 
        3  2737 1 1  9 ARG HH11 H  -3.567  14.107   7.557 1.00 . A A .  9 ARG HH11 1 1 
        3  2738 1 1  9 ARG HH12 H  -2.177  15.054   7.973 1.00 . A A .  9 ARG HH12 1 1 
        3  2739 1 1  9 ARG HH21 H  -0.261  13.884   5.331 1.00 . A A .  9 ARG HH21 1 1 
        3  2740 1 1  9 ARG HH22 H  -0.305  14.927   6.713 1.00 . A A .  9 ARG HH22 1 1 
        3  2741 1 1  9 ARG N    N  -5.047   8.342   5.918 1.00 . A A .  9 ARG N    1 1 
        3  2742 1 1  9 ARG NE   N  -2.578  13.012   5.556 1.00 . A A .  9 ARG NE   1 1 
        3  2743 1 1  9 ARG NH1  N  -2.625  14.390   7.374 1.00 . A A .  9 ARG NH1  1 1 
        3  2744 1 1  9 ARG NH2  N  -0.753  14.264   6.113 1.00 . A A .  9 ARG NH2  1 1 
        3  2745 1 1  9 ARG O    O  -5.899  10.394   8.727 1.00 . A A .  9 ARG O    1 1 
        3  2746 1 1 10 VAL C    C  -7.478   8.073  10.083 1.00 . A A . 10 VAL C    1 1 
        3  2747 1 1 10 VAL CA   C  -8.069   8.698   8.818 1.00 . A A . 10 VAL CA   1 1 
        3  2748 1 1 10 VAL CB   C  -9.302   7.898   8.368 1.00 . A A . 10 VAL CB   1 1 
        3  2749 1 1 10 VAL CG1  C  -8.985   6.393   8.359 1.00 . A A . 10 VAL CG1  1 1 
        3  2750 1 1 10 VAL CG2  C -10.472   8.172   9.323 1.00 . A A . 10 VAL CG2  1 1 
        3  2751 1 1 10 VAL H    H  -7.194   8.179   6.964 1.00 . A A . 10 VAL H    1 1 
        3  2752 1 1 10 VAL HA   H  -8.389   9.684   9.123 1.00 . A A . 10 VAL HA   1 1 
        3  2753 1 1 10 VAL HB   H  -9.578   8.207   7.369 1.00 . A A . 10 VAL HB   1 1 
        3  2754 1 1 10 VAL HG11 H  -9.650   5.888   7.674 1.00 . A A . 10 VAL HG11 1 1 
        3  2755 1 1 10 VAL HG12 H  -9.117   5.986   9.352 1.00 . A A . 10 VAL HG12 1 1 
        3  2756 1 1 10 VAL HG13 H  -7.964   6.239   8.046 1.00 . A A . 10 VAL HG13 1 1 
        3  2757 1 1 10 VAL HG21 H -10.156   7.988  10.340 1.00 . A A . 10 VAL HG21 1 1 
        3  2758 1 1 10 VAL HG22 H -11.297   7.519   9.080 1.00 . A A . 10 VAL HG22 1 1 
        3  2759 1 1 10 VAL HG23 H -10.784   9.202   9.224 1.00 . A A . 10 VAL HG23 1 1 
        3  2760 1 1 10 VAL N    N  -7.100   8.785   7.728 1.00 . A A . 10 VAL N    1 1 
        3  2761 1 1 10 VAL O    O  -7.872   8.462  11.183 1.00 . A A . 10 VAL O    1 1 
        3  2762 1 1 11 SER C    C  -5.095   7.528  11.942 1.00 . A A . 11 SER C    1 1 
        3  2763 1 1 11 SER CA   C  -5.994   6.541  11.198 1.00 . A A . 11 SER CA   1 1 
        3  2764 1 1 11 SER CB   C  -5.197   5.282  10.854 1.00 . A A . 11 SER CB   1 1 
        3  2765 1 1 11 SER H    H  -6.216   6.810   9.114 1.00 . A A . 11 SER H    1 1 
        3  2766 1 1 11 SER HA   H  -6.777   6.274  11.890 1.00 . A A . 11 SER HA   1 1 
        3  2767 1 1 11 SER HB2  H  -5.848   4.556  10.398 1.00 . A A . 11 SER HB2  1 1 
        3  2768 1 1 11 SER HB3  H  -4.404   5.536  10.163 1.00 . A A . 11 SER HB3  1 1 
        3  2769 1 1 11 SER HG   H  -4.243   3.892  11.826 1.00 . A A . 11 SER HG   1 1 
        3  2770 1 1 11 SER N    N  -6.550   7.125   9.980 1.00 . A A . 11 SER N    1 1 
        3  2771 1 1 11 SER O    O  -5.293   7.743  13.108 1.00 . A A . 11 SER O    1 1 
        3  2772 1 1 11 SER OG   O  -4.649   4.734  12.046 1.00 . A A . 11 SER OG   1 1 
        3  2773 1 1 12 ILE C    C  -4.021  10.115  12.726 1.00 . A A . 12 ILE C    1 1 
        3  2774 1 1 12 ILE CA   C  -3.204   9.017  12.008 1.00 . A A . 12 ILE CA   1 1 
        3  2775 1 1 12 ILE CB   C  -2.208   9.659  11.023 1.00 . A A . 12 ILE CB   1 1 
        3  2776 1 1 12 ILE CD1  C   0.040  10.735  10.832 1.00 . A A . 12 ILE CD1  1 1 
        3  2777 1 1 12 ILE CG1  C  -1.072  10.334  11.804 1.00 . A A . 12 ILE CG1  1 1 
        3  2778 1 1 12 ILE CG2  C  -2.905  10.711  10.162 1.00 . A A . 12 ILE CG2  1 1 
        3  2779 1 1 12 ILE H    H  -3.959   7.820  10.360 1.00 . A A . 12 ILE H    1 1 
        3  2780 1 1 12 ILE HA   H  -2.634   8.438  12.717 1.00 . A A . 12 ILE HA   1 1 
        3  2781 1 1 12 ILE HB   H  -1.795   8.892  10.383 1.00 . A A . 12 ILE HB   1 1 
        3  2782 1 1 12 ILE HD11 H   0.890  11.101  11.389 1.00 . A A . 12 ILE HD11 1 1 
        3  2783 1 1 12 ILE HD12 H  -0.320  11.512  10.175 1.00 . A A . 12 ILE HD12 1 1 
        3  2784 1 1 12 ILE HD13 H   0.333   9.877  10.248 1.00 . A A . 12 ILE HD13 1 1 
        3  2785 1 1 12 ILE HG12 H  -1.452  11.215  12.300 1.00 . A A . 12 ILE HG12 1 1 
        3  2786 1 1 12 ILE HG13 H  -0.674   9.649  12.537 1.00 . A A . 12 ILE HG13 1 1 
        3  2787 1 1 12 ILE HG21 H  -3.825  10.311   9.778 1.00 . A A . 12 ILE HG21 1 1 
        3  2788 1 1 12 ILE HG22 H  -2.260  10.986   9.339 1.00 . A A . 12 ILE HG22 1 1 
        3  2789 1 1 12 ILE HG23 H  -3.109  11.585  10.763 1.00 . A A . 12 ILE HG23 1 1 
        3  2790 1 1 12 ILE N    N  -4.106   8.101  11.287 1.00 . A A . 12 ILE N    1 1 
        3  2791 1 1 12 ILE O    O  -3.809  10.454  13.889 1.00 . A A . 12 ILE O    1 1 
        3  2792 1 1 13 ILE C    C  -6.739  11.187  13.634 1.00 . A A . 13 ILE C    1 1 
        3  2793 1 1 13 ILE CA   C  -5.891  11.655  12.415 1.00 . A A . 13 ILE CA   1 1 
        3  2794 1 1 13 ILE CB   C  -6.822  12.101  11.273 1.00 . A A . 13 ILE CB   1 1 
        3  2795 1 1 13 ILE CD1  C  -6.864  13.085   8.960 1.00 . A A . 13 ILE CD1  1 1 
        3  2796 1 1 13 ILE CG1  C  -6.007  12.847  10.208 1.00 . A A . 13 ILE CG1  1 1 
        3  2797 1 1 13 ILE CG2  C  -7.902  13.040  11.825 1.00 . A A . 13 ILE CG2  1 1 
        3  2798 1 1 13 ILE H    H  -4.982  10.152  11.092 1.00 . A A . 13 ILE H    1 1 
        3  2799 1 1 13 ILE HA   H  -5.313  12.505  12.745 1.00 . A A . 13 ILE HA   1 1 
        3  2800 1 1 13 ILE HB   H  -7.290  11.233  10.833 1.00 . A A . 13 ILE HB   1 1 
        3  2801 1 1 13 ILE HD11 H  -7.429  12.193   8.729 1.00 . A A . 13 ILE HD11 1 1 
        3  2802 1 1 13 ILE HD12 H  -6.224  13.329   8.125 1.00 . A A . 13 ILE HD12 1 1 
        3  2803 1 1 13 ILE HD13 H  -7.544  13.905   9.141 1.00 . A A . 13 ILE HD13 1 1 
        3  2804 1 1 13 ILE HG12 H  -5.681  13.797  10.606 1.00 . A A . 13 ILE HG12 1 1 
        3  2805 1 1 13 ILE HG13 H  -5.147  12.259   9.938 1.00 . A A . 13 ILE HG13 1 1 
        3  2806 1 1 13 ILE HG21 H  -8.628  12.467  12.382 1.00 . A A . 13 ILE HG21 1 1 
        3  2807 1 1 13 ILE HG22 H  -8.395  13.545  11.009 1.00 . A A . 13 ILE HG22 1 1 
        3  2808 1 1 13 ILE HG23 H  -7.444  13.769  12.475 1.00 . A A . 13 ILE HG23 1 1 
        3  2809 1 1 13 ILE N    N  -4.963  10.609  11.957 1.00 . A A . 13 ILE N    1 1 
        3  2810 1 1 13 ILE O    O  -6.852  11.905  14.627 1.00 . A A . 13 ILE O    1 1 
        3  2811 1 1 14 GLY C    C  -7.126   8.695  15.735 1.00 . A A . 14 GLY C    1 1 
        3  2812 1 1 14 GLY CA   C  -8.046   9.399  14.700 1.00 . A A . 14 GLY CA   1 1 
        3  2813 1 1 14 GLY H    H  -7.014   9.426  12.794 1.00 . A A . 14 GLY H    1 1 
        3  2814 1 1 14 GLY HA2  H  -8.584  10.194  15.193 1.00 . A A . 14 GLY HA2  1 1 
        3  2815 1 1 14 GLY HA3  H  -8.754   8.680  14.317 1.00 . A A . 14 GLY HA3  1 1 
        3  2816 1 1 14 GLY N    N  -7.275   9.972  13.566 1.00 . A A . 14 GLY N    1 1 
        3  2817 1 1 14 GLY O    O  -7.422   8.602  16.926 1.00 . A A . 14 GLY O    1 1 
        3  2818 1 1 15 THR C    C  -4.105   8.426  16.797 1.00 . A A . 15 THR C    1 1 
        3  2819 1 1 15 THR CA   C  -4.978   7.496  15.956 1.00 . A A . 15 THR CA   1 1 
        3  2820 1 1 15 THR CB   C  -4.081   6.630  15.066 1.00 . A A . 15 THR CB   1 1 
        3  2821 1 1 15 THR CG2  C  -3.142   5.803  15.946 1.00 . A A . 15 THR CG2  1 1 
        3  2822 1 1 15 THR H    H  -5.948   8.447  14.252 1.00 . A A . 15 THR H    1 1 
        3  2823 1 1 15 THR HA   H  -5.484   6.840  16.650 1.00 . A A . 15 THR HA   1 1 
        3  2824 1 1 15 THR HB   H  -3.493   7.257  14.426 1.00 . A A . 15 THR HB   1 1 
        3  2825 1 1 15 THR HG1  H  -5.804   5.926  14.500 1.00 . A A . 15 THR HG1  1 1 
        3  2826 1 1 15 THR HG21 H  -2.670   5.037  15.349 1.00 . A A . 15 THR HG21 1 1 
        3  2827 1 1 15 THR HG22 H  -3.705   5.342  16.744 1.00 . A A . 15 THR HG22 1 1 
        3  2828 1 1 15 THR HG23 H  -2.383   6.448  16.368 1.00 . A A . 15 THR HG23 1 1 
        3  2829 1 1 15 THR N    N  -6.023   8.217  15.197 1.00 . A A . 15 THR N    1 1 
        3  2830 1 1 15 THR O    O  -3.566   8.007  17.821 1.00 . A A . 15 THR O    1 1 
        3  2831 1 1 15 THR OG1  O  -4.884   5.752  14.288 1.00 . A A . 15 THR OG1  1 1 
        3  2832 1 1 16 THR C    C  -3.889  11.188  18.350 1.00 . A A . 16 THR C    1 1 
        3  2833 1 1 16 THR CA   C  -3.153  10.645  17.125 1.00 . A A . 16 THR CA   1 1 
        3  2834 1 1 16 THR CB   C  -2.713  11.795  16.208 1.00 . A A . 16 THR CB   1 1 
        3  2835 1 1 16 THR CG2  C  -3.924  12.621  15.757 1.00 . A A . 16 THR CG2  1 1 
        3  2836 1 1 16 THR H    H  -4.454  10.010  15.600 1.00 . A A . 16 THR H    1 1 
        3  2837 1 1 16 THR HA   H  -2.264  10.138  17.471 1.00 . A A . 16 THR HA   1 1 
        3  2838 1 1 16 THR HB   H  -2.218  11.385  15.340 1.00 . A A . 16 THR HB   1 1 
        3  2839 1 1 16 THR HG1  H  -1.753  12.317  17.816 1.00 . A A . 16 THR HG1  1 1 
        3  2840 1 1 16 THR HG21 H  -3.731  13.045  14.781 1.00 . A A . 16 THR HG21 1 1 
        3  2841 1 1 16 THR HG22 H  -4.094  13.418  16.462 1.00 . A A . 16 THR HG22 1 1 
        3  2842 1 1 16 THR HG23 H  -4.799  11.991  15.707 1.00 . A A . 16 THR HG23 1 1 
        3  2843 1 1 16 THR N    N  -3.963   9.681  16.382 1.00 . A A . 16 THR N    1 1 
        3  2844 1 1 16 THR O    O  -3.266  11.578  19.338 1.00 . A A . 16 THR O    1 1 
        3  2845 1 1 16 THR OG1  O  -1.807  12.632  16.911 1.00 . A A . 16 THR OG1  1 1 
        3  2846 1 1 17 LEU C    C  -6.227  10.878  20.541 1.00 . A A . 17 LEU C    1 1 
        3  2847 1 1 17 LEU CA   C  -6.074  11.789  19.318 1.00 . A A . 17 LEU CA   1 1 
        3  2848 1 1 17 LEU CB   C  -7.472  12.121  18.728 1.00 . A A . 17 LEU CB   1 1 
        3  2849 1 1 17 LEU CD1  C  -6.563  14.101  17.457 1.00 . A A . 17 LEU CD1  1 1 
        3  2850 1 1 17 LEU CD2  C  -9.020  13.913  17.917 1.00 . A A . 17 LEU CD2  1 1 
        3  2851 1 1 17 LEU CG   C  -7.617  13.633  18.467 1.00 . A A . 17 LEU CG   1 1 
        3  2852 1 1 17 LEU H    H  -5.691  10.953  17.455 1.00 . A A . 17 LEU H    1 1 
        3  2853 1 1 17 LEU HA   H  -5.634  12.701  19.689 1.00 . A A . 17 LEU HA   1 1 
        3  2854 1 1 17 LEU HB2  H  -7.593  11.594  17.795 1.00 . A A . 17 LEU HB2  1 1 
        3  2855 1 1 17 LEU HB3  H  -8.251  11.809  19.411 1.00 . A A . 17 LEU HB3  1 1 
        3  2856 1 1 17 LEU HD11 H  -5.628  14.268  17.970 1.00 . A A . 17 LEU HD11 1 1 
        3  2857 1 1 17 LEU HD12 H  -6.884  15.024  16.994 1.00 . A A . 17 LEU HD12 1 1 
        3  2858 1 1 17 LEU HD13 H  -6.427  13.347  16.696 1.00 . A A . 17 LEU HD13 1 1 
        3  2859 1 1 17 LEU HD21 H  -9.741  13.846  18.718 1.00 . A A . 17 LEU HD21 1 1 
        3  2860 1 1 17 LEU HD22 H  -9.261  13.189  17.153 1.00 . A A . 17 LEU HD22 1 1 
        3  2861 1 1 17 LEU HD23 H  -9.048  14.906  17.492 1.00 . A A . 17 LEU HD23 1 1 
        3  2862 1 1 17 LEU HG   H  -7.483  14.168  19.395 1.00 . A A . 17 LEU HG   1 1 
        3  2863 1 1 17 LEU N    N  -5.217  11.253  18.260 1.00 . A A . 17 LEU N    1 1 
        3  2864 1 1 17 LEU O    O  -6.534  11.383  21.621 1.00 . A A . 17 LEU O    1 1 
        3  2865 1 1 18 VAL C    C  -5.305   9.192  22.712 1.00 . A A . 18 VAL C    1 1 
        3  2866 1 1 18 VAL CA   C  -6.260   8.741  21.610 1.00 . A A . 18 VAL CA   1 1 
        3  2867 1 1 18 VAL CB   C  -6.037   7.259  21.275 1.00 . A A . 18 VAL CB   1 1 
        3  2868 1 1 18 VAL CG1  C  -4.610   7.037  20.753 1.00 . A A . 18 VAL CG1  1 1 
        3  2869 1 1 18 VAL CG2  C  -6.262   6.419  22.536 1.00 . A A . 18 VAL CG2  1 1 
        3  2870 1 1 18 VAL H    H  -5.795   9.142  19.580 1.00 . A A . 18 VAL H    1 1 
        3  2871 1 1 18 VAL HA   H  -7.294   8.875  21.899 1.00 . A A . 18 VAL HA   1 1 
        3  2872 1 1 18 VAL HB   H  -6.744   6.958  20.514 1.00 . A A . 18 VAL HB   1 1 
        3  2873 1 1 18 VAL HG11 H  -4.326   7.858  20.112 1.00 . A A . 18 VAL HG11 1 1 
        3  2874 1 1 18 VAL HG12 H  -4.577   6.115  20.189 1.00 . A A . 18 VAL HG12 1 1 
        3  2875 1 1 18 VAL HG13 H  -3.922   6.971  21.583 1.00 . A A . 18 VAL HG13 1 1 
        3  2876 1 1 18 VAL HG21 H  -6.304   5.373  22.269 1.00 . A A . 18 VAL HG21 1 1 
        3  2877 1 1 18 VAL HG22 H  -7.191   6.710  23.002 1.00 . A A . 18 VAL HG22 1 1 
        3  2878 1 1 18 VAL HG23 H  -5.446   6.581  23.226 1.00 . A A . 18 VAL HG23 1 1 
        3  2879 1 1 18 VAL N    N  -6.063   9.564  20.423 1.00 . A A . 18 VAL N    1 1 
        3  2880 1 1 18 VAL O    O  -5.705   9.470  23.842 1.00 . A A . 18 VAL O    1 1 
        3  2881 1 1 19 ALA C    C  -3.141  10.987  23.850 1.00 . A A . 19 ALA C    1 1 
        3  2882 1 1 19 ALA CA   C  -2.949   9.589  23.263 1.00 . A A . 19 ALA CA   1 1 
        3  2883 1 1 19 ALA CB   C  -1.612   9.535  22.523 1.00 . A A . 19 ALA CB   1 1 
        3  2884 1 1 19 ALA H    H  -3.795   8.915  21.449 1.00 . A A . 19 ALA H    1 1 
        3  2885 1 1 19 ALA HA   H  -2.919   8.869  24.063 1.00 . A A . 19 ALA HA   1 1 
        3  2886 1 1 19 ALA HB1  H  -1.627  10.237  21.701 1.00 . A A . 19 ALA HB1  1 1 
        3  2887 1 1 19 ALA HB2  H  -1.452   8.538  22.141 1.00 . A A . 19 ALA HB2  1 1 
        3  2888 1 1 19 ALA HB3  H  -0.814   9.794  23.202 1.00 . A A . 19 ALA HB3  1 1 
        3  2889 1 1 19 ALA N    N  -4.025   9.220  22.351 1.00 . A A . 19 ALA N    1 1 
        3  2890 1 1 19 ALA O    O  -2.753  11.244  24.991 1.00 . A A . 19 ALA O    1 1 
        3  2891 1 1 20 LEU C    C  -4.986  13.190  24.746 1.00 . A A . 20 LEU C    1 1 
        3  2892 1 1 20 LEU CA   C  -3.997  13.232  23.579 1.00 . A A . 20 LEU CA   1 1 
        3  2893 1 1 20 LEU CB   C  -4.506  14.143  22.454 1.00 . A A . 20 LEU CB   1 1 
        3  2894 1 1 20 LEU CD1  C  -3.450  16.165  23.534 1.00 . A A . 20 LEU CD1  1 1 
        3  2895 1 1 20 LEU CD2  C  -5.277  16.437  21.832 1.00 . A A . 20 LEU CD2  1 1 
        3  2896 1 1 20 LEU CG   C  -4.756  15.565  22.982 1.00 . A A . 20 LEU CG   1 1 
        3  2897 1 1 20 LEU H    H  -4.096  11.601  22.208 1.00 . A A . 20 LEU H    1 1 
        3  2898 1 1 20 LEU HA   H  -3.075  13.625  23.980 1.00 . A A . 20 LEU HA   1 1 
        3  2899 1 1 20 LEU HB2  H  -3.770  14.179  21.665 1.00 . A A . 20 LEU HB2  1 1 
        3  2900 1 1 20 LEU HB3  H  -5.430  13.743  22.062 1.00 . A A . 20 LEU HB3  1 1 
        3  2901 1 1 20 LEU HD11 H  -2.612  15.824  22.942 1.00 . A A . 20 LEU HD11 1 1 
        3  2902 1 1 20 LEU HD12 H  -3.316  15.852  24.559 1.00 . A A . 20 LEU HD12 1 1 
        3  2903 1 1 20 LEU HD13 H  -3.499  17.245  23.497 1.00 . A A . 20 LEU HD13 1 1 
        3  2904 1 1 20 LEU HD21 H  -5.214  17.478  22.114 1.00 . A A . 20 LEU HD21 1 1 
        3  2905 1 1 20 LEU HD22 H  -6.305  16.182  21.623 1.00 . A A . 20 LEU HD22 1 1 
        3  2906 1 1 20 LEU HD23 H  -4.676  16.267  20.950 1.00 . A A . 20 LEU HD23 1 1 
        3  2907 1 1 20 LEU HG   H  -5.494  15.534  23.769 1.00 . A A . 20 LEU HG   1 1 
        3  2908 1 1 20 LEU N    N  -3.755  11.880  23.083 1.00 . A A . 20 LEU N    1 1 
        3  2909 1 1 20 LEU O    O  -4.769  13.842  25.768 1.00 . A A . 20 LEU O    1 1 
        3  2910 1 1 21 SER C    C  -6.481  11.423  26.804 1.00 . A A . 21 SER C    1 1 
        3  2911 1 1 21 SER CA   C  -7.038  12.301  25.686 1.00 . A A . 21 SER CA   1 1 
        3  2912 1 1 21 SER CB   C  -8.339  11.700  25.153 1.00 . A A . 21 SER CB   1 1 
        3  2913 1 1 21 SER H    H  -6.186  11.908  23.778 1.00 . A A . 21 SER H    1 1 
        3  2914 1 1 21 SER HA   H  -7.240  13.289  26.074 1.00 . A A . 21 SER HA   1 1 
        3  2915 1 1 21 SER HB2  H  -9.102  11.756  25.912 1.00 . A A . 21 SER HB2  1 1 
        3  2916 1 1 21 SER HB3  H  -8.659  12.257  24.282 1.00 . A A . 21 SER HB3  1 1 
        3  2917 1 1 21 SER HG   H  -7.239  10.095  25.094 1.00 . A A . 21 SER HG   1 1 
        3  2918 1 1 21 SER N    N  -6.056  12.413  24.607 1.00 . A A . 21 SER N    1 1 
        3  2919 1 1 21 SER O    O  -7.015  11.373  27.901 1.00 . A A . 21 SER O    1 1 
        3  2920 1 1 21 SER OG   O  -8.123  10.338  24.807 1.00 . A A . 21 SER OG   1 1 
        3  2921 1 1 22 SER C    C  -3.922  10.502  28.440 1.00 . A A . 22 SER C    1 1 
        3  2922 1 1 22 SER CA   C  -4.806   9.768  27.417 1.00 . A A . 22 SER CA   1 1 
        3  2923 1 1 22 SER CB   C  -3.918   8.794  26.643 1.00 . A A . 22 SER CB   1 1 
        3  2924 1 1 22 SER H    H  -5.123  10.764  25.545 1.00 . A A . 22 SER H    1 1 
        3  2925 1 1 22 SER HA   H  -5.594   9.192  27.876 1.00 . A A . 22 SER HA   1 1 
        3  2926 1 1 22 SER HB2  H  -4.441   8.439  25.771 1.00 . A A . 22 SER HB2  1 1 
        3  2927 1 1 22 SER HB3  H  -3.011   9.301  26.336 1.00 . A A . 22 SER HB3  1 1 
        3  2928 1 1 22 SER HG   H  -2.648   7.547  27.430 1.00 . A A . 22 SER HG   1 1 
        3  2929 1 1 22 SER N    N  -5.433  10.693  26.472 1.00 . A A . 22 SER N    1 1 
        3  2930 1 1 22 SER O    O  -3.574   9.964  29.491 1.00 . A A . 22 SER O    1 1 
        3  2931 1 1 22 SER OG   O  -3.596   7.689  27.477 1.00 . A A . 22 SER OG   1 1 
        3  2932 1 1 23 PHE C    C  -3.512  13.258  30.106 1.00 . A A . 23 PHE C    1 1 
        3  2933 1 1 23 PHE CA   C  -2.714  12.551  28.981 1.00 . A A . 23 PHE CA   1 1 
        3  2934 1 1 23 PHE CB   C  -1.908  13.577  28.162 1.00 . A A . 23 PHE CB   1 1 
        3  2935 1 1 23 PHE CD1  C  -0.675  11.640  27.074 1.00 . A A . 23 PHE CD1  1 1 
        3  2936 1 1 23 PHE CD2  C   0.541  13.680  27.560 1.00 . A A . 23 PHE CD2  1 1 
        3  2937 1 1 23 PHE CE1  C   0.487  11.074  26.536 1.00 . A A . 23 PHE CE1  1 1 
        3  2938 1 1 23 PHE CE2  C   1.704  13.114  27.023 1.00 . A A . 23 PHE CE2  1 1 
        3  2939 1 1 23 PHE CG   C  -0.648  12.943  27.586 1.00 . A A . 23 PHE CG   1 1 
        3  2940 1 1 23 PHE CZ   C   1.677  11.812  26.511 1.00 . A A . 23 PHE CZ   1 1 
        3  2941 1 1 23 PHE H    H  -3.990  12.072  27.271 1.00 . A A . 23 PHE H    1 1 
        3  2942 1 1 23 PHE HA   H  -2.029  11.902  29.508 1.00 . A A . 23 PHE HA   1 1 
        3  2943 1 1 23 PHE HB2  H  -2.520  13.944  27.352 1.00 . A A . 23 PHE HB2  1 1 
        3  2944 1 1 23 PHE HB3  H  -1.627  14.406  28.798 1.00 . A A . 23 PHE HB3  1 1 
        3  2945 1 1 23 PHE HD1  H  -1.586  11.068  27.089 1.00 . A A . 23 PHE HD1  1 1 
        3  2946 1 1 23 PHE HD2  H   0.563  14.685  27.955 1.00 . A A . 23 PHE HD2  1 1 
        3  2947 1 1 23 PHE HE1  H   0.466  10.069  26.141 1.00 . A A . 23 PHE HE1  1 1 
        3  2948 1 1 23 PHE HE2  H   2.618  13.686  27.002 1.00 . A A . 23 PHE HE2  1 1 
        3  2949 1 1 23 PHE HZ   H   2.573  11.377  26.094 1.00 . A A . 23 PHE HZ   1 1 
        3  2950 1 1 23 PHE N    N  -3.569  11.742  28.091 1.00 . A A . 23 PHE N    1 1 
        3  2951 1 1 23 PHE O    O  -3.013  13.321  31.229 1.00 . A A . 23 PHE O    1 1 
        3  2952 1 1 24 THR C    C  -5.939  13.643  32.063 1.00 . A A . 24 THR C    1 1 
        3  2953 1 1 24 THR CA   C  -5.414  14.548  30.922 1.00 . A A . 24 THR CA   1 1 
        3  2954 1 1 24 THR CB   C  -6.561  15.391  30.328 1.00 . A A . 24 THR CB   1 1 
        3  2955 1 1 24 THR CG2  C  -7.404  16.000  31.454 1.00 . A A . 24 THR CG2  1 1 
        3  2956 1 1 24 THR H    H  -5.042  13.919  28.938 1.00 . A A . 24 THR H    1 1 
        3  2957 1 1 24 THR HA   H  -4.705  15.241  31.351 1.00 . A A . 24 THR HA   1 1 
        3  2958 1 1 24 THR HB   H  -7.190  14.784  29.705 1.00 . A A . 24 THR HB   1 1 
        3  2959 1 1 24 THR HG1  H  -5.746  17.147  30.142 1.00 . A A . 24 THR HG1  1 1 
        3  2960 1 1 24 THR HG21 H  -6.752  16.440  32.194 1.00 . A A . 24 THR HG21 1 1 
        3  2961 1 1 24 THR HG22 H  -8.002  15.227  31.914 1.00 . A A . 24 THR HG22 1 1 
        3  2962 1 1 24 THR HG23 H  -8.052  16.762  31.047 1.00 . A A . 24 THR HG23 1 1 
        3  2963 1 1 24 THR N    N  -4.694  13.829  29.849 1.00 . A A . 24 THR N    1 1 
        3  2964 1 1 24 THR O    O  -5.938  14.052  33.224 1.00 . A A . 24 THR O    1 1 
        3  2965 1 1 24 THR OG1  O  -6.006  16.440  29.547 1.00 . A A . 24 THR OG1  1 1 
        3  2966 1 1 25 PRO C    C  -6.201  11.338  34.040 1.00 . A A . 25 PRO C    1 1 
        3  2967 1 1 25 PRO CA   C  -7.019  11.524  32.763 1.00 . A A . 25 PRO CA   1 1 
        3  2968 1 1 25 PRO CB   C  -7.121  10.209  31.989 1.00 . A A . 25 PRO CB   1 1 
        3  2969 1 1 25 PRO CD   C  -6.487  11.893  30.410 1.00 . A A . 25 PRO CD   1 1 
        3  2970 1 1 25 PRO CG   C  -7.342  10.639  30.584 1.00 . A A . 25 PRO CG   1 1 
        3  2971 1 1 25 PRO HA   H  -8.012  11.851  33.018 1.00 . A A . 25 PRO HA   1 1 
        3  2972 1 1 25 PRO HB2  H  -6.199   9.646  32.074 1.00 . A A . 25 PRO HB2  1 1 
        3  2973 1 1 25 PRO HB3  H  -7.958   9.623  32.338 1.00 . A A . 25 PRO HB3  1 1 
        3  2974 1 1 25 PRO HD2  H  -5.507  11.627  30.067 1.00 . A A . 25 PRO HD2  1 1 
        3  2975 1 1 25 PRO HD3  H  -6.955  12.584  29.739 1.00 . A A . 25 PRO HD3  1 1 
        3  2976 1 1 25 PRO HG2  H  -7.025   9.860  29.900 1.00 . A A . 25 PRO HG2  1 1 
        3  2977 1 1 25 PRO HG3  H  -8.383  10.879  30.423 1.00 . A A . 25 PRO HG3  1 1 
        3  2978 1 1 25 PRO N    N  -6.426  12.467  31.757 1.00 . A A . 25 PRO N    1 1 
        3  2979 1 1 25 PRO O    O  -6.768  10.987  35.067 1.00 . A A . 25 PRO O    1 1 
        3  2980 1 1 26 VAL C    C  -4.654  12.372  36.331 1.00 . A A . 26 VAL C    1 1 
        3  2981 1 1 26 VAL CA   C  -4.116  11.437  35.243 1.00 . A A . 26 VAL CA   1 1 
        3  2982 1 1 26 VAL CB   C  -2.644  11.754  34.966 1.00 . A A . 26 VAL CB   1 1 
        3  2983 1 1 26 VAL CG1  C  -2.491  13.243  34.652 1.00 . A A . 26 VAL CG1  1 1 
        3  2984 1 1 26 VAL CG2  C  -1.801  11.404  36.196 1.00 . A A . 26 VAL CG2  1 1 
        3  2985 1 1 26 VAL H    H  -4.453  11.915  33.210 1.00 . A A . 26 VAL H    1 1 
        3  2986 1 1 26 VAL HA   H  -4.195  10.428  35.619 1.00 . A A . 26 VAL HA   1 1 
        3  2987 1 1 26 VAL HB   H  -2.306  11.173  34.119 1.00 . A A . 26 VAL HB   1 1 
        3  2988 1 1 26 VAL HG11 H  -3.259  13.544  33.954 1.00 . A A . 26 VAL HG11 1 1 
        3  2989 1 1 26 VAL HG12 H  -1.519  13.422  34.217 1.00 . A A . 26 VAL HG12 1 1 
        3  2990 1 1 26 VAL HG13 H  -2.589  13.815  35.563 1.00 . A A . 26 VAL HG13 1 1 
        3  2991 1 1 26 VAL HG21 H  -1.836  10.338  36.364 1.00 . A A . 26 VAL HG21 1 1 
        3  2992 1 1 26 VAL HG22 H  -2.194  11.918  37.061 1.00 . A A . 26 VAL HG22 1 1 
        3  2993 1 1 26 VAL HG23 H  -0.779  11.709  36.030 1.00 . A A . 26 VAL HG23 1 1 
        3  2994 1 1 26 VAL N    N  -4.898  11.585  34.018 1.00 . A A . 26 VAL N    1 1 
        3  2995 1 1 26 VAL O    O  -4.745  11.989  37.492 1.00 . A A . 26 VAL O    1 1 
        3  2996 1 1 27 LEU C    C  -6.574  14.113  37.808 1.00 . A A . 27 LEU C    1 1 
        3  2997 1 1 27 LEU CA   C  -5.441  14.619  36.905 1.00 . A A . 27 LEU CA   1 1 
        3  2998 1 1 27 LEU CB   C  -5.940  15.836  36.110 1.00 . A A . 27 LEU CB   1 1 
        3  2999 1 1 27 LEU CD1  C  -5.271  17.416  37.961 1.00 . A A . 27 LEU CD1  1 1 
        3  3000 1 1 27 LEU CD2  C  -6.923  18.128  36.212 1.00 . A A . 27 LEU CD2  1 1 
        3  3001 1 1 27 LEU CG   C  -6.422  16.949  37.055 1.00 . A A . 27 LEU CG   1 1 
        3  3002 1 1 27 LEU H    H  -4.798  13.893  35.034 1.00 . A A . 27 LEU H    1 1 
        3  3003 1 1 27 LEU HA   H  -4.596  14.934  37.495 1.00 . A A . 27 LEU HA   1 1 
        3  3004 1 1 27 LEU HB2  H  -5.135  16.214  35.498 1.00 . A A . 27 LEU HB2  1 1 
        3  3005 1 1 27 LEU HB3  H  -6.757  15.532  35.473 1.00 . A A . 27 LEU HB3  1 1 
        3  3006 1 1 27 LEU HD11 H  -4.345  17.413  37.403 1.00 . A A . 27 LEU HD11 1 1 
        3  3007 1 1 27 LEU HD12 H  -5.185  16.749  38.806 1.00 . A A . 27 LEU HD12 1 1 
        3  3008 1 1 27 LEU HD13 H  -5.471  18.416  38.317 1.00 . A A . 27 LEU HD13 1 1 
        3  3009 1 1 27 LEU HD21 H  -7.144  18.965  36.858 1.00 . A A . 27 LEU HD21 1 1 
        3  3010 1 1 27 LEU HD22 H  -7.816  17.836  35.681 1.00 . A A . 27 LEU HD22 1 1 
        3  3011 1 1 27 LEU HD23 H  -6.159  18.413  35.503 1.00 . A A . 27 LEU HD23 1 1 
        3  3012 1 1 27 LEU HG   H  -7.233  16.582  37.667 1.00 . A A . 27 LEU HG   1 1 
        3  3013 1 1 27 LEU N    N  -4.966  13.606  35.957 1.00 . A A . 27 LEU N    1 1 
        3  3014 1 1 27 LEU O    O  -6.760  14.617  38.916 1.00 . A A . 27 LEU O    1 1 
        3  3015 1 1 28 VAL C    C  -7.980  11.775  39.306 1.00 . A A . 28 VAL C    1 1 
        3  3016 1 1 28 VAL CA   C  -8.456  12.590  38.098 1.00 . A A . 28 VAL CA   1 1 
        3  3017 1 1 28 VAL CB   C  -9.334  11.702  37.196 1.00 . A A . 28 VAL CB   1 1 
        3  3018 1 1 28 VAL CG1  C  -9.538  12.404  35.847 1.00 . A A . 28 VAL CG1  1 1 
        3  3019 1 1 28 VAL CG2  C  -8.686  10.312  36.987 1.00 . A A . 28 VAL CG2  1 1 
        3  3020 1 1 28 VAL H    H  -7.129  12.748  36.456 1.00 . A A . 28 VAL H    1 1 
        3  3021 1 1 28 VAL HA   H  -9.061  13.415  38.446 1.00 . A A . 28 VAL HA   1 1 
        3  3022 1 1 28 VAL HB   H -10.301  11.579  37.668 1.00 . A A . 28 VAL HB   1 1 
        3  3023 1 1 28 VAL HG11 H  -8.583  12.533  35.361 1.00 . A A . 28 VAL HG11 1 1 
        3  3024 1 1 28 VAL HG12 H  -9.994  13.369  36.009 1.00 . A A . 28 VAL HG12 1 1 
        3  3025 1 1 28 VAL HG13 H -10.181  11.802  35.222 1.00 . A A . 28 VAL HG13 1 1 
        3  3026 1 1 28 VAL HG21 H  -9.070   9.623  37.727 1.00 . A A . 28 VAL HG21 1 1 
        3  3027 1 1 28 VAL HG22 H  -7.616  10.383  37.096 1.00 . A A . 28 VAL HG22 1 1 
        3  3028 1 1 28 VAL HG23 H  -8.921   9.937  35.999 1.00 . A A . 28 VAL HG23 1 1 
        3  3029 1 1 28 VAL N    N  -7.335  13.138  37.331 1.00 . A A . 28 VAL N    1 1 
        3  3030 1 1 28 VAL O    O  -8.669  11.690  40.323 1.00 . A A . 28 VAL O    1 1 
        3  3031 1 1 29 ILE C    C  -6.052  11.194  41.533 1.00 . A A . 29 ILE C    1 1 
        3  3032 1 1 29 ILE CA   C  -6.238  10.367  40.259 1.00 . A A . 29 ILE CA   1 1 
        3  3033 1 1 29 ILE CB   C  -4.892   9.749  39.824 1.00 . A A . 29 ILE CB   1 1 
        3  3034 1 1 29 ILE CD1  C  -3.331   7.823  40.167 1.00 . A A . 29 ILE CD1  1 1 
        3  3035 1 1 29 ILE CG1  C  -4.553   8.552  40.729 1.00 . A A . 29 ILE CG1  1 1 
        3  3036 1 1 29 ILE CG2  C  -3.760  10.795  39.922 1.00 . A A . 29 ILE CG2  1 1 
        3  3037 1 1 29 ILE H    H  -6.278  11.342  38.366 1.00 . A A . 29 ILE H    1 1 
        3  3038 1 1 29 ILE HA   H  -6.925   9.576  40.515 1.00 . A A . 29 ILE HA   1 1 
        3  3039 1 1 29 ILE HB   H  -4.975   9.410  38.801 1.00 . A A . 29 ILE HB   1 1 
        3  3040 1 1 29 ILE HD11 H  -2.484   8.493  40.157 1.00 . A A . 29 ILE HD11 1 1 
        3  3041 1 1 29 ILE HD12 H  -3.540   7.493  39.161 1.00 . A A . 29 ILE HD12 1 1 
        3  3042 1 1 29 ILE HD13 H  -3.105   6.967  40.787 1.00 . A A . 29 ILE HD13 1 1 
        3  3043 1 1 29 ILE HG12 H  -4.335   8.905  41.727 1.00 . A A . 29 ILE HG12 1 1 
        3  3044 1 1 29 ILE HG13 H  -5.389   7.870  40.762 1.00 . A A . 29 ILE HG13 1 1 
        3  3045 1 1 29 ILE HG21 H  -2.983  10.553  39.212 1.00 . A A . 29 ILE HG21 1 1 
        3  3046 1 1 29 ILE HG22 H  -3.343  10.793  40.920 1.00 . A A . 29 ILE HG22 1 1 
        3  3047 1 1 29 ILE HG23 H  -4.149  11.778  39.706 1.00 . A A . 29 ILE HG23 1 1 
        3  3048 1 1 29 ILE N    N  -6.800  11.177  39.178 1.00 . A A . 29 ILE N    1 1 
        3  3049 1 1 29 ILE O    O  -6.243  10.673  42.630 1.00 . A A . 29 ILE O    1 1 
        3  3050 1 1 30 LEU C    C  -6.779  13.319  43.439 1.00 . A A . 30 LEU C    1 1 
        3  3051 1 1 30 LEU CA   C  -5.497  13.281  42.611 1.00 . A A . 30 LEU CA   1 1 
        3  3052 1 1 30 LEU CB   C  -5.079  14.704  42.211 1.00 . A A . 30 LEU CB   1 1 
        3  3053 1 1 30 LEU CD1  C  -3.833  15.027  44.383 1.00 . A A . 30 LEU CD1  1 1 
        3  3054 1 1 30 LEU CD2  C  -4.517  17.005  43.000 1.00 . A A . 30 LEU CD2  1 1 
        3  3055 1 1 30 LEU CG   C  -4.918  15.596  43.454 1.00 . A A . 30 LEU CG   1 1 
        3  3056 1 1 30 LEU H    H  -5.530  12.867  40.534 1.00 . A A . 30 LEU H    1 1 
        3  3057 1 1 30 LEU HA   H  -4.737  12.854  43.245 1.00 . A A . 30 LEU HA   1 1 
        3  3058 1 1 30 LEU HB2  H  -4.140  14.662  41.680 1.00 . A A . 30 LEU HB2  1 1 
        3  3059 1 1 30 LEU HB3  H  -5.835  15.128  41.566 1.00 . A A . 30 LEU HB3  1 1 
        3  3060 1 1 30 LEU HD11 H  -3.433  15.817  45.005 1.00 . A A . 30 LEU HD11 1 1 
        3  3061 1 1 30 LEU HD12 H  -3.035  14.597  43.794 1.00 . A A . 30 LEU HD12 1 1 
        3  3062 1 1 30 LEU HD13 H  -4.265  14.264  45.015 1.00 . A A . 30 LEU HD13 1 1 
        3  3063 1 1 30 LEU HD21 H  -5.304  17.426  42.392 1.00 . A A . 30 LEU HD21 1 1 
        3  3064 1 1 30 LEU HD22 H  -3.606  16.951  42.421 1.00 . A A . 30 LEU HD22 1 1 
        3  3065 1 1 30 LEU HD23 H  -4.356  17.630  43.865 1.00 . A A . 30 LEU HD23 1 1 
        3  3066 1 1 30 LEU HG   H  -5.855  15.650  43.988 1.00 . A A . 30 LEU HG   1 1 
        3  3067 1 1 30 LEU N    N  -5.686  12.467  41.414 1.00 . A A . 30 LEU N    1 1 
        3  3068 1 1 30 LEU O    O  -6.730  13.080  44.646 1.00 . A A . 30 LEU O    1 1 
        3  3069 1 1 31 LEU C    C  -9.384  12.397  44.340 1.00 . A A . 31 LEU C    1 1 
        3  3070 1 1 31 LEU CA   C  -9.148  13.720  43.614 1.00 . A A . 31 LEU CA   1 1 
        3  3071 1 1 31 LEU CB   C -10.324  13.982  42.662 1.00 . A A . 31 LEU CB   1 1 
        3  3072 1 1 31 LEU CD1  C  -9.070  15.812  41.489 1.00 . A A . 31 LEU CD1  1 1 
        3  3073 1 1 31 LEU CD2  C -11.567  15.712  41.353 1.00 . A A . 31 LEU CD2  1 1 
        3  3074 1 1 31 LEU CG   C -10.353  15.460  42.251 1.00 . A A . 31 LEU CG   1 1 
        3  3075 1 1 31 LEU H    H  -7.936  13.909  41.895 1.00 . A A . 31 LEU H    1 1 
        3  3076 1 1 31 LEU HA   H  -9.062  14.557  44.292 1.00 . A A . 31 LEU HA   1 1 
        3  3077 1 1 31 LEU HB2  H -10.214  13.369  41.780 1.00 . A A . 31 LEU HB2  1 1 
        3  3078 1 1 31 LEU HB3  H -11.253  13.734  43.155 1.00 . A A . 31 LEU HB3  1 1 
        3  3079 1 1 31 LEU HD11 H  -9.214  16.736  40.947 1.00 . A A . 31 LEU HD11 1 1 
        3  3080 1 1 31 LEU HD12 H  -8.835  15.020  40.793 1.00 . A A . 31 LEU HD12 1 1 
        3  3081 1 1 31 LEU HD13 H  -8.257  15.930  42.189 1.00 . A A . 31 LEU HD13 1 1 
        3  3082 1 1 31 LEU HD21 H -11.595  16.754  41.070 1.00 . A A . 31 LEU HD21 1 1 
        3  3083 1 1 31 LEU HD22 H -12.470  15.460  41.890 1.00 . A A . 31 LEU HD22 1 1 
        3  3084 1 1 31 LEU HD23 H -11.493  15.099  40.466 1.00 . A A . 31 LEU HD23 1 1 
        3  3085 1 1 31 LEU HG   H -10.424  16.076  43.136 1.00 . A A . 31 LEU HG   1 1 
        3  3086 1 1 31 LEU N    N  -7.915  13.642  42.838 1.00 . A A . 31 LEU N    1 1 
        3  3087 1 1 31 LEU O    O  -9.769  12.358  45.509 1.00 . A A . 31 LEU O    1 1 
        3  3088 1 1 32 GLY C    C  -8.265   9.778  45.318 1.00 . A A . 32 GLY C    1 1 
        3  3089 1 1 32 GLY CA   C  -9.242   9.973  44.162 1.00 . A A . 32 GLY CA   1 1 
        3  3090 1 1 32 GLY H    H  -8.755  11.469  42.713 1.00 . A A . 32 GLY H    1 1 
        3  3091 1 1 32 GLY HA2  H -10.254   9.830  44.516 1.00 . A A . 32 GLY HA2  1 1 
        3  3092 1 1 32 GLY HA3  H  -9.027   9.250  43.390 1.00 . A A . 32 GLY HA3  1 1 
        3  3093 1 1 32 GLY N    N  -9.107  11.319  43.616 1.00 . A A . 32 GLY N    1 1 
        3  3094 1 1 32 GLY O    O  -8.628   9.283  46.380 1.00 . A A . 32 GLY O    1 1 
        3  3095 1 1 33 VAL C    C  -6.615  10.883  47.382 1.00 . A A . 33 VAL C    1 1 
        3  3096 1 1 33 VAL CA   C  -6.032  10.149  46.171 1.00 . A A . 33 VAL CA   1 1 
        3  3097 1 1 33 VAL CB   C  -4.707  10.787  45.736 1.00 . A A . 33 VAL CB   1 1 
        3  3098 1 1 33 VAL CG1  C  -3.783  10.929  46.950 1.00 . A A . 33 VAL CG1  1 1 
        3  3099 1 1 33 VAL CG2  C  -4.027   9.897  44.686 1.00 . A A . 33 VAL CG2  1 1 
        3  3100 1 1 33 VAL H    H  -6.880  10.671  44.244 1.00 . A A . 33 VAL H    1 1 
        3  3101 1 1 33 VAL HA   H  -5.868   9.116  46.446 1.00 . A A . 33 VAL HA   1 1 
        3  3102 1 1 33 VAL HB   H  -4.899  11.763  45.315 1.00 . A A . 33 VAL HB   1 1 
        3  3103 1 1 33 VAL HG11 H  -4.128  11.740  47.574 1.00 . A A . 33 VAL HG11 1 1 
        3  3104 1 1 33 VAL HG12 H  -2.777  11.135  46.615 1.00 . A A . 33 VAL HG12 1 1 
        3  3105 1 1 33 VAL HG13 H  -3.790  10.010  47.518 1.00 . A A . 33 VAL HG13 1 1 
        3  3106 1 1 33 VAL HG21 H  -3.296  10.477  44.142 1.00 . A A . 33 VAL HG21 1 1 
        3  3107 1 1 33 VAL HG22 H  -4.765   9.515  43.998 1.00 . A A . 33 VAL HG22 1 1 
        3  3108 1 1 33 VAL HG23 H  -3.534   9.068  45.175 1.00 . A A . 33 VAL HG23 1 1 
        3  3109 1 1 33 VAL N    N  -7.033  10.230  45.105 1.00 . A A . 33 VAL N    1 1 
        3  3110 1 1 33 VAL O    O  -6.632  10.355  48.493 1.00 . A A . 33 VAL O    1 1 
        3  3111 1 1 34 VAL C    C  -8.842  12.131  48.834 1.00 . A A . 34 VAL C    1 1 
        3  3112 1 1 34 VAL CA   C  -7.664  12.900  48.233 1.00 . A A . 34 VAL CA   1 1 
        3  3113 1 1 34 VAL CB   C  -8.145  14.249  47.690 1.00 . A A . 34 VAL CB   1 1 
        3  3114 1 1 34 VAL CG1  C  -8.943  14.988  48.768 1.00 . A A . 34 VAL CG1  1 1 
        3  3115 1 1 34 VAL CG2  C  -6.935  15.093  47.283 1.00 . A A . 34 VAL CG2  1 1 
        3  3116 1 1 34 VAL H    H  -6.947  12.490  46.261 1.00 . A A . 34 VAL H    1 1 
        3  3117 1 1 34 VAL HA   H  -6.887  13.070  48.965 1.00 . A A . 34 VAL HA   1 1 
        3  3118 1 1 34 VAL HB   H  -8.776  14.083  46.828 1.00 . A A . 34 VAL HB   1 1 
        3  3119 1 1 34 VAL HG11 H  -9.917  14.534  48.870 1.00 . A A . 34 VAL HG11 1 1 
        3  3120 1 1 34 VAL HG12 H  -9.057  16.025  48.485 1.00 . A A . 34 VAL HG12 1 1 
        3  3121 1 1 34 VAL HG13 H  -8.417  14.927  49.710 1.00 . A A . 34 VAL HG13 1 1 
        3  3122 1 1 34 VAL HG21 H  -7.273  15.983  46.772 1.00 . A A . 34 VAL HG21 1 1 
        3  3123 1 1 34 VAL HG22 H  -6.300  14.520  46.626 1.00 . A A . 34 VAL HG22 1 1 
        3  3124 1 1 34 VAL HG23 H  -6.380  15.375  48.165 1.00 . A A . 34 VAL HG23 1 1 
        3  3125 1 1 34 VAL N    N  -7.087  12.104  47.151 1.00 . A A . 34 VAL N    1 1 
        3  3126 1 1 34 VAL O    O  -9.032  12.063  50.046 1.00 . A A . 34 VAL O    1 1 
        3  3127 1 1 35 GLY C    C -10.307   9.607  49.231 1.00 . A A . 35 GLY C    1 1 
        3  3128 1 1 35 GLY CA   C -10.771  10.753  48.333 1.00 . A A . 35 GLY CA   1 1 
        3  3129 1 1 35 GLY H    H  -9.346  11.669  46.999 1.00 . A A . 35 GLY H    1 1 
        3  3130 1 1 35 GLY HA2  H -11.468  11.380  48.871 1.00 . A A . 35 GLY HA2  1 1 
        3  3131 1 1 35 GLY HA3  H -11.250  10.346  47.455 1.00 . A A . 35 GLY HA3  1 1 
        3  3132 1 1 35 GLY N    N  -9.613  11.545  47.934 1.00 . A A . 35 GLY N    1 1 
        3  3133 1 1 35 GLY O    O -10.887   9.346  50.285 1.00 . A A . 35 GLY O    1 1 
        3  3134 1 1 36 LEU C    C  -7.939   8.339  50.802 1.00 . A A . 36 LEU C    1 1 
        3  3135 1 1 36 LEU CA   C  -8.648   7.837  49.543 1.00 . A A . 36 LEU CA   1 1 
        3  3136 1 1 36 LEU CB   C  -7.638   7.101  48.658 1.00 . A A . 36 LEU CB   1 1 
        3  3137 1 1 36 LEU CD1  C  -7.325   5.831  46.527 1.00 . A A . 36 LEU CD1  1 1 
        3  3138 1 1 36 LEU CD2  C  -9.200   5.190  48.078 1.00 . A A . 36 LEU CD2  1 1 
        3  3139 1 1 36 LEU CG   C  -8.364   6.364  47.520 1.00 . A A . 36 LEU CG   1 1 
        3  3140 1 1 36 LEU H    H  -8.835   9.222  47.954 1.00 . A A . 36 LEU H    1 1 
        3  3141 1 1 36 LEU HA   H  -9.432   7.148  49.811 1.00 . A A . 36 LEU HA   1 1 
        3  3142 1 1 36 LEU HB2  H  -6.948   7.818  48.235 1.00 . A A . 36 LEU HB2  1 1 
        3  3143 1 1 36 LEU HB3  H  -7.088   6.388  49.254 1.00 . A A . 36 LEU HB3  1 1 
        3  3144 1 1 36 LEU HD11 H  -6.707   6.647  46.181 1.00 . A A . 36 LEU HD11 1 1 
        3  3145 1 1 36 LEU HD12 H  -7.830   5.379  45.686 1.00 . A A . 36 LEU HD12 1 1 
        3  3146 1 1 36 LEU HD13 H  -6.706   5.092  47.015 1.00 . A A . 36 LEU HD13 1 1 
        3  3147 1 1 36 LEU HD21 H  -9.297   4.420  47.325 1.00 . A A . 36 LEU HD21 1 1 
        3  3148 1 1 36 LEU HD22 H -10.183   5.544  48.345 1.00 . A A . 36 LEU HD22 1 1 
        3  3149 1 1 36 LEU HD23 H  -8.719   4.776  48.952 1.00 . A A . 36 LEU HD23 1 1 
        3  3150 1 1 36 LEU HG   H  -9.017   7.057  47.010 1.00 . A A . 36 LEU HG   1 1 
        3  3151 1 1 36 LEU N    N  -9.239   8.946  48.798 1.00 . A A . 36 LEU N    1 1 
        3  3152 1 1 36 LEU O    O  -7.919   7.668  51.835 1.00 . A A . 36 LEU O    1 1 
        3  3153 1 1 37 SER C    C  -7.764  10.339  52.958 1.00 . A A . 37 SER C    1 1 
        3  3154 1 1 37 SER CA   C  -6.724  10.159  51.857 1.00 . A A . 37 SER CA   1 1 
        3  3155 1 1 37 SER CB   C  -6.089  11.505  51.491 1.00 . A A . 37 SER CB   1 1 
        3  3156 1 1 37 SER H    H  -7.544  10.049  49.876 1.00 . A A . 37 SER H    1 1 
        3  3157 1 1 37 SER HA   H  -5.962   9.492  52.231 1.00 . A A . 37 SER HA   1 1 
        3  3158 1 1 37 SER HB2  H  -5.462  11.838  52.300 1.00 . A A . 37 SER HB2  1 1 
        3  3159 1 1 37 SER HB3  H  -5.487  11.383  50.600 1.00 . A A . 37 SER HB3  1 1 
        3  3160 1 1 37 SER HG   H  -6.718  13.196  50.770 1.00 . A A . 37 SER HG   1 1 
        3  3161 1 1 37 SER N    N  -7.391   9.551  50.706 1.00 . A A . 37 SER N    1 1 
        3  3162 1 1 37 SER O    O  -7.500  10.130  54.116 1.00 . A A . 37 SER O    1 1 
        3  3163 1 1 37 SER OG   O  -7.105  12.468  51.262 1.00 . A A . 37 SER OG   1 1 
        3  3164 1 1 38 ALA C    C -10.236   9.514  54.299 1.00 . A A . 38 ALA C    1 1 
        3  3165 1 1 38 ALA CA   C -10.035  10.839  53.548 1.00 . A A . 38 ALA CA   1 1 
        3  3166 1 1 38 ALA CB   C -11.332  11.271  52.863 1.00 . A A . 38 ALA CB   1 1 
        3  3167 1 1 38 ALA H    H  -9.100  10.837  51.612 1.00 . A A . 38 ALA H    1 1 
        3  3168 1 1 38 ALA HA   H  -9.770  11.559  54.310 1.00 . A A . 38 ALA HA   1 1 
        3  3169 1 1 38 ALA HB1  H -11.139  12.134  52.242 1.00 . A A . 38 ALA HB1  1 1 
        3  3170 1 1 38 ALA HB2  H -12.070  11.523  53.611 1.00 . A A . 38 ALA HB2  1 1 
        3  3171 1 1 38 ALA HB3  H -11.703  10.462  52.251 1.00 . A A . 38 ALA HB3  1 1 
        3  3172 1 1 38 ALA N    N  -8.962  10.686  52.571 1.00 . A A . 38 ALA N    1 1 
        3  3173 1 1 38 ALA O    O -10.501   9.509  55.501 1.00 . A A . 38 ALA O    1 1 
        3  3174 1 1 39 LEU C    C  -8.999   6.735  55.115 1.00 . A A . 39 LEU C    1 1 
        3  3175 1 1 39 LEU CA   C -10.235   7.096  54.247 1.00 . A A . 39 LEU CA   1 1 
        3  3176 1 1 39 LEU CB   C -10.455   6.013  53.180 1.00 . A A . 39 LEU CB   1 1 
        3  3177 1 1 39 LEU CD1  C -11.857   4.645  54.772 1.00 . A A . 39 LEU CD1  1 1 
        3  3178 1 1 39 LEU CD2  C -10.846   3.587  52.734 1.00 . A A . 39 LEU CD2  1 1 
        3  3179 1 1 39 LEU CG   C -10.636   4.632  53.834 1.00 . A A . 39 LEU CG   1 1 
        3  3180 1 1 39 LEU H    H  -9.832   8.519  52.654 1.00 . A A . 39 LEU H    1 1 
        3  3181 1 1 39 LEU HA   H -11.105   7.133  54.882 1.00 . A A . 39 LEU HA   1 1 
        3  3182 1 1 39 LEU HB2  H -11.338   6.254  52.606 1.00 . A A . 39 LEU HB2  1 1 
        3  3183 1 1 39 LEU HB3  H  -9.599   5.983  52.521 1.00 . A A . 39 LEU HB3  1 1 
        3  3184 1 1 39 LEU HD11 H -11.565   5.031  55.736 1.00 . A A . 39 LEU HD11 1 1 
        3  3185 1 1 39 LEU HD12 H -12.235   3.638  54.893 1.00 . A A . 39 LEU HD12 1 1 
        3  3186 1 1 39 LEU HD13 H -12.632   5.270  54.353 1.00 . A A . 39 LEU HD13 1 1 
        3  3187 1 1 39 LEU HD21 H -11.810   3.741  52.271 1.00 . A A . 39 LEU HD21 1 1 
        3  3188 1 1 39 LEU HD22 H -10.808   2.598  53.164 1.00 . A A . 39 LEU HD22 1 1 
        3  3189 1 1 39 LEU HD23 H -10.069   3.686  51.989 1.00 . A A . 39 LEU HD23 1 1 
        3  3190 1 1 39 LEU HG   H  -9.752   4.380  54.401 1.00 . A A . 39 LEU HG   1 1 
        3  3191 1 1 39 LEU N    N -10.086   8.405  53.594 1.00 . A A . 39 LEU N    1 1 
        3  3192 1 1 39 LEU O    O  -9.134   6.348  56.275 1.00 . A A . 39 LEU O    1 1 
        3  3193 1 1 40 THR C    C  -5.749   7.654  55.723 1.00 . A A . 40 THR C    1 1 
        3  3194 1 1 40 THR CA   C  -6.545   6.447  55.194 1.00 . A A . 40 THR CA   1 1 
        3  3195 1 1 40 THR CB   C  -5.654   5.699  54.201 1.00 . A A . 40 THR CB   1 1 
        3  3196 1 1 40 THR CG2  C  -6.382   4.454  53.693 1.00 . A A . 40 THR CG2  1 1 
        3  3197 1 1 40 THR H    H  -7.829   7.070  53.561 1.00 . A A . 40 THR H    1 1 
        3  3198 1 1 40 THR HA   H  -6.773   5.764  55.999 1.00 . A A . 40 THR HA   1 1 
        3  3199 1 1 40 THR HB   H  -4.740   5.400  54.692 1.00 . A A . 40 THR HB   1 1 
        3  3200 1 1 40 THR HG1  H  -5.401   6.029  52.301 1.00 . A A . 40 THR HG1  1 1 
        3  3201 1 1 40 THR HG21 H  -6.539   3.769  54.513 1.00 . A A . 40 THR HG21 1 1 
        3  3202 1 1 40 THR HG22 H  -5.785   3.974  52.931 1.00 . A A . 40 THR HG22 1 1 
        3  3203 1 1 40 THR HG23 H  -7.337   4.739  53.276 1.00 . A A . 40 THR HG23 1 1 
        3  3204 1 1 40 THR N    N  -7.811   6.820  54.509 1.00 . A A . 40 THR N    1 1 
        3  3205 1 1 40 THR O    O  -4.734   7.493  56.401 1.00 . A A . 40 THR O    1 1 
        3  3206 1 1 40 THR OG1  O  -5.348   6.550  53.105 1.00 . A A . 40 THR OG1  1 1 
        3  3207 1 1 41 GLY C    C  -4.202  10.263  55.621 1.00 . A A . 41 GLY C    1 1 
        3  3208 1 1 41 GLY CA   C  -5.662  10.063  56.016 1.00 . A A . 41 GLY CA   1 1 
        3  3209 1 1 41 GLY H    H  -7.177   8.851  55.106 1.00 . A A . 41 GLY H    1 1 
        3  3210 1 1 41 GLY HA2  H  -6.223  10.923  55.696 1.00 . A A . 41 GLY HA2  1 1 
        3  3211 1 1 41 GLY HA3  H  -5.712  10.012  57.094 1.00 . A A . 41 GLY HA3  1 1 
        3  3212 1 1 41 GLY N    N  -6.271   8.837  55.479 1.00 . A A . 41 GLY N    1 1 
        3  3213 1 1 41 GLY O    O  -3.310  10.085  56.450 1.00 . A A . 41 GLY O    1 1 
        3  3214 1 1 42 TYR C    C  -2.389  12.417  53.689 1.00 . A A . 42 TYR C    1 1 
        3  3215 1 1 42 TYR CA   C  -2.578  10.912  53.913 1.00 . A A . 42 TYR CA   1 1 
        3  3216 1 1 42 TYR CB   C  -2.342  10.135  52.587 1.00 . A A . 42 TYR CB   1 1 
        3  3217 1 1 42 TYR CD1  C  -1.375   8.149  53.815 1.00 . A A . 42 TYR CD1  1 1 
        3  3218 1 1 42 TYR CD2  C  -0.150   9.051  51.926 1.00 . A A . 42 TYR CD2  1 1 
        3  3219 1 1 42 TYR CE1  C  -0.375   7.187  54.004 1.00 . A A . 42 TYR CE1  1 1 
        3  3220 1 1 42 TYR CE2  C   0.849   8.089  52.115 1.00 . A A . 42 TYR CE2  1 1 
        3  3221 1 1 42 TYR CG   C  -1.262   9.081  52.776 1.00 . A A . 42 TYR CG   1 1 
        3  3222 1 1 42 TYR CZ   C   0.737   7.157  53.153 1.00 . A A . 42 TYR CZ   1 1 
        3  3223 1 1 42 TYR H    H  -4.659  10.803  53.720 1.00 . A A . 42 TYR H    1 1 
        3  3224 1 1 42 TYR HA   H  -1.858  10.577  54.646 1.00 . A A . 42 TYR HA   1 1 
        3  3225 1 1 42 TYR HB2  H  -3.260   9.645  52.297 1.00 . A A . 42 TYR HB2  1 1 
        3  3226 1 1 42 TYR HB3  H  -2.044  10.816  51.800 1.00 . A A . 42 TYR HB3  1 1 
        3  3227 1 1 42 TYR HD1  H  -2.232   8.171  54.471 1.00 . A A . 42 TYR HD1  1 1 
        3  3228 1 1 42 TYR HD2  H  -0.064   9.770  51.125 1.00 . A A . 42 TYR HD2  1 1 
        3  3229 1 1 42 TYR HE1  H  -0.461   6.468  54.804 1.00 . A A . 42 TYR HE1  1 1 
        3  3230 1 1 42 TYR HE2  H   1.707   8.066  51.458 1.00 . A A . 42 TYR HE2  1 1 
        3  3231 1 1 42 TYR HH   H   1.670   5.900  54.246 1.00 . A A . 42 TYR HH   1 1 
        3  3232 1 1 42 TYR N    N  -3.945  10.662  54.376 1.00 . A A . 42 TYR N    1 1 
        3  3233 1 1 42 TYR O    O  -1.495  12.839  52.955 1.00 . A A . 42 TYR O    1 1 
        3  3234 1 1 42 TYR OH   O   1.723   6.209  53.339 1.00 . A A . 42 TYR OH   1 1 
        3  3235 1 1 43 LEU C    C  -1.800  15.244  54.324 1.00 . A A . 43 LEU C    1 1 
        3  3236 1 1 43 LEU CA   C  -3.216  14.669  54.199 1.00 . A A . 43 LEU CA   1 1 
        3  3237 1 1 43 LEU CB   C  -4.025  15.205  55.403 1.00 . A A . 43 LEU CB   1 1 
        3  3238 1 1 43 LEU CD1  C  -5.419  17.076  56.300 1.00 . A A . 43 LEU CD1  1 1 
        3  3239 1 1 43 LEU CD2  C  -3.297  17.599  55.064 1.00 . A A . 43 LEU CD2  1 1 
        3  3240 1 1 43 LEU CG   C  -4.502  16.647  55.149 1.00 . A A . 43 LEU CG   1 1 
        3  3241 1 1 43 LEU H    H  -3.945  12.831  54.894 1.00 . A A . 43 LEU H    1 1 
        3  3242 1 1 43 LEU HA   H  -3.740  15.015  53.320 1.00 . A A . 43 LEU HA   1 1 
        3  3243 1 1 43 LEU HB2  H  -4.887  14.575  55.554 1.00 . A A . 43 LEU HB2  1 1 
        3  3244 1 1 43 LEU HB3  H  -3.415  15.185  56.296 1.00 . A A . 43 LEU HB3  1 1 
        3  3245 1 1 43 LEU HD11 H  -6.191  16.335  56.441 1.00 . A A . 43 LEU HD11 1 1 
        3  3246 1 1 43 LEU HD12 H  -5.872  18.027  56.065 1.00 . A A . 43 LEU HD12 1 1 
        3  3247 1 1 43 LEU HD13 H  -4.838  17.169  57.206 1.00 . A A . 43 LEU HD13 1 1 
        3  3248 1 1 43 LEU HD21 H  -2.540  17.293  55.772 1.00 . A A . 43 LEU HD21 1 1 
        3  3249 1 1 43 LEU HD22 H  -3.614  18.609  55.292 1.00 . A A . 43 LEU HD22 1 1 
        3  3250 1 1 43 LEU HD23 H  -2.889  17.574  54.065 1.00 . A A . 43 LEU HD23 1 1 
        3  3251 1 1 43 LEU HG   H  -5.060  16.684  54.224 1.00 . A A . 43 LEU HG   1 1 
        3  3252 1 1 43 LEU N    N  -3.250  13.213  54.318 1.00 . A A . 43 LEU N    1 1 
        3  3253 1 1 43 LEU O    O  -1.294  15.897  53.413 1.00 . A A . 43 LEU O    1 1 
        3  3254 1 1 44 ASP C    C   1.151  14.801  54.755 1.00 . A A . 44 ASP C    1 1 
        3  3255 1 1 44 ASP CA   C   0.177  15.463  55.727 1.00 . A A . 44 ASP CA   1 1 
        3  3256 1 1 44 ASP CB   C   0.615  15.162  57.159 1.00 . A A . 44 ASP CB   1 1 
        3  3257 1 1 44 ASP CG   C  -0.147  16.010  58.171 1.00 . A A . 44 ASP CG   1 1 
        3  3258 1 1 44 ASP H    H  -1.657  14.424  56.120 1.00 . A A . 44 ASP H    1 1 
        3  3259 1 1 44 ASP HA   H   0.209  16.523  55.533 1.00 . A A . 44 ASP HA   1 1 
        3  3260 1 1 44 ASP HB2  H   0.437  14.118  57.369 1.00 . A A . 44 ASP HB2  1 1 
        3  3261 1 1 44 ASP HB3  H   1.672  15.364  57.253 1.00 . A A . 44 ASP HB3  1 1 
        3  3262 1 1 44 ASP N    N  -1.180  14.983  55.470 1.00 . A A . 44 ASP N    1 1 
        3  3263 1 1 44 ASP O    O   2.096  15.434  54.282 1.00 . A A . 44 ASP O    1 1 
        3  3264 1 1 44 ASP OD1  O  -0.779  16.976  57.778 1.00 . A A . 44 ASP OD1  1 1 
        3  3265 1 1 44 ASP OD2  O  -0.086  15.665  59.340 1.00 . A A . 44 ASP OD2  1 1 
        3  3266 1 1 45 TYR C    C   1.908  13.395  52.205 1.00 . A A . 45 TYR C    1 1 
        3  3267 1 1 45 TYR CA   C   1.818  12.770  53.602 1.00 . A A . 45 TYR CA   1 1 
        3  3268 1 1 45 TYR CB   C   1.324  11.318  53.482 1.00 . A A . 45 TYR CB   1 1 
        3  3269 1 1 45 TYR CD1  C   0.988  10.412  55.819 1.00 . A A . 45 TYR CD1  1 1 
        3  3270 1 1 45 TYR CD2  C   2.991   9.792  54.600 1.00 . A A . 45 TYR CD2  1 1 
        3  3271 1 1 45 TYR CE1  C   1.403   9.625  56.899 1.00 . A A . 45 TYR CE1  1 1 
        3  3272 1 1 45 TYR CE2  C   3.406   9.006  55.681 1.00 . A A . 45 TYR CE2  1 1 
        3  3273 1 1 45 TYR CG   C   1.782  10.496  54.668 1.00 . A A . 45 TYR CG   1 1 
        3  3274 1 1 45 TYR CZ   C   2.611   8.923  56.830 1.00 . A A . 45 TYR CZ   1 1 
        3  3275 1 1 45 TYR H    H   0.191  13.061  54.934 1.00 . A A . 45 TYR H    1 1 
        3  3276 1 1 45 TYR HA   H   2.813  12.761  54.021 1.00 . A A . 45 TYR HA   1 1 
        3  3277 1 1 45 TYR HB2  H   0.245  11.315  53.446 1.00 . A A . 45 TYR HB2  1 1 
        3  3278 1 1 45 TYR HB3  H   1.710  10.873  52.573 1.00 . A A . 45 TYR HB3  1 1 
        3  3279 1 1 45 TYR HD1  H   0.059  10.956  55.875 1.00 . A A . 45 TYR HD1  1 1 
        3  3280 1 1 45 TYR HD2  H   3.603   9.857  53.712 1.00 . A A . 45 TYR HD2  1 1 
        3  3281 1 1 45 TYR HE1  H   0.791   9.560  57.787 1.00 . A A . 45 TYR HE1  1 1 
        3  3282 1 1 45 TYR HE2  H   4.338   8.464  55.627 1.00 . A A . 45 TYR HE2  1 1 
        3  3283 1 1 45 TYR HH   H   2.910   8.664  58.699 1.00 . A A . 45 TYR HH   1 1 
        3  3284 1 1 45 TYR N    N   0.933  13.520  54.488 1.00 . A A . 45 TYR N    1 1 
        3  3285 1 1 45 TYR O    O   2.996  13.421  51.642 1.00 . A A . 45 TYR O    1 1 
        3  3286 1 1 45 TYR OH   O   3.021   8.148  57.897 1.00 . A A . 45 TYR OH   1 1 
        3  3287 1 1 46 VAL C    C   2.079  14.745  49.671 1.00 . A A . 46 VAL C    1 1 
        3  3288 1 1 46 VAL CA   C   0.712  14.442  50.294 1.00 . A A . 46 VAL CA   1 1 
        3  3289 1 1 46 VAL CB   C  -0.119  15.729  50.325 1.00 . A A . 46 VAL CB   1 1 
        3  3290 1 1 46 VAL CG1  C  -1.574  15.393  50.674 1.00 . A A . 46 VAL CG1  1 1 
        3  3291 1 1 46 VAL CG2  C   0.458  16.697  51.366 1.00 . A A . 46 VAL CG2  1 1 
        3  3292 1 1 46 VAL H    H  -0.077  13.762  52.129 1.00 . A A . 46 VAL H    1 1 
        3  3293 1 1 46 VAL HA   H   0.207  13.742  49.647 1.00 . A A . 46 VAL HA   1 1 
        3  3294 1 1 46 VAL HB   H  -0.088  16.193  49.349 1.00 . A A . 46 VAL HB   1 1 
        3  3295 1 1 46 VAL HG11 H  -2.073  15.009  49.798 1.00 . A A . 46 VAL HG11 1 1 
        3  3296 1 1 46 VAL HG12 H  -2.081  16.284  51.015 1.00 . A A . 46 VAL HG12 1 1 
        3  3297 1 1 46 VAL HG13 H  -1.596  14.648  51.456 1.00 . A A . 46 VAL HG13 1 1 
        3  3298 1 1 46 VAL HG21 H   0.726  16.156  52.261 1.00 . A A . 46 VAL HG21 1 1 
        3  3299 1 1 46 VAL HG22 H  -0.279  17.449  51.609 1.00 . A A . 46 VAL HG22 1 1 
        3  3300 1 1 46 VAL HG23 H   1.337  17.177  50.961 1.00 . A A . 46 VAL HG23 1 1 
        3  3301 1 1 46 VAL N    N   0.773  13.853  51.651 1.00 . A A . 46 VAL N    1 1 
        3  3302 1 1 46 VAL O    O   2.308  14.417  48.507 1.00 . A A . 46 VAL O    1 1 
        3  3303 1 1 47 LEU C    C   5.012  14.507  49.315 1.00 . A A . 47 LEU C    1 1 
        3  3304 1 1 47 LEU CA   C   4.268  15.744  49.846 1.00 . A A . 47 LEU CA   1 1 
        3  3305 1 1 47 LEU CB   C   5.129  16.371  50.948 1.00 . A A . 47 LEU CB   1 1 
        3  3306 1 1 47 LEU CD1  C   5.330  18.247  52.581 1.00 . A A . 47 LEU CD1  1 1 
        3  3307 1 1 47 LEU CD2  C   4.810  18.763  50.172 1.00 . A A . 47 LEU CD2  1 1 
        3  3308 1 1 47 LEU CG   C   4.594  17.761  51.328 1.00 . A A . 47 LEU CG   1 1 
        3  3309 1 1 47 LEU H    H   2.722  15.695  51.307 1.00 . A A . 47 LEU H    1 1 
        3  3310 1 1 47 LEU HA   H   4.125  16.484  49.076 1.00 . A A . 47 LEU HA   1 1 
        3  3311 1 1 47 LEU HB2  H   5.109  15.732  51.820 1.00 . A A . 47 LEU HB2  1 1 
        3  3312 1 1 47 LEU HB3  H   6.148  16.462  50.601 1.00 . A A . 47 LEU HB3  1 1 
        3  3313 1 1 47 LEU HD11 H   5.062  19.275  52.780 1.00 . A A . 47 LEU HD11 1 1 
        3  3314 1 1 47 LEU HD12 H   6.396  18.178  52.420 1.00 . A A . 47 LEU HD12 1 1 
        3  3315 1 1 47 LEU HD13 H   5.052  17.631  53.423 1.00 . A A . 47 LEU HD13 1 1 
        3  3316 1 1 47 LEU HD21 H   4.921  19.763  50.570 1.00 . A A . 47 LEU HD21 1 1 
        3  3317 1 1 47 LEU HD22 H   3.955  18.743  49.514 1.00 . A A . 47 LEU HD22 1 1 
        3  3318 1 1 47 LEU HD23 H   5.697  18.501  49.614 1.00 . A A . 47 LEU HD23 1 1 
        3  3319 1 1 47 LEU HG   H   3.538  17.685  51.547 1.00 . A A . 47 LEU HG   1 1 
        3  3320 1 1 47 LEU N    N   2.966  15.393  50.407 1.00 . A A . 47 LEU N    1 1 
        3  3321 1 1 47 LEU O    O   5.560  14.527  48.215 1.00 . A A . 47 LEU O    1 1 
        3  3322 1 1 48 LEU C    C   5.170  11.552  48.481 1.00 . A A . 48 LEU C    1 1 
        3  3323 1 1 48 LEU CA   C   5.756  12.216  49.754 1.00 . A A . 48 LEU CA   1 1 
        3  3324 1 1 48 LEU CB   C   5.830  11.239  50.950 1.00 . A A . 48 LEU CB   1 1 
        3  3325 1 1 48 LEU CD1  C   8.367  11.162  51.024 1.00 . A A . 48 LEU CD1  1 1 
        3  3326 1 1 48 LEU CD2  C   7.106  12.990  52.227 1.00 . A A . 48 LEU CD2  1 1 
        3  3327 1 1 48 LEU CG   C   7.083  11.510  51.807 1.00 . A A . 48 LEU CG   1 1 
        3  3328 1 1 48 LEU H    H   4.600  13.535  50.997 1.00 . A A . 48 LEU H    1 1 
        3  3329 1 1 48 LEU HA   H   6.759  12.499  49.472 1.00 . A A . 48 LEU HA   1 1 
        3  3330 1 1 48 LEU HB2  H   4.965  11.382  51.576 1.00 . A A . 48 LEU HB2  1 1 
        3  3331 1 1 48 LEU HB3  H   5.853  10.221  50.593 1.00 . A A . 48 LEU HB3  1 1 
        3  3332 1 1 48 LEU HD11 H   8.768  12.049  50.552 1.00 . A A . 48 LEU HD11 1 1 
        3  3333 1 1 48 LEU HD12 H   8.151  10.419  50.268 1.00 . A A . 48 LEU HD12 1 1 
        3  3334 1 1 48 LEU HD13 H   9.103  10.764  51.710 1.00 . A A . 48 LEU HD13 1 1 
        3  3335 1 1 48 LEU HD21 H   7.770  13.113  53.070 1.00 . A A . 48 LEU HD21 1 1 
        3  3336 1 1 48 LEU HD22 H   6.111  13.305  52.506 1.00 . A A . 48 LEU HD22 1 1 
        3  3337 1 1 48 LEU HD23 H   7.458  13.595  51.404 1.00 . A A . 48 LEU HD23 1 1 
        3  3338 1 1 48 LEU HG   H   7.038  10.894  52.693 1.00 . A A . 48 LEU HG   1 1 
        3  3339 1 1 48 LEU N    N   5.048  13.450  50.130 1.00 . A A . 48 LEU N    1 1 
        3  3340 1 1 48 LEU O    O   5.904  11.391  47.507 1.00 . A A . 48 LEU O    1 1 
        3  3341 1 1 49 PRO C    C   3.666  11.401  45.907 1.00 . A A . 49 PRO C    1 1 
        3  3342 1 1 49 PRO CA   C   3.314  10.601  47.169 1.00 . A A . 49 PRO CA   1 1 
        3  3343 1 1 49 PRO CB   C   1.806  10.653  47.433 1.00 . A A . 49 PRO CB   1 1 
        3  3344 1 1 49 PRO CD   C   2.892  11.285  49.485 1.00 . A A . 49 PRO CD   1 1 
        3  3345 1 1 49 PRO CG   C   1.689  10.530  48.910 1.00 . A A . 49 PRO CG   1 1 
        3  3346 1 1 49 PRO HA   H   3.627   9.577  47.063 1.00 . A A . 49 PRO HA   1 1 
        3  3347 1 1 49 PRO HB2  H   1.394  11.597  47.097 1.00 . A A . 49 PRO HB2  1 1 
        3  3348 1 1 49 PRO HB3  H   1.307   9.828  46.948 1.00 . A A . 49 PRO HB3  1 1 
        3  3349 1 1 49 PRO HD2  H   2.633  12.301  49.683 1.00 . A A . 49 PRO HD2  1 1 
        3  3350 1 1 49 PRO HD3  H   3.242  10.797  50.372 1.00 . A A . 49 PRO HD3  1 1 
        3  3351 1 1 49 PRO HG2  H   0.761  10.976  49.250 1.00 . A A . 49 PRO HG2  1 1 
        3  3352 1 1 49 PRO HG3  H   1.734   9.492  49.204 1.00 . A A . 49 PRO HG3  1 1 
        3  3353 1 1 49 PRO N    N   3.902  11.200  48.415 1.00 . A A . 49 PRO N    1 1 
        3  3354 1 1 49 PRO O    O   3.704  10.850  44.807 1.00 . A A . 49 PRO O    1 1 
        3  3355 1 1 50 ALA C    C   5.688  13.155  44.387 1.00 . A A . 50 ALA C    1 1 
        3  3356 1 1 50 ALA CA   C   4.333  13.560  44.967 1.00 . A A . 50 ALA CA   1 1 
        3  3357 1 1 50 ALA CB   C   4.387  15.014  45.438 1.00 . A A . 50 ALA CB   1 1 
        3  3358 1 1 50 ALA H    H   3.970  13.072  46.981 1.00 . A A . 50 ALA H    1 1 
        3  3359 1 1 50 ALA HA   H   3.621  13.482  44.159 1.00 . A A . 50 ALA HA   1 1 
        3  3360 1 1 50 ALA HB1  H   3.548  15.212  46.088 1.00 . A A . 50 ALA HB1  1 1 
        3  3361 1 1 50 ALA HB2  H   4.343  15.674  44.582 1.00 . A A . 50 ALA HB2  1 1 
        3  3362 1 1 50 ALA HB3  H   5.307  15.186  45.976 1.00 . A A . 50 ALA HB3  1 1 
        3  3363 1 1 50 ALA N    N   3.949  12.690  46.079 1.00 . A A . 50 ALA N    1 1 
        3  3364 1 1 50 ALA O    O   5.927  13.321  43.190 1.00 . A A . 50 ALA O    1 1 
        3  3365 1 1 51 LEU C    C   7.690  11.026  43.743 1.00 . A A . 51 LEU C    1 1 
        3  3366 1 1 51 LEU CA   C   7.872  12.167  44.737 1.00 . A A . 51 LEU CA   1 1 
        3  3367 1 1 51 LEU CB   C   8.741  11.695  45.913 1.00 . A A . 51 LEU CB   1 1 
        3  3368 1 1 51 LEU CD1  C   8.257  13.890  47.023 1.00 . A A . 51 LEU CD1  1 1 
        3  3369 1 1 51 LEU CD2  C  10.123  12.438  47.864 1.00 . A A . 51 LEU CD2  1 1 
        3  3370 1 1 51 LEU CG   C   9.361  12.907  46.619 1.00 . A A . 51 LEU CG   1 1 
        3  3371 1 1 51 LEU H    H   6.311  12.453  46.154 1.00 . A A . 51 LEU H    1 1 
        3  3372 1 1 51 LEU HA   H   8.361  13.001  44.253 1.00 . A A . 51 LEU HA   1 1 
        3  3373 1 1 51 LEU HB2  H   8.128  11.145  46.612 1.00 . A A . 51 LEU HB2  1 1 
        3  3374 1 1 51 LEU HB3  H   9.531  11.054  45.547 1.00 . A A . 51 LEU HB3  1 1 
        3  3375 1 1 51 LEU HD11 H   8.627  14.556  47.789 1.00 . A A . 51 LEU HD11 1 1 
        3  3376 1 1 51 LEU HD12 H   7.407  13.344  47.401 1.00 . A A . 51 LEU HD12 1 1 
        3  3377 1 1 51 LEU HD13 H   7.959  14.466  46.160 1.00 . A A . 51 LEU HD13 1 1 
        3  3378 1 1 51 LEU HD21 H   9.537  11.700  48.390 1.00 . A A . 51 LEU HD21 1 1 
        3  3379 1 1 51 LEU HD22 H  10.307  13.282  48.513 1.00 . A A . 51 LEU HD22 1 1 
        3  3380 1 1 51 LEU HD23 H  11.065  12.002  47.567 1.00 . A A . 51 LEU HD23 1 1 
        3  3381 1 1 51 LEU HG   H  10.046  13.400  45.943 1.00 . A A . 51 LEU HG   1 1 
        3  3382 1 1 51 LEU N    N   6.564  12.606  45.220 1.00 . A A . 51 LEU N    1 1 
        3  3383 1 1 51 LEU O    O   8.365  10.955  42.716 1.00 . A A . 51 LEU O    1 1 
        3  3384 1 1 52 ALA C    C   5.974   9.547  41.835 1.00 . A A . 52 ALA C    1 1 
        3  3385 1 1 52 ALA CA   C   6.427   9.027  43.197 1.00 . A A . 52 ALA CA   1 1 
        3  3386 1 1 52 ALA CB   C   5.330   8.163  43.823 1.00 . A A . 52 ALA CB   1 1 
        3  3387 1 1 52 ALA H    H   6.222  10.329  44.876 1.00 . A A . 52 ALA H    1 1 
        3  3388 1 1 52 ALA HA   H   7.313   8.429  43.044 1.00 . A A . 52 ALA HA   1 1 
        3  3389 1 1 52 ALA HB1  H   4.415   8.734  43.884 1.00 . A A . 52 ALA HB1  1 1 
        3  3390 1 1 52 ALA HB2  H   5.633   7.861  44.814 1.00 . A A . 52 ALA HB2  1 1 
        3  3391 1 1 52 ALA HB3  H   5.169   7.287  43.212 1.00 . A A . 52 ALA HB3  1 1 
        3  3392 1 1 52 ALA N    N   6.741  10.156  44.062 1.00 . A A . 52 ALA N    1 1 
        3  3393 1 1 52 ALA O    O   6.385   9.028  40.798 1.00 . A A . 52 ALA O    1 1 
        3  3394 1 1 53 ILE C    C   5.831  11.759  39.798 1.00 . A A . 53 ILE C    1 1 
        3  3395 1 1 53 ILE CA   C   4.667  11.168  40.591 1.00 . A A . 53 ILE CA   1 1 
        3  3396 1 1 53 ILE CB   C   3.638  12.264  40.877 1.00 . A A . 53 ILE CB   1 1 
        3  3397 1 1 53 ILE CD1  C   1.769  10.548  40.756 1.00 . A A . 53 ILE CD1  1 1 
        3  3398 1 1 53 ILE CG1  C   2.412  11.667  41.592 1.00 . A A . 53 ILE CG1  1 1 
        3  3399 1 1 53 ILE CG2  C   3.210  12.929  39.566 1.00 . A A . 53 ILE CG2  1 1 
        3  3400 1 1 53 ILE H    H   4.843  10.960  42.696 1.00 . A A . 53 ILE H    1 1 
        3  3401 1 1 53 ILE HA   H   4.222  10.420  39.952 1.00 . A A . 53 ILE HA   1 1 
        3  3402 1 1 53 ILE HB   H   4.091  13.011  41.515 1.00 . A A . 53 ILE HB   1 1 
        3  3403 1 1 53 ILE HD11 H   2.271   9.613  40.962 1.00 . A A . 53 ILE HD11 1 1 
        3  3404 1 1 53 ILE HD12 H   1.852  10.774  39.704 1.00 . A A . 53 ILE HD12 1 1 
        3  3405 1 1 53 ILE HD13 H   0.727  10.458  41.021 1.00 . A A . 53 ILE HD13 1 1 
        3  3406 1 1 53 ILE HG12 H   2.720  11.263  42.545 1.00 . A A . 53 ILE HG12 1 1 
        3  3407 1 1 53 ILE HG13 H   1.683  12.447  41.758 1.00 . A A . 53 ILE HG13 1 1 
        3  3408 1 1 53 ILE HG21 H   2.992  12.167  38.831 1.00 . A A . 53 ILE HG21 1 1 
        3  3409 1 1 53 ILE HG22 H   4.008  13.560  39.204 1.00 . A A . 53 ILE HG22 1 1 
        3  3410 1 1 53 ILE HG23 H   2.327  13.527  39.736 1.00 . A A . 53 ILE HG23 1 1 
        3  3411 1 1 53 ILE N    N   5.141  10.584  41.841 1.00 . A A . 53 ILE N    1 1 
        3  3412 1 1 53 ILE O    O   5.987  11.447  38.618 1.00 . A A . 53 ILE O    1 1 
        3  3413 1 1 54 PHE C    C   8.716  12.103  39.188 1.00 . A A . 54 PHE C    1 1 
        3  3414 1 1 54 PHE CA   C   7.785  13.191  39.710 1.00 . A A . 54 PHE CA   1 1 
        3  3415 1 1 54 PHE CB   C   8.556  14.128  40.641 1.00 . A A . 54 PHE CB   1 1 
        3  3416 1 1 54 PHE CD1  C   9.497  15.799  39.005 1.00 . A A . 54 PHE CD1  1 1 
        3  3417 1 1 54 PHE CD2  C  11.015  14.251  40.092 1.00 . A A . 54 PHE CD2  1 1 
        3  3418 1 1 54 PHE CE1  C  10.573  16.368  38.313 1.00 . A A . 54 PHE CE1  1 1 
        3  3419 1 1 54 PHE CE2  C  12.091  14.821  39.400 1.00 . A A . 54 PHE CE2  1 1 
        3  3420 1 1 54 PHE CG   C   9.718  14.741  39.895 1.00 . A A . 54 PHE CG   1 1 
        3  3421 1 1 54 PHE CZ   C  11.870  15.879  38.511 1.00 . A A . 54 PHE CZ   1 1 
        3  3422 1 1 54 PHE H    H   6.518  12.860  41.355 1.00 . A A . 54 PHE H    1 1 
        3  3423 1 1 54 PHE HA   H   7.419  13.757  38.867 1.00 . A A . 54 PHE HA   1 1 
        3  3424 1 1 54 PHE HB2  H   7.897  14.911  40.988 1.00 . A A . 54 PHE HB2  1 1 
        3  3425 1 1 54 PHE HB3  H   8.926  13.569  41.488 1.00 . A A . 54 PHE HB3  1 1 
        3  3426 1 1 54 PHE HD1  H   8.497  16.175  38.853 1.00 . A A . 54 PHE HD1  1 1 
        3  3427 1 1 54 PHE HD2  H  11.186  13.435  40.778 1.00 . A A . 54 PHE HD2  1 1 
        3  3428 1 1 54 PHE HE1  H  10.402  17.184  37.628 1.00 . A A . 54 PHE HE1  1 1 
        3  3429 1 1 54 PHE HE2  H  13.092  14.443  39.553 1.00 . A A . 54 PHE HE2  1 1 
        3  3430 1 1 54 PHE HZ   H  12.700  16.318  37.977 1.00 . A A . 54 PHE HZ   1 1 
        3  3431 1 1 54 PHE N    N   6.654  12.600  40.420 1.00 . A A . 54 PHE N    1 1 
        3  3432 1 1 54 PHE O    O   9.183  12.170  38.052 1.00 . A A . 54 PHE O    1 1 
        3  3433 1 1 55 ILE C    C   9.146   9.239  38.439 1.00 . A A . 55 ILE C    1 1 
        3  3434 1 1 55 ILE CA   C   9.806   9.977  39.601 1.00 . A A . 55 ILE CA   1 1 
        3  3435 1 1 55 ILE CB   C   9.995   9.010  40.785 1.00 . A A . 55 ILE CB   1 1 
        3  3436 1 1 55 ILE CD1  C  12.373   9.626  41.508 1.00 . A A . 55 ILE CD1  1 1 
        3  3437 1 1 55 ILE CG1  C  10.874   9.668  41.872 1.00 . A A . 55 ILE CG1  1 1 
        3  3438 1 1 55 ILE CG2  C  10.648   7.707  40.301 1.00 . A A . 55 ILE CG2  1 1 
        3  3439 1 1 55 ILE H    H   8.523  11.064  40.887 1.00 . A A . 55 ILE H    1 1 
        3  3440 1 1 55 ILE HA   H  10.767  10.362  39.304 1.00 . A A . 55 ILE HA   1 1 
        3  3441 1 1 55 ILE HB   H   9.026   8.780  41.205 1.00 . A A . 55 ILE HB   1 1 
        3  3442 1 1 55 ILE HD11 H  12.507   9.475  40.448 1.00 . A A . 55 ILE HD11 1 1 
        3  3443 1 1 55 ILE HD12 H  12.846   8.817  42.044 1.00 . A A . 55 ILE HD12 1 1 
        3  3444 1 1 55 ILE HD13 H  12.835  10.560  41.796 1.00 . A A . 55 ILE HD13 1 1 
        3  3445 1 1 55 ILE HG12 H  10.575  10.698  41.989 1.00 . A A . 55 ILE HG12 1 1 
        3  3446 1 1 55 ILE HG13 H  10.724   9.150  42.807 1.00 . A A . 55 ILE HG13 1 1 
        3  3447 1 1 55 ILE HG21 H  11.458   7.941  39.626 1.00 . A A . 55 ILE HG21 1 1 
        3  3448 1 1 55 ILE HG22 H   9.914   7.107  39.786 1.00 . A A . 55 ILE HG22 1 1 
        3  3449 1 1 55 ILE HG23 H  11.032   7.159  41.149 1.00 . A A . 55 ILE HG23 1 1 
        3  3450 1 1 55 ILE N    N   8.957  11.088  40.009 1.00 . A A . 55 ILE N    1 1 
        3  3451 1 1 55 ILE O    O   9.789   8.868  37.458 1.00 . A A . 55 ILE O    1 1 
        3  3452 1 1 56 GLY C    C   7.058   9.185  36.257 1.00 . A A . 56 GLY C    1 1 
        3  3453 1 1 56 GLY CA   C   7.039   8.392  37.562 1.00 . A A . 56 GLY CA   1 1 
        3  3454 1 1 56 GLY H    H   7.416   9.437  39.380 1.00 . A A . 56 GLY H    1 1 
        3  3455 1 1 56 GLY HA2  H   7.441   7.404  37.386 1.00 . A A . 56 GLY HA2  1 1 
        3  3456 1 1 56 GLY HA3  H   6.020   8.305  37.906 1.00 . A A . 56 GLY HA3  1 1 
        3  3457 1 1 56 GLY N    N   7.838   9.059  38.580 1.00 . A A . 56 GLY N    1 1 
        3  3458 1 1 56 GLY O    O   7.158   8.613  35.171 1.00 . A A . 56 GLY O    1 1 
        3  3459 1 1 57 LEU C    C   8.300  11.208  34.452 1.00 . A A . 57 LEU C    1 1 
        3  3460 1 1 57 LEU CA   C   6.977  11.372  35.200 1.00 . A A . 57 LEU CA   1 1 
        3  3461 1 1 57 LEU CB   C   6.792  12.834  35.634 1.00 . A A . 57 LEU CB   1 1 
        3  3462 1 1 57 LEU CD1  C   5.622  13.442  33.486 1.00 . A A . 57 LEU CD1  1 1 
        3  3463 1 1 57 LEU CD2  C   6.675  15.220  34.907 1.00 . A A . 57 LEU CD2  1 1 
        3  3464 1 1 57 LEU CG   C   6.799  13.773  34.418 1.00 . A A . 57 LEU CG   1 1 
        3  3465 1 1 57 LEU H    H   6.897  10.894  37.277 1.00 . A A . 57 LEU H    1 1 
        3  3466 1 1 57 LEU HA   H   6.173  11.090  34.540 1.00 . A A . 57 LEU HA   1 1 
        3  3467 1 1 57 LEU HB2  H   5.850  12.933  36.153 1.00 . A A . 57 LEU HB2  1 1 
        3  3468 1 1 57 LEU HB3  H   7.596  13.110  36.300 1.00 . A A . 57 LEU HB3  1 1 
        3  3469 1 1 57 LEU HD11 H   4.757  13.168  34.073 1.00 . A A . 57 LEU HD11 1 1 
        3  3470 1 1 57 LEU HD12 H   5.893  12.621  32.842 1.00 . A A . 57 LEU HD12 1 1 
        3  3471 1 1 57 LEU HD13 H   5.384  14.304  32.879 1.00 . A A . 57 LEU HD13 1 1 
        3  3472 1 1 57 LEU HD21 H   7.458  15.426  35.623 1.00 . A A . 57 LEU HD21 1 1 
        3  3473 1 1 57 LEU HD22 H   5.712  15.359  35.377 1.00 . A A . 57 LEU HD22 1 1 
        3  3474 1 1 57 LEU HD23 H   6.767  15.893  34.069 1.00 . A A . 57 LEU HD23 1 1 
        3  3475 1 1 57 LEU HG   H   7.727  13.657  33.877 1.00 . A A . 57 LEU HG   1 1 
        3  3476 1 1 57 LEU N    N   6.967  10.508  36.378 1.00 . A A . 57 LEU N    1 1 
        3  3477 1 1 57 LEU O    O   8.318  11.015  33.237 1.00 . A A . 57 LEU O    1 1 
        3  3478 1 1 58 THR C    C  10.836   9.953  33.721 1.00 . A A . 58 THR C    1 1 
        3  3479 1 1 58 THR CA   C  10.721  11.229  34.553 1.00 . A A . 58 THR CA   1 1 
        3  3480 1 1 58 THR CB   C  11.804  11.217  35.637 1.00 . A A . 58 THR CB   1 1 
        3  3481 1 1 58 THR CG2  C  11.817  12.560  36.375 1.00 . A A . 58 THR CG2  1 1 
        3  3482 1 1 58 THR H    H   9.326  11.570  36.123 1.00 . A A . 58 THR H    1 1 
        3  3483 1 1 58 THR HA   H  10.873  12.101  33.934 1.00 . A A . 58 THR HA   1 1 
        3  3484 1 1 58 THR HB   H  12.767  11.058  35.178 1.00 . A A . 58 THR HB   1 1 
        3  3485 1 1 58 THR HG1  H  11.366  10.563  37.414 1.00 . A A . 58 THR HG1  1 1 
        3  3486 1 1 58 THR HG21 H  12.301  12.438  37.332 1.00 . A A . 58 THR HG21 1 1 
        3  3487 1 1 58 THR HG22 H  10.804  12.903  36.525 1.00 . A A . 58 THR HG22 1 1 
        3  3488 1 1 58 THR HG23 H  12.359  13.287  35.789 1.00 . A A . 58 THR HG23 1 1 
        3  3489 1 1 58 THR N    N   9.406  11.326  35.176 1.00 . A A . 58 THR N    1 1 
        3  3490 1 1 58 THR O    O  11.392   9.960  32.623 1.00 . A A . 58 THR O    1 1 
        3  3491 1 1 58 THR OG1  O  11.541  10.168  36.556 1.00 . A A . 58 THR OG1  1 1 
        3  3492 1 1 59 ILE C    C   9.465   7.730  32.239 1.00 . A A . 59 ILE C    1 1 
        3  3493 1 1 59 ILE CA   C  10.277   7.600  33.529 1.00 . A A . 59 ILE CA   1 1 
        3  3494 1 1 59 ILE CB   C   9.721   6.476  34.408 1.00 . A A . 59 ILE CB   1 1 
        3  3495 1 1 59 ILE CD1  C  10.023   5.299  36.595 1.00 . A A . 59 ILE CD1  1 1 
        3  3496 1 1 59 ILE CG1  C  10.688   6.215  35.566 1.00 . A A . 59 ILE CG1  1 1 
        3  3497 1 1 59 ILE CG2  C   9.568   5.199  33.577 1.00 . A A . 59 ILE CG2  1 1 
        3  3498 1 1 59 ILE H    H   9.798   8.963  35.098 1.00 . A A . 59 ILE H    1 1 
        3  3499 1 1 59 ILE HA   H  11.285   7.361  33.229 1.00 . A A . 59 ILE HA   1 1 
        3  3500 1 1 59 ILE HB   H   8.756   6.768  34.801 1.00 . A A . 59 ILE HB   1 1 
        3  3501 1 1 59 ILE HD11 H   9.252   5.845  37.118 1.00 . A A . 59 ILE HD11 1 1 
        3  3502 1 1 59 ILE HD12 H  10.763   4.955  37.302 1.00 . A A . 59 ILE HD12 1 1 
        3  3503 1 1 59 ILE HD13 H   9.584   4.450  36.090 1.00 . A A . 59 ILE HD13 1 1 
        3  3504 1 1 59 ILE HG12 H  11.582   5.743  35.186 1.00 . A A . 59 ILE HG12 1 1 
        3  3505 1 1 59 ILE HG13 H  10.947   7.152  36.036 1.00 . A A . 59 ILE HG13 1 1 
        3  3506 1 1 59 ILE HG21 H  10.458   5.049  32.983 1.00 . A A . 59 ILE HG21 1 1 
        3  3507 1 1 59 ILE HG22 H   8.712   5.293  32.926 1.00 . A A . 59 ILE HG22 1 1 
        3  3508 1 1 59 ILE HG23 H   9.429   4.354  34.236 1.00 . A A . 59 ILE HG23 1 1 
        3  3509 1 1 59 ILE N    N  10.271   8.872  34.244 1.00 . A A . 59 ILE N    1 1 
        3  3510 1 1 59 ILE O    O   9.904   7.279  31.181 1.00 . A A . 59 ILE O    1 1 
        3  3511 1 1 60 TYR C    C   8.188   9.153  29.980 1.00 . A A . 60 TYR C    1 1 
        3  3512 1 1 60 TYR CA   C   7.433   8.502  31.148 1.00 . A A . 60 TYR CA   1 1 
        3  3513 1 1 60 TYR CB   C   6.181   9.337  31.521 1.00 . A A . 60 TYR CB   1 1 
        3  3514 1 1 60 TYR CD1  C   4.838   9.646  29.386 1.00 . A A . 60 TYR CD1  1 1 
        3  3515 1 1 60 TYR CD2  C   6.233  11.462  30.184 1.00 . A A . 60 TYR CD2  1 1 
        3  3516 1 1 60 TYR CE1  C   4.457  10.422  28.286 1.00 . A A . 60 TYR CE1  1 1 
        3  3517 1 1 60 TYR CE2  C   5.851  12.238  29.083 1.00 . A A . 60 TYR CE2  1 1 
        3  3518 1 1 60 TYR CG   C   5.726  10.166  30.335 1.00 . A A . 60 TYR CG   1 1 
        3  3519 1 1 60 TYR CZ   C   4.963  11.719  28.134 1.00 . A A . 60 TYR CZ   1 1 
        3  3520 1 1 60 TYR H    H   7.955   8.652  33.190 1.00 . A A . 60 TYR H    1 1 
        3  3521 1 1 60 TYR HA   H   7.105   7.526  30.821 1.00 . A A . 60 TYR HA   1 1 
        3  3522 1 1 60 TYR HB2  H   5.380   8.678  31.822 1.00 . A A . 60 TYR HB2  1 1 
        3  3523 1 1 60 TYR HB3  H   6.423   9.994  32.341 1.00 . A A . 60 TYR HB3  1 1 
        3  3524 1 1 60 TYR HD1  H   4.448   8.646  29.503 1.00 . A A . 60 TYR HD1  1 1 
        3  3525 1 1 60 TYR HD2  H   6.920  11.862  30.913 1.00 . A A . 60 TYR HD2  1 1 
        3  3526 1 1 60 TYR HE1  H   3.773  10.020  27.555 1.00 . A A . 60 TYR HE1  1 1 
        3  3527 1 1 60 TYR HE2  H   6.242  13.239  28.966 1.00 . A A . 60 TYR HE2  1 1 
        3  3528 1 1 60 TYR HH   H   5.286  13.131  26.892 1.00 . A A . 60 TYR HH   1 1 
        3  3529 1 1 60 TYR N    N   8.285   8.336  32.325 1.00 . A A . 60 TYR N    1 1 
        3  3530 1 1 60 TYR O    O   8.022   8.739  28.840 1.00 . A A . 60 TYR O    1 1 
        3  3531 1 1 60 TYR OH   O   4.597  12.480  27.045 1.00 . A A . 60 TYR OH   1 1 
        3  3532 1 1 61 ALA C    C  10.796   9.879  28.546 1.00 . A A . 61 ALA C    1 1 
        3  3533 1 1 61 ALA CA   C   9.759  10.808  29.168 1.00 . A A . 61 ALA CA   1 1 
        3  3534 1 1 61 ALA CB   C  10.451  12.062  29.704 1.00 . A A . 61 ALA CB   1 1 
        3  3535 1 1 61 ALA H    H   9.183  10.484  31.145 1.00 . A A . 61 ALA H    1 1 
        3  3536 1 1 61 ALA HA   H   9.105  11.093  28.359 1.00 . A A . 61 ALA HA   1 1 
        3  3537 1 1 61 ALA HB1  H  11.046  11.805  30.567 1.00 . A A . 61 ALA HB1  1 1 
        3  3538 1 1 61 ALA HB2  H   9.707  12.793  29.984 1.00 . A A . 61 ALA HB2  1 1 
        3  3539 1 1 61 ALA HB3  H  11.090  12.475  28.936 1.00 . A A . 61 ALA HB3  1 1 
        3  3540 1 1 61 ALA N    N   9.009  10.157  30.238 1.00 . A A . 61 ALA N    1 1 
        3  3541 1 1 61 ALA O    O  11.131  10.039  27.379 1.00 . A A . 61 ALA O    1 1 
        3  3542 1 1 62 ILE C    C  11.646   6.987  27.758 1.00 . A A . 62 ILE C    1 1 
        3  3543 1 1 62 ILE CA   C  12.278   7.975  28.747 1.00 . A A . 62 ILE CA   1 1 
        3  3544 1 1 62 ILE CB   C  12.948   7.202  29.889 1.00 . A A . 62 ILE CB   1 1 
        3  3545 1 1 62 ILE CD1  C  14.242   7.476  32.023 1.00 . A A . 62 ILE CD1  1 1 
        3  3546 1 1 62 ILE CG1  C  13.759   8.178  30.750 1.00 . A A . 62 ILE CG1  1 1 
        3  3547 1 1 62 ILE CG2  C  13.886   6.135  29.311 1.00 . A A . 62 ILE CG2  1 1 
        3  3548 1 1 62 ILE H    H  10.959   8.762  30.206 1.00 . A A . 62 ILE H    1 1 
        3  3549 1 1 62 ILE HA   H  13.037   8.544  28.234 1.00 . A A . 62 ILE HA   1 1 
        3  3550 1 1 62 ILE HB   H  12.190   6.725  30.493 1.00 . A A . 62 ILE HB   1 1 
        3  3551 1 1 62 ILE HD11 H  14.567   8.217  32.739 1.00 . A A . 62 ILE HD11 1 1 
        3  3552 1 1 62 ILE HD12 H  15.069   6.825  31.781 1.00 . A A . 62 ILE HD12 1 1 
        3  3553 1 1 62 ILE HD13 H  13.439   6.894  32.446 1.00 . A A . 62 ILE HD13 1 1 
        3  3554 1 1 62 ILE HG12 H  14.611   8.530  30.187 1.00 . A A . 62 ILE HG12 1 1 
        3  3555 1 1 62 ILE HG13 H  13.136   9.017  31.021 1.00 . A A . 62 ILE HG13 1 1 
        3  3556 1 1 62 ILE HG21 H  13.300   5.325  28.902 1.00 . A A . 62 ILE HG21 1 1 
        3  3557 1 1 62 ILE HG22 H  14.529   5.757  30.091 1.00 . A A . 62 ILE HG22 1 1 
        3  3558 1 1 62 ILE HG23 H  14.489   6.573  28.528 1.00 . A A . 62 ILE HG23 1 1 
        3  3559 1 1 62 ILE N    N  11.293   8.905  29.296 1.00 . A A . 62 ILE N    1 1 
        3  3560 1 1 62 ILE O    O  12.211   6.690  26.707 1.00 . A A . 62 ILE O    1 1 
        3  3561 1 1 63 GLN C    C   9.284   6.221  25.974 1.00 . A A . 63 GLN C    1 1 
        3  3562 1 1 63 GLN CA   C   9.756   5.535  27.264 1.00 . A A . 63 GLN CA   1 1 
        3  3563 1 1 63 GLN CB   C   8.550   4.913  28.018 1.00 . A A . 63 GLN CB   1 1 
        3  3564 1 1 63 GLN CD   C   6.209   5.403  28.836 1.00 . A A . 63 GLN CD   1 1 
        3  3565 1 1 63 GLN CG   C   7.266   5.737  27.789 1.00 . A A . 63 GLN CG   1 1 
        3  3566 1 1 63 GLN H    H  10.073   6.827  28.950 1.00 . A A . 63 GLN H    1 1 
        3  3567 1 1 63 GLN HA   H  10.438   4.747  26.981 1.00 . A A . 63 GLN HA   1 1 
        3  3568 1 1 63 GLN HB2  H   8.389   3.903  27.665 1.00 . A A . 63 GLN HB2  1 1 
        3  3569 1 1 63 GLN HB3  H   8.770   4.887  29.075 1.00 . A A . 63 GLN HB3  1 1 
        3  3570 1 1 63 GLN HE21 H   4.850   6.604  28.029 1.00 . A A . 63 GLN HE21 1 1 
        3  3571 1 1 63 GLN HE22 H   4.347   5.770  29.419 1.00 . A A . 63 GLN HE22 1 1 
        3  3572 1 1 63 GLN HG2  H   7.500   6.782  27.843 1.00 . A A . 63 GLN HG2  1 1 
        3  3573 1 1 63 GLN HG3  H   6.874   5.512  26.809 1.00 . A A . 63 GLN HG3  1 1 
        3  3574 1 1 63 GLN N    N  10.466   6.490  28.119 1.00 . A A . 63 GLN N    1 1 
        3  3575 1 1 63 GLN NE2  N   5.038   5.973  28.755 1.00 . A A . 63 GLN NE2  1 1 
        3  3576 1 1 63 GLN O    O   9.255   5.606  24.911 1.00 . A A . 63 GLN O    1 1 
        3  3577 1 1 63 GLN OE1  O   6.453   4.621  29.755 1.00 . A A . 63 GLN OE1  1 1 
        3  3578 1 1 64 ARG C    C   9.635   8.806  24.064 1.00 . A A . 64 ARG C    1 1 
        3  3579 1 1 64 ARG CA   C   8.486   8.323  24.962 1.00 . A A . 64 ARG CA   1 1 
        3  3580 1 1 64 ARG CB   C   7.726   9.542  25.493 1.00 . A A . 64 ARG CB   1 1 
        3  3581 1 1 64 ARG CD   C   6.162  11.382  24.812 1.00 . A A . 64 ARG CD   1 1 
        3  3582 1 1 64 ARG CG   C   7.140  10.317  24.311 1.00 . A A . 64 ARG CG   1 1 
        3  3583 1 1 64 ARG CZ   C   4.635  11.586  22.941 1.00 . A A . 64 ARG CZ   1 1 
        3  3584 1 1 64 ARG H    H   9.025   7.967  26.940 1.00 . A A . 64 ARG H    1 1 
        3  3585 1 1 64 ARG HA   H   7.799   7.746  24.374 1.00 . A A . 64 ARG HA   1 1 
        3  3586 1 1 64 ARG HB2  H   6.930   9.215  26.146 1.00 . A A . 64 ARG HB2  1 1 
        3  3587 1 1 64 ARG HB3  H   8.404  10.180  26.040 1.00 . A A . 64 ARG HB3  1 1 
        3  3588 1 1 64 ARG HD2  H   5.361  10.907  25.357 1.00 . A A . 64 ARG HD2  1 1 
        3  3589 1 1 64 ARG HD3  H   6.682  12.068  25.465 1.00 . A A . 64 ARG HD3  1 1 
        3  3590 1 1 64 ARG HE   H   5.979  12.988  23.438 1.00 . A A . 64 ARG HE   1 1 
        3  3591 1 1 64 ARG HG2  H   7.938  10.795  23.764 1.00 . A A . 64 ARG HG2  1 1 
        3  3592 1 1 64 ARG HG3  H   6.617   9.634  23.657 1.00 . A A . 64 ARG HG3  1 1 
        3  3593 1 1 64 ARG HH11 H   4.458   9.945  24.074 1.00 . A A . 64 ARG HH11 1 1 
        3  3594 1 1 64 ARG HH12 H   3.386  10.038  22.717 1.00 . A A . 64 ARG HH12 1 1 
        3  3595 1 1 64 ARG HH21 H   4.589  13.106  21.640 1.00 . A A . 64 ARG HH21 1 1 
        3  3596 1 1 64 ARG HH22 H   3.460  11.827  21.339 1.00 . A A . 64 ARG HH22 1 1 
        3  3597 1 1 64 ARG N    N   8.942   7.500  26.083 1.00 . A A . 64 ARG N    1 1 
        3  3598 1 1 64 ARG NE   N   5.610  12.111  23.676 1.00 . A A . 64 ARG NE   1 1 
        3  3599 1 1 64 ARG NH1  N   4.119  10.433  23.270 1.00 . A A . 64 ARG NH1  1 1 
        3  3600 1 1 64 ARG NH2  N   4.193  12.223  21.891 1.00 . A A . 64 ARG NH2  1 1 
        3  3601 1 1 64 ARG O    O   9.426   9.180  22.913 1.00 . A A . 64 ARG O    1 1 
        3  3602 1 1 65 LYS C    C  12.653   8.319  22.933 1.00 . A A . 65 LYS C    1 1 
        3  3603 1 1 65 LYS CA   C  12.045   9.300  23.954 1.00 . A A . 65 LYS CA   1 1 
        3  3604 1 1 65 LYS CB   C  13.116   9.514  25.035 1.00 . A A . 65 LYS CB   1 1 
        3  3605 1 1 65 LYS CD   C  15.412  10.377  25.524 1.00 . A A . 65 LYS CD   1 1 
        3  3606 1 1 65 LYS CE   C  16.714  10.887  24.905 1.00 . A A . 65 LYS CE   1 1 
        3  3607 1 1 65 LYS CG   C  14.401  10.081  24.414 1.00 . A A . 65 LYS CG   1 1 
        3  3608 1 1 65 LYS H    H  10.915   8.415  25.520 1.00 . A A . 65 LYS H    1 1 
        3  3609 1 1 65 LYS HA   H  11.826  10.287  23.571 1.00 . A A . 65 LYS HA   1 1 
        3  3610 1 1 65 LYS HB2  H  12.747  10.209  25.769 1.00 . A A . 65 LYS HB2  1 1 
        3  3611 1 1 65 LYS HB3  H  13.336   8.571  25.513 1.00 . A A . 65 LYS HB3  1 1 
        3  3612 1 1 65 LYS HD2  H  15.008  11.129  26.187 1.00 . A A . 65 LYS HD2  1 1 
        3  3613 1 1 65 LYS HD3  H  15.609   9.474  26.081 1.00 . A A . 65 LYS HD3  1 1 
        3  3614 1 1 65 LYS HE2  H  17.441  11.058  25.684 1.00 . A A . 65 LYS HE2  1 1 
        3  3615 1 1 65 LYS HE3  H  17.095  10.153  24.212 1.00 . A A . 65 LYS HE3  1 1 
        3  3616 1 1 65 LYS HG2  H  14.829   9.362  23.730 1.00 . A A . 65 LYS HG2  1 1 
        3  3617 1 1 65 LYS HG3  H  14.174  10.993  23.884 1.00 . A A . 65 LYS HG3  1 1 
        3  3618 1 1 65 LYS HZ1  H  17.124  12.889  24.503 1.00 . A A . 65 LYS HZ1  1 1 
        3  3619 1 1 65 LYS HZ2  H  15.480  12.478  24.375 1.00 . A A . 65 LYS HZ2  1 1 
        3  3620 1 1 65 LYS HZ3  H  16.572  12.014  23.160 1.00 . A A . 65 LYS HZ3  1 1 
        3  3621 1 1 65 LYS N    N  10.832   8.825  24.634 1.00 . A A . 65 LYS N    1 1 
        3  3622 1 1 65 LYS NZ   N  16.453  12.163  24.180 1.00 . A A . 65 LYS NZ   1 1 
        3  3623 1 1 65 LYS O    O  13.191   8.702  21.894 1.00 . A A . 65 LYS O    1 1 
        3  3624 1 1 66 ARG C    C  11.975   5.551  21.320 1.00 . A A . 66 ARG C    1 1 
        3  3625 1 1 66 ARG CA   C  12.967   5.927  22.433 1.00 . A A . 66 ARG CA   1 1 
        3  3626 1 1 66 ARG CB   C  13.258   4.705  23.305 1.00 . A A . 66 ARG CB   1 1 
        3  3627 1 1 66 ARG CD   C  14.783   3.796  25.076 1.00 . A A . 66 ARG CD   1 1 
        3  3628 1 1 66 ARG CG   C  14.455   5.012  24.208 1.00 . A A . 66 ARG CG   1 1 
        3  3629 1 1 66 ARG CZ   C  16.408   3.204  26.788 1.00 . A A . 66 ARG CZ   1 1 
        3  3630 1 1 66 ARG H    H  11.853   6.886  23.993 1.00 . A A . 66 ARG H    1 1 
        3  3631 1 1 66 ARG HA   H  13.884   6.225  21.949 1.00 . A A . 66 ARG HA   1 1 
        3  3632 1 1 66 ARG HB2  H  12.393   4.481  23.913 1.00 . A A . 66 ARG HB2  1 1 
        3  3633 1 1 66 ARG HB3  H  13.489   3.859  22.678 1.00 . A A . 66 ARG HB3  1 1 
        3  3634 1 1 66 ARG HD2  H  13.920   3.536  25.671 1.00 . A A . 66 ARG HD2  1 1 
        3  3635 1 1 66 ARG HD3  H  15.044   2.961  24.441 1.00 . A A . 66 ARG HD3  1 1 
        3  3636 1 1 66 ARG HE   H  16.285   5.010  25.941 1.00 . A A . 66 ARG HE   1 1 
        3  3637 1 1 66 ARG HG2  H  15.311   5.257  23.595 1.00 . A A . 66 ARG HG2  1 1 
        3  3638 1 1 66 ARG HG3  H  14.218   5.851  24.844 1.00 . A A . 66 ARG HG3  1 1 
        3  3639 1 1 66 ARG HH11 H  15.162   1.748  26.207 1.00 . A A . 66 ARG HH11 1 1 
        3  3640 1 1 66 ARG HH12 H  16.298   1.314  27.440 1.00 . A A . 66 ARG HH12 1 1 
        3  3641 1 1 66 ARG HH21 H  17.770   4.451  27.560 1.00 . A A . 66 ARG HH21 1 1 
        3  3642 1 1 66 ARG HH22 H  17.774   2.843  28.206 1.00 . A A . 66 ARG HH22 1 1 
        3  3643 1 1 66 ARG N    N  12.502   7.042  23.275 1.00 . A A . 66 ARG N    1 1 
        3  3644 1 1 66 ARG NE   N  15.902   4.109  25.956 1.00 . A A . 66 ARG NE   1 1 
        3  3645 1 1 66 ARG NH1  N  15.917   1.994  26.814 1.00 . A A . 66 ARG NH1  1 1 
        3  3646 1 1 66 ARG NH2  N  17.395   3.524  27.580 1.00 . A A . 66 ARG NH2  1 1 
        3  3647 1 1 66 ARG O    O  12.351   5.338  20.168 1.00 . A A . 66 ARG O    1 1 
        3  3648 1 1 67 GLN C    C   9.161   6.598  20.072 1.00 . A A . 67 GLN C    1 1 
        3  3649 1 1 67 GLN CA   C   9.586   5.303  20.770 1.00 . A A . 67 GLN CA   1 1 
        3  3650 1 1 67 GLN CB   C   8.405   4.662  21.507 1.00 . A A . 67 GLN CB   1 1 
        3  3651 1 1 67 GLN CD   C   6.809   5.003  23.393 1.00 . A A . 67 GLN CD   1 1 
        3  3652 1 1 67 GLN CG   C   7.693   5.702  22.361 1.00 . A A . 67 GLN CG   1 1 
        3  3653 1 1 67 GLN H    H  10.507   5.915  22.580 1.00 . A A . 67 GLN H    1 1 
        3  3654 1 1 67 GLN HA   H   9.927   4.611  20.012 1.00 . A A . 67 GLN HA   1 1 
        3  3655 1 1 67 GLN HB2  H   7.711   4.255  20.787 1.00 . A A . 67 GLN HB2  1 1 
        3  3656 1 1 67 GLN HB3  H   8.770   3.865  22.139 1.00 . A A . 67 GLN HB3  1 1 
        3  3657 1 1 67 GLN HE21 H   5.107   5.467  22.483 1.00 . A A . 67 GLN HE21 1 1 
        3  3658 1 1 67 GLN HE22 H   4.943   4.568  23.914 1.00 . A A . 67 GLN HE22 1 1 
        3  3659 1 1 67 GLN HG2  H   8.431   6.305  22.856 1.00 . A A . 67 GLN HG2  1 1 
        3  3660 1 1 67 GLN HG3  H   7.080   6.329  21.730 1.00 . A A . 67 GLN HG3  1 1 
        3  3661 1 1 67 GLN N    N  10.702   5.555  21.689 1.00 . A A . 67 GLN N    1 1 
        3  3662 1 1 67 GLN NE2  N   5.513   5.013  23.251 1.00 . A A . 67 GLN NE2  1 1 
        3  3663 1 1 67 GLN O    O   8.320   6.600  19.179 1.00 . A A . 67 GLN O    1 1 
        3  3664 1 1 67 GLN OE1  O   7.324   4.399  24.334 1.00 . A A . 67 GLN OE1  1 1 
        3  3665 1 1 68 ALA C    C   9.205   9.006  18.576 1.00 . A A . 68 ALA C    1 1 
        3  3666 1 1 68 ALA CA   C   9.300   9.036  20.114 1.00 . A A . 68 ALA CA   1 1 
        3  3667 1 1 68 ALA CB   C  10.368  10.071  20.550 1.00 . A A . 68 ALA CB   1 1 
        3  3668 1 1 68 ALA H    H  10.324   7.548  21.322 1.00 . A A . 68 ALA H    1 1 
        3  3669 1 1 68 ALA HA   H   8.359   9.286  20.587 1.00 . A A . 68 ALA HA   1 1 
        3  3670 1 1 68 ALA HB1  H   9.951  10.745  21.286 1.00 . A A . 68 ALA HB1  1 1 
        3  3671 1 1 68 ALA HB2  H  10.706  10.648  19.698 1.00 . A A . 68 ALA HB2  1 1 
        3  3672 1 1 68 ALA HB3  H  11.210   9.551  20.981 1.00 . A A . 68 ALA HB3  1 1 
        3  3673 1 1 68 ALA N    N   9.691   7.701  20.591 1.00 . A A . 68 ALA N    1 1 
        3  3674 1 1 68 ALA O    O   8.229   9.482  17.994 1.00 . A A . 68 ALA O    1 1 
        3  3675 1 1 69 ASP C    C   8.888   7.391  16.137 1.00 . A A . 69 ASP C    1 1 
        3  3676 1 1 69 ASP CA   C  10.152   8.168  16.494 1.00 . A A . 69 ASP CA   1 1 
        3  3677 1 1 69 ASP CB   C  11.385   7.367  16.069 1.00 . A A . 69 ASP CB   1 1 
        3  3678 1 1 69 ASP CG   C  12.623   8.256  16.154 1.00 . A A . 69 ASP CG   1 1 
        3  3679 1 1 69 ASP H    H  10.887   7.945  18.485 1.00 . A A . 69 ASP H    1 1 
        3  3680 1 1 69 ASP HA   H  10.147   9.099  15.945 1.00 . A A . 69 ASP HA   1 1 
        3  3681 1 1 69 ASP HB2  H  11.507   6.515  16.723 1.00 . A A . 69 ASP HB2  1 1 
        3  3682 1 1 69 ASP HB3  H  11.260   7.025  15.052 1.00 . A A . 69 ASP HB3  1 1 
        3  3683 1 1 69 ASP N    N  10.181   8.358  17.946 1.00 . A A . 69 ASP N    1 1 
        3  3684 1 1 69 ASP O    O   8.131   7.775  15.247 1.00 . A A . 69 ASP O    1 1 
        3  3685 1 1 69 ASP OD1  O  12.446   9.459  16.259 1.00 . A A . 69 ASP OD1  1 1 
        3  3686 1 1 69 ASP OD2  O  13.722   7.731  16.092 1.00 . A A . 69 ASP OD2  1 1 
        3  3687 1 1 70 ALA C    C   6.220   6.199  16.845 1.00 . A A . 70 ALA C    1 1 
        3  3688 1 1 70 ALA CA   C   7.525   5.432  16.614 1.00 . A A . 70 ALA CA   1 1 
        3  3689 1 1 70 ALA CB   C   7.581   4.219  17.546 1.00 . A A . 70 ALA CB   1 1 
        3  3690 1 1 70 ALA H    H   9.377   6.027  17.484 1.00 . A A . 70 ALA H    1 1 
        3  3691 1 1 70 ALA HA   H   7.547   5.083  15.593 1.00 . A A . 70 ALA HA   1 1 
        3  3692 1 1 70 ALA HB1  H   7.228   4.501  18.527 1.00 . A A . 70 ALA HB1  1 1 
        3  3693 1 1 70 ALA HB2  H   8.599   3.866  17.618 1.00 . A A . 70 ALA HB2  1 1 
        3  3694 1 1 70 ALA HB3  H   6.955   3.432  17.152 1.00 . A A . 70 ALA HB3  1 1 
        3  3695 1 1 70 ALA N    N   8.685   6.290  16.842 1.00 . A A . 70 ALA N    1 1 
        3  3696 1 1 70 ALA O    O   5.235   5.993  16.138 1.00 . A A . 70 ALA O    1 1 
        3  3697 1 1 71 SER C    C   4.599   8.731  17.003 1.00 . A A . 71 SER C    1 1 
        3  3698 1 1 71 SER CA   C   5.023   7.843  18.171 1.00 . A A . 71 SER CA   1 1 
        3  3699 1 1 71 SER CB   C   5.285   8.712  19.399 1.00 . A A . 71 SER CB   1 1 
        3  3700 1 1 71 SER H    H   7.023   7.184  18.386 1.00 . A A . 71 SER H    1 1 
        3  3701 1 1 71 SER HA   H   4.218   7.160  18.398 1.00 . A A . 71 SER HA   1 1 
        3  3702 1 1 71 SER HB2  H   6.168   9.308  19.239 1.00 . A A . 71 SER HB2  1 1 
        3  3703 1 1 71 SER HB3  H   4.438   9.365  19.564 1.00 . A A . 71 SER HB3  1 1 
        3  3704 1 1 71 SER HG   H   6.429   7.731  20.631 1.00 . A A . 71 SER HG   1 1 
        3  3705 1 1 71 SER N    N   6.216   7.068  17.848 1.00 . A A . 71 SER N    1 1 
        3  3706 1 1 71 SER O    O   3.407   8.877  16.731 1.00 . A A . 71 SER O    1 1 
        3  3707 1 1 71 SER OG   O   5.484   7.877  20.533 1.00 . A A . 71 SER OG   1 1 
        3  3708 1 1 72 SER C    C   6.022   9.782  13.927 1.00 . A A . 72 SER C    1 1 
        3  3709 1 1 72 SER CA   C   5.283  10.226  15.187 1.00 . A A . 72 SER CA   1 1 
        3  3710 1 1 72 SER CB   C   5.702  11.653  15.539 1.00 . A A . 72 SER CB   1 1 
        3  3711 1 1 72 SER H    H   6.507   9.191  16.587 1.00 . A A . 72 SER H    1 1 
        3  3712 1 1 72 SER HA   H   4.220  10.221  14.984 1.00 . A A . 72 SER HA   1 1 
        3  3713 1 1 72 SER HB2  H   5.115  12.009  16.371 1.00 . A A . 72 SER HB2  1 1 
        3  3714 1 1 72 SER HB3  H   6.749  11.663  15.812 1.00 . A A . 72 SER HB3  1 1 
        3  3715 1 1 72 SER HG   H   5.938  13.329  14.577 1.00 . A A . 72 SER HG   1 1 
        3  3716 1 1 72 SER N    N   5.575   9.336  16.320 1.00 . A A . 72 SER N    1 1 
        3  3717 1 1 72 SER O    O   7.222   9.517  13.957 1.00 . A A . 72 SER O    1 1 
        3  3718 1 1 72 SER OG   O   5.482  12.499  14.418 1.00 . A A . 72 SER OG   1 1 
        3  3719 1 1 73 THR C    C   6.659   8.016  11.691 1.00 . A A . 73 THR C    1 1 
        3  3720 1 1 73 THR CA   C   5.876   9.319  11.540 1.00 . A A . 73 THR CA   1 1 
        3  3721 1 1 73 THR CB   C   6.807  10.427  11.031 1.00 . A A . 73 THR CB   1 1 
        3  3722 1 1 73 THR CG2  C   7.217  10.147   9.579 1.00 . A A . 73 THR CG2  1 1 
        3  3723 1 1 73 THR H    H   4.340   9.952  12.855 1.00 . A A . 73 THR H    1 1 
        3  3724 1 1 73 THR HA   H   5.085   9.175  10.820 1.00 . A A . 73 THR HA   1 1 
        3  3725 1 1 73 THR HB   H   7.689  10.473  11.649 1.00 . A A . 73 THR HB   1 1 
        3  3726 1 1 73 THR HG1  H   5.742  11.836  10.216 1.00 . A A . 73 THR HG1  1 1 
        3  3727 1 1 73 THR HG21 H   6.429  10.468   8.916 1.00 . A A . 73 THR HG21 1 1 
        3  3728 1 1 73 THR HG22 H   7.393   9.091   9.443 1.00 . A A . 73 THR HG22 1 1 
        3  3729 1 1 73 THR HG23 H   8.121  10.692   9.350 1.00 . A A . 73 THR HG23 1 1 
        3  3730 1 1 73 THR N    N   5.290   9.719  12.817 1.00 . A A . 73 THR N    1 1 
        3  3731 1 1 73 THR O    O   7.862   7.970  11.431 1.00 . A A . 73 THR O    1 1 
        3  3732 1 1 73 THR OG1  O   6.121  11.671  11.081 1.00 . A A . 73 THR OG1  1 1 
        3  3733 1 1 74 PRO C    C   7.010   4.976  10.955 1.00 . A A . 74 PRO C    1 1 
        3  3734 1 1 74 PRO CA   C   6.657   5.631  12.291 1.00 . A A . 74 PRO CA   1 1 
        3  3735 1 1 74 PRO CB   C   5.597   4.820  13.050 1.00 . A A . 74 PRO CB   1 1 
        3  3736 1 1 74 PRO CD   C   4.570   6.919  12.446 1.00 . A A . 74 PRO CD   1 1 
        3  3737 1 1 74 PRO CG   C   4.294   5.426  12.642 1.00 . A A . 74 PRO CG   1 1 
        3  3738 1 1 74 PRO HA   H   7.541   5.731  12.899 1.00 . A A . 74 PRO HA   1 1 
        3  3739 1 1 74 PRO HB2  H   5.639   3.775  12.766 1.00 . A A . 74 PRO HB2  1 1 
        3  3740 1 1 74 PRO HB3  H   5.736   4.924  14.115 1.00 . A A . 74 PRO HB3  1 1 
        3  3741 1 1 74 PRO HD2  H   3.969   7.312  11.637 1.00 . A A . 74 PRO HD2  1 1 
        3  3742 1 1 74 PRO HD3  H   4.387   7.467  13.358 1.00 . A A . 74 PRO HD3  1 1 
        3  3743 1 1 74 PRO HG2  H   3.952   4.981  11.714 1.00 . A A . 74 PRO HG2  1 1 
        3  3744 1 1 74 PRO HG3  H   3.555   5.289  13.416 1.00 . A A . 74 PRO HG3  1 1 
        3  3745 1 1 74 PRO N    N   6.004   6.963  12.105 1.00 . A A . 74 PRO N    1 1 
        3  3746 1 1 74 PRO O    O   6.344   5.205   9.945 1.00 . A A . 74 PRO O    1 1 
        3  3747 1 1 75 LYS C    C   7.377   2.565   9.227 1.00 . A A . 75 LYS C    1 1 
        3  3748 1 1 75 LYS CA   C   8.486   3.476   9.744 1.00 . A A . 75 LYS CA   1 1 
        3  3749 1 1 75 LYS CB   C   9.741   2.647  10.025 1.00 . A A . 75 LYS CB   1 1 
        3  3750 1 1 75 LYS CD   C  11.601   1.376   8.884 1.00 . A A . 75 LYS CD   1 1 
        3  3751 1 1 75 LYS CE   C  11.606   0.160   9.818 1.00 . A A . 75 LYS CE   1 1 
        3  3752 1 1 75 LYS CG   C  10.178   1.937   8.737 1.00 . A A . 75 LYS CG   1 1 
        3  3753 1 1 75 LYS H    H   8.551   4.013  11.794 1.00 . A A . 75 LYS H    1 1 
        3  3754 1 1 75 LYS HA   H   8.716   4.212   8.990 1.00 . A A . 75 LYS HA   1 1 
        3  3755 1 1 75 LYS HB2  H  10.533   3.298  10.370 1.00 . A A . 75 LYS HB2  1 1 
        3  3756 1 1 75 LYS HB3  H   9.518   1.915  10.784 1.00 . A A . 75 LYS HB3  1 1 
        3  3757 1 1 75 LYS HD2  H  11.968   1.080   7.912 1.00 . A A . 75 LYS HD2  1 1 
        3  3758 1 1 75 LYS HD3  H  12.248   2.139   9.290 1.00 . A A . 75 LYS HD3  1 1 
        3  3759 1 1 75 LYS HE2  H  12.611  -0.228   9.892 1.00 . A A . 75 LYS HE2  1 1 
        3  3760 1 1 75 LYS HE3  H  11.263   0.447  10.798 1.00 . A A . 75 LYS HE3  1 1 
        3  3761 1 1 75 LYS HG2  H   9.496   1.125   8.530 1.00 . A A . 75 LYS HG2  1 1 
        3  3762 1 1 75 LYS HG3  H  10.157   2.639   7.918 1.00 . A A . 75 LYS HG3  1 1 
        3  3763 1 1 75 LYS HZ1  H  10.883  -1.792   9.761 1.00 . A A . 75 LYS HZ1  1 1 
        3  3764 1 1 75 LYS HZ2  H  10.911  -1.020   8.248 1.00 . A A . 75 LYS HZ2  1 1 
        3  3765 1 1 75 LYS HZ3  H   9.720  -0.615   9.391 1.00 . A A . 75 LYS HZ3  1 1 
        3  3766 1 1 75 LYS N    N   8.058   4.160  10.959 1.00 . A A . 75 LYS N    1 1 
        3  3767 1 1 75 LYS NZ   N  10.713  -0.896   9.262 1.00 . A A . 75 LYS NZ   1 1 
        3  3768 1 1 75 LYS O    O   7.097   2.532   8.028 1.00 . A A . 75 LYS O    1 1 
        3  3769 1 1 76 PHE C    C   4.499   1.695   9.170 1.00 . A A . 76 PHE C    1 1 
        3  3770 1 1 76 PHE CA   C   5.672   0.921   9.764 1.00 . A A . 76 PHE CA   1 1 
        3  3771 1 1 76 PHE CB   C   5.200   0.149  10.998 1.00 . A A . 76 PHE CB   1 1 
        3  3772 1 1 76 PHE CD1  C   4.323  -2.022  10.059 1.00 . A A . 76 PHE CD1  1 1 
        3  3773 1 1 76 PHE CD2  C   2.738  -0.364  10.843 1.00 . A A . 76 PHE CD2  1 1 
        3  3774 1 1 76 PHE CE1  C   3.265  -2.873   9.719 1.00 . A A . 76 PHE CE1  1 1 
        3  3775 1 1 76 PHE CE2  C   1.679  -1.214  10.503 1.00 . A A . 76 PHE CE2  1 1 
        3  3776 1 1 76 PHE CG   C   4.060  -0.767  10.622 1.00 . A A . 76 PHE CG   1 1 
        3  3777 1 1 76 PHE CZ   C   1.943  -2.469   9.941 1.00 . A A . 76 PHE CZ   1 1 
        3  3778 1 1 76 PHE H    H   7.017   1.898  11.078 1.00 . A A . 76 PHE H    1 1 
        3  3779 1 1 76 PHE HA   H   6.039   0.218   9.032 1.00 . A A . 76 PHE HA   1 1 
        3  3780 1 1 76 PHE HB2  H   6.018  -0.437  11.389 1.00 . A A . 76 PHE HB2  1 1 
        3  3781 1 1 76 PHE HB3  H   4.866   0.847  11.751 1.00 . A A . 76 PHE HB3  1 1 
        3  3782 1 1 76 PHE HD1  H   5.343  -2.334   9.888 1.00 . A A . 76 PHE HD1  1 1 
        3  3783 1 1 76 PHE HD2  H   2.534   0.604  11.277 1.00 . A A . 76 PHE HD2  1 1 
        3  3784 1 1 76 PHE HE1  H   3.468  -3.841   9.285 1.00 . A A . 76 PHE HE1  1 1 
        3  3785 1 1 76 PHE HE2  H   0.659  -0.903  10.674 1.00 . A A . 76 PHE HE2  1 1 
        3  3786 1 1 76 PHE HZ   H   1.127  -3.125   9.678 1.00 . A A . 76 PHE HZ   1 1 
        3  3787 1 1 76 PHE N    N   6.750   1.829  10.138 1.00 . A A . 76 PHE N    1 1 
        3  3788 1 1 76 PHE O    O   4.010   2.654   9.768 1.00 . A A . 76 PHE O    1 1 
        3  3789 1 1 77 ASN C    C   1.991   0.882   6.704 1.00 . A A . 77 ASN C    1 1 
        3  3790 1 1 77 ASN CA   C   2.925   1.922   7.315 1.00 . A A . 77 ASN CA   1 1 
        3  3791 1 1 77 ASN CB   C   3.442   2.860   6.222 1.00 . A A . 77 ASN CB   1 1 
        3  3792 1 1 77 ASN CG   C   4.235   2.077   5.181 1.00 . A A . 77 ASN CG   1 1 
        3  3793 1 1 77 ASN H    H   4.479   0.498   7.566 1.00 . A A . 77 ASN H    1 1 
        3  3794 1 1 77 ASN HA   H   2.365   2.505   8.034 1.00 . A A . 77 ASN HA   1 1 
        3  3795 1 1 77 ASN HB2  H   2.605   3.345   5.743 1.00 . A A . 77 ASN HB2  1 1 
        3  3796 1 1 77 ASN HB3  H   4.082   3.607   6.668 1.00 . A A . 77 ASN HB3  1 1 
        3  3797 1 1 77 ASN HD21 H   5.206   3.676   4.516 1.00 . A A . 77 ASN HD21 1 1 
        3  3798 1 1 77 ASN HD22 H   5.598   2.216   3.745 1.00 . A A . 77 ASN HD22 1 1 
        3  3799 1 1 77 ASN N    N   4.049   1.269   7.990 1.00 . A A . 77 ASN N    1 1 
        3  3800 1 1 77 ASN ND2  N   5.083   2.709   4.417 1.00 . A A . 77 ASN ND2  1 1 
        3  3801 1 1 77 ASN O    O   1.179   1.197   5.835 1.00 . A A . 77 ASN O    1 1 
        3  3802 1 1 77 ASN OD1  O   4.078   0.862   5.058 1.00 . A A . 77 ASN OD1  1 1 
        3  3803 1 1 78 GLY C    C  -0.148  -1.319   7.191 1.00 . A A . 78 GLY C    1 1 
        3  3804 1 1 78 GLY CA   C   1.275  -1.438   6.656 1.00 . A A . 78 GLY CA   1 1 
        3  3805 1 1 78 GLY H    H   2.778  -0.552   7.858 1.00 . A A . 78 GLY H    1 1 
        3  3806 1 1 78 GLY HA2  H   1.255  -1.393   5.577 1.00 . A A . 78 GLY HA2  1 1 
        3  3807 1 1 78 GLY HA3  H   1.689  -2.385   6.965 1.00 . A A . 78 GLY HA3  1 1 
        3  3808 1 1 78 GLY N    N   2.113  -0.359   7.165 1.00 . A A . 78 GLY N    1 1 
        3  3809 1 1 78 GLY O    O  -0.414  -0.542   8.108 1.00 . A A . 78 GLY O    1 1 
        3  3810 1 1 79 VAL C    C  -2.892  -3.452   7.532 1.00 . A A . 79 VAL C    1 1 
        3  3811 1 1 79 VAL CA   C  -2.469  -2.078   7.024 1.00 . A A . 79 VAL CA   1 1 
        3  3812 1 1 79 VAL CB   C  -3.354  -1.680   5.841 1.00 . A A . 79 VAL CB   1 1 
        3  3813 1 1 79 VAL CG1  C  -4.821  -1.694   6.274 1.00 . A A . 79 VAL CG1  1 1 
        3  3814 1 1 79 VAL CG2  C  -2.974  -0.274   5.372 1.00 . A A . 79 VAL CG2  1 1 
        3  3815 1 1 79 VAL H    H  -0.789  -2.692   5.882 1.00 . A A . 79 VAL H    1 1 
        3  3816 1 1 79 VAL HA   H  -2.606  -1.356   7.818 1.00 . A A . 79 VAL HA   1 1 
        3  3817 1 1 79 VAL HB   H  -3.211  -2.383   5.033 1.00 . A A . 79 VAL HB   1 1 
        3  3818 1 1 79 VAL HG11 H  -5.420  -1.188   5.530 1.00 . A A . 79 VAL HG11 1 1 
        3  3819 1 1 79 VAL HG12 H  -4.921  -1.186   7.221 1.00 . A A . 79 VAL HG12 1 1 
        3  3820 1 1 79 VAL HG13 H  -5.157  -2.714   6.374 1.00 . A A . 79 VAL HG13 1 1 
        3  3821 1 1 79 VAL HG21 H  -3.055   0.416   6.200 1.00 . A A . 79 VAL HG21 1 1 
        3  3822 1 1 79 VAL HG22 H  -3.641   0.034   4.581 1.00 . A A . 79 VAL HG22 1 1 
        3  3823 1 1 79 VAL HG23 H  -1.958  -0.278   5.005 1.00 . A A . 79 VAL HG23 1 1 
        3  3824 1 1 79 VAL N    N  -1.063  -2.095   6.609 1.00 . A A . 79 VAL N    1 1 
        3  3825 1 1 79 VAL O    O  -2.715  -4.460   6.847 1.00 . A A . 79 VAL O    1 1 
        3  3826 1 1 80 LYS C    C  -4.996  -5.371   8.476 1.00 . A A . 80 LYS C    1 1 
        3  3827 1 1 80 LYS CA   C  -3.897  -4.742   9.329 1.00 . A A . 80 LYS CA   1 1 
        3  3828 1 1 80 LYS CB   C  -4.431  -4.491  10.744 1.00 . A A . 80 LYS CB   1 1 
        3  3829 1 1 80 LYS CD   C  -2.556  -5.374  12.192 1.00 . A A . 80 LYS CD   1 1 
        3  3830 1 1 80 LYS CE   C  -1.526  -4.980  13.252 1.00 . A A . 80 LYS CE   1 1 
        3  3831 1 1 80 LYS CG   C  -3.283  -4.115  11.698 1.00 . A A . 80 LYS CG   1 1 
        3  3832 1 1 80 LYS H    H  -3.569  -2.650   9.237 1.00 . A A . 80 LYS H    1 1 
        3  3833 1 1 80 LYS HA   H  -3.064  -5.421   9.378 1.00 . A A . 80 LYS HA   1 1 
        3  3834 1 1 80 LYS HB2  H  -5.149  -3.683  10.715 1.00 . A A . 80 LYS HB2  1 1 
        3  3835 1 1 80 LYS HB3  H  -4.919  -5.385  11.106 1.00 . A A . 80 LYS HB3  1 1 
        3  3836 1 1 80 LYS HD2  H  -3.271  -6.060  12.622 1.00 . A A . 80 LYS HD2  1 1 
        3  3837 1 1 80 LYS HD3  H  -2.051  -5.853  11.370 1.00 . A A . 80 LYS HD3  1 1 
        3  3838 1 1 80 LYS HE2  H  -0.805  -4.304  12.818 1.00 . A A . 80 LYS HE2  1 1 
        3  3839 1 1 80 LYS HE3  H  -2.025  -4.492  14.076 1.00 . A A . 80 LYS HE3  1 1 
        3  3840 1 1 80 LYS HG2  H  -2.581  -3.478  11.180 1.00 . A A . 80 LYS HG2  1 1 
        3  3841 1 1 80 LYS HG3  H  -3.686  -3.583  12.547 1.00 . A A . 80 LYS HG3  1 1 
        3  3842 1 1 80 LYS HZ1  H  -1.494  -6.787  14.287 1.00 . A A . 80 LYS HZ1  1 1 
        3  3843 1 1 80 LYS HZ2  H  -0.032  -5.921  14.357 1.00 . A A . 80 LYS HZ2  1 1 
        3  3844 1 1 80 LYS HZ3  H  -0.468  -6.746  12.936 1.00 . A A . 80 LYS HZ3  1 1 
        3  3845 1 1 80 LYS N    N  -3.452  -3.485   8.737 1.00 . A A . 80 LYS N    1 1 
        3  3846 1 1 80 LYS NZ   N  -0.828  -6.201  13.745 1.00 . A A . 80 LYS NZ   1 1 
        3  3847 1 1 80 LYS O    O  -5.030  -6.587   8.290 1.00 . A A . 80 LYS O    1 1 
        3  3848 1 1 81 LYS C    C  -6.476  -5.373   5.734 1.00 . A A . 81 LYS C    1 1 
        3  3849 1 1 81 LYS CA   C  -6.985  -5.020   7.128 1.00 . A A . 81 LYS CA   1 1 
        3  3850 1 1 81 LYS CB   C  -8.076  -3.950   7.026 1.00 . A A . 81 LYS CB   1 1 
        3  3851 1 1 81 LYS CD   C -10.362  -3.431   6.158 1.00 . A A . 81 LYS CD   1 1 
        3  3852 1 1 81 LYS CE   C -11.554  -3.978   5.370 1.00 . A A . 81 LYS CE   1 1 
        3  3853 1 1 81 LYS CG   C  -9.256  -4.487   6.211 1.00 . A A . 81 LYS CG   1 1 
        3  3854 1 1 81 LYS H    H  -5.813  -3.574   8.142 1.00 . A A . 81 LYS H    1 1 
        3  3855 1 1 81 LYS HA   H  -7.405  -5.905   7.583 1.00 . A A . 81 LYS HA   1 1 
        3  3856 1 1 81 LYS HB2  H  -8.413  -3.687   8.018 1.00 . A A . 81 LYS HB2  1 1 
        3  3857 1 1 81 LYS HB3  H  -7.675  -3.074   6.540 1.00 . A A . 81 LYS HB3  1 1 
        3  3858 1 1 81 LYS HD2  H -10.675  -3.187   7.163 1.00 . A A . 81 LYS HD2  1 1 
        3  3859 1 1 81 LYS HD3  H  -9.989  -2.543   5.672 1.00 . A A . 81 LYS HD3  1 1 
        3  3860 1 1 81 LYS HE2  H -11.892  -4.898   5.823 1.00 . A A . 81 LYS HE2  1 1 
        3  3861 1 1 81 LYS HE3  H -12.355  -3.254   5.381 1.00 . A A . 81 LYS HE3  1 1 
        3  3862 1 1 81 LYS HG2  H  -8.929  -4.714   5.207 1.00 . A A . 81 LYS HG2  1 1 
        3  3863 1 1 81 LYS HG3  H  -9.639  -5.382   6.677 1.00 . A A . 81 LYS HG3  1 1 
        3  3864 1 1 81 LYS HZ1  H -10.930  -5.251   3.845 1.00 . A A . 81 LYS HZ1  1 1 
        3  3865 1 1 81 LYS HZ2  H -10.291  -3.680   3.741 1.00 . A A . 81 LYS HZ2  1 1 
        3  3866 1 1 81 LYS HZ3  H -11.911  -3.971   3.319 1.00 . A A . 81 LYS HZ3  1 1 
        3  3867 1 1 81 LYS N    N  -5.890  -4.534   7.960 1.00 . A A . 81 LYS N    1 1 
        3  3868 1 1 81 LYS NZ   N -11.140  -4.240   3.963 1.00 . A A . 81 LYS NZ   1 1 
        3  3869 1 1 81 LYS O    O  -6.381  -4.475   4.914 1.00 . A A . 81 LYS O    1 1 
        3  3870 1 1 81 LYS OXT  O  -6.189  -6.536   5.506 1.00 . A A . 81 LYS OXT  1 1 
        4  3871 1 1  1 MET C    C  -4.284  11.021  -7.821 1.00 . A A .  1 MET C    1 1 
        4  3872 1 1  1 MET CA   C  -4.845  12.060  -8.785 1.00 . A A .  1 MET CA   1 1 
        4  3873 1 1  1 MET CB   C  -4.830  11.505 -10.211 1.00 . A A .  1 MET CB   1 1 
        4  3874 1 1  1 MET CE   C  -6.441  10.393 -12.724 1.00 . A A .  1 MET CE   1 1 
        4  3875 1 1  1 MET CG   C  -5.599  12.450 -11.137 1.00 . A A .  1 MET CG   1 1 
        4  3876 1 1  1 MET H1   H  -3.490  13.317  -7.826 1.00 . A A .  1 MET H1   1 1 
        4  3877 1 1  1 MET H2   H  -4.623  14.130  -8.795 1.00 . A A .  1 MET H2   1 1 
        4  3878 1 1  1 MET H3   H  -3.333  13.291  -9.514 1.00 . A A .  1 MET H3   1 1 
        4  3879 1 1  1 MET HA   H  -5.860  12.300  -8.504 1.00 . A A .  1 MET HA   1 1 
        4  3880 1 1  1 MET HB2  H  -3.808  11.417 -10.552 1.00 . A A .  1 MET HB2  1 1 
        4  3881 1 1  1 MET HB3  H  -5.298  10.533 -10.223 1.00 . A A .  1 MET HB3  1 1 
        4  3882 1 1  1 MET HE1  H  -7.300  10.591 -12.097 1.00 . A A .  1 MET HE1  1 1 
        4  3883 1 1  1 MET HE2  H  -5.858   9.598 -12.289 1.00 . A A .  1 MET HE2  1 1 
        4  3884 1 1  1 MET HE3  H  -6.769  10.097 -13.711 1.00 . A A .  1 MET HE3  1 1 
        4  3885 1 1  1 MET HG2  H  -6.643  12.455 -10.861 1.00 . A A .  1 MET HG2  1 1 
        4  3886 1 1  1 MET HG3  H  -5.198  13.448 -11.045 1.00 . A A .  1 MET HG3  1 1 
        4  3887 1 1  1 MET N    N  -4.009  13.293  -8.726 1.00 . A A .  1 MET N    1 1 
        4  3888 1 1  1 MET O    O  -4.420   9.818  -8.042 1.00 . A A .  1 MET O    1 1 
        4  3889 1 1  1 MET SD   S  -5.428  11.889 -12.853 1.00 . A A .  1 MET SD   1 1 
        4  3890 1 1  2 LYS C    C  -4.111  10.235  -4.697 1.00 . A A .  2 LYS C    1 1 
        4  3891 1 1  2 LYS CA   C  -3.064  10.595  -5.754 1.00 . A A .  2 LYS CA   1 1 
        4  3892 1 1  2 LYS CB   C  -1.852  11.280  -5.088 1.00 . A A .  2 LYS CB   1 1 
        4  3893 1 1  2 LYS CD   C  -0.658  11.523  -7.277 1.00 . A A .  2 LYS CD   1 1 
        4  3894 1 1  2 LYS CE   C   0.661  11.277  -8.011 1.00 . A A .  2 LYS CE   1 1 
        4  3895 1 1  2 LYS CG   C  -0.565  10.955  -5.859 1.00 . A A .  2 LYS CG   1 1 
        4  3896 1 1  2 LYS H    H  -3.569  12.462  -6.627 1.00 . A A .  2 LYS H    1 1 
        4  3897 1 1  2 LYS HA   H  -2.739   9.685  -6.242 1.00 . A A .  2 LYS HA   1 1 
        4  3898 1 1  2 LYS HB2  H  -2.005  12.349  -5.085 1.00 . A A .  2 LYS HB2  1 1 
        4  3899 1 1  2 LYS HB3  H  -1.747  10.933  -4.070 1.00 . A A .  2 LYS HB3  1 1 
        4  3900 1 1  2 LYS HD2  H  -1.464  11.035  -7.808 1.00 . A A .  2 LYS HD2  1 1 
        4  3901 1 1  2 LYS HD3  H  -0.850  12.584  -7.229 1.00 . A A .  2 LYS HD3  1 1 
        4  3902 1 1  2 LYS HE2  H   1.464  11.769  -7.482 1.00 . A A .  2 LYS HE2  1 1 
        4  3903 1 1  2 LYS HE3  H   0.856  10.216  -8.056 1.00 . A A .  2 LYS HE3  1 1 
        4  3904 1 1  2 LYS HG2  H   0.279  11.398  -5.350 1.00 . A A .  2 LYS HG2  1 1 
        4  3905 1 1  2 LYS HG3  H  -0.434   9.885  -5.909 1.00 . A A .  2 LYS HG3  1 1 
        4  3906 1 1  2 LYS HZ1  H  -0.419  12.066  -9.608 1.00 . A A .  2 LYS HZ1  1 1 
        4  3907 1 1  2 LYS HZ2  H   0.907  11.110 -10.073 1.00 . A A .  2 LYS HZ2  1 1 
        4  3908 1 1  2 LYS HZ3  H   1.157  12.678  -9.469 1.00 . A A .  2 LYS HZ3  1 1 
        4  3909 1 1  2 LYS N    N  -3.649  11.493  -6.750 1.00 . A A .  2 LYS N    1 1 
        4  3910 1 1  2 LYS NZ   N   0.569  11.824  -9.395 1.00 . A A .  2 LYS NZ   1 1 
        4  3911 1 1  2 LYS O    O  -4.302  10.964  -3.724 1.00 . A A .  2 LYS O    1 1 
        4  3912 1 1  3 ASP C    C  -5.177   8.371  -2.580 1.00 . A A .  3 ASP C    1 1 
        4  3913 1 1  3 ASP CA   C  -5.796   8.644  -3.958 1.00 . A A .  3 ASP CA   1 1 
        4  3914 1 1  3 ASP CB   C  -6.478   7.370  -4.500 1.00 . A A .  3 ASP CB   1 1 
        4  3915 1 1  3 ASP CG   C  -7.926   7.265  -4.019 1.00 . A A .  3 ASP CG   1 1 
        4  3916 1 1  3 ASP H    H  -4.577   8.562  -5.690 1.00 . A A .  3 ASP H    1 1 
        4  3917 1 1  3 ASP HA   H  -6.538   9.423  -3.855 1.00 . A A .  3 ASP HA   1 1 
        4  3918 1 1  3 ASP HB2  H  -6.468   7.396  -5.578 1.00 . A A .  3 ASP HB2  1 1 
        4  3919 1 1  3 ASP HB3  H  -5.940   6.495  -4.166 1.00 . A A .  3 ASP HB3  1 1 
        4  3920 1 1  3 ASP N    N  -4.777   9.102  -4.897 1.00 . A A .  3 ASP N    1 1 
        4  3921 1 1  3 ASP O    O  -5.788   8.670  -1.554 1.00 . A A .  3 ASP O    1 1 
        4  3922 1 1  3 ASP OD1  O  -8.325   8.058  -3.182 1.00 . A A .  3 ASP OD1  1 1 
        4  3923 1 1  3 ASP OD2  O  -8.612   6.380  -4.503 1.00 . A A .  3 ASP OD2  1 1 
        4  3924 1 1  4 PRO C    C  -2.944   8.731  -0.434 1.00 . A A .  4 PRO C    1 1 
        4  3925 1 1  4 PRO CA   C  -3.297   7.478  -1.244 1.00 . A A .  4 PRO CA   1 1 
        4  3926 1 1  4 PRO CB   C  -2.018   6.726  -1.680 1.00 . A A .  4 PRO CB   1 1 
        4  3927 1 1  4 PRO CD   C  -3.162   7.399  -3.687 1.00 . A A .  4 PRO CD   1 1 
        4  3928 1 1  4 PRO CG   C  -2.262   6.320  -3.099 1.00 . A A .  4 PRO CG   1 1 
        4  3929 1 1  4 PRO HA   H  -3.912   6.823  -0.659 1.00 . A A .  4 PRO HA   1 1 
        4  3930 1 1  4 PRO HB2  H  -1.153   7.378  -1.621 1.00 . A A .  4 PRO HB2  1 1 
        4  3931 1 1  4 PRO HB3  H  -1.863   5.851  -1.064 1.00 . A A .  4 PRO HB3  1 1 
        4  3932 1 1  4 PRO HD2  H  -2.568   8.231  -4.044 1.00 . A A .  4 PRO HD2  1 1 
        4  3933 1 1  4 PRO HD3  H  -3.770   6.997  -4.474 1.00 . A A .  4 PRO HD3  1 1 
        4  3934 1 1  4 PRO HG2  H  -1.327   6.269  -3.642 1.00 . A A .  4 PRO HG2  1 1 
        4  3935 1 1  4 PRO HG3  H  -2.768   5.366  -3.136 1.00 . A A .  4 PRO HG3  1 1 
        4  3936 1 1  4 PRO N    N  -3.989   7.801  -2.532 1.00 . A A .  4 PRO N    1 1 
        4  3937 1 1  4 PRO O    O  -2.366   8.640   0.647 1.00 . A A .  4 PRO O    1 1 
        4  3938 1 1  5 LYS C    C  -3.992  11.422   0.870 1.00 . A A .  5 LYS C    1 1 
        4  3939 1 1  5 LYS CA   C  -3.016  11.154  -0.283 1.00 . A A .  5 LYS CA   1 1 
        4  3940 1 1  5 LYS CB   C  -3.132  12.300  -1.299 1.00 . A A .  5 LYS CB   1 1 
        4  3941 1 1  5 LYS CD   C  -1.079  13.703  -0.851 1.00 . A A .  5 LYS CD   1 1 
        4  3942 1 1  5 LYS CE   C  -0.592  15.064  -0.350 1.00 . A A .  5 LYS CE   1 1 
        4  3943 1 1  5 LYS CG   C  -2.604  13.620  -0.703 1.00 . A A .  5 LYS CG   1 1 
        4  3944 1 1  5 LYS H    H  -3.795   9.904  -1.808 1.00 . A A .  5 LYS H    1 1 
        4  3945 1 1  5 LYS HA   H  -2.004  11.130   0.083 1.00 . A A .  5 LYS HA   1 1 
        4  3946 1 1  5 LYS HB2  H  -2.561  12.051  -2.182 1.00 . A A .  5 LYS HB2  1 1 
        4  3947 1 1  5 LYS HB3  H  -4.169  12.426  -1.573 1.00 . A A .  5 LYS HB3  1 1 
        4  3948 1 1  5 LYS HD2  H  -0.613  12.922  -0.270 1.00 . A A .  5 LYS HD2  1 1 
        4  3949 1 1  5 LYS HD3  H  -0.810  13.588  -1.890 1.00 . A A .  5 LYS HD3  1 1 
        4  3950 1 1  5 LYS HE2  H  -0.856  15.180   0.690 1.00 . A A .  5 LYS HE2  1 1 
        4  3951 1 1  5 LYS HE3  H   0.481  15.124  -0.457 1.00 . A A .  5 LYS HE3  1 1 
        4  3952 1 1  5 LYS HG2  H  -3.055  14.452  -1.224 1.00 . A A .  5 LYS HG2  1 1 
        4  3953 1 1  5 LYS HG3  H  -2.862  13.677   0.343 1.00 . A A .  5 LYS HG3  1 1 
        4  3954 1 1  5 LYS HZ1  H  -2.228  16.242  -0.869 1.00 . A A .  5 LYS HZ1  1 1 
        4  3955 1 1  5 LYS HZ2  H  -1.179  15.906  -2.162 1.00 . A A .  5 LYS HZ2  1 1 
        4  3956 1 1  5 LYS HZ3  H  -0.737  17.043  -0.979 1.00 . A A .  5 LYS HZ3  1 1 
        4  3957 1 1  5 LYS N    N  -3.297   9.894  -0.963 1.00 . A A .  5 LYS N    1 1 
        4  3958 1 1  5 LYS NZ   N  -1.233  16.145  -1.151 1.00 . A A .  5 LYS NZ   1 1 
        4  3959 1 1  5 LYS O    O  -3.594  11.680   2.005 1.00 . A A .  5 LYS O    1 1 
        4  3960 1 1  6 THR C    C  -6.581  10.175   2.323 1.00 . A A .  6 THR C    1 1 
        4  3961 1 1  6 THR CA   C  -6.380  11.451   1.494 1.00 . A A .  6 THR CA   1 1 
        4  3962 1 1  6 THR CB   C  -7.672  11.776   0.740 1.00 . A A .  6 THR CB   1 1 
        4  3963 1 1  6 THR CG2  C  -8.821  11.933   1.737 1.00 . A A .  6 THR CG2  1 1 
        4  3964 1 1  6 THR H    H  -5.489  10.947  -0.348 1.00 . A A .  6 THR H    1 1 
        4  3965 1 1  6 THR HA   H  -6.158  12.261   2.163 1.00 . A A .  6 THR HA   1 1 
        4  3966 1 1  6 THR HB   H  -7.901  10.974   0.055 1.00 . A A .  6 THR HB   1 1 
        4  3967 1 1  6 THR HG1  H  -7.058  13.616   0.587 1.00 . A A .  6 THR HG1  1 1 
        4  3968 1 1  6 THR HG21 H  -8.507  12.570   2.550 1.00 . A A .  6 THR HG21 1 1 
        4  3969 1 1  6 THR HG22 H  -9.097  10.963   2.123 1.00 . A A .  6 THR HG22 1 1 
        4  3970 1 1  6 THR HG23 H  -9.671  12.377   1.239 1.00 . A A .  6 THR HG23 1 1 
        4  3971 1 1  6 THR N    N  -5.276  11.297   0.542 1.00 . A A .  6 THR N    1 1 
        4  3972 1 1  6 THR O    O  -6.997  10.207   3.478 1.00 . A A .  6 THR O    1 1 
        4  3973 1 1  6 THR OG1  O  -7.502  12.987   0.015 1.00 . A A .  6 THR OG1  1 1 
        4  3974 1 1  7 LEU C    C  -5.404   7.692   3.539 1.00 . A A .  7 LEU C    1 1 
        4  3975 1 1  7 LEU CA   C  -6.352   7.754   2.325 1.00 . A A .  7 LEU CA   1 1 
        4  3976 1 1  7 LEU CB   C  -6.000   6.641   1.325 1.00 . A A .  7 LEU CB   1 1 
        4  3977 1 1  7 LEU CD1  C  -6.444   4.283   0.611 1.00 . A A .  7 LEU CD1  1 1 
        4  3978 1 1  7 LEU CD2  C  -6.189   4.811   3.053 1.00 . A A .  7 LEU CD2  1 1 
        4  3979 1 1  7 LEU CG   C  -6.709   5.328   1.700 1.00 . A A .  7 LEU CG   1 1 
        4  3980 1 1  7 LEU H    H  -5.821   9.226   0.818 1.00 . A A .  7 LEU H    1 1 
        4  3981 1 1  7 LEU HA   H  -7.365   7.616   2.677 1.00 . A A .  7 LEU HA   1 1 
        4  3982 1 1  7 LEU HB2  H  -6.308   6.941   0.334 1.00 . A A .  7 LEU HB2  1 1 
        4  3983 1 1  7 LEU HB3  H  -4.933   6.477   1.332 1.00 . A A .  7 LEU HB3  1 1 
        4  3984 1 1  7 LEU HD11 H  -5.425   3.935   0.684 1.00 . A A .  7 LEU HD11 1 1 
        4  3985 1 1  7 LEU HD12 H  -6.606   4.726  -0.361 1.00 . A A .  7 LEU HD12 1 1 
        4  3986 1 1  7 LEU HD13 H  -7.119   3.448   0.742 1.00 . A A .  7 LEU HD13 1 1 
        4  3987 1 1  7 LEU HD21 H  -5.131   5.017   3.143 1.00 . A A .  7 LEU HD21 1 1 
        4  3988 1 1  7 LEU HD22 H  -6.352   3.744   3.123 1.00 . A A .  7 LEU HD22 1 1 
        4  3989 1 1  7 LEU HD23 H  -6.721   5.303   3.851 1.00 . A A .  7 LEU HD23 1 1 
        4  3990 1 1  7 LEU HG   H  -7.772   5.505   1.768 1.00 . A A .  7 LEU HG   1 1 
        4  3991 1 1  7 LEU N    N  -6.249   9.069   1.685 1.00 . A A .  7 LEU N    1 1 
        4  3992 1 1  7 LEU O    O  -5.794   7.290   4.631 1.00 . A A .  7 LEU O    1 1 
        4  3993 1 1  8 LEU C    C  -3.304   9.397   5.300 1.00 . A A .  8 LEU C    1 1 
        4  3994 1 1  8 LEU CA   C  -3.110   8.213   4.338 1.00 . A A .  8 LEU CA   1 1 
        4  3995 1 1  8 LEU CB   C  -1.752   8.360   3.644 1.00 . A A .  8 LEU CB   1 1 
        4  3996 1 1  8 LEU CD1  C  -0.153   7.329   2.012 1.00 . A A .  8 LEU CD1  1 1 
        4  3997 1 1  8 LEU CD2  C  -1.199   5.890   3.790 1.00 . A A .  8 LEU CD2  1 1 
        4  3998 1 1  8 LEU CG   C  -1.423   7.088   2.841 1.00 . A A .  8 LEU CG   1 1 
        4  3999 1 1  8 LEU H    H  -3.937   8.501   2.444 1.00 . A A .  8 LEU H    1 1 
        4  4000 1 1  8 LEU HA   H  -3.110   7.282   4.881 1.00 . A A .  8 LEU HA   1 1 
        4  4001 1 1  8 LEU HB2  H  -1.787   9.208   2.975 1.00 . A A .  8 LEU HB2  1 1 
        4  4002 1 1  8 LEU HB3  H  -0.986   8.525   4.387 1.00 . A A .  8 LEU HB3  1 1 
        4  4003 1 1  8 LEU HD11 H   0.711   7.295   2.659 1.00 . A A .  8 LEU HD11 1 1 
        4  4004 1 1  8 LEU HD12 H  -0.208   8.296   1.534 1.00 . A A .  8 LEU HD12 1 1 
        4  4005 1 1  8 LEU HD13 H  -0.067   6.561   1.257 1.00 . A A .  8 LEU HD13 1 1 
        4  4006 1 1  8 LEU HD21 H  -0.782   6.232   4.727 1.00 . A A .  8 LEU HD21 1 1 
        4  4007 1 1  8 LEU HD22 H  -0.520   5.182   3.336 1.00 . A A .  8 LEU HD22 1 1 
        4  4008 1 1  8 LEU HD23 H  -2.143   5.399   3.977 1.00 . A A .  8 LEU HD23 1 1 
        4  4009 1 1  8 LEU HG   H  -2.244   6.868   2.174 1.00 . A A .  8 LEU HG   1 1 
        4  4010 1 1  8 LEU N    N  -4.173   8.137   3.322 1.00 . A A .  8 LEU N    1 1 
        4  4011 1 1  8 LEU O    O  -2.790   9.420   6.418 1.00 . A A .  8 LEU O    1 1 
        4  4012 1 1  9 ARG C    C  -5.218  11.262   6.825 1.00 . A A .  9 ARG C    1 1 
        4  4013 1 1  9 ARG CA   C  -4.397  11.575   5.570 1.00 . A A .  9 ARG CA   1 1 
        4  4014 1 1  9 ARG CB   C  -5.171  12.563   4.705 1.00 . A A .  9 ARG CB   1 1 
        4  4015 1 1  9 ARG CD   C  -5.987  14.918   4.555 1.00 . A A .  9 ARG CD   1 1 
        4  4016 1 1  9 ARG CG   C  -5.402  13.857   5.488 1.00 . A A .  9 ARG CG   1 1 
        4  4017 1 1  9 ARG CZ   C  -5.331  17.009   5.604 1.00 . A A .  9 ARG CZ   1 1 
        4  4018 1 1  9 ARG H    H  -4.567  10.110   4.003 1.00 . A A .  9 ARG H    1 1 
        4  4019 1 1  9 ARG HA   H  -3.472  12.041   5.875 1.00 . A A .  9 ARG HA   1 1 
        4  4020 1 1  9 ARG HB2  H  -4.607  12.778   3.811 1.00 . A A .  9 ARG HB2  1 1 
        4  4021 1 1  9 ARG HB3  H  -6.123  12.136   4.443 1.00 . A A .  9 ARG HB3  1 1 
        4  4022 1 1  9 ARG HD2  H  -5.274  15.142   3.776 1.00 . A A .  9 ARG HD2  1 1 
        4  4023 1 1  9 ARG HD3  H  -6.894  14.537   4.107 1.00 . A A .  9 ARG HD3  1 1 
        4  4024 1 1  9 ARG HE   H  -7.212  16.327   5.557 1.00 . A A .  9 ARG HE   1 1 
        4  4025 1 1  9 ARG HG2  H  -6.091  13.669   6.298 1.00 . A A .  9 ARG HG2  1 1 
        4  4026 1 1  9 ARG HG3  H  -4.464  14.210   5.888 1.00 . A A .  9 ARG HG3  1 1 
        4  4027 1 1  9 ARG HH11 H  -3.861  15.914   4.798 1.00 . A A .  9 ARG HH11 1 1 
        4  4028 1 1  9 ARG HH12 H  -3.372  17.415   5.512 1.00 . A A .  9 ARG HH12 1 1 
        4  4029 1 1  9 ARG HH21 H  -6.581  18.303   6.482 1.00 . A A .  9 ARG HH21 1 1 
        4  4030 1 1  9 ARG HH22 H  -4.913  18.767   6.465 1.00 . A A .  9 ARG HH22 1 1 
        4  4031 1 1  9 ARG N    N  -4.073  10.358   4.813 1.00 . A A .  9 ARG N    1 1 
        4  4032 1 1  9 ARG NE   N  -6.287  16.138   5.295 1.00 . A A .  9 ARG NE   1 1 
        4  4033 1 1  9 ARG NH1  N  -4.092  16.759   5.279 1.00 . A A .  9 ARG NH1  1 1 
        4  4034 1 1  9 ARG NH2  N  -5.631  18.112   6.233 1.00 . A A .  9 ARG NH2  1 1 
        4  4035 1 1  9 ARG O    O  -5.097  11.945   7.840 1.00 . A A .  9 ARG O    1 1 
        4  4036 1 1 10 VAL C    C  -6.051   9.379   9.083 1.00 . A A . 10 VAL C    1 1 
        4  4037 1 1 10 VAL CA   C  -6.883   9.819   7.882 1.00 . A A . 10 VAL CA   1 1 
        4  4038 1 1 10 VAL CB   C  -7.821   8.673   7.479 1.00 . A A . 10 VAL CB   1 1 
        4  4039 1 1 10 VAL CG1  C  -8.551   9.045   6.187 1.00 . A A . 10 VAL CG1  1 1 
        4  4040 1 1 10 VAL CG2  C  -7.013   7.374   7.283 1.00 . A A . 10 VAL CG2  1 1 
        4  4041 1 1 10 VAL H    H  -6.066   9.682   5.932 1.00 . A A . 10 VAL H    1 1 
        4  4042 1 1 10 VAL HA   H  -7.480  10.640   8.246 1.00 . A A . 10 VAL HA   1 1 
        4  4043 1 1 10 VAL HB   H  -8.551   8.527   8.263 1.00 . A A . 10 VAL HB   1 1 
        4  4044 1 1 10 VAL HG11 H  -9.218   8.242   5.907 1.00 . A A . 10 VAL HG11 1 1 
        4  4045 1 1 10 VAL HG12 H  -7.830   9.203   5.402 1.00 . A A . 10 VAL HG12 1 1 
        4  4046 1 1 10 VAL HG13 H  -9.121   9.949   6.341 1.00 . A A . 10 VAL HG13 1 1 
        4  4047 1 1 10 VAL HG21 H  -6.920   6.864   8.230 1.00 . A A . 10 VAL HG21 1 1 
        4  4048 1 1 10 VAL HG22 H  -6.028   7.608   6.907 1.00 . A A . 10 VAL HG22 1 1 
        4  4049 1 1 10 VAL HG23 H  -7.522   6.729   6.579 1.00 . A A . 10 VAL HG23 1 1 
        4  4050 1 1 10 VAL N    N  -6.047  10.223   6.749 1.00 . A A . 10 VAL N    1 1 
        4  4051 1 1 10 VAL O    O  -6.485   9.575  10.219 1.00 . A A . 10 VAL O    1 1 
        4  4052 1 1 11 SER C    C  -3.671   9.632  10.861 1.00 . A A . 11 SER C    1 1 
        4  4053 1 1 11 SER CA   C  -4.073   8.409  10.039 1.00 . A A . 11 SER CA   1 1 
        4  4054 1 1 11 SER CB   C  -2.822   7.657   9.583 1.00 . A A . 11 SER CB   1 1 
        4  4055 1 1 11 SER H    H  -4.503   8.675   7.985 1.00 . A A . 11 SER H    1 1 
        4  4056 1 1 11 SER HA   H  -4.642   7.775  10.702 1.00 . A A . 11 SER HA   1 1 
        4  4057 1 1 11 SER HB2  H  -2.243   7.363  10.442 1.00 . A A . 11 SER HB2  1 1 
        4  4058 1 1 11 SER HB3  H  -3.118   6.773   9.032 1.00 . A A . 11 SER HB3  1 1 
        4  4059 1 1 11 SER HG   H  -1.586   9.136   9.323 1.00 . A A . 11 SER HG   1 1 
        4  4060 1 1 11 SER N    N  -4.868   8.809   8.884 1.00 . A A . 11 SER N    1 1 
        4  4061 1 1 11 SER O    O  -3.888   9.656  12.040 1.00 . A A . 11 SER O    1 1 
        4  4062 1 1 11 SER OG   O  -2.037   8.507   8.756 1.00 . A A . 11 SER OG   1 1 
        4  4063 1 1 12 ILE C    C  -3.845  12.378  11.819 1.00 . A A . 12 ILE C    1 1 
        4  4064 1 1 12 ILE CA   C  -2.654  11.805  11.026 1.00 . A A . 12 ILE CA   1 1 
        4  4065 1 1 12 ILE CB   C  -2.132  12.883  10.069 1.00 . A A . 12 ILE CB   1 1 
        4  4066 1 1 12 ILE CD1  C   0.219  11.924  10.247 1.00 . A A . 12 ILE CD1  1 1 
        4  4067 1 1 12 ILE CG1  C  -0.908  12.358   9.294 1.00 . A A . 12 ILE CG1  1 1 
        4  4068 1 1 12 ILE CG2  C  -1.753  14.139  10.860 1.00 . A A . 12 ILE CG2  1 1 
        4  4069 1 1 12 ILE H    H  -2.880  10.518   9.297 1.00 . A A . 12 ILE H    1 1 
        4  4070 1 1 12 ILE HA   H  -1.862  11.518  11.697 1.00 . A A . 12 ILE HA   1 1 
        4  4071 1 1 12 ILE HB   H  -2.914  13.136   9.367 1.00 . A A . 12 ILE HB   1 1 
        4  4072 1 1 12 ILE HD11 H   0.220  12.543  11.131 1.00 . A A . 12 ILE HD11 1 1 
        4  4073 1 1 12 ILE HD12 H   1.169  12.020   9.745 1.00 . A A . 12 ILE HD12 1 1 
        4  4074 1 1 12 ILE HD13 H   0.070  10.893  10.532 1.00 . A A . 12 ILE HD13 1 1 
        4  4075 1 1 12 ILE HG12 H  -1.206  11.511   8.695 1.00 . A A . 12 ILE HG12 1 1 
        4  4076 1 1 12 ILE HG13 H  -0.539  13.138   8.644 1.00 . A A . 12 ILE HG13 1 1 
        4  4077 1 1 12 ILE HG21 H  -2.649  14.640  11.194 1.00 . A A . 12 ILE HG21 1 1 
        4  4078 1 1 12 ILE HG22 H  -1.183  14.804  10.227 1.00 . A A . 12 ILE HG22 1 1 
        4  4079 1 1 12 ILE HG23 H  -1.157  13.859  11.716 1.00 . A A . 12 ILE HG23 1 1 
        4  4080 1 1 12 ILE N    N  -3.083  10.630  10.250 1.00 . A A . 12 ILE N    1 1 
        4  4081 1 1 12 ILE O    O  -3.766  12.676  13.009 1.00 . A A . 12 ILE O    1 1 
        4  4082 1 1 13 ILE C    C  -6.658  12.084  12.852 1.00 . A A . 13 ILE C    1 1 
        4  4083 1 1 13 ILE CA   C  -6.195  12.970  11.661 1.00 . A A . 13 ILE CA   1 1 
        4  4084 1 1 13 ILE CB   C  -7.285  13.009  10.583 1.00 . A A . 13 ILE CB   1 1 
        4  4085 1 1 13 ILE CD1  C  -6.761  15.453  10.096 1.00 . A A . 13 ILE CD1  1 1 
        4  4086 1 1 13 ILE CG1  C  -6.930  14.045   9.499 1.00 . A A . 13 ILE CG1  1 1 
        4  4087 1 1 13 ILE CG2  C  -8.635  13.363  11.218 1.00 . A A . 13 ILE CG2  1 1 
        4  4088 1 1 13 ILE H    H  -4.801  12.126  10.193 1.00 . A A . 13 ILE H    1 1 
        4  4089 1 1 13 ILE HA   H  -6.038  13.962  12.052 1.00 . A A . 13 ILE HA   1 1 
        4  4090 1 1 13 ILE HB   H  -7.361  12.032  10.128 1.00 . A A . 13 ILE HB   1 1 
        4  4091 1 1 13 ILE HD11 H  -7.403  15.575  10.954 1.00 . A A . 13 ILE HD11 1 1 
        4  4092 1 1 13 ILE HD12 H  -7.018  16.191   9.351 1.00 . A A . 13 ILE HD12 1 1 
        4  4093 1 1 13 ILE HD13 H  -5.732  15.593  10.395 1.00 . A A . 13 ILE HD13 1 1 
        4  4094 1 1 13 ILE HG12 H  -6.007  13.754   9.021 1.00 . A A . 13 ILE HG12 1 1 
        4  4095 1 1 13 ILE HG13 H  -7.717  14.067   8.760 1.00 . A A . 13 ILE HG13 1 1 
        4  4096 1 1 13 ILE HG21 H  -9.007  12.513  11.771 1.00 . A A . 13 ILE HG21 1 1 
        4  4097 1 1 13 ILE HG22 H  -9.340  13.625  10.444 1.00 . A A . 13 ILE HG22 1 1 
        4  4098 1 1 13 ILE HG23 H  -8.508  14.200  11.888 1.00 . A A . 13 ILE HG23 1 1 
        4  4099 1 1 13 ILE N    N  -4.931  12.476  11.099 1.00 . A A . 13 ILE N    1 1 
        4  4100 1 1 13 ILE O    O  -7.039  12.599  13.899 1.00 . A A . 13 ILE O    1 1 
        4  4101 1 1 14 GLY C    C  -5.683   9.670  14.773 1.00 . A A . 14 GLY C    1 1 
        4  4102 1 1 14 GLY CA   C  -6.886   9.833  13.806 1.00 . A A . 14 GLY CA   1 1 
        4  4103 1 1 14 GLY H    H  -6.108  10.471  11.876 1.00 . A A . 14 GLY H    1 1 
        4  4104 1 1 14 GLY HA2  H  -7.733  10.221  14.352 1.00 . A A . 14 GLY HA2  1 1 
        4  4105 1 1 14 GLY HA3  H  -7.140   8.867  13.394 1.00 . A A . 14 GLY HA3  1 1 
        4  4106 1 1 14 GLY N    N  -6.551  10.768  12.698 1.00 . A A . 14 GLY N    1 1 
        4  4107 1 1 14 GLY O    O  -5.794   9.741  15.997 1.00 . A A . 14 GLY O    1 1 
        4  4108 1 1 15 THR C    C  -2.798  10.313  15.644 1.00 . A A . 15 THR C    1 1 
        4  4109 1 1 15 THR CA   C  -3.265   9.143  14.773 1.00 . A A . 15 THR CA   1 1 
        4  4110 1 1 15 THR CB   C  -2.170   8.828  13.747 1.00 . A A . 15 THR CB   1 1 
        4  4111 1 1 15 THR CG2  C  -0.905   8.375  14.479 1.00 . A A . 15 THR CG2  1 1 
        4  4112 1 1 15 THR H    H  -4.726   9.322  13.170 1.00 . A A . 15 THR H    1 1 
        4  4113 1 1 15 THR HA   H  -3.381   8.284  15.416 1.00 . A A . 15 THR HA   1 1 
        4  4114 1 1 15 THR HB   H  -1.940   9.709  13.171 1.00 . A A . 15 THR HB   1 1 
        4  4115 1 1 15 THR HG1  H  -1.896   7.147  12.805 1.00 . A A . 15 THR HG1  1 1 
        4  4116 1 1 15 THR HG21 H  -0.458   9.222  14.978 1.00 . A A . 15 THR HG21 1 1 
        4  4117 1 1 15 THR HG22 H  -0.203   7.966  13.767 1.00 . A A . 15 THR HG22 1 1 
        4  4118 1 1 15 THR HG23 H  -1.157   7.620  15.208 1.00 . A A . 15 THR HG23 1 1 
        4  4119 1 1 15 THR N    N  -4.569   9.401  14.128 1.00 . A A . 15 THR N    1 1 
        4  4120 1 1 15 THR O    O  -2.092  10.103  16.630 1.00 . A A . 15 THR O    1 1 
        4  4121 1 1 15 THR OG1  O  -2.610   7.784  12.888 1.00 . A A . 15 THR OG1  1 1 
        4  4122 1 1 16 THR C    C  -3.639  12.810  17.382 1.00 . A A . 16 THR C    1 1 
        4  4123 1 1 16 THR CA   C  -2.827  12.710  16.092 1.00 . A A . 16 THR CA   1 1 
        4  4124 1 1 16 THR CB   C  -3.001  13.987  15.266 1.00 . A A . 16 THR CB   1 1 
        4  4125 1 1 16 THR CG2  C  -2.650  15.204  16.124 1.00 . A A . 16 THR CG2  1 1 
        4  4126 1 1 16 THR H    H  -3.817  11.668  14.556 1.00 . A A . 16 THR H    1 1 
        4  4127 1 1 16 THR HA   H  -1.788  12.619  16.372 1.00 . A A . 16 THR HA   1 1 
        4  4128 1 1 16 THR HB   H  -4.025  14.067  14.937 1.00 . A A . 16 THR HB   1 1 
        4  4129 1 1 16 THR HG1  H  -2.106  14.814  13.749 1.00 . A A . 16 THR HG1  1 1 
        4  4130 1 1 16 THR HG21 H  -2.516  16.066  15.488 1.00 . A A . 16 THR HG21 1 1 
        4  4131 1 1 16 THR HG22 H  -1.735  15.011  16.666 1.00 . A A . 16 THR HG22 1 1 
        4  4132 1 1 16 THR HG23 H  -3.450  15.393  16.824 1.00 . A A . 16 THR HG23 1 1 
        4  4133 1 1 16 THR N    N  -3.201  11.533  15.305 1.00 . A A . 16 THR N    1 1 
        4  4134 1 1 16 THR O    O  -3.164  13.333  18.390 1.00 . A A . 16 THR O    1 1 
        4  4135 1 1 16 THR OG1  O  -2.141  13.936  14.136 1.00 . A A . 16 THR OG1  1 1 
        4  4136 1 1 17 LEU C    C  -5.515  11.439  19.588 1.00 . A A . 17 LEU C    1 1 
        4  4137 1 1 17 LEU CA   C  -5.821  12.406  18.439 1.00 . A A . 17 LEU CA   1 1 
        4  4138 1 1 17 LEU CB   C  -7.256  12.171  17.919 1.00 . A A . 17 LEU CB   1 1 
        4  4139 1 1 17 LEU CD1  C  -8.299  14.390  18.592 1.00 . A A . 17 LEU CD1  1 1 
        4  4140 1 1 17 LEU CD2  C  -6.901  14.243  16.505 1.00 . A A . 17 LEU CD2  1 1 
        4  4141 1 1 17 LEU CG   C  -7.890  13.488  17.410 1.00 . A A . 17 LEU CG   1 1 
        4  4142 1 1 17 LEU H    H  -5.232  11.950  16.498 1.00 . A A . 17 LEU H    1 1 
        4  4143 1 1 17 LEU HA   H  -5.778  13.387  18.875 1.00 . A A . 17 LEU HA   1 1 
        4  4144 1 1 17 LEU HB2  H  -7.219  11.465  17.102 1.00 . A A . 17 LEU HB2  1 1 
        4  4145 1 1 17 LEU HB3  H  -7.872  11.760  18.706 1.00 . A A . 17 LEU HB3  1 1 
        4  4146 1 1 17 LEU HD11 H  -7.449  14.970  18.923 1.00 . A A . 17 LEU HD11 1 1 
        4  4147 1 1 17 LEU HD12 H  -8.660  13.786  19.410 1.00 . A A . 17 LEU HD12 1 1 
        4  4148 1 1 17 LEU HD13 H  -9.083  15.060  18.272 1.00 . A A . 17 LEU HD13 1 1 
        4  4149 1 1 17 LEU HD21 H  -6.212  14.816  17.110 1.00 . A A . 17 LEU HD21 1 1 
        4  4150 1 1 17 LEU HD22 H  -7.449  14.913  15.860 1.00 . A A . 17 LEU HD22 1 1 
        4  4151 1 1 17 LEU HD23 H  -6.351  13.540  15.903 1.00 . A A . 17 LEU HD23 1 1 
        4  4152 1 1 17 LEU HG   H  -8.775  13.247  16.840 1.00 . A A . 17 LEU HG   1 1 
        4  4153 1 1 17 LEU N    N  -4.881  12.346  17.322 1.00 . A A . 17 LEU N    1 1 
        4  4154 1 1 17 LEU O    O  -5.945  11.701  20.711 1.00 . A A . 17 LEU O    1 1 
        4  4155 1 1 18 VAL C    C  -3.938  10.189  21.631 1.00 . A A . 18 VAL C    1 1 
        4  4156 1 1 18 VAL CA   C  -4.594   9.419  20.484 1.00 . A A . 18 VAL CA   1 1 
        4  4157 1 1 18 VAL CB   C  -3.710   8.243  20.046 1.00 . A A . 18 VAL CB   1 1 
        4  4158 1 1 18 VAL CG1  C  -2.342   8.751  19.571 1.00 . A A . 18 VAL CG1  1 1 
        4  4159 1 1 18 VAL CG2  C  -3.520   7.286  21.228 1.00 . A A . 18 VAL CG2  1 1 
        4  4160 1 1 18 VAL H    H  -4.454  10.105  18.481 1.00 . A A . 18 VAL H    1 1 
        4  4161 1 1 18 VAL HA   H  -5.565   9.036  20.763 1.00 . A A . 18 VAL HA   1 1 
        4  4162 1 1 18 VAL HB   H  -4.193   7.718  19.236 1.00 . A A . 18 VAL HB   1 1 
        4  4163 1 1 18 VAL HG11 H  -1.875   7.994  18.958 1.00 . A A . 18 VAL HG11 1 1 
        4  4164 1 1 18 VAL HG12 H  -1.712   8.958  20.424 1.00 . A A . 18 VAL HG12 1 1 
        4  4165 1 1 18 VAL HG13 H  -2.472   9.651  18.990 1.00 . A A . 18 VAL HG13 1 1 
        4  4166 1 1 18 VAL HG21 H  -3.049   6.378  20.882 1.00 . A A . 18 VAL HG21 1 1 
        4  4167 1 1 18 VAL HG22 H  -4.482   7.052  21.659 1.00 . A A . 18 VAL HG22 1 1 
        4  4168 1 1 18 VAL HG23 H  -2.895   7.755  21.974 1.00 . A A . 18 VAL HG23 1 1 
        4  4169 1 1 18 VAL N    N  -4.825  10.324  19.362 1.00 . A A . 18 VAL N    1 1 
        4  4170 1 1 18 VAL O    O  -4.388  10.155  22.776 1.00 . A A . 18 VAL O    1 1 
        4  4171 1 1 19 ALA C    C  -2.900  12.726  22.905 1.00 . A A . 19 ALA C    1 1 
        4  4172 1 1 19 ALA CA   C  -2.060  11.651  22.225 1.00 . A A . 19 ALA CA   1 1 
        4  4173 1 1 19 ALA CB   C  -0.891  12.311  21.494 1.00 . A A . 19 ALA CB   1 1 
        4  4174 1 1 19 ALA H    H  -2.537  10.785  20.357 1.00 . A A . 19 ALA H    1 1 
        4  4175 1 1 19 ALA HA   H  -1.661  10.989  22.977 1.00 . A A . 19 ALA HA   1 1 
        4  4176 1 1 19 ALA HB1  H  -1.265  13.086  20.840 1.00 . A A . 19 ALA HB1  1 1 
        4  4177 1 1 19 ALA HB2  H  -0.368  11.569  20.908 1.00 . A A . 19 ALA HB2  1 1 
        4  4178 1 1 19 ALA HB3  H  -0.213  12.745  22.214 1.00 . A A . 19 ALA HB3  1 1 
        4  4179 1 1 19 ALA N    N  -2.849  10.865  21.281 1.00 . A A . 19 ALA N    1 1 
        4  4180 1 1 19 ALA O    O  -2.654  13.075  24.059 1.00 . A A . 19 ALA O    1 1 
        4  4181 1 1 20 LEU C    C  -5.606  13.672  23.900 1.00 . A A . 20 LEU C    1 1 
        4  4182 1 1 20 LEU CA   C  -4.757  14.268  22.780 1.00 . A A . 20 LEU CA   1 1 
        4  4183 1 1 20 LEU CB   C  -5.646  14.907  21.700 1.00 . A A . 20 LEU CB   1 1 
        4  4184 1 1 20 LEU CD1  C  -6.579  17.212  21.229 1.00 . A A . 20 LEU CD1  1 1 
        4  4185 1 1 20 LEU CD2  C  -7.861  15.661  22.697 1.00 . A A . 20 LEU CD2  1 1 
        4  4186 1 1 20 LEU CG   C  -6.448  16.106  22.283 1.00 . A A . 20 LEU CG   1 1 
        4  4187 1 1 20 LEU H    H  -4.077  12.901  21.297 1.00 . A A . 20 LEU H    1 1 
        4  4188 1 1 20 LEU HA   H  -4.136  15.028  23.230 1.00 . A A . 20 LEU HA   1 1 
        4  4189 1 1 20 LEU HB2  H  -5.011  15.250  20.893 1.00 . A A . 20 LEU HB2  1 1 
        4  4190 1 1 20 LEU HB3  H  -6.328  14.162  21.317 1.00 . A A . 20 LEU HB3  1 1 
        4  4191 1 1 20 LEU HD11 H  -6.997  16.799  20.323 1.00 . A A . 20 LEU HD11 1 1 
        4  4192 1 1 20 LEU HD12 H  -5.605  17.627  21.020 1.00 . A A . 20 LEU HD12 1 1 
        4  4193 1 1 20 LEU HD13 H  -7.228  17.990  21.604 1.00 . A A . 20 LEU HD13 1 1 
        4  4194 1 1 20 LEU HD21 H  -8.351  15.185  21.860 1.00 . A A . 20 LEU HD21 1 1 
        4  4195 1 1 20 LEU HD22 H  -8.432  16.526  23.001 1.00 . A A . 20 LEU HD22 1 1 
        4  4196 1 1 20 LEU HD23 H  -7.799  14.968  23.520 1.00 . A A . 20 LEU HD23 1 1 
        4  4197 1 1 20 LEU HG   H  -5.933  16.507  23.146 1.00 . A A . 20 LEU HG   1 1 
        4  4198 1 1 20 LEU N    N  -3.899  13.244  22.198 1.00 . A A . 20 LEU N    1 1 
        4  4199 1 1 20 LEU O    O  -5.701  14.251  24.982 1.00 . A A . 20 LEU O    1 1 
        4  4200 1 1 21 SER C    C  -6.224  11.148  25.713 1.00 . A A . 21 SER C    1 1 
        4  4201 1 1 21 SER CA   C  -7.057  11.872  24.658 1.00 . A A . 21 SER CA   1 1 
        4  4202 1 1 21 SER CB   C  -7.989  10.866  23.981 1.00 . A A . 21 SER CB   1 1 
        4  4203 1 1 21 SER H    H  -6.146  12.086  22.775 1.00 . A A . 21 SER H    1 1 
        4  4204 1 1 21 SER HA   H  -7.665  12.633  25.124 1.00 . A A . 21 SER HA   1 1 
        4  4205 1 1 21 SER HB2  H  -8.605  11.373  23.258 1.00 . A A . 21 SER HB2  1 1 
        4  4206 1 1 21 SER HB3  H  -7.398  10.111  23.480 1.00 . A A . 21 SER HB3  1 1 
        4  4207 1 1 21 SER HG   H  -8.930  10.888  25.684 1.00 . A A . 21 SER HG   1 1 
        4  4208 1 1 21 SER N    N  -6.223  12.521  23.650 1.00 . A A . 21 SER N    1 1 
        4  4209 1 1 21 SER O    O  -6.666  10.942  26.830 1.00 . A A . 21 SER O    1 1 
        4  4210 1 1 21 SER OG   O  -8.820  10.263  24.964 1.00 . A A . 21 SER OG   1 1 
        4  4211 1 1 22 SER C    C  -3.280  10.853  27.088 1.00 . A A . 22 SER C    1 1 
        4  4212 1 1 22 SER CA   C  -4.135   9.961  26.173 1.00 . A A . 22 SER CA   1 1 
        4  4213 1 1 22 SER CB   C  -3.216   9.082  25.326 1.00 . A A . 22 SER CB   1 1 
        4  4214 1 1 22 SER H    H  -4.798  10.939  24.373 1.00 . A A . 22 SER H    1 1 
        4  4215 1 1 22 SER HA   H  -4.727   9.319  26.804 1.00 . A A . 22 SER HA   1 1 
        4  4216 1 1 22 SER HB2  H  -2.680   9.692  24.621 1.00 . A A . 22 SER HB2  1 1 
        4  4217 1 1 22 SER HB3  H  -2.508   8.577  25.972 1.00 . A A . 22 SER HB3  1 1 
        4  4218 1 1 22 SER HG   H  -4.253   8.515  23.781 1.00 . A A . 22 SER HG   1 1 
        4  4219 1 1 22 SER N    N  -5.038  10.721  25.298 1.00 . A A . 22 SER N    1 1 
        4  4220 1 1 22 SER O    O  -2.745  10.375  28.089 1.00 . A A . 22 SER O    1 1 
        4  4221 1 1 22 SER OG   O  -3.998   8.127  24.621 1.00 . A A . 22 SER OG   1 1 
        4  4222 1 1 23 PHE C    C  -3.214  13.497  28.886 1.00 . A A . 23 PHE C    1 1 
        4  4223 1 1 23 PHE CA   C  -2.388  13.028  27.659 1.00 . A A . 23 PHE CA   1 1 
        4  4224 1 1 23 PHE CB   C  -1.843  14.233  26.866 1.00 . A A . 23 PHE CB   1 1 
        4  4225 1 1 23 PHE CD1  C  -0.126  12.685  25.837 1.00 . A A . 23 PHE CD1  1 1 
        4  4226 1 1 23 PHE CD2  C   0.532  14.949  26.403 1.00 . A A . 23 PHE CD2  1 1 
        4  4227 1 1 23 PHE CE1  C   1.167  12.429  25.364 1.00 . A A . 23 PHE CE1  1 1 
        4  4228 1 1 23 PHE CE2  C   1.824  14.693  25.929 1.00 . A A . 23 PHE CE2  1 1 
        4  4229 1 1 23 PHE CG   C  -0.442  13.946  26.357 1.00 . A A . 23 PHE CG   1 1 
        4  4230 1 1 23 PHE CZ   C   2.141  13.432  25.409 1.00 . A A . 23 PHE CZ   1 1 
        4  4231 1 1 23 PHE H    H  -3.691  12.447  25.998 1.00 . A A . 23 PHE H    1 1 
        4  4232 1 1 23 PHE HA   H  -1.571  12.475  28.102 1.00 . A A . 23 PHE HA   1 1 
        4  4233 1 1 23 PHE HB2  H  -2.492  14.427  26.025 1.00 . A A . 23 PHE HB2  1 1 
        4  4234 1 1 23 PHE HB3  H  -1.816  15.109  27.501 1.00 . A A . 23 PHE HB3  1 1 
        4  4235 1 1 23 PHE HD1  H  -0.878  11.911  25.802 1.00 . A A . 23 PHE HD1  1 1 
        4  4236 1 1 23 PHE HD2  H   0.288  15.922  26.804 1.00 . A A . 23 PHE HD2  1 1 
        4  4237 1 1 23 PHE HE1  H   1.411  11.456  24.962 1.00 . A A . 23 PHE HE1  1 1 
        4  4238 1 1 23 PHE HE2  H   2.577  15.467  25.965 1.00 . A A . 23 PHE HE2  1 1 
        4  4239 1 1 23 PHE HZ   H   3.138  13.234  25.043 1.00 . A A . 23 PHE HZ   1 1 
        4  4240 1 1 23 PHE N    N  -3.175  12.142  26.774 1.00 . A A . 23 PHE N    1 1 
        4  4241 1 1 23 PHE O    O  -2.661  13.552  29.985 1.00 . A A . 23 PHE O    1 1 
        4  4242 1 1 24 THR C    C  -5.576  13.343  30.988 1.00 . A A . 24 THR C    1 1 
        4  4243 1 1 24 THR CA   C  -5.251  14.392  29.897 1.00 . A A . 24 THR CA   1 1 
        4  4244 1 1 24 THR CB   C  -6.541  15.084  29.417 1.00 . A A . 24 THR CB   1 1 
        4  4245 1 1 24 THR CG2  C  -7.392  15.499  30.622 1.00 . A A . 24 THR CG2  1 1 
        4  4246 1 1 24 THR H    H  -4.881  13.996  27.848 1.00 . A A . 24 THR H    1 1 
        4  4247 1 1 24 THR HA   H  -4.643  15.152  30.363 1.00 . A A . 24 THR HA   1 1 
        4  4248 1 1 24 THR HB   H  -7.112  14.420  28.793 1.00 . A A . 24 THR HB   1 1 
        4  4249 1 1 24 THR HG1  H  -6.840  16.346  27.968 1.00 . A A . 24 THR HG1  1 1 
        4  4250 1 1 24 THR HG21 H  -8.128  16.224  30.308 1.00 . A A . 24 THR HG21 1 1 
        4  4251 1 1 24 THR HG22 H  -6.757  15.935  31.378 1.00 . A A . 24 THR HG22 1 1 
        4  4252 1 1 24 THR HG23 H  -7.890  14.631  31.027 1.00 . A A . 24 THR HG23 1 1 
        4  4253 1 1 24 THR N    N  -4.484  13.884  28.737 1.00 . A A . 24 THR N    1 1 
        4  4254 1 1 24 THR O    O  -5.594  13.674  32.173 1.00 . A A . 24 THR O    1 1 
        4  4255 1 1 24 THR OG1  O  -6.195  16.243  28.672 1.00 . A A . 24 THR OG1  1 1 
        4  4256 1 1 25 PRO C    C  -5.415  10.865  32.806 1.00 . A A . 25 PRO C    1 1 
        4  4257 1 1 25 PRO CA   C  -6.306  11.048  31.577 1.00 . A A . 25 PRO CA   1 1 
        4  4258 1 1 25 PRO CB   C  -6.282   9.784  30.717 1.00 . A A . 25 PRO CB   1 1 
        4  4259 1 1 25 PRO CD   C  -5.904  11.636  29.240 1.00 . A A . 25 PRO CD   1 1 
        4  4260 1 1 25 PRO CG   C  -6.585  10.269  29.348 1.00 . A A . 25 PRO CG   1 1 
        4  4261 1 1 25 PRO HA   H  -7.320  11.224  31.896 1.00 . A A . 25 PRO HA   1 1 
        4  4262 1 1 25 PRO HB2  H  -5.302   9.323  30.750 1.00 . A A . 25 PRO HB2  1 1 
        4  4263 1 1 25 PRO HB3  H  -7.039   9.085  31.042 1.00 . A A . 25 PRO HB3  1 1 
        4  4264 1 1 25 PRO HD2  H  -4.902  11.527  28.877 1.00 . A A . 25 PRO HD2  1 1 
        4  4265 1 1 25 PRO HD3  H  -6.468  12.298  28.614 1.00 . A A . 25 PRO HD3  1 1 
        4  4266 1 1 25 PRO HG2  H  -6.181   9.581  28.618 1.00 . A A . 25 PRO HG2  1 1 
        4  4267 1 1 25 PRO HG3  H  -7.650  10.378  29.213 1.00 . A A . 25 PRO HG3  1 1 
        4  4268 1 1 25 PRO N    N  -5.895  12.131  30.620 1.00 . A A . 25 PRO N    1 1 
        4  4269 1 1 25 PRO O    O  -5.883  10.346  33.811 1.00 . A A . 25 PRO O    1 1 
        4  4270 1 1 26 VAL C    C  -3.822  11.897  35.126 1.00 . A A . 26 VAL C    1 1 
        4  4271 1 1 26 VAL CA   C  -3.298  11.088  33.934 1.00 . A A . 26 VAL CA   1 1 
        4  4272 1 1 26 VAL CB   C  -1.865  11.518  33.600 1.00 . A A . 26 VAL CB   1 1 
        4  4273 1 1 26 VAL CG1  C  -1.011  11.530  34.872 1.00 . A A . 26 VAL CG1  1 1 
        4  4274 1 1 26 VAL CG2  C  -1.262  10.533  32.595 1.00 . A A . 26 VAL CG2  1 1 
        4  4275 1 1 26 VAL H    H  -3.776  11.711  31.974 1.00 . A A . 26 VAL H    1 1 
        4  4276 1 1 26 VAL HA   H  -3.291  10.047  34.218 1.00 . A A . 26 VAL HA   1 1 
        4  4277 1 1 26 VAL HB   H  -1.879  12.509  33.169 1.00 . A A . 26 VAL HB   1 1 
        4  4278 1 1 26 VAL HG11 H  -1.277  12.385  35.475 1.00 . A A . 26 VAL HG11 1 1 
        4  4279 1 1 26 VAL HG12 H   0.033  11.589  34.605 1.00 . A A . 26 VAL HG12 1 1 
        4  4280 1 1 26 VAL HG13 H  -1.189  10.624  35.433 1.00 . A A . 26 VAL HG13 1 1 
        4  4281 1 1 26 VAL HG21 H  -1.072   9.590  33.086 1.00 . A A . 26 VAL HG21 1 1 
        4  4282 1 1 26 VAL HG22 H  -0.334  10.932  32.211 1.00 . A A . 26 VAL HG22 1 1 
        4  4283 1 1 26 VAL HG23 H  -1.954  10.382  31.780 1.00 . A A . 26 VAL HG23 1 1 
        4  4284 1 1 26 VAL N    N  -4.153  11.265  32.761 1.00 . A A . 26 VAL N    1 1 
        4  4285 1 1 26 VAL O    O  -3.854  11.403  36.248 1.00 . A A . 26 VAL O    1 1 
        4  4286 1 1 27 LEU C    C  -5.722  13.463  36.833 1.00 . A A . 27 LEU C    1 1 
        4  4287 1 1 27 LEU CA   C  -4.618  14.063  35.947 1.00 . A A . 27 LEU CA   1 1 
        4  4288 1 1 27 LEU CB   C  -5.153  15.356  35.293 1.00 . A A . 27 LEU CB   1 1 
        4  4289 1 1 27 LEU CD1  C  -3.331  16.867  36.226 1.00 . A A . 27 LEU CD1  1 1 
        4  4290 1 1 27 LEU CD2  C  -2.961  15.581  34.086 1.00 . A A . 27 LEU CD2  1 1 
        4  4291 1 1 27 LEU CG   C  -3.999  16.317  34.946 1.00 . A A . 27 LEU CG   1 1 
        4  4292 1 1 27 LEU H    H  -4.049  13.533  33.991 1.00 . A A . 27 LEU H    1 1 
        4  4293 1 1 27 LEU HA   H  -3.757  14.318  36.541 1.00 . A A . 27 LEU HA   1 1 
        4  4294 1 1 27 LEU HB2  H  -5.681  15.099  34.387 1.00 . A A . 27 LEU HB2  1 1 
        4  4295 1 1 27 LEU HB3  H  -5.834  15.854  35.970 1.00 . A A . 27 LEU HB3  1 1 
        4  4296 1 1 27 LEU HD11 H  -2.493  16.244  36.506 1.00 . A A . 27 LEU HD11 1 1 
        4  4297 1 1 27 LEU HD12 H  -4.047  16.888  37.036 1.00 . A A . 27 LEU HD12 1 1 
        4  4298 1 1 27 LEU HD13 H  -2.980  17.871  36.039 1.00 . A A . 27 LEU HD13 1 1 
        4  4299 1 1 27 LEU HD21 H  -2.253  16.293  33.690 1.00 . A A . 27 LEU HD21 1 1 
        4  4300 1 1 27 LEU HD22 H  -3.461  15.080  33.271 1.00 . A A . 27 LEU HD22 1 1 
        4  4301 1 1 27 LEU HD23 H  -2.440  14.854  34.691 1.00 . A A . 27 LEU HD23 1 1 
        4  4302 1 1 27 LEU HG   H  -4.397  17.148  34.381 1.00 . A A . 27 LEU HG   1 1 
        4  4303 1 1 27 LEU N    N  -4.169  13.155  34.886 1.00 . A A . 27 LEU N    1 1 
        4  4304 1 1 27 LEU O    O  -5.877  13.864  37.987 1.00 . A A . 27 LEU O    1 1 
        4  4305 1 1 28 VAL C    C  -7.110  10.977  38.136 1.00 . A A . 28 VAL C    1 1 
        4  4306 1 1 28 VAL CA   C  -7.606  11.932  37.042 1.00 . A A . 28 VAL CA   1 1 
        4  4307 1 1 28 VAL CB   C  -8.548  11.177  36.085 1.00 . A A . 28 VAL CB   1 1 
        4  4308 1 1 28 VAL CG1  C  -8.748  12.015  34.818 1.00 . A A . 28 VAL CG1  1 1 
        4  4309 1 1 28 VAL CG2  C  -7.975   9.786  35.723 1.00 . A A . 28 VAL CG2  1 1 
        4  4310 1 1 28 VAL H    H  -6.341  12.241  35.370 1.00 . A A . 28 VAL H    1 1 
        4  4311 1 1 28 VAL HA   H  -8.170  12.731  37.500 1.00 . A A . 28 VAL HA   1 1 
        4  4312 1 1 28 VAL HB   H  -9.509  11.053  36.570 1.00 . A A . 28 VAL HB   1 1 
        4  4313 1 1 28 VAL HG11 H  -7.806  12.114  34.300 1.00 . A A . 28 VAL HG11 1 1 
        4  4314 1 1 28 VAL HG12 H  -9.114  12.995  35.088 1.00 . A A . 28 VAL HG12 1 1 
        4  4315 1 1 28 VAL HG13 H  -9.465  11.528  34.173 1.00 . A A . 28 VAL HG13 1 1 
        4  4316 1 1 28 VAL HG21 H  -6.900   9.808  35.778 1.00 . A A . 28 VAL HG21 1 1 
        4  4317 1 1 28 VAL HG22 H  -8.278   9.509  34.724 1.00 . A A . 28 VAL HG22 1 1 
        4  4318 1 1 28 VAL HG23 H  -8.349   9.051  36.423 1.00 . A A . 28 VAL HG23 1 1 
        4  4319 1 1 28 VAL N    N  -6.502  12.536  36.291 1.00 . A A . 28 VAL N    1 1 
        4  4320 1 1 28 VAL O    O  -7.761  10.809  39.168 1.00 . A A . 28 VAL O    1 1 
        4  4321 1 1 29 ILE C    C  -5.127  10.090  40.200 1.00 . A A . 29 ILE C    1 1 
        4  4322 1 1 29 ILE CA   C  -5.392   9.413  38.853 1.00 . A A . 29 ILE CA   1 1 
        4  4323 1 1 29 ILE CB   C  -4.087   8.799  38.294 1.00 . A A . 29 ILE CB   1 1 
        4  4324 1 1 29 ILE CD1  C  -4.580   6.312  38.365 1.00 . A A . 29 ILE CD1  1 1 
        4  4325 1 1 29 ILE CG1  C  -3.783   7.461  39.006 1.00 . A A . 29 ILE CG1  1 1 
        4  4326 1 1 29 ILE CG2  C  -2.906   9.773  38.500 1.00 . A A . 29 ILE CG2  1 1 
        4  4327 1 1 29 ILE H    H  -5.472  10.574  37.074 1.00 . A A . 29 ILE H    1 1 
        4  4328 1 1 29 ILE HA   H  -6.099   8.622  39.050 1.00 . A A . 29 ILE HA   1 1 
        4  4329 1 1 29 ILE HB   H  -4.211   8.620  37.234 1.00 . A A . 29 ILE HB   1 1 
        4  4330 1 1 29 ILE HD11 H  -4.781   5.557  39.110 1.00 . A A . 29 ILE HD11 1 1 
        4  4331 1 1 29 ILE HD12 H  -4.000   5.879  37.564 1.00 . A A . 29 ILE HD12 1 1 
        4  4332 1 1 29 ILE HD13 H  -5.515   6.681  37.969 1.00 . A A . 29 ILE HD13 1 1 
        4  4333 1 1 29 ILE HG12 H  -2.727   7.242  38.928 1.00 . A A . 29 ILE HG12 1 1 
        4  4334 1 1 29 ILE HG13 H  -4.052   7.540  40.049 1.00 . A A . 29 ILE HG13 1 1 
        4  4335 1 1 29 ILE HG21 H  -2.143   9.574  37.762 1.00 . A A . 29 ILE HG21 1 1 
        4  4336 1 1 29 ILE HG22 H  -2.492   9.638  39.490 1.00 . A A . 29 ILE HG22 1 1 
        4  4337 1 1 29 ILE HG23 H  -3.250  10.790  38.396 1.00 . A A . 29 ILE HG23 1 1 
        4  4338 1 1 29 ILE N    N  -5.963  10.354  37.893 1.00 . A A . 29 ILE N    1 1 
        4  4339 1 1 29 ILE O    O  -5.279   9.457  41.243 1.00 . A A . 29 ILE O    1 1 
        4  4340 1 1 30 LEU C    C  -5.702  12.029  42.353 1.00 . A A . 30 LEU C    1 1 
        4  4341 1 1 30 LEU CA   C  -4.464  12.037  41.463 1.00 . A A . 30 LEU CA   1 1 
        4  4342 1 1 30 LEU CB   C  -4.025  13.481  41.204 1.00 . A A . 30 LEU CB   1 1 
        4  4343 1 1 30 LEU CD1  C  -2.319  14.933  40.098 1.00 . A A . 30 LEU CD1  1 1 
        4  4344 1 1 30 LEU CD2  C  -1.558  13.048  41.576 1.00 . A A . 30 LEU CD2  1 1 
        4  4345 1 1 30 LEU CG   C  -2.628  13.506  40.563 1.00 . A A . 30 LEU CG   1 1 
        4  4346 1 1 30 LEU H    H  -4.605  11.842  39.355 1.00 . A A . 30 LEU H    1 1 
        4  4347 1 1 30 LEU HA   H  -3.695  11.525  42.018 1.00 . A A . 30 LEU HA   1 1 
        4  4348 1 1 30 LEU HB2  H  -4.732  13.952  40.535 1.00 . A A . 30 LEU HB2  1 1 
        4  4349 1 1 30 LEU HB3  H  -4.003  14.023  42.137 1.00 . A A . 30 LEU HB3  1 1 
        4  4350 1 1 30 LEU HD11 H  -1.302  14.983  39.740 1.00 . A A . 30 LEU HD11 1 1 
        4  4351 1 1 30 LEU HD12 H  -2.444  15.615  40.926 1.00 . A A . 30 LEU HD12 1 1 
        4  4352 1 1 30 LEU HD13 H  -2.996  15.206  39.301 1.00 . A A . 30 LEU HD13 1 1 
        4  4353 1 1 30 LEU HD21 H  -0.600  13.475  41.311 1.00 . A A . 30 LEU HD21 1 1 
        4  4354 1 1 30 LEU HD22 H  -1.480  11.972  41.556 1.00 . A A . 30 LEU HD22 1 1 
        4  4355 1 1 30 LEU HD23 H  -1.829  13.370  42.571 1.00 . A A . 30 LEU HD23 1 1 
        4  4356 1 1 30 LEU HG   H  -2.620  12.844  39.707 1.00 . A A . 30 LEU HG   1 1 
        4  4357 1 1 30 LEU N    N  -4.734  11.359  40.198 1.00 . A A . 30 LEU N    1 1 
        4  4358 1 1 30 LEU O    O  -5.598  11.685  43.530 1.00 . A A . 30 LEU O    1 1 
        4  4359 1 1 31 LEU C    C  -8.313  11.086  43.279 1.00 . A A . 31 LEU C    1 1 
        4  4360 1 1 31 LEU CA   C  -8.045  12.466  42.690 1.00 . A A . 31 LEU CA   1 1 
        4  4361 1 1 31 LEU CB   C  -9.255  12.877  41.845 1.00 . A A . 31 LEU CB   1 1 
        4  4362 1 1 31 LEU CD1  C -10.226  14.659  40.390 1.00 . A A . 31 LEU CD1  1 1 
        4  4363 1 1 31 LEU CD2  C  -9.291  15.285  42.641 1.00 . A A . 31 LEU CD2  1 1 
        4  4364 1 1 31 LEU CG   C  -9.135  14.349  41.420 1.00 . A A . 31 LEU CG   1 1 
        4  4365 1 1 31 LEU H    H  -6.919  12.785  40.931 1.00 . A A . 31 LEU H    1 1 
        4  4366 1 1 31 LEU HA   H  -7.888  13.216  43.449 1.00 . A A . 31 LEU HA   1 1 
        4  4367 1 1 31 LEU HB2  H  -9.298  12.254  40.962 1.00 . A A . 31 LEU HB2  1 1 
        4  4368 1 1 31 LEU HB3  H -10.158  12.741  42.420 1.00 . A A . 31 LEU HB3  1 1 
        4  4369 1 1 31 LEU HD11 H -11.170  14.265  40.735 1.00 . A A . 31 LEU HD11 1 1 
        4  4370 1 1 31 LEU HD12 H  -9.969  14.202  39.445 1.00 . A A . 31 LEU HD12 1 1 
        4  4371 1 1 31 LEU HD13 H -10.308  15.729  40.261 1.00 . A A . 31 LEU HD13 1 1 
        4  4372 1 1 31 LEU HD21 H  -8.323  15.448  43.093 1.00 . A A . 31 LEU HD21 1 1 
        4  4373 1 1 31 LEU HD22 H  -9.955  14.839  43.366 1.00 . A A . 31 LEU HD22 1 1 
        4  4374 1 1 31 LEU HD23 H  -9.696  16.236  42.323 1.00 . A A . 31 LEU HD23 1 1 
        4  4375 1 1 31 LEU HG   H  -8.166  14.508  40.966 1.00 . A A . 31 LEU HG   1 1 
        4  4376 1 1 31 LEU N    N  -6.859  12.429  41.842 1.00 . A A . 31 LEU N    1 1 
        4  4377 1 1 31 LEU O    O  -8.648  10.939  44.455 1.00 . A A . 31 LEU O    1 1 
        4  4378 1 1 32 GLY C    C  -7.296   8.332  43.931 1.00 . A A . 32 GLY C    1 1 
        4  4379 1 1 32 GLY CA   C  -8.309   8.691  42.848 1.00 . A A . 32 GLY CA   1 1 
        4  4380 1 1 32 GLY H    H  -7.815  10.302  41.533 1.00 . A A . 32 GLY H    1 1 
        4  4381 1 1 32 GLY HA2  H  -9.310   8.561  43.233 1.00 . A A . 32 GLY HA2  1 1 
        4  4382 1 1 32 GLY HA3  H  -8.163   8.041  41.998 1.00 . A A . 32 GLY HA3  1 1 
        4  4383 1 1 32 GLY N    N  -8.127  10.078  42.434 1.00 . A A . 32 GLY N    1 1 
        4  4384 1 1 32 GLY O    O  -7.640   7.745  44.954 1.00 . A A . 32 GLY O    1 1 
        4  4385 1 1 33 VAL C    C  -5.504   9.141  46.014 1.00 . A A . 33 VAL C    1 1 
        4  4386 1 1 33 VAL CA   C  -5.009   8.515  44.708 1.00 . A A . 33 VAL CA   1 1 
        4  4387 1 1 33 VAL CB   C  -3.678   9.143  44.275 1.00 . A A . 33 VAL CB   1 1 
        4  4388 1 1 33 VAL CG1  C  -2.695   9.124  45.450 1.00 . A A . 33 VAL CG1  1 1 
        4  4389 1 1 33 VAL CG2  C  -3.084   8.334  43.109 1.00 . A A . 33 VAL CG2  1 1 
        4  4390 1 1 33 VAL H    H  -5.911   9.267  42.888 1.00 . A A . 33 VAL H    1 1 
        4  4391 1 1 33 VAL HA   H  -4.881   7.452  44.864 1.00 . A A . 33 VAL HA   1 1 
        4  4392 1 1 33 VAL HB   H  -3.846  10.162  43.960 1.00 . A A . 33 VAL HB   1 1 
        4  4393 1 1 33 VAL HG11 H  -1.699   9.336  45.089 1.00 . A A . 33 VAL HG11 1 1 
        4  4394 1 1 33 VAL HG12 H  -2.709   8.150  45.917 1.00 . A A . 33 VAL HG12 1 1 
        4  4395 1 1 33 VAL HG13 H  -2.983   9.873  46.171 1.00 . A A . 33 VAL HG13 1 1 
        4  4396 1 1 33 VAL HG21 H  -3.871   8.042  42.430 1.00 . A A . 33 VAL HG21 1 1 
        4  4397 1 1 33 VAL HG22 H  -2.596   7.449  43.491 1.00 . A A . 33 VAL HG22 1 1 
        4  4398 1 1 33 VAL HG23 H  -2.364   8.942  42.582 1.00 . A A . 33 VAL HG23 1 1 
        4  4399 1 1 33 VAL N    N  -6.052   8.747  43.707 1.00 . A A . 33 VAL N    1 1 
        4  4400 1 1 33 VAL O    O  -5.491   8.502  47.065 1.00 . A A . 33 VAL O    1 1 
        4  4401 1 1 34 VAL C    C  -7.605  10.306  47.695 1.00 . A A . 34 VAL C    1 1 
        4  4402 1 1 34 VAL CA   C  -6.433  11.096  47.114 1.00 . A A . 34 VAL CA   1 1 
        4  4403 1 1 34 VAL CB   C  -6.891  12.509  46.735 1.00 . A A . 34 VAL CB   1 1 
        4  4404 1 1 34 VAL CG1  C  -7.610  13.157  47.922 1.00 . A A . 34 VAL CG1  1 1 
        4  4405 1 1 34 VAL CG2  C  -5.671  13.354  46.359 1.00 . A A . 34 VAL CG2  1 1 
        4  4406 1 1 34 VAL H    H  -5.830  10.867  45.078 1.00 . A A . 34 VAL H    1 1 
        4  4407 1 1 34 VAL HA   H  -5.624  11.166  47.825 1.00 . A A . 34 VAL HA   1 1 
        4  4408 1 1 34 VAL HB   H  -7.565  12.455  45.893 1.00 . A A . 34 VAL HB   1 1 
        4  4409 1 1 34 VAL HG11 H  -7.708  14.218  47.747 1.00 . A A . 34 VAL HG11 1 1 
        4  4410 1 1 34 VAL HG12 H  -7.039  12.992  48.823 1.00 . A A . 34 VAL HG12 1 1 
        4  4411 1 1 34 VAL HG13 H  -8.591  12.717  48.030 1.00 . A A . 34 VAL HG13 1 1 
        4  4412 1 1 34 VAL HG21 H  -5.061  12.810  45.653 1.00 . A A . 34 VAL HG21 1 1 
        4  4413 1 1 34 VAL HG22 H  -5.093  13.566  47.246 1.00 . A A . 34 VAL HG22 1 1 
        4  4414 1 1 34 VAL HG23 H  -5.999  14.281  45.913 1.00 . A A . 34 VAL HG23 1 1 
        4  4415 1 1 34 VAL N    N  -5.937  10.396  45.931 1.00 . A A . 34 VAL N    1 1 
        4  4416 1 1 34 VAL O    O  -7.734  10.121  48.904 1.00 . A A . 34 VAL O    1 1 
        4  4417 1 1 35 GLY C    C  -9.108   7.790  47.924 1.00 . A A . 35 GLY C    1 1 
        4  4418 1 1 35 GLY CA   C  -9.597   9.027  47.170 1.00 . A A . 35 GLY CA   1 1 
        4  4419 1 1 35 GLY H    H  -8.217  10.034  45.853 1.00 . A A . 35 GLY H    1 1 
        4  4420 1 1 35 GLY HA2  H -10.246   9.611  47.807 1.00 . A A . 35 GLY HA2  1 1 
        4  4421 1 1 35 GLY HA3  H -10.134   8.717  46.288 1.00 . A A . 35 GLY HA3  1 1 
        4  4422 1 1 35 GLY N    N  -8.440   9.829  46.785 1.00 . A A . 35 GLY N    1 1 
        4  4423 1 1 35 GLY O    O  -9.640   7.424  48.972 1.00 . A A . 35 GLY O    1 1 
        4  4424 1 1 36 LEU C    C  -6.691   6.352  49.239 1.00 . A A . 36 LEU C    1 1 
        4  4425 1 1 36 LEU CA   C  -7.447   5.990  47.959 1.00 . A A . 36 LEU CA   1 1 
        4  4426 1 1 36 LEU CB   C  -6.473   5.376  46.945 1.00 . A A . 36 LEU CB   1 1 
        4  4427 1 1 36 LEU CD1  C  -6.898   3.051  47.832 1.00 . A A . 36 LEU CD1  1 1 
        4  4428 1 1 36 LEU CD2  C  -4.841   3.544  46.479 1.00 . A A . 36 LEU CD2  1 1 
        4  4429 1 1 36 LEU CG   C  -5.822   4.105  47.515 1.00 . A A . 36 LEU CG   1 1 
        4  4430 1 1 36 LEU H    H  -7.705   7.533  46.540 1.00 . A A . 36 LEU H    1 1 
        4  4431 1 1 36 LEU HA   H  -8.221   5.269  48.170 1.00 . A A . 36 LEU HA   1 1 
        4  4432 1 1 36 LEU HB2  H  -7.010   5.126  46.041 1.00 . A A . 36 LEU HB2  1 1 
        4  4433 1 1 36 LEU HB3  H  -5.701   6.095  46.712 1.00 . A A . 36 LEU HB3  1 1 
        4  4434 1 1 36 LEU HD11 H  -7.686   3.099  47.094 1.00 . A A . 36 LEU HD11 1 1 
        4  4435 1 1 36 LEU HD12 H  -7.310   3.241  48.812 1.00 . A A . 36 LEU HD12 1 1 
        4  4436 1 1 36 LEU HD13 H  -6.457   2.063  47.819 1.00 . A A . 36 LEU HD13 1 1 
        4  4437 1 1 36 LEU HD21 H  -4.386   2.643  46.864 1.00 . A A . 36 LEU HD21 1 1 
        4  4438 1 1 36 LEU HD22 H  -4.075   4.277  46.277 1.00 . A A . 36 LEU HD22 1 1 
        4  4439 1 1 36 LEU HD23 H  -5.373   3.316  45.567 1.00 . A A . 36 LEU HD23 1 1 
        4  4440 1 1 36 LEU HG   H  -5.285   4.348  48.420 1.00 . A A . 36 LEU HG   1 1 
        4  4441 1 1 36 LEU N    N  -8.069   7.174  47.373 1.00 . A A . 36 LEU N    1 1 
        4  4442 1 1 36 LEU O    O  -6.648   5.585  50.200 1.00 . A A . 36 LEU O    1 1 
        4  4443 1 1 37 SER C    C  -6.398   8.132  51.578 1.00 . A A . 37 SER C    1 1 
        4  4444 1 1 37 SER CA   C  -5.426   8.073  50.405 1.00 . A A . 37 SER CA   1 1 
        4  4445 1 1 37 SER CB   C  -4.839   9.459  50.137 1.00 . A A . 37 SER CB   1 1 
        4  4446 1 1 37 SER H    H  -6.331   8.138  48.467 1.00 . A A . 37 SER H    1 1 
        4  4447 1 1 37 SER HA   H  -4.632   7.393  50.676 1.00 . A A . 37 SER HA   1 1 
        4  4448 1 1 37 SER HB2  H  -4.161   9.413  49.302 1.00 . A A . 37 SER HB2  1 1 
        4  4449 1 1 37 SER HB3  H  -5.639  10.148  49.912 1.00 . A A . 37 SER HB3  1 1 
        4  4450 1 1 37 SER HG   H  -4.778  10.068  51.984 1.00 . A A . 37 SER HG   1 1 
        4  4451 1 1 37 SER N    N  -6.139   7.562  49.236 1.00 . A A . 37 SER N    1 1 
        4  4452 1 1 37 SER O    O  -6.059   7.792  52.683 1.00 . A A . 37 SER O    1 1 
        4  4453 1 1 37 SER OG   O  -4.136   9.900  51.291 1.00 . A A . 37 SER OG   1 1 
        4  4454 1 1 38 ALA C    C  -8.869   7.231  52.965 1.00 . A A . 38 ALA C    1 1 
        4  4455 1 1 38 ALA CA   C  -8.642   8.618  52.340 1.00 . A A . 38 ALA CA   1 1 
        4  4456 1 1 38 ALA CB   C  -9.953   9.156  51.762 1.00 . A A . 38 ALA CB   1 1 
        4  4457 1 1 38 ALA H    H  -7.784   8.797  50.369 1.00 . A A . 38 ALA H    1 1 
        4  4458 1 1 38 ALA HA   H  -8.329   9.245  53.162 1.00 . A A . 38 ALA HA   1 1 
        4  4459 1 1 38 ALA HB1  H  -9.758  10.069  51.218 1.00 . A A . 38 ALA HB1  1 1 
        4  4460 1 1 38 ALA HB2  H -10.645   9.356  52.565 1.00 . A A . 38 ALA HB2  1 1 
        4  4461 1 1 38 ALA HB3  H -10.379   8.423  51.093 1.00 . A A . 38 ALA HB3  1 1 
        4  4462 1 1 38 ALA N    N  -7.611   8.546  51.300 1.00 . A A . 38 ALA N    1 1 
        4  4463 1 1 38 ALA O    O  -9.080   7.119  54.173 1.00 . A A . 38 ALA O    1 1 
        4  4464 1 1 39 LEU C    C  -7.728   4.385  53.496 1.00 . A A . 39 LEU C    1 1 
        4  4465 1 1 39 LEU CA   C  -8.975   4.833  52.698 1.00 . A A . 39 LEU CA   1 1 
        4  4466 1 1 39 LEU CB   C  -9.232   3.845  51.556 1.00 . A A . 39 LEU CB   1 1 
        4  4467 1 1 39 LEU CD1  C -10.686   3.291  49.602 1.00 . A A . 39 LEU CD1  1 1 
        4  4468 1 1 39 LEU CD2  C -11.731   4.154  51.716 1.00 . A A . 39 LEU CD2  1 1 
        4  4469 1 1 39 LEU CG   C -10.503   4.240  50.790 1.00 . A A . 39 LEU CG   1 1 
        4  4470 1 1 39 LEU H    H  -8.582   6.383  51.220 1.00 . A A . 39 LEU H    1 1 
        4  4471 1 1 39 LEU HA   H  -9.824   4.830  53.364 1.00 . A A . 39 LEU HA   1 1 
        4  4472 1 1 39 LEU HB2  H  -8.390   3.853  50.879 1.00 . A A . 39 LEU HB2  1 1 
        4  4473 1 1 39 LEU HB3  H  -9.356   2.853  51.962 1.00 . A A . 39 LEU HB3  1 1 
        4  4474 1 1 39 LEU HD11 H -11.684   3.402  49.202 1.00 . A A . 39 LEU HD11 1 1 
        4  4475 1 1 39 LEU HD12 H -10.542   2.272  49.929 1.00 . A A . 39 LEU HD12 1 1 
        4  4476 1 1 39 LEU HD13 H  -9.963   3.528  48.836 1.00 . A A . 39 LEU HD13 1 1 
        4  4477 1 1 39 LEU HD21 H -11.609   3.337  52.413 1.00 . A A . 39 LEU HD21 1 1 
        4  4478 1 1 39 LEU HD22 H -12.623   3.990  51.126 1.00 . A A . 39 LEU HD22 1 1 
        4  4479 1 1 39 LEU HD23 H -11.836   5.080  52.261 1.00 . A A . 39 LEU HD23 1 1 
        4  4480 1 1 39 LEU HG   H -10.397   5.253  50.423 1.00 . A A . 39 LEU HG   1 1 
        4  4481 1 1 39 LEU N    N  -8.798   6.190  52.156 1.00 . A A . 39 LEU N    1 1 
        4  4482 1 1 39 LEU O    O  -7.832   3.919  54.631 1.00 . A A . 39 LEU O    1 1 
        4  4483 1 1 40 THR C    C  -4.588   5.298  54.175 1.00 . A A . 40 THR C    1 1 
        4  4484 1 1 40 THR CA   C  -5.279   4.117  53.480 1.00 . A A . 40 THR CA   1 1 
        4  4485 1 1 40 THR CB   C  -4.351   3.557  52.401 1.00 . A A . 40 THR CB   1 1 
        4  4486 1 1 40 THR CG2  C  -5.002   2.340  51.744 1.00 . A A . 40 THR CG2  1 1 
        4  4487 1 1 40 THR H    H  -6.626   4.865  51.950 1.00 . A A . 40 THR H    1 1 
        4  4488 1 1 40 THR HA   H  -5.466   3.341  54.209 1.00 . A A . 40 THR HA   1 1 
        4  4489 1 1 40 THR HB   H  -3.414   3.261  52.848 1.00 . A A . 40 THR HB   1 1 
        4  4490 1 1 40 THR HG1  H  -4.581   4.306  50.620 1.00 . A A . 40 THR HG1  1 1 
        4  4491 1 1 40 THR HG21 H  -4.396   2.011  50.912 1.00 . A A . 40 THR HG21 1 1 
        4  4492 1 1 40 THR HG22 H  -5.987   2.606  51.387 1.00 . A A . 40 THR HG22 1 1 
        4  4493 1 1 40 THR HG23 H  -5.085   1.541  52.466 1.00 . A A . 40 THR HG23 1 1 
        4  4494 1 1 40 THR N    N  -6.567   4.519  52.865 1.00 . A A . 40 THR N    1 1 
        4  4495 1 1 40 THR O    O  -3.479   5.174  54.694 1.00 . A A . 40 THR O    1 1 
        4  4496 1 1 40 THR OG1  O  -4.112   4.557  51.420 1.00 . A A . 40 THR OG1  1 1 
        4  4497 1 1 41 GLY C    C  -3.407   8.024  54.592 1.00 . A A . 41 GLY C    1 1 
        4  4498 1 1 41 GLY CA   C  -4.825   7.594  54.963 1.00 . A A . 41 GLY CA   1 1 
        4  4499 1 1 41 GLY H    H  -6.240   6.353  53.963 1.00 . A A . 41 GLY H    1 1 
        4  4500 1 1 41 GLY HA2  H  -5.495   8.417  54.776 1.00 . A A . 41 GLY HA2  1 1 
        4  4501 1 1 41 GLY HA3  H  -4.846   7.377  56.021 1.00 . A A . 41 GLY HA3  1 1 
        4  4502 1 1 41 GLY N    N  -5.303   6.405  54.247 1.00 . A A . 41 GLY N    1 1 
        4  4503 1 1 41 GLY O    O  -2.454   7.692  55.297 1.00 . A A . 41 GLY O    1 1 
        4  4504 1 1 42 TYR C    C  -1.979  10.782  52.961 1.00 . A A . 42 TYR C    1 1 
        4  4505 1 1 42 TYR CA   C  -1.954   9.251  53.048 1.00 . A A . 42 TYR CA   1 1 
        4  4506 1 1 42 TYR CB   C  -1.648   8.648  51.647 1.00 . A A . 42 TYR CB   1 1 
        4  4507 1 1 42 TYR CD1  C  -0.507   6.629  52.659 1.00 . A A . 42 TYR CD1  1 1 
        4  4508 1 1 42 TYR CD2  C   0.608   7.815  50.861 1.00 . A A . 42 TYR CD2  1 1 
        4  4509 1 1 42 TYR CE1  C   0.566   5.733  52.733 1.00 . A A . 42 TYR CE1  1 1 
        4  4510 1 1 42 TYR CE2  C   1.681   6.918  50.935 1.00 . A A . 42 TYR CE2  1 1 
        4  4511 1 1 42 TYR CG   C  -0.486   7.670  51.723 1.00 . A A . 42 TYR CG   1 1 
        4  4512 1 1 42 TYR CZ   C   1.660   5.877  51.871 1.00 . A A . 42 TYR CZ   1 1 
        4  4513 1 1 42 TYR H    H  -4.031   8.996  52.933 1.00 . A A . 42 TYR H    1 1 
        4  4514 1 1 42 TYR HA   H  -1.172   8.952  53.733 1.00 . A A . 42 TYR HA   1 1 
        4  4515 1 1 42 TYR HB2  H  -2.521   8.122  51.296 1.00 . A A . 42 TYR HB2  1 1 
        4  4516 1 1 42 TYR HB3  H  -1.408   9.434  50.944 1.00 . A A . 42 TYR HB3  1 1 
        4  4517 1 1 42 TYR HD1  H  -1.350   6.518  53.324 1.00 . A A . 42 TYR HD1  1 1 
        4  4518 1 1 42 TYR HD2  H   0.625   8.616  50.138 1.00 . A A . 42 TYR HD2  1 1 
        4  4519 1 1 42 TYR HE1  H   0.550   4.930  53.456 1.00 . A A . 42 TYR HE1  1 1 
        4  4520 1 1 42 TYR HE2  H   2.525   7.030  50.271 1.00 . A A . 42 TYR HE2  1 1 
        4  4521 1 1 42 TYR HH   H   3.202   5.042  51.117 1.00 . A A . 42 TYR HH   1 1 
        4  4522 1 1 42 TYR N    N  -3.263   8.769  53.497 1.00 . A A . 42 TYR N    1 1 
        4  4523 1 1 42 TYR O    O  -1.180  11.384  52.245 1.00 . A A . 42 TYR O    1 1 
        4  4524 1 1 42 TYR OH   O   2.717   4.994  51.945 1.00 . A A . 42 TYR OH   1 1 
        4  4525 1 1 43 LEU C    C  -1.726  13.573  53.826 1.00 . A A . 43 LEU C    1 1 
        4  4526 1 1 43 LEU CA   C  -3.062  12.850  53.678 1.00 . A A . 43 LEU CA   1 1 
        4  4527 1 1 43 LEU CB   C  -3.865  13.203  54.938 1.00 . A A . 43 LEU CB   1 1 
        4  4528 1 1 43 LEU CD1  C  -5.974  12.820  56.219 1.00 . A A . 43 LEU CD1  1 1 
        4  4529 1 1 43 LEU CD2  C  -6.085  13.112  53.728 1.00 . A A . 43 LEU CD2  1 1 
        4  4530 1 1 43 LEU CG   C  -5.253  12.544  54.895 1.00 . A A . 43 LEU CG   1 1 
        4  4531 1 1 43 LEU H    H  -3.530  10.881  54.238 1.00 . A A . 43 LEU H    1 1 
        4  4532 1 1 43 LEU HA   H  -3.649  13.206  52.847 1.00 . A A . 43 LEU HA   1 1 
        4  4533 1 1 43 LEU HB2  H  -3.332  12.854  55.810 1.00 . A A . 43 LEU HB2  1 1 
        4  4534 1 1 43 LEU HB3  H  -3.982  14.275  54.997 1.00 . A A . 43 LEU HB3  1 1 
        4  4535 1 1 43 LEU HD11 H  -5.358  12.489  57.041 1.00 . A A . 43 LEU HD11 1 1 
        4  4536 1 1 43 LEU HD12 H  -6.914  12.287  56.235 1.00 . A A . 43 LEU HD12 1 1 
        4  4537 1 1 43 LEU HD13 H  -6.161  13.880  56.313 1.00 . A A . 43 LEU HD13 1 1 
        4  4538 1 1 43 LEU HD21 H  -5.845  14.156  53.580 1.00 . A A . 43 LEU HD21 1 1 
        4  4539 1 1 43 LEU HD22 H  -7.140  13.016  53.948 1.00 . A A . 43 LEU HD22 1 1 
        4  4540 1 1 43 LEU HD23 H  -5.862  12.561  52.826 1.00 . A A . 43 LEU HD23 1 1 
        4  4541 1 1 43 LEU HG   H  -5.138  11.477  54.771 1.00 . A A . 43 LEU HG   1 1 
        4  4542 1 1 43 LEU N    N  -2.911  11.398  53.681 1.00 . A A . 43 LEU N    1 1 
        4  4543 1 1 43 LEU O    O  -1.341  14.381  52.981 1.00 . A A . 43 LEU O    1 1 
        4  4544 1 1 44 ASP C    C   1.287  13.388  54.110 1.00 . A A . 44 ASP C    1 1 
        4  4545 1 1 44 ASP CA   C   0.287  13.851  55.164 1.00 . A A . 44 ASP CA   1 1 
        4  4546 1 1 44 ASP CB   C   0.780  13.505  56.569 1.00 . A A . 44 ASP CB   1 1 
        4  4547 1 1 44 ASP CG   C   2.098  14.214  56.858 1.00 . A A . 44 ASP CG   1 1 
        4  4548 1 1 44 ASP H    H  -1.383  12.571  55.509 1.00 . A A . 44 ASP H    1 1 
        4  4549 1 1 44 ASP HA   H   0.193  14.921  55.056 1.00 . A A . 44 ASP HA   1 1 
        4  4550 1 1 44 ASP HB2  H   0.041  13.814  57.294 1.00 . A A . 44 ASP HB2  1 1 
        4  4551 1 1 44 ASP HB3  H   0.927  12.436  56.642 1.00 . A A . 44 ASP HB3  1 1 
        4  4552 1 1 44 ASP N    N  -1.019  13.252  54.907 1.00 . A A . 44 ASP N    1 1 
        4  4553 1 1 44 ASP O    O   2.130  14.165  53.660 1.00 . A A . 44 ASP O    1 1 
        4  4554 1 1 44 ASP OD1  O   2.071  15.414  57.073 1.00 . A A . 44 ASP OD1  1 1 
        4  4555 1 1 44 ASP OD2  O   3.115  13.540  56.881 1.00 . A A . 44 ASP OD2  1 1 
        4  4556 1 1 45 TYR C    C   2.068  12.351  51.438 1.00 . A A . 45 TYR C    1 1 
        4  4557 1 1 45 TYR CA   C   2.137  11.572  52.752 1.00 . A A . 45 TYR CA   1 1 
        4  4558 1 1 45 TYR CB   C   1.829  10.086  52.500 1.00 . A A . 45 TYR CB   1 1 
        4  4559 1 1 45 TYR CD1  C   1.767   8.973  54.772 1.00 . A A . 45 TYR CD1  1 1 
        4  4560 1 1 45 TYR CD2  C   3.737   8.700  53.384 1.00 . A A . 45 TYR CD2  1 1 
        4  4561 1 1 45 TYR CE1  C   2.356   8.179  55.764 1.00 . A A . 45 TYR CE1  1 1 
        4  4562 1 1 45 TYR CE2  C   4.325   7.906  54.376 1.00 . A A . 45 TYR CE2  1 1 
        4  4563 1 1 45 TYR CG   C   2.458   9.233  53.582 1.00 . A A . 45 TYR CG   1 1 
        4  4564 1 1 45 TYR CZ   C   3.636   7.645  55.566 1.00 . A A . 45 TYR CZ   1 1 
        4  4565 1 1 45 TYR H    H   0.552  11.527  54.163 1.00 . A A . 45 TYR H    1 1 
        4  4566 1 1 45 TYR HA   H   3.142  11.660  53.138 1.00 . A A . 45 TYR HA   1 1 
        4  4567 1 1 45 TYR HB2  H   0.760   9.936  52.505 1.00 . A A . 45 TYR HB2  1 1 
        4  4568 1 1 45 TYR HB3  H   2.227   9.789  51.539 1.00 . A A . 45 TYR HB3  1 1 
        4  4569 1 1 45 TYR HD1  H   0.782   9.385  54.925 1.00 . A A . 45 TYR HD1  1 1 
        4  4570 1 1 45 TYR HD2  H   4.270   8.900  52.466 1.00 . A A . 45 TYR HD2  1 1 
        4  4571 1 1 45 TYR HE1  H   1.824   7.979  56.681 1.00 . A A . 45 TYR HE1  1 1 
        4  4572 1 1 45 TYR HE2  H   5.313   7.494  54.223 1.00 . A A . 45 TYR HE2  1 1 
        4  4573 1 1 45 TYR HH   H   4.597   7.447  57.203 1.00 . A A . 45 TYR HH   1 1 
        4  4574 1 1 45 TYR N    N   1.208  12.117  53.736 1.00 . A A . 45 TYR N    1 1 
        4  4575 1 1 45 TYR O    O   3.106  12.580  50.827 1.00 . A A . 45 TYR O    1 1 
        4  4576 1 1 45 TYR OH   O   4.216   6.863  56.543 1.00 . A A . 45 TYR OH   1 1 
        4  4577 1 1 46 VAL C    C   1.892  13.970  49.075 1.00 . A A . 46 VAL C    1 1 
        4  4578 1 1 46 VAL CA   C   0.616  13.435  49.735 1.00 . A A . 46 VAL CA   1 1 
        4  4579 1 1 46 VAL CB   C  -0.349  14.598  49.981 1.00 . A A . 46 VAL CB   1 1 
        4  4580 1 1 46 VAL CG1  C   0.329  15.663  50.851 1.00 . A A . 46 VAL CG1  1 1 
        4  4581 1 1 46 VAL CG2  C  -0.756  15.214  48.639 1.00 . A A . 46 VAL CG2  1 1 
        4  4582 1 1 46 VAL H    H   0.058  12.442  51.519 1.00 . A A . 46 VAL H    1 1 
        4  4583 1 1 46 VAL HA   H   0.146  12.760  49.036 1.00 . A A . 46 VAL HA   1 1 
        4  4584 1 1 46 VAL HB   H  -1.228  14.231  50.489 1.00 . A A . 46 VAL HB   1 1 
        4  4585 1 1 46 VAL HG11 H   1.002  16.252  50.245 1.00 . A A . 46 VAL HG11 1 1 
        4  4586 1 1 46 VAL HG12 H   0.885  15.184  51.644 1.00 . A A . 46 VAL HG12 1 1 
        4  4587 1 1 46 VAL HG13 H  -0.424  16.307  51.280 1.00 . A A . 46 VAL HG13 1 1 
        4  4588 1 1 46 VAL HG21 H   0.104  15.685  48.184 1.00 . A A . 46 VAL HG21 1 1 
        4  4589 1 1 46 VAL HG22 H  -1.527  15.952  48.800 1.00 . A A . 46 VAL HG22 1 1 
        4  4590 1 1 46 VAL HG23 H  -1.130  14.439  47.986 1.00 . A A . 46 VAL HG23 1 1 
        4  4591 1 1 46 VAL N    N   0.848  12.713  51.006 1.00 . A A . 46 VAL N    1 1 
        4  4592 1 1 46 VAL O    O   2.084  13.787  47.873 1.00 . A A . 46 VAL O    1 1 
        4  4593 1 1 47 LEU C    C   4.804  14.133  48.554 1.00 . A A . 47 LEU C    1 1 
        4  4594 1 1 47 LEU CA   C   3.949  15.215  49.236 1.00 . A A . 47 LEU CA   1 1 
        4  4595 1 1 47 LEU CB   C   4.788  15.855  50.347 1.00 . A A . 47 LEU CB   1 1 
        4  4596 1 1 47 LEU CD1  C   4.832  17.601  52.137 1.00 . A A . 47 LEU CD1  1 1 
        4  4597 1 1 47 LEU CD2  C   4.074  18.231  49.821 1.00 . A A . 47 LEU CD2  1 1 
        4  4598 1 1 47 LEU CG   C   4.088  17.113  50.889 1.00 . A A . 47 LEU CG   1 1 
        4  4599 1 1 47 LEU H    H   2.514  14.835  50.762 1.00 . A A . 47 LEU H    1 1 
        4  4600 1 1 47 LEU HA   H   3.665  15.989  48.544 1.00 . A A . 47 LEU HA   1 1 
        4  4601 1 1 47 LEU HB2  H   4.913  15.143  51.150 1.00 . A A . 47 LEU HB2  1 1 
        4  4602 1 1 47 LEU HB3  H   5.758  16.123  49.956 1.00 . A A . 47 LEU HB3  1 1 
        4  4603 1 1 47 LEU HD11 H   4.973  16.777  52.820 1.00 . A A . 47 LEU HD11 1 1 
        4  4604 1 1 47 LEU HD12 H   4.255  18.375  52.621 1.00 . A A . 47 LEU HD12 1 1 
        4  4605 1 1 47 LEU HD13 H   5.795  17.998  51.850 1.00 . A A . 47 LEU HD13 1 1 
        4  4606 1 1 47 LEU HD21 H   4.948  18.153  49.191 1.00 . A A . 47 LEU HD21 1 1 
        4  4607 1 1 47 LEU HD22 H   4.069  19.198  50.304 1.00 . A A . 47 LEU HD22 1 1 
        4  4608 1 1 47 LEU HD23 H   3.185  18.138  49.215 1.00 . A A . 47 LEU HD23 1 1 
        4  4609 1 1 47 LEU HG   H   3.072  16.863  51.159 1.00 . A A . 47 LEU HG   1 1 
        4  4610 1 1 47 LEU N    N   2.739  14.650  49.826 1.00 . A A . 47 LEU N    1 1 
        4  4611 1 1 47 LEU O    O   5.289  14.324  47.441 1.00 . A A . 47 LEU O    1 1 
        4  4612 1 1 48 LEU C    C   5.245  11.316  47.406 1.00 . A A . 48 LEU C    1 1 
        4  4613 1 1 48 LEU CA   C   5.818  11.908  48.720 1.00 . A A . 48 LEU CA   1 1 
        4  4614 1 1 48 LEU CB   C   6.041  10.824  49.802 1.00 . A A . 48 LEU CB   1 1 
        4  4615 1 1 48 LEU CD1  C   8.576  10.849  49.624 1.00 . A A . 48 LEU CD1  1 1 
        4  4616 1 1 48 LEU CD2  C   7.386  12.478  51.148 1.00 . A A . 48 LEU CD2  1 1 
        4  4617 1 1 48 LEU CG   C   7.365  11.056  50.561 1.00 . A A . 48 LEU CG   1 1 
        4  4618 1 1 48 LEU H    H   4.586  12.954  50.138 1.00 . A A . 48 LEU H    1 1 
        4  4619 1 1 48 LEU HA   H   6.772  12.327  48.444 1.00 . A A . 48 LEU HA   1 1 
        4  4620 1 1 48 LEU HB2  H   5.235  10.871  50.517 1.00 . A A . 48 LEU HB2  1 1 
        4  4621 1 1 48 LEU HB3  H   6.058   9.845  49.346 1.00 . A A . 48 LEU HB3  1 1 
        4  4622 1 1 48 LEU HD11 H   8.883  11.794  49.196 1.00 . A A . 48 LEU HD11 1 1 
        4  4623 1 1 48 LEU HD12 H   8.316  10.165  48.829 1.00 . A A . 48 LEU HD12 1 1 
        4  4624 1 1 48 LEU HD13 H   9.396  10.435  50.192 1.00 . A A . 48 LEU HD13 1 1 
        4  4625 1 1 48 LEU HD21 H   8.074  12.510  51.982 1.00 . A A . 48 LEU HD21 1 1 
        4  4626 1 1 48 LEU HD22 H   6.398  12.747  51.492 1.00 . A A . 48 LEU HD22 1 1 
        4  4627 1 1 48 LEU HD23 H   7.708  13.181  50.394 1.00 . A A . 48 LEU HD23 1 1 
        4  4628 1 1 48 LEU HG   H   7.428  10.341  51.369 1.00 . A A . 48 LEU HG   1 1 
        4  4629 1 1 48 LEU N    N   4.997  13.010  49.250 1.00 . A A . 48 LEU N    1 1 
        4  4630 1 1 48 LEU O    O   5.935  11.350  46.387 1.00 . A A . 48 LEU O    1 1 
        4  4631 1 1 49 PRO C    C   3.627  11.223  44.910 1.00 . A A . 49 PRO C    1 1 
        4  4632 1 1 49 PRO CA   C   3.440  10.271  46.096 1.00 . A A . 49 PRO CA   1 1 
        4  4633 1 1 49 PRO CB   C   1.957  10.107  46.436 1.00 . A A . 49 PRO CB   1 1 
        4  4634 1 1 49 PRO CD   C   3.085  10.667  48.486 1.00 . A A . 49 PRO CD   1 1 
        4  4635 1 1 49 PRO CG   C   1.948   9.827  47.898 1.00 . A A . 49 PRO CG   1 1 
        4  4636 1 1 49 PRO HA   H   3.867   9.307  45.870 1.00 . A A . 49 PRO HA   1 1 
        4  4637 1 1 49 PRO HB2  H   1.414  11.020  46.220 1.00 . A A . 49 PRO HB2  1 1 
        4  4638 1 1 49 PRO HB3  H   1.531   9.275  45.894 1.00 . A A . 49 PRO HB3  1 1 
        4  4639 1 1 49 PRO HD2  H   2.719  11.619  48.800 1.00 . A A . 49 PRO HD2  1 1 
        4  4640 1 1 49 PRO HD3  H   3.548  10.144  49.300 1.00 . A A . 49 PRO HD3  1 1 
        4  4641 1 1 49 PRO HG2  H   0.996  10.120  48.327 1.00 . A A . 49 PRO HG2  1 1 
        4  4642 1 1 49 PRO HG3  H   2.134   8.779  48.081 1.00 . A A . 49 PRO HG3  1 1 
        4  4643 1 1 49 PRO N    N   4.029  10.813  47.364 1.00 . A A . 49 PRO N    1 1 
        4  4644 1 1 49 PRO O    O   3.676  10.790  43.760 1.00 . A A . 49 PRO O    1 1 
        4  4645 1 1 50 ALA C    C   5.371  13.299  43.494 1.00 . A A . 50 ALA C    1 1 
        4  4646 1 1 50 ALA CA   C   4.021  13.523  44.172 1.00 . A A . 50 ALA CA   1 1 
        4  4647 1 1 50 ALA CB   C   3.973  14.926  44.786 1.00 . A A . 50 ALA CB   1 1 
        4  4648 1 1 50 ALA H    H   3.822  12.801  46.138 1.00 . A A . 50 ALA H    1 1 
        4  4649 1 1 50 ALA HA   H   3.289  13.462  43.382 1.00 . A A . 50 ALA HA   1 1 
        4  4650 1 1 50 ALA HB1  H   3.794  15.655  44.010 1.00 . A A . 50 ALA HB1  1 1 
        4  4651 1 1 50 ALA HB2  H   4.914  15.141  45.271 1.00 . A A . 50 ALA HB2  1 1 
        4  4652 1 1 50 ALA HB3  H   3.175  14.973  45.513 1.00 . A A . 50 ALA HB3  1 1 
        4  4653 1 1 50 ALA N    N   3.781  12.512  45.202 1.00 . A A . 50 ALA N    1 1 
        4  4654 1 1 50 ALA O    O   5.527  13.592  42.309 1.00 . A A . 50 ALA O    1 1 
        4  4655 1 1 51 LEU C    C   7.509  11.436  42.536 1.00 . A A . 51 LEU C    1 1 
        4  4656 1 1 51 LEU CA   C   7.642  12.482  43.643 1.00 . A A . 51 LEU CA   1 1 
        4  4657 1 1 51 LEU CB   C   8.603  11.964  44.726 1.00 . A A . 51 LEU CB   1 1 
        4  4658 1 1 51 LEU CD1  C  10.136  13.988  44.812 1.00 . A A . 51 LEU CD1  1 1 
        4  4659 1 1 51 LEU CD2  C   7.946  14.000  46.044 1.00 . A A . 51 LEU CD2  1 1 
        4  4660 1 1 51 LEU CG   C   9.124  13.128  45.593 1.00 . A A . 51 LEU CG   1 1 
        4  4661 1 1 51 LEU H    H   6.146  12.490  45.150 1.00 . A A . 51 LEU H    1 1 
        4  4662 1 1 51 LEU HA   H   8.039  13.397  43.236 1.00 . A A . 51 LEU HA   1 1 
        4  4663 1 1 51 LEU HB2  H   8.077  11.262  45.357 1.00 . A A . 51 LEU HB2  1 1 
        4  4664 1 1 51 LEU HB3  H   9.439  11.462  44.260 1.00 . A A . 51 LEU HB3  1 1 
        4  4665 1 1 51 LEU HD11 H   9.617  14.744  44.240 1.00 . A A . 51 LEU HD11 1 1 
        4  4666 1 1 51 LEU HD12 H  10.710  13.365  44.143 1.00 . A A . 51 LEU HD12 1 1 
        4  4667 1 1 51 LEU HD13 H  10.805  14.469  45.509 1.00 . A A . 51 LEU HD13 1 1 
        4  4668 1 1 51 LEU HD21 H   7.599  14.594  45.212 1.00 . A A . 51 LEU HD21 1 1 
        4  4669 1 1 51 LEU HD22 H   8.266  14.652  46.843 1.00 . A A . 51 LEU HD22 1 1 
        4  4670 1 1 51 LEU HD23 H   7.147  13.368  46.394 1.00 . A A . 51 LEU HD23 1 1 
        4  4671 1 1 51 LEU HG   H   9.613  12.719  46.466 1.00 . A A . 51 LEU HG   1 1 
        4  4672 1 1 51 LEU N    N   6.333  12.755  44.225 1.00 . A A . 51 LEU N    1 1 
        4  4673 1 1 51 LEU O    O   8.139  11.529  41.485 1.00 . A A . 51 LEU O    1 1 
        4  4674 1 1 52 ALA C    C   5.852   9.992  40.529 1.00 . A A . 52 ALA C    1 1 
        4  4675 1 1 52 ALA CA   C   6.407   9.392  41.820 1.00 . A A . 52 ALA CA   1 1 
        4  4676 1 1 52 ALA CB   C   5.421   8.370  42.388 1.00 . A A . 52 ALA CB   1 1 
        4  4677 1 1 52 ALA H    H   6.161  10.493  43.640 1.00 . A A . 52 ALA H    1 1 
        4  4678 1 1 52 ALA HA   H   7.337   8.897  41.585 1.00 . A A . 52 ALA HA   1 1 
        4  4679 1 1 52 ALA HB1  H   4.438   8.815  42.453 1.00 . A A . 52 ALA HB1  1 1 
        4  4680 1 1 52 ALA HB2  H   5.744   8.065  43.372 1.00 . A A . 52 ALA HB2  1 1 
        4  4681 1 1 52 ALA HB3  H   5.383   7.509  41.738 1.00 . A A . 52 ALA HB3  1 1 
        4  4682 1 1 52 ALA N    N   6.654  10.453  42.794 1.00 . A A . 52 ALA N    1 1 
        4  4683 1 1 52 ALA O    O   6.287   9.634  39.435 1.00 . A A . 52 ALA O    1 1 
        4  4684 1 1 53 ILE C    C   5.406  12.367  38.728 1.00 . A A . 53 ILE C    1 1 
        4  4685 1 1 53 ILE CA   C   4.336  11.571  39.484 1.00 . A A . 53 ILE CA   1 1 
        4  4686 1 1 53 ILE CB   C   3.145  12.474  39.883 1.00 . A A . 53 ILE CB   1 1 
        4  4687 1 1 53 ILE CD1  C   1.993  10.996  41.578 1.00 . A A . 53 ILE CD1  1 1 
        4  4688 1 1 53 ILE CG1  C   1.896  11.614  40.183 1.00 . A A . 53 ILE CG1  1 1 
        4  4689 1 1 53 ILE CG2  C   2.816  13.448  38.742 1.00 . A A . 53 ILE CG2  1 1 
        4  4690 1 1 53 ILE H    H   4.610  11.174  41.559 1.00 . A A . 53 ILE H    1 1 
        4  4691 1 1 53 ILE HA   H   3.987  10.829  38.782 1.00 . A A . 53 ILE HA   1 1 
        4  4692 1 1 53 ILE HB   H   3.410  13.039  40.766 1.00 . A A . 53 ILE HB   1 1 
        4  4693 1 1 53 ILE HD11 H   2.825  10.311  41.616 1.00 . A A . 53 ILE HD11 1 1 
        4  4694 1 1 53 ILE HD12 H   1.080  10.460  41.796 1.00 . A A . 53 ILE HD12 1 1 
        4  4695 1 1 53 ILE HD13 H   2.132  11.776  42.307 1.00 . A A . 53 ILE HD13 1 1 
        4  4696 1 1 53 ILE HG12 H   1.014  12.237  40.137 1.00 . A A . 53 ILE HG12 1 1 
        4  4697 1 1 53 ILE HG13 H   1.810  10.827  39.449 1.00 . A A . 53 ILE HG13 1 1 
        4  4698 1 1 53 ILE HG21 H   3.568  14.223  38.700 1.00 . A A . 53 ILE HG21 1 1 
        4  4699 1 1 53 ILE HG22 H   1.849  13.896  38.918 1.00 . A A . 53 ILE HG22 1 1 
        4  4700 1 1 53 ILE HG23 H   2.799  12.912  37.805 1.00 . A A . 53 ILE HG23 1 1 
        4  4701 1 1 53 ILE N    N   4.909  10.920  40.660 1.00 . A A . 53 ILE N    1 1 
        4  4702 1 1 53 ILE O    O   5.532  12.203  37.515 1.00 . A A . 53 ILE O    1 1 
        4  4703 1 1 54 PHE C    C   8.216  13.058  38.031 1.00 . A A . 54 PHE C    1 1 
        4  4704 1 1 54 PHE CA   C   7.198  13.990  38.687 1.00 . A A . 54 PHE CA   1 1 
        4  4705 1 1 54 PHE CB   C   7.928  14.938  39.646 1.00 . A A . 54 PHE CB   1 1 
        4  4706 1 1 54 PHE CD1  C   6.711  17.057  39.018 1.00 . A A . 54 PHE CD1  1 1 
        4  4707 1 1 54 PHE CD2  C   6.552  16.258  41.302 1.00 . A A . 54 PHE CD2  1 1 
        4  4708 1 1 54 PHE CE1  C   5.897  18.148  39.343 1.00 . A A . 54 PHE CE1  1 1 
        4  4709 1 1 54 PHE CE2  C   5.739  17.351  41.627 1.00 . A A . 54 PHE CE2  1 1 
        4  4710 1 1 54 PHE CG   C   7.039  16.112  39.998 1.00 . A A . 54 PHE CG   1 1 
        4  4711 1 1 54 PHE CZ   C   5.411  18.296  40.648 1.00 . A A . 54 PHE CZ   1 1 
        4  4712 1 1 54 PHE H    H   6.067  13.375  40.361 1.00 . A A . 54 PHE H    1 1 
        4  4713 1 1 54 PHE HA   H   6.728  14.571  37.909 1.00 . A A . 54 PHE HA   1 1 
        4  4714 1 1 54 PHE HB2  H   8.192  14.402  40.546 1.00 . A A . 54 PHE HB2  1 1 
        4  4715 1 1 54 PHE HB3  H   8.828  15.304  39.173 1.00 . A A . 54 PHE HB3  1 1 
        4  4716 1 1 54 PHE HD1  H   7.086  16.943  38.011 1.00 . A A . 54 PHE HD1  1 1 
        4  4717 1 1 54 PHE HD2  H   6.807  15.532  42.058 1.00 . A A . 54 PHE HD2  1 1 
        4  4718 1 1 54 PHE HE1  H   5.644  18.878  38.588 1.00 . A A . 54 PHE HE1  1 1 
        4  4719 1 1 54 PHE HE2  H   5.364  17.463  42.634 1.00 . A A . 54 PHE HE2  1 1 
        4  4720 1 1 54 PHE HZ   H   4.783  19.138  40.898 1.00 . A A . 54 PHE HZ   1 1 
        4  4721 1 1 54 PHE N    N   6.176  13.223  39.399 1.00 . A A . 54 PHE N    1 1 
        4  4722 1 1 54 PHE O    O   8.659  13.309  36.912 1.00 . A A . 54 PHE O    1 1 
        4  4723 1 1 55 ILE C    C   8.914  10.336  36.952 1.00 . A A . 55 ILE C    1 1 
        4  4724 1 1 55 ILE CA   C   9.542  11.034  38.163 1.00 . A A . 55 ILE CA   1 1 
        4  4725 1 1 55 ILE CB   C   9.926   9.994  39.261 1.00 . A A . 55 ILE CB   1 1 
        4  4726 1 1 55 ILE CD1  C  10.842  11.631  40.966 1.00 . A A . 55 ILE CD1  1 1 
        4  4727 1 1 55 ILE CG1  C  11.178  10.454  40.045 1.00 . A A . 55 ILE CG1  1 1 
        4  4728 1 1 55 ILE CG2  C  10.227   8.618  38.641 1.00 . A A . 55 ILE CG2  1 1 
        4  4729 1 1 55 ILE H    H   8.194  11.817  39.603 1.00 . A A . 55 ILE H    1 1 
        4  4730 1 1 55 ILE HA   H  10.429  11.577  37.874 1.00 . A A . 55 ILE HA   1 1 
        4  4731 1 1 55 ILE HB   H   9.099   9.892  39.949 1.00 . A A . 55 ILE HB   1 1 
        4  4732 1 1 55 ILE HD11 H  11.743  12.184  41.184 1.00 . A A . 55 ILE HD11 1 1 
        4  4733 1 1 55 ILE HD12 H  10.422  11.255  41.888 1.00 . A A . 55 ILE HD12 1 1 
        4  4734 1 1 55 ILE HD13 H  10.130  12.282  40.485 1.00 . A A . 55 ILE HD13 1 1 
        4  4735 1 1 55 ILE HG12 H  11.541   9.632  40.645 1.00 . A A . 55 ILE HG12 1 1 
        4  4736 1 1 55 ILE HG13 H  11.954  10.751  39.354 1.00 . A A . 55 ILE HG13 1 1 
        4  4737 1 1 55 ILE HG21 H  10.877   8.741  37.787 1.00 . A A . 55 ILE HG21 1 1 
        4  4738 1 1 55 ILE HG22 H   9.302   8.156  38.325 1.00 . A A . 55 ILE HG22 1 1 
        4  4739 1 1 55 ILE HG23 H  10.710   7.988  39.373 1.00 . A A . 55 ILE HG23 1 1 
        4  4740 1 1 55 ILE N    N   8.581  11.983  38.717 1.00 . A A . 55 ILE N    1 1 
        4  4741 1 1 55 ILE O    O   9.550  10.136  35.917 1.00 . A A . 55 ILE O    1 1 
        4  4742 1 1 56 GLY C    C   6.670  10.260  34.872 1.00 . A A . 56 GLY C    1 1 
        4  4743 1 1 56 GLY CA   C   6.874   9.335  36.070 1.00 . A A . 56 GLY CA   1 1 
        4  4744 1 1 56 GLY H    H   7.222  10.242  37.969 1.00 . A A . 56 GLY H    1 1 
        4  4745 1 1 56 GLY HA2  H   7.401   8.448  35.749 1.00 . A A . 56 GLY HA2  1 1 
        4  4746 1 1 56 GLY HA3  H   5.910   9.051  36.463 1.00 . A A . 56 GLY HA3  1 1 
        4  4747 1 1 56 GLY N    N   7.643   9.992  37.120 1.00 . A A . 56 GLY N    1 1 
        4  4748 1 1 56 GLY O    O   6.765   9.837  33.721 1.00 . A A . 56 GLY O    1 1 
        4  4749 1 1 57 LEU C    C   7.394  12.863  33.333 1.00 . A A . 57 LEU C    1 1 
        4  4750 1 1 57 LEU CA   C   6.130  12.528  34.123 1.00 . A A . 57 LEU CA   1 1 
        4  4751 1 1 57 LEU CB   C   5.569  13.800  34.771 1.00 . A A . 57 LEU CB   1 1 
        4  4752 1 1 57 LEU CD1  C   4.205  14.338  32.714 1.00 . A A . 57 LEU CD1  1 1 
        4  4753 1 1 57 LEU CD2  C   4.718  16.119  34.405 1.00 . A A . 57 LEU CD2  1 1 
        4  4754 1 1 57 LEU CG   C   5.256  14.865  33.706 1.00 . A A . 57 LEU CG   1 1 
        4  4755 1 1 57 LEU H    H   6.300  11.802  36.095 1.00 . A A . 57 LEU H    1 1 
        4  4756 1 1 57 LEU HA   H   5.392  12.136  33.442 1.00 . A A . 57 LEU HA   1 1 
        4  4757 1 1 57 LEU HB2  H   4.662  13.557  35.306 1.00 . A A . 57 LEU HB2  1 1 
        4  4758 1 1 57 LEU HB3  H   6.296  14.196  35.465 1.00 . A A . 57 LEU HB3  1 1 
        4  4759 1 1 57 LEU HD11 H   3.686  15.168  32.256 1.00 . A A . 57 LEU HD11 1 1 
        4  4760 1 1 57 LEU HD12 H   3.492  13.714  33.234 1.00 . A A . 57 LEU HD12 1 1 
        4  4761 1 1 57 LEU HD13 H   4.695  13.758  31.946 1.00 . A A . 57 LEU HD13 1 1 
        4  4762 1 1 57 LEU HD21 H   5.361  16.371  35.237 1.00 . A A . 57 LEU HD21 1 1 
        4  4763 1 1 57 LEU HD22 H   3.719  15.928  34.768 1.00 . A A . 57 LEU HD22 1 1 
        4  4764 1 1 57 LEU HD23 H   4.696  16.940  33.705 1.00 . A A . 57 LEU HD23 1 1 
        4  4765 1 1 57 LEU HG   H   6.159  15.117  33.169 1.00 . A A . 57 LEU HG   1 1 
        4  4766 1 1 57 LEU N    N   6.373  11.523  35.159 1.00 . A A . 57 LEU N    1 1 
        4  4767 1 1 57 LEU O    O   7.322  13.193  32.149 1.00 . A A . 57 LEU O    1 1 
        4  4768 1 1 58 THR C    C  10.149  11.947  32.314 1.00 . A A . 58 THR C    1 1 
        4  4769 1 1 58 THR CA   C   9.808  13.059  33.301 1.00 . A A . 58 THR CA   1 1 
        4  4770 1 1 58 THR CB   C  10.940  13.201  34.327 1.00 . A A . 58 THR CB   1 1 
        4  4771 1 1 58 THR CG2  C  10.708  14.438  35.216 1.00 . A A . 58 THR CG2  1 1 
        4  4772 1 1 58 THR H    H   8.556  12.446  34.907 1.00 . A A . 58 THR H    1 1 
        4  4773 1 1 58 THR HA   H   9.707  13.994  32.770 1.00 . A A . 58 THR HA   1 1 
        4  4774 1 1 58 THR HB   H  11.879  13.311  33.804 1.00 . A A . 58 THR HB   1 1 
        4  4775 1 1 58 THR HG1  H  10.092  11.789  35.362 1.00 . A A . 58 THR HG1  1 1 
        4  4776 1 1 58 THR HG21 H  11.098  14.244  36.204 1.00 . A A . 58 THR HG21 1 1 
        4  4777 1 1 58 THR HG22 H   9.651  14.652  35.284 1.00 . A A . 58 THR HG22 1 1 
        4  4778 1 1 58 THR HG23 H  11.218  15.291  34.792 1.00 . A A . 58 THR HG23 1 1 
        4  4779 1 1 58 THR N    N   8.549  12.770  33.982 1.00 . A A . 58 THR N    1 1 
        4  4780 1 1 58 THR O    O  10.634  12.202  31.215 1.00 . A A . 58 THR O    1 1 
        4  4781 1 1 58 THR OG1  O  10.991  12.033  35.133 1.00 . A A . 58 THR OG1  1 1 
        4  4782 1 1 59 ILE C    C   9.216   9.649  30.611 1.00 . A A . 59 ILE C    1 1 
        4  4783 1 1 59 ILE CA   C  10.082   9.553  31.866 1.00 . A A . 59 ILE CA   1 1 
        4  4784 1 1 59 ILE CB   C   9.784   8.258  32.627 1.00 . A A . 59 ILE CB   1 1 
        4  4785 1 1 59 ILE CD1  C  10.386   6.943  34.668 1.00 . A A . 59 ILE CD1  1 1 
        4  4786 1 1 59 ILE CG1  C  10.827   8.070  33.733 1.00 . A A . 59 ILE CG1  1 1 
        4  4787 1 1 59 ILE CG2  C   9.847   7.066  31.667 1.00 . A A . 59 ILE CG2  1 1 
        4  4788 1 1 59 ILE H    H   9.407  10.618  33.588 1.00 . A A . 59 ILE H    1 1 
        4  4789 1 1 59 ILE HA   H  11.109   9.550  31.533 1.00 . A A . 59 ILE HA   1 1 
        4  4790 1 1 59 ILE HB   H   8.798   8.315  33.066 1.00 . A A . 59 ILE HB   1 1 
        4  4791 1 1 59 ILE HD11 H   9.386   7.141  35.026 1.00 . A A . 59 ILE HD11 1 1 
        4  4792 1 1 59 ILE HD12 H  11.063   6.886  35.508 1.00 . A A . 59 ILE HD12 1 1 
        4  4793 1 1 59 ILE HD13 H  10.396   6.006  34.132 1.00 . A A . 59 ILE HD13 1 1 
        4  4794 1 1 59 ILE HG12 H  11.780   7.820  33.290 1.00 . A A . 59 ILE HG12 1 1 
        4  4795 1 1 59 ILE HG13 H  10.922   8.987  34.297 1.00 . A A . 59 ILE HG13 1 1 
        4  4796 1 1 59 ILE HG21 H   8.970   7.066  31.037 1.00 . A A . 59 ILE HG21 1 1 
        4  4797 1 1 59 ILE HG22 H   9.883   6.147  32.233 1.00 . A A . 59 ILE HG22 1 1 
        4  4798 1 1 59 ILE HG23 H  10.732   7.146  31.053 1.00 . A A . 59 ILE HG23 1 1 
        4  4799 1 1 59 ILE N    N   9.847  10.717  32.718 1.00 . A A . 59 ILE N    1 1 
        4  4800 1 1 59 ILE O    O   9.671   9.339  29.510 1.00 . A A . 59 ILE O    1 1 
        4  4801 1 1 60 TYR C    C   7.659  10.923  28.486 1.00 . A A . 60 TYR C    1 1 
        4  4802 1 1 60 TYR CA   C   7.038  10.156  29.659 1.00 . A A . 60 TYR CA   1 1 
        4  4803 1 1 60 TYR CB   C   5.740  10.853  30.119 1.00 . A A . 60 TYR CB   1 1 
        4  4804 1 1 60 TYR CD1  C   5.179   8.796  31.477 1.00 . A A . 60 TYR CD1  1 1 
        4  4805 1 1 60 TYR CD2  C   3.392   9.938  30.301 1.00 . A A . 60 TYR CD2  1 1 
        4  4806 1 1 60 TYR CE1  C   4.259   7.861  31.967 1.00 . A A . 60 TYR CE1  1 1 
        4  4807 1 1 60 TYR CE2  C   2.471   9.003  30.791 1.00 . A A . 60 TYR CE2  1 1 
        4  4808 1 1 60 TYR CG   C   4.745   9.834  30.644 1.00 . A A . 60 TYR CG   1 1 
        4  4809 1 1 60 TYR CZ   C   2.905   7.965  31.624 1.00 . A A . 60 TYR CZ   1 1 
        4  4810 1 1 60 TYR H    H   7.634  10.235  31.688 1.00 . A A . 60 TYR H    1 1 
        4  4811 1 1 60 TYR HA   H   6.798   9.168  29.295 1.00 . A A . 60 TYR HA   1 1 
        4  4812 1 1 60 TYR HB2  H   5.973  11.556  30.904 1.00 . A A . 60 TYR HB2  1 1 
        4  4813 1 1 60 TYR HB3  H   5.295  11.386  29.287 1.00 . A A . 60 TYR HB3  1 1 
        4  4814 1 1 60 TYR HD1  H   6.221   8.713  31.740 1.00 . A A . 60 TYR HD1  1 1 
        4  4815 1 1 60 TYR HD2  H   3.057  10.739  29.658 1.00 . A A . 60 TYR HD2  1 1 
        4  4816 1 1 60 TYR HE1  H   4.593   7.060  32.610 1.00 . A A . 60 TYR HE1  1 1 
        4  4817 1 1 60 TYR HE2  H   1.428   9.083  30.527 1.00 . A A . 60 TYR HE2  1 1 
        4  4818 1 1 60 TYR HH   H   1.242   7.033  31.516 1.00 . A A . 60 TYR HH   1 1 
        4  4819 1 1 60 TYR N    N   7.965  10.053  30.782 1.00 . A A . 60 TYR N    1 1 
        4  4820 1 1 60 TYR O    O   7.396  10.585  27.337 1.00 . A A . 60 TYR O    1 1 
        4  4821 1 1 60 TYR OH   O   1.998   7.044  32.107 1.00 . A A . 60 TYR OH   1 1 
        4  4822 1 1 61 ALA C    C  10.158  11.756  26.921 1.00 . A A . 61 ALA C    1 1 
        4  4823 1 1 61 ALA CA   C   9.135  12.641  27.640 1.00 . A A . 61 ALA CA   1 1 
        4  4824 1 1 61 ALA CB   C   9.826  13.899  28.169 1.00 . A A . 61 ALA CB   1 1 
        4  4825 1 1 61 ALA H    H   8.738  12.140  29.670 1.00 . A A . 61 ALA H    1 1 
        4  4826 1 1 61 ALA HA   H   8.424  12.928  26.881 1.00 . A A . 61 ALA HA   1 1 
        4  4827 1 1 61 ALA HB1  H   9.087  14.570  28.581 1.00 . A A . 61 ALA HB1  1 1 
        4  4828 1 1 61 ALA HB2  H  10.347  14.390  27.360 1.00 . A A . 61 ALA HB2  1 1 
        4  4829 1 1 61 ALA HB3  H  10.532  13.625  28.938 1.00 . A A . 61 ALA HB3  1 1 
        4  4830 1 1 61 ALA N    N   8.499  11.920  28.746 1.00 . A A . 61 ALA N    1 1 
        4  4831 1 1 61 ALA O    O  10.126  11.660  25.695 1.00 . A A . 61 ALA O    1 1 
        4  4832 1 1 62 ILE C    C  11.558   9.358  26.011 1.00 . A A . 62 ILE C    1 1 
        4  4833 1 1 62 ILE CA   C  12.147  10.369  27.004 1.00 . A A . 62 ILE CA   1 1 
        4  4834 1 1 62 ILE CB   C  12.940   9.607  28.098 1.00 . A A . 62 ILE CB   1 1 
        4  4835 1 1 62 ILE CD1  C  13.193  11.646  29.537 1.00 . A A . 62 ILE CD1  1 1 
        4  4836 1 1 62 ILE CG1  C  13.943  10.553  28.779 1.00 . A A . 62 ILE CG1  1 1 
        4  4837 1 1 62 ILE CG2  C  13.717   8.428  27.488 1.00 . A A . 62 ILE CG2  1 1 
        4  4838 1 1 62 ILE H    H  11.175  11.363  28.604 1.00 . A A . 62 ILE H    1 1 
        4  4839 1 1 62 ILE HA   H  12.832  11.044  26.512 1.00 . A A . 62 ILE HA   1 1 
        4  4840 1 1 62 ILE HB   H  12.248   9.229  28.836 1.00 . A A . 62 ILE HB   1 1 
        4  4841 1 1 62 ILE HD11 H  12.808  12.372  28.837 1.00 . A A . 62 ILE HD11 1 1 
        4  4842 1 1 62 ILE HD12 H  13.866  12.132  30.228 1.00 . A A . 62 ILE HD12 1 1 
        4  4843 1 1 62 ILE HD13 H  12.377  11.203  30.084 1.00 . A A . 62 ILE HD13 1 1 
        4  4844 1 1 62 ILE HG12 H  14.550   9.990  29.472 1.00 . A A . 62 ILE HG12 1 1 
        4  4845 1 1 62 ILE HG13 H  14.579  11.005  28.033 1.00 . A A . 62 ILE HG13 1 1 
        4  4846 1 1 62 ILE HG21 H  13.033   7.621  27.270 1.00 . A A . 62 ILE HG21 1 1 
        4  4847 1 1 62 ILE HG22 H  14.465   8.085  28.189 1.00 . A A . 62 ILE HG22 1 1 
        4  4848 1 1 62 ILE HG23 H  14.198   8.748  26.576 1.00 . A A . 62 ILE HG23 1 1 
        4  4849 1 1 62 ILE N    N  11.099  11.165  27.648 1.00 . A A . 62 ILE N    1 1 
        4  4850 1 1 62 ILE O    O  12.067   9.197  24.902 1.00 . A A . 62 ILE O    1 1 
        4  4851 1 1 63 GLN C    C   9.172   8.418  24.338 1.00 . A A . 63 GLN C    1 1 
        4  4852 1 1 63 GLN CA   C   9.835   7.722  25.531 1.00 . A A . 63 GLN CA   1 1 
        4  4853 1 1 63 GLN CB   C   8.794   6.910  26.309 1.00 . A A . 63 GLN CB   1 1 
        4  4854 1 1 63 GLN CD   C   6.725   7.068  27.717 1.00 . A A . 63 GLN CD   1 1 
        4  4855 1 1 63 GLN CG   C   7.807   7.859  26.991 1.00 . A A . 63 GLN CG   1 1 
        4  4856 1 1 63 GLN H    H  10.099   8.904  27.288 1.00 . A A . 63 GLN H    1 1 
        4  4857 1 1 63 GLN HA   H  10.588   7.047  25.150 1.00 . A A . 63 GLN HA   1 1 
        4  4858 1 1 63 GLN HB2  H   8.260   6.263  25.628 1.00 . A A . 63 GLN HB2  1 1 
        4  4859 1 1 63 GLN HB3  H   9.291   6.313  27.058 1.00 . A A . 63 GLN HB3  1 1 
        4  4860 1 1 63 GLN HE21 H   7.707   7.007  29.442 1.00 . A A . 63 GLN HE21 1 1 
        4  4861 1 1 63 GLN HE22 H   6.196   6.234  29.440 1.00 . A A . 63 GLN HE22 1 1 
        4  4862 1 1 63 GLN HG2  H   8.341   8.470  27.703 1.00 . A A . 63 GLN HG2  1 1 
        4  4863 1 1 63 GLN HG3  H   7.345   8.493  26.252 1.00 . A A . 63 GLN HG3  1 1 
        4  4864 1 1 63 GLN N    N  10.480   8.695  26.410 1.00 . A A . 63 GLN N    1 1 
        4  4865 1 1 63 GLN NE2  N   6.889   6.743  28.971 1.00 . A A . 63 GLN NE2  1 1 
        4  4866 1 1 63 GLN O    O   9.197   7.903  23.224 1.00 . A A . 63 GLN O    1 1 
        4  4867 1 1 63 GLN OE1  O   5.690   6.753  27.128 1.00 . A A . 63 GLN OE1  1 1 
        4  4868 1 1 64 ARG C    C   9.001  11.179  22.708 1.00 . A A . 64 ARG C    1 1 
        4  4869 1 1 64 ARG CA   C   7.959  10.424  23.558 1.00 . A A . 64 ARG CA   1 1 
        4  4870 1 1 64 ARG CB   C   6.992  11.429  24.232 1.00 . A A . 64 ARG CB   1 1 
        4  4871 1 1 64 ARG CD   C   6.063  12.336  22.067 1.00 . A A . 64 ARG CD   1 1 
        4  4872 1 1 64 ARG CG   C   5.719  11.633  23.382 1.00 . A A . 64 ARG CG   1 1 
        4  4873 1 1 64 ARG CZ   C   4.980  13.816  20.481 1.00 . A A . 64 ARG CZ   1 1 
        4  4874 1 1 64 ARG H    H   8.655   9.991  25.480 1.00 . A A . 64 ARG H    1 1 
        4  4875 1 1 64 ARG HA   H   7.388   9.773  22.923 1.00 . A A . 64 ARG HA   1 1 
        4  4876 1 1 64 ARG HB2  H   6.703  11.043  25.194 1.00 . A A . 64 ARG HB2  1 1 
        4  4877 1 1 64 ARG HB3  H   7.485  12.382  24.369 1.00 . A A . 64 ARG HB3  1 1 
        4  4878 1 1 64 ARG HD2  H   6.814  13.091  22.241 1.00 . A A . 64 ARG HD2  1 1 
        4  4879 1 1 64 ARG HD3  H   6.444  11.606  21.368 1.00 . A A . 64 ARG HD3  1 1 
        4  4880 1 1 64 ARG HE   H   3.989  12.717  21.833 1.00 . A A . 64 ARG HE   1 1 
        4  4881 1 1 64 ARG HG2  H   5.269  10.675  23.171 1.00 . A A . 64 ARG HG2  1 1 
        4  4882 1 1 64 ARG HG3  H   5.017  12.239  23.936 1.00 . A A . 64 ARG HG3  1 1 
        4  4883 1 1 64 ARG HH11 H   6.981  13.839  20.505 1.00 . A A . 64 ARG HH11 1 1 
        4  4884 1 1 64 ARG HH12 H   6.235  14.835  19.300 1.00 . A A . 64 ARG HH12 1 1 
        4  4885 1 1 64 ARG HH21 H   3.002  13.989  20.226 1.00 . A A . 64 ARG HH21 1 1 
        4  4886 1 1 64 ARG HH22 H   3.982  14.919  19.143 1.00 . A A . 64 ARG HH22 1 1 
        4  4887 1 1 64 ARG N    N   8.610   9.600  24.583 1.00 . A A . 64 ARG N    1 1 
        4  4888 1 1 64 ARG NE   N   4.877  12.963  21.495 1.00 . A A . 64 ARG NE   1 1 
        4  4889 1 1 64 ARG NH1  N   6.157  14.192  20.063 1.00 . A A . 64 ARG NH1  1 1 
        4  4890 1 1 64 ARG NH2  N   3.904  14.277  19.905 1.00 . A A . 64 ARG NH2  1 1 
        4  4891 1 1 64 ARG O    O   8.713  11.669  21.620 1.00 . A A . 64 ARG O    1 1 
        4  4892 1 1 65 LYS C    C  11.974  11.365  21.440 1.00 . A A . 65 LYS C    1 1 
        4  4893 1 1 65 LYS CA   C  11.311  12.045  22.658 1.00 . A A . 65 LYS CA   1 1 
        4  4894 1 1 65 LYS CB   C  12.395  12.211  23.730 1.00 . A A . 65 LYS CB   1 1 
        4  4895 1 1 65 LYS CD   C  14.552  13.331  24.319 1.00 . A A . 65 LYS CD   1 1 
        4  4896 1 1 65 LYS CE   C  15.643  14.280  23.822 1.00 . A A . 65 LYS CE   1 1 
        4  4897 1 1 65 LYS CG   C  13.524  13.107  23.207 1.00 . A A . 65 LYS CG   1 1 
        4  4898 1 1 65 LYS H    H  10.365  10.833  24.110 1.00 . A A . 65 LYS H    1 1 
        4  4899 1 1 65 LYS HA   H  10.958  13.038  22.429 1.00 . A A . 65 LYS HA   1 1 
        4  4900 1 1 65 LYS HB2  H  11.960  12.660  24.611 1.00 . A A . 65 LYS HB2  1 1 
        4  4901 1 1 65 LYS HB3  H  12.797  11.242  23.985 1.00 . A A . 65 LYS HB3  1 1 
        4  4902 1 1 65 LYS HD2  H  14.062  13.763  25.180 1.00 . A A . 65 LYS HD2  1 1 
        4  4903 1 1 65 LYS HD3  H  14.996  12.386  24.594 1.00 . A A . 65 LYS HD3  1 1 
        4  4904 1 1 65 LYS HE2  H  15.194  15.205  23.492 1.00 . A A . 65 LYS HE2  1 1 
        4  4905 1 1 65 LYS HE3  H  16.336  14.483  24.625 1.00 . A A . 65 LYS HE3  1 1 
        4  4906 1 1 65 LYS HG2  H  14.007  12.632  22.366 1.00 . A A . 65 LYS HG2  1 1 
        4  4907 1 1 65 LYS HG3  H  13.116  14.059  22.900 1.00 . A A . 65 LYS HG3  1 1 
        4  4908 1 1 65 LYS HZ1  H  17.396  13.727  22.842 1.00 . A A . 65 LYS HZ1  1 1 
        4  4909 1 1 65 LYS HZ2  H  16.117  14.134  21.799 1.00 . A A . 65 LYS HZ2  1 1 
        4  4910 1 1 65 LYS HZ3  H  16.109  12.646  22.618 1.00 . A A . 65 LYS HZ3  1 1 
        4  4911 1 1 65 LYS N    N  10.198  11.306  23.269 1.00 . A A . 65 LYS N    1 1 
        4  4912 1 1 65 LYS NZ   N  16.371  13.649  22.685 1.00 . A A . 65 LYS NZ   1 1 
        4  4913 1 1 65 LYS O    O  12.323  12.021  20.458 1.00 . A A . 65 LYS O    1 1 
        4  4914 1 1 66 ARG C    C  11.446   9.260  19.260 1.00 . A A . 66 ARG C    1 1 
        4  4915 1 1 66 ARG CA   C  12.557   9.306  20.316 1.00 . A A . 66 ARG CA   1 1 
        4  4916 1 1 66 ARG CB   C  12.981   7.889  20.715 1.00 . A A . 66 ARG CB   1 1 
        4  4917 1 1 66 ARG CD   C  15.041   7.933  19.243 1.00 . A A . 66 ARG CD   1 1 
        4  4918 1 1 66 ARG CG   C  13.717   7.207  19.551 1.00 . A A . 66 ARG CG   1 1 
        4  4919 1 1 66 ARG CZ   C  15.810   9.740  17.813 1.00 . A A . 66 ARG CZ   1 1 
        4  4920 1 1 66 ARG H    H  11.476   9.629  22.180 1.00 . A A . 66 ARG H    1 1 
        4  4921 1 1 66 ARG HA   H  13.387   9.830  19.869 1.00 . A A . 66 ARG HA   1 1 
        4  4922 1 1 66 ARG HB2  H  13.634   7.939  21.573 1.00 . A A . 66 ARG HB2  1 1 
        4  4923 1 1 66 ARG HB3  H  12.104   7.312  20.966 1.00 . A A . 66 ARG HB3  1 1 
        4  4924 1 1 66 ARG HD2  H  15.401   8.439  20.127 1.00 . A A . 66 ARG HD2  1 1 
        4  4925 1 1 66 ARG HD3  H  15.781   7.210  18.924 1.00 . A A . 66 ARG HD3  1 1 
        4  4926 1 1 66 ARG HE   H  13.978   8.941  17.712 1.00 . A A . 66 ARG HE   1 1 
        4  4927 1 1 66 ARG HG2  H  13.921   6.179  19.817 1.00 . A A . 66 ARG HG2  1 1 
        4  4928 1 1 66 ARG HG3  H  13.088   7.228  18.673 1.00 . A A . 66 ARG HG3  1 1 
        4  4929 1 1 66 ARG HH11 H  17.098   9.091  19.202 1.00 . A A . 66 ARG HH11 1 1 
        4  4930 1 1 66 ARG HH12 H  17.683  10.352  18.168 1.00 . A A . 66 ARG HH12 1 1 
        4  4931 1 1 66 ARG HH21 H  14.745  10.581  16.341 1.00 . A A . 66 ARG HH21 1 1 
        4  4932 1 1 66 ARG HH22 H  16.351  11.195  16.549 1.00 . A A . 66 ARG HH22 1 1 
        4  4933 1 1 66 ARG N    N  12.040  10.036  21.490 1.00 . A A . 66 ARG N    1 1 
        4  4934 1 1 66 ARG NE   N  14.839   8.910  18.179 1.00 . A A . 66 ARG NE   1 1 
        4  4935 1 1 66 ARG NH1  N  16.953   9.728  18.444 1.00 . A A . 66 ARG NH1  1 1 
        4  4936 1 1 66 ARG NH2  N  15.621  10.570  16.824 1.00 . A A . 66 ARG NH2  1 1 
        4  4937 1 1 66 ARG O    O  11.604   9.760  18.147 1.00 . A A . 66 ARG O    1 1 
        4  4938 1 1 67 GLN C    C   8.681   9.891  18.302 1.00 . A A . 67 GLN C    1 1 
        4  4939 1 1 67 GLN CA   C   9.181   8.516  18.740 1.00 . A A . 67 GLN CA   1 1 
        4  4940 1 1 67 GLN CB   C   8.055   7.759  19.438 1.00 . A A . 67 GLN CB   1 1 
        4  4941 1 1 67 GLN CD   C   6.599   7.730  21.456 1.00 . A A . 67 GLN CD   1 1 
        4  4942 1 1 67 GLN CG   C   7.590   8.556  20.643 1.00 . A A . 67 GLN CG   1 1 
        4  4943 1 1 67 GLN H    H  10.346   8.185  20.493 1.00 . A A . 67 GLN H    1 1 
        4  4944 1 1 67 GLN HA   H   9.497   7.927  17.890 1.00 . A A . 67 GLN HA   1 1 
        4  4945 1 1 67 GLN HB2  H   7.231   7.624  18.752 1.00 . A A . 67 GLN HB2  1 1 
        4  4946 1 1 67 GLN HB3  H   8.417   6.796  19.763 1.00 . A A . 67 GLN HB3  1 1 
        4  4947 1 1 67 GLN HE21 H   5.045   8.871  20.980 1.00 . A A . 67 GLN HE21 1 1 
        4  4948 1 1 67 GLN HE22 H   4.697   7.560  22.000 1.00 . A A . 67 GLN HE22 1 1 
        4  4949 1 1 67 GLN HG2  H   8.448   8.801  21.241 1.00 . A A . 67 GLN HG2  1 1 
        4  4950 1 1 67 GLN HG3  H   7.110   9.466  20.312 1.00 . A A . 67 GLN HG3  1 1 
        4  4951 1 1 67 GLN N    N  10.334   8.651  19.633 1.00 . A A . 67 GLN N    1 1 
        4  4952 1 1 67 GLN NE2  N   5.344   8.083  21.481 1.00 . A A . 67 GLN NE2  1 1 
        4  4953 1 1 67 GLN O    O   7.816  10.013  17.437 1.00 . A A . 67 GLN O    1 1 
        4  4954 1 1 67 GLN OE1  O   6.970   6.720  22.055 1.00 . A A . 67 GLN OE1  1 1 
        4  4955 1 1 68 ALA C    C   8.621  12.514  17.239 1.00 . A A . 68 ALA C    1 1 
        4  4956 1 1 68 ALA CA   C   8.752  12.289  18.747 1.00 . A A . 68 ALA CA   1 1 
        4  4957 1 1 68 ALA CB   C   9.799  13.264  19.302 1.00 . A A . 68 ALA CB   1 1 
        4  4958 1 1 68 ALA H    H   9.849  10.676  19.675 1.00 . A A . 68 ALA H    1 1 
        4  4959 1 1 68 ALA HA   H   7.822  12.445  19.273 1.00 . A A . 68 ALA HA   1 1 
        4  4960 1 1 68 ALA HB1  H  10.637  13.327  18.622 1.00 . A A . 68 ALA HB1  1 1 
        4  4961 1 1 68 ALA HB2  H  10.145  12.914  20.259 1.00 . A A . 68 ALA HB2  1 1 
        4  4962 1 1 68 ALA HB3  H   9.355  14.242  19.415 1.00 . A A . 68 ALA HB3  1 1 
        4  4963 1 1 68 ALA N    N   9.194  10.911  18.984 1.00 . A A . 68 ALA N    1 1 
        4  4964 1 1 68 ALA O    O   7.672  13.143  16.770 1.00 . A A . 68 ALA O    1 1 
        4  4965 1 1 69 ASP C    C   8.130  11.402  14.592 1.00 . A A . 69 ASP C    1 1 
        4  4966 1 1 69 ASP CA   C   9.471  11.978  15.036 1.00 . A A . 69 ASP CA   1 1 
        4  4967 1 1 69 ASP CB   C  10.583  11.101  14.455 1.00 . A A . 69 ASP CB   1 1 
        4  4968 1 1 69 ASP CG   C  10.540  11.150  12.932 1.00 . A A . 69 ASP CG   1 1 
        4  4969 1 1 69 ASP H    H  10.234  11.391  16.943 1.00 . A A . 69 ASP H    1 1 
        4  4970 1 1 69 ASP HA   H   9.573  12.967  14.610 1.00 . A A . 69 ASP HA   1 1 
        4  4971 1 1 69 ASP HB2  H  11.542  11.462  14.800 1.00 . A A . 69 ASP HB2  1 1 
        4  4972 1 1 69 ASP HB3  H  10.444  10.081  14.784 1.00 . A A . 69 ASP HB3  1 1 
        4  4973 1 1 69 ASP N    N   9.542  11.916  16.490 1.00 . A A . 69 ASP N    1 1 
        4  4974 1 1 69 ASP O    O   7.356  12.069  13.906 1.00 . A A . 69 ASP O    1 1 
        4  4975 1 1 69 ASP OD1  O   9.603  11.726  12.405 1.00 . A A . 69 ASP OD1  1 1 
        4  4976 1 1 69 ASP OD2  O  11.435  10.598  12.314 1.00 . A A . 69 ASP OD2  1 1 
        4  4977 1 1 70 ALA C    C   5.413  10.272  15.183 1.00 . A A . 70 ALA C    1 1 
        4  4978 1 1 70 ALA CA   C   6.608   9.510  14.617 1.00 . A A . 70 ALA CA   1 1 
        4  4979 1 1 70 ALA CB   C   6.593   8.074  15.146 1.00 . A A . 70 ALA CB   1 1 
        4  4980 1 1 70 ALA H    H   8.539   9.654  15.477 1.00 . A A . 70 ALA H    1 1 
        4  4981 1 1 70 ALA HA   H   6.530   9.484  13.541 1.00 . A A . 70 ALA HA   1 1 
        4  4982 1 1 70 ALA HB1  H   7.339   7.491  14.626 1.00 . A A . 70 ALA HB1  1 1 
        4  4983 1 1 70 ALA HB2  H   5.617   7.640  14.982 1.00 . A A . 70 ALA HB2  1 1 
        4  4984 1 1 70 ALA HB3  H   6.813   8.078  16.203 1.00 . A A . 70 ALA HB3  1 1 
        4  4985 1 1 70 ALA N    N   7.860  10.161  14.985 1.00 . A A . 70 ALA N    1 1 
        4  4986 1 1 70 ALA O    O   4.383  10.409  14.522 1.00 . A A . 70 ALA O    1 1 
        4  4987 1 1 71 SER C    C   3.263  10.602  17.258 1.00 . A A . 71 SER C    1 1 
        4  4988 1 1 71 SER CA   C   4.479  11.501  17.059 1.00 . A A . 71 SER CA   1 1 
        4  4989 1 1 71 SER CB   C   4.093  12.715  16.212 1.00 . A A . 71 SER CB   1 1 
        4  4990 1 1 71 SER H    H   6.394  10.617  16.890 1.00 . A A . 71 SER H    1 1 
        4  4991 1 1 71 SER HA   H   4.822  11.844  18.024 1.00 . A A . 71 SER HA   1 1 
        4  4992 1 1 71 SER HB2  H   4.983  13.182  15.823 1.00 . A A . 71 SER HB2  1 1 
        4  4993 1 1 71 SER HB3  H   3.466  12.398  15.388 1.00 . A A . 71 SER HB3  1 1 
        4  4994 1 1 71 SER HG   H   3.050  14.341  16.451 1.00 . A A . 71 SER HG   1 1 
        4  4995 1 1 71 SER N    N   5.554  10.761  16.410 1.00 . A A . 71 SER N    1 1 
        4  4996 1 1 71 SER O    O   2.121  11.050  17.158 1.00 . A A . 71 SER O    1 1 
        4  4997 1 1 71 SER OG   O   3.392  13.649  17.023 1.00 . A A . 71 SER OG   1 1 
        4  4998 1 1 72 SER C    C   2.934   7.187  18.589 1.00 . A A . 72 SER C    1 1 
        4  4999 1 1 72 SER CA   C   2.444   8.364  17.750 1.00 . A A . 72 SER CA   1 1 
        4  5000 1 1 72 SER CB   C   1.934   7.852  16.403 1.00 . A A . 72 SER CB   1 1 
        4  5001 1 1 72 SER H    H   4.451   9.028  17.605 1.00 . A A . 72 SER H    1 1 
        4  5002 1 1 72 SER HA   H   1.631   8.849  18.269 1.00 . A A . 72 SER HA   1 1 
        4  5003 1 1 72 SER HB2  H   1.063   7.236  16.555 1.00 . A A . 72 SER HB2  1 1 
        4  5004 1 1 72 SER HB3  H   1.672   8.694  15.777 1.00 . A A . 72 SER HB3  1 1 
        4  5005 1 1 72 SER HG   H   3.682   7.665  15.570 1.00 . A A . 72 SER HG   1 1 
        4  5006 1 1 72 SER N    N   3.521   9.327  17.539 1.00 . A A . 72 SER N    1 1 
        4  5007 1 1 72 SER O    O   4.138   6.982  18.745 1.00 . A A . 72 SER O    1 1 
        4  5008 1 1 72 SER OG   O   2.951   7.079  15.779 1.00 . A A . 72 SER OG   1 1 
        4  5009 1 1 73 THR C    C   1.514   4.030  19.495 1.00 . A A . 73 THR C    1 1 
        4  5010 1 1 73 THR CA   C   2.322   5.251  19.955 1.00 . A A . 73 THR CA   1 1 
        4  5011 1 1 73 THR CB   C   2.004   5.548  21.423 1.00 . A A . 73 THR CB   1 1 
        4  5012 1 1 73 THR CG2  C   0.516   5.876  21.574 1.00 . A A . 73 THR CG2  1 1 
        4  5013 1 1 73 THR H    H   1.047   6.630  18.965 1.00 . A A . 73 THR H    1 1 
        4  5014 1 1 73 THR HA   H   3.378   5.045  19.864 1.00 . A A . 73 THR HA   1 1 
        4  5015 1 1 73 THR HB   H   2.589   6.394  21.753 1.00 . A A . 73 THR HB   1 1 
        4  5016 1 1 73 THR HG1  H   1.747   3.694  21.950 1.00 . A A . 73 THR HG1  1 1 
        4  5017 1 1 73 THR HG21 H   0.259   6.692  20.914 1.00 . A A . 73 THR HG21 1 1 
        4  5018 1 1 73 THR HG22 H   0.313   6.160  22.595 1.00 . A A . 73 THR HG22 1 1 
        4  5019 1 1 73 THR HG23 H  -0.072   5.007  21.318 1.00 . A A . 73 THR HG23 1 1 
        4  5020 1 1 73 THR N    N   1.990   6.414  19.128 1.00 . A A . 73 THR N    1 1 
        4  5021 1 1 73 THR O    O   0.339   4.162  19.152 1.00 . A A . 73 THR O    1 1 
        4  5022 1 1 73 THR OG1  O   2.324   4.413  22.215 1.00 . A A . 73 THR OG1  1 1 
        4  5023 1 1 74 PRO C    C   0.339   1.161  20.035 1.00 . A A . 74 PRO C    1 1 
        4  5024 1 1 74 PRO CA   C   1.389   1.615  19.020 1.00 . A A . 74 PRO CA   1 1 
        4  5025 1 1 74 PRO CB   C   2.518   0.585  18.878 1.00 . A A . 74 PRO CB   1 1 
        4  5026 1 1 74 PRO CD   C   3.498   2.555  19.857 1.00 . A A . 74 PRO CD   1 1 
        4  5027 1 1 74 PRO CG   C   3.554   1.028  19.856 1.00 . A A . 74 PRO CG   1 1 
        4  5028 1 1 74 PRO HA   H   0.927   1.780  18.060 1.00 . A A . 74 PRO HA   1 1 
        4  5029 1 1 74 PRO HB2  H   2.162  -0.409  19.120 1.00 . A A . 74 PRO HB2  1 1 
        4  5030 1 1 74 PRO HB3  H   2.923   0.606  17.876 1.00 . A A . 74 PRO HB3  1 1 
        4  5031 1 1 74 PRO HD2  H   3.711   2.943  20.844 1.00 . A A . 74 PRO HD2  1 1 
        4  5032 1 1 74 PRO HD3  H   4.182   2.965  19.129 1.00 . A A . 74 PRO HD3  1 1 
        4  5033 1 1 74 PRO HG2  H   3.324   0.640  20.842 1.00 . A A . 74 PRO HG2  1 1 
        4  5034 1 1 74 PRO HG3  H   4.533   0.697  19.545 1.00 . A A . 74 PRO HG3  1 1 
        4  5035 1 1 74 PRO N    N   2.104   2.852  19.466 1.00 . A A . 74 PRO N    1 1 
        4  5036 1 1 74 PRO O    O   0.467   1.418  21.232 1.00 . A A . 74 PRO O    1 1 
        4  5037 1 1 75 LYS C    C  -1.440  -1.401  20.927 1.00 . A A . 75 LYS C    1 1 
        4  5038 1 1 75 LYS CA   C  -1.768  -0.005  20.407 1.00 . A A . 75 LYS CA   1 1 
        4  5039 1 1 75 LYS CB   C  -3.083  -0.051  19.625 1.00 . A A . 75 LYS CB   1 1 
        4  5040 1 1 75 LYS CD   C  -4.895   1.383  18.619 1.00 . A A . 75 LYS CD   1 1 
        4  5041 1 1 75 LYS CE   C  -4.897   0.728  17.233 1.00 . A A . 75 LYS CE   1 1 
        4  5042 1 1 75 LYS CG   C  -3.480   1.371  19.214 1.00 . A A . 75 LYS CG   1 1 
        4  5043 1 1 75 LYS H    H  -0.740   0.313  18.579 1.00 . A A . 75 LYS H    1 1 
        4  5044 1 1 75 LYS HA   H  -1.886   0.664  21.247 1.00 . A A . 75 LYS HA   1 1 
        4  5045 1 1 75 LYS HB2  H  -2.947  -0.660  18.746 1.00 . A A . 75 LYS HB2  1 1 
        4  5046 1 1 75 LYS HB3  H  -3.858  -0.477  20.244 1.00 . A A . 75 LYS HB3  1 1 
        4  5047 1 1 75 LYS HD2  H  -5.561   0.838  19.272 1.00 . A A . 75 LYS HD2  1 1 
        4  5048 1 1 75 LYS HD3  H  -5.237   2.403  18.530 1.00 . A A . 75 LYS HD3  1 1 
        4  5049 1 1 75 LYS HE2  H  -4.138   1.183  16.615 1.00 . A A . 75 LYS HE2  1 1 
        4  5050 1 1 75 LYS HE3  H  -4.699  -0.328  17.328 1.00 . A A . 75 LYS HE3  1 1 
        4  5051 1 1 75 LYS HG2  H  -3.453   2.014  20.083 1.00 . A A . 75 LYS HG2  1 1 
        4  5052 1 1 75 LYS HG3  H  -2.781   1.739  18.478 1.00 . A A . 75 LYS HG3  1 1 
        4  5053 1 1 75 LYS HZ1  H  -6.447   0.104  15.990 1.00 . A A . 75 LYS HZ1  1 1 
        4  5054 1 1 75 LYS HZ2  H  -6.226   1.789  16.031 1.00 . A A . 75 LYS HZ2  1 1 
        4  5055 1 1 75 LYS HZ3  H  -6.960   0.993  17.341 1.00 . A A . 75 LYS HZ3  1 1 
        4  5056 1 1 75 LYS N    N  -0.695   0.485  19.543 1.00 . A A . 75 LYS N    1 1 
        4  5057 1 1 75 LYS NZ   N  -6.234   0.917  16.601 1.00 . A A . 75 LYS NZ   1 1 
        4  5058 1 1 75 LYS O    O  -2.187  -1.968  21.723 1.00 . A A . 75 LYS O    1 1 
        4  5059 1 1 76 PHE C    C  -1.007  -4.296  20.604 1.00 . A A . 76 PHE C    1 1 
        4  5060 1 1 76 PHE CA   C   0.097  -3.283  20.888 1.00 . A A . 76 PHE CA   1 1 
        4  5061 1 1 76 PHE CB   C   0.414  -3.285  22.385 1.00 . A A . 76 PHE CB   1 1 
        4  5062 1 1 76 PHE CD1  C   2.840  -2.612  22.530 1.00 . A A . 76 PHE CD1  1 1 
        4  5063 1 1 76 PHE CD2  C   1.138  -0.985  23.112 1.00 . A A . 76 PHE CD2  1 1 
        4  5064 1 1 76 PHE CE1  C   3.837  -1.669  22.809 1.00 . A A . 76 PHE CE1  1 1 
        4  5065 1 1 76 PHE CE2  C   2.135  -0.043  23.391 1.00 . A A . 76 PHE CE2  1 1 
        4  5066 1 1 76 PHE CG   C   1.491  -2.270  22.681 1.00 . A A . 76 PHE CG   1 1 
        4  5067 1 1 76 PHE CZ   C   3.484  -0.385  23.240 1.00 . A A . 76 PHE CZ   1 1 
        4  5068 1 1 76 PHE H    H   0.234  -1.451  19.831 1.00 . A A . 76 PHE H    1 1 
        4  5069 1 1 76 PHE HA   H   0.985  -3.564  20.342 1.00 . A A . 76 PHE HA   1 1 
        4  5070 1 1 76 PHE HB2  H  -0.478  -3.036  22.941 1.00 . A A . 76 PHE HB2  1 1 
        4  5071 1 1 76 PHE HB3  H   0.756  -4.267  22.677 1.00 . A A . 76 PHE HB3  1 1 
        4  5072 1 1 76 PHE HD1  H   3.112  -3.603  22.198 1.00 . A A . 76 PHE HD1  1 1 
        4  5073 1 1 76 PHE HD2  H   0.097  -0.722  23.228 1.00 . A A . 76 PHE HD2  1 1 
        4  5074 1 1 76 PHE HE1  H   4.877  -1.932  22.693 1.00 . A A . 76 PHE HE1  1 1 
        4  5075 1 1 76 PHE HE2  H   1.862   0.949  23.723 1.00 . A A . 76 PHE HE2  1 1 
        4  5076 1 1 76 PHE HZ   H   4.252   0.343  23.455 1.00 . A A . 76 PHE HZ   1 1 
        4  5077 1 1 76 PHE N    N  -0.319  -1.950  20.466 1.00 . A A . 76 PHE N    1 1 
        4  5078 1 1 76 PHE O    O  -2.051  -3.949  20.053 1.00 . A A . 76 PHE O    1 1 
        4  5079 1 1 77 ASN C    C  -2.152  -6.676  19.301 1.00 . A A . 77 ASN C    1 1 
        4  5080 1 1 77 ASN CA   C  -1.760  -6.599  20.773 1.00 . A A . 77 ASN CA   1 1 
        4  5081 1 1 77 ASN CB   C  -3.004  -6.327  21.624 1.00 . A A . 77 ASN CB   1 1 
        4  5082 1 1 77 ASN CG   C  -2.617  -6.257  23.097 1.00 . A A . 77 ASN CG   1 1 
        4  5083 1 1 77 ASN H    H   0.076  -5.765  21.427 1.00 . A A . 77 ASN H    1 1 
        4  5084 1 1 77 ASN HA   H  -1.335  -7.545  21.073 1.00 . A A . 77 ASN HA   1 1 
        4  5085 1 1 77 ASN HB2  H  -3.445  -5.389  21.322 1.00 . A A . 77 ASN HB2  1 1 
        4  5086 1 1 77 ASN HB3  H  -3.717  -7.124  21.478 1.00 . A A . 77 ASN HB3  1 1 
        4  5087 1 1 77 ASN HD21 H  -3.716  -4.643  23.459 1.00 . A A . 77 ASN HD21 1 1 
        4  5088 1 1 77 ASN HD22 H  -2.862  -5.255  24.793 1.00 . A A . 77 ASN HD22 1 1 
        4  5089 1 1 77 ASN N    N  -0.772  -5.548  20.988 1.00 . A A . 77 ASN N    1 1 
        4  5090 1 1 77 ASN ND2  N  -3.105  -5.306  23.846 1.00 . A A . 77 ASN ND2  1 1 
        4  5091 1 1 77 ASN O    O  -2.822  -5.785  18.780 1.00 . A A . 77 ASN O    1 1 
        4  5092 1 1 77 ASN OD1  O  -1.844  -7.086  23.577 1.00 . A A . 77 ASN OD1  1 1 
        4  5093 1 1 78 GLY C    C  -3.546  -7.975  16.999 1.00 . A A . 78 GLY C    1 1 
        4  5094 1 1 78 GLY CA   C  -2.039  -7.921  17.220 1.00 . A A . 78 GLY CA   1 1 
        4  5095 1 1 78 GLY H    H  -1.195  -8.423  19.099 1.00 . A A . 78 GLY H    1 1 
        4  5096 1 1 78 GLY HA2  H  -1.625  -7.095  16.661 1.00 . A A . 78 GLY HA2  1 1 
        4  5097 1 1 78 GLY HA3  H  -1.599  -8.843  16.873 1.00 . A A . 78 GLY HA3  1 1 
        4  5098 1 1 78 GLY N    N  -1.728  -7.745  18.634 1.00 . A A . 78 GLY N    1 1 
        4  5099 1 1 78 GLY O    O  -4.062  -7.410  16.035 1.00 . A A . 78 GLY O    1 1 
        4  5100 1 1 79 VAL C    C  -6.342  -8.727  19.187 1.00 . A A . 79 VAL C    1 1 
        4  5101 1 1 79 VAL CA   C  -5.708  -8.777  17.801 1.00 . A A . 79 VAL CA   1 1 
        4  5102 1 1 79 VAL CB   C  -6.078 -10.093  17.117 1.00 . A A . 79 VAL CB   1 1 
        4  5103 1 1 79 VAL CG1  C  -5.569 -11.266  17.956 1.00 . A A . 79 VAL CG1  1 1 
        4  5104 1 1 79 VAL CG2  C  -7.599 -10.187  16.982 1.00 . A A . 79 VAL CG2  1 1 
        4  5105 1 1 79 VAL H    H  -3.787  -9.084  18.650 1.00 . A A . 79 VAL H    1 1 
        4  5106 1 1 79 VAL HA   H  -6.097  -7.957  17.212 1.00 . A A . 79 VAL HA   1 1 
        4  5107 1 1 79 VAL HB   H  -5.624 -10.129  16.137 1.00 . A A . 79 VAL HB   1 1 
        4  5108 1 1 79 VAL HG11 H  -4.539 -11.092  18.233 1.00 . A A . 79 VAL HG11 1 1 
        4  5109 1 1 79 VAL HG12 H  -5.637 -12.178  17.379 1.00 . A A . 79 VAL HG12 1 1 
        4  5110 1 1 79 VAL HG13 H  -6.171 -11.360  18.847 1.00 . A A . 79 VAL HG13 1 1 
        4  5111 1 1 79 VAL HG21 H  -7.984  -9.251  16.604 1.00 . A A . 79 VAL HG21 1 1 
        4  5112 1 1 79 VAL HG22 H  -8.035 -10.391  17.949 1.00 . A A . 79 VAL HG22 1 1 
        4  5113 1 1 79 VAL HG23 H  -7.852 -10.982  16.297 1.00 . A A . 79 VAL HG23 1 1 
        4  5114 1 1 79 VAL N    N  -4.253  -8.656  17.901 1.00 . A A . 79 VAL N    1 1 
        4  5115 1 1 79 VAL O    O  -5.853  -9.353  20.127 1.00 . A A . 79 VAL O    1 1 
        4  5116 1 1 80 LYS C    C  -8.667  -9.210  21.034 1.00 . A A . 80 LYS C    1 1 
        4  5117 1 1 80 LYS CA   C  -8.130  -7.856  20.582 1.00 . A A . 80 LYS CA   1 1 
        4  5118 1 1 80 LYS CB   C  -9.285  -6.861  20.453 1.00 . A A . 80 LYS CB   1 1 
        4  5119 1 1 80 LYS CD   C  -9.876  -4.451  20.150 1.00 . A A . 80 LYS CD   1 1 
        4  5120 1 1 80 LYS CE   C  -9.312  -3.039  19.984 1.00 . A A . 80 LYS CE   1 1 
        4  5121 1 1 80 LYS CG   C  -8.723  -5.448  20.280 1.00 . A A . 80 LYS CG   1 1 
        4  5122 1 1 80 LYS H    H  -7.780  -7.504  18.521 1.00 . A A . 80 LYS H    1 1 
        4  5123 1 1 80 LYS HA   H  -7.436  -7.489  21.323 1.00 . A A . 80 LYS HA   1 1 
        4  5124 1 1 80 LYS HB2  H  -9.888  -7.118  19.594 1.00 . A A . 80 LYS HB2  1 1 
        4  5125 1 1 80 LYS HB3  H  -9.893  -6.897  21.345 1.00 . A A . 80 LYS HB3  1 1 
        4  5126 1 1 80 LYS HD2  H -10.476  -4.704  19.288 1.00 . A A . 80 LYS HD2  1 1 
        4  5127 1 1 80 LYS HD3  H -10.487  -4.489  21.039 1.00 . A A . 80 LYS HD3  1 1 
        4  5128 1 1 80 LYS HE2  H  -8.716  -2.784  20.848 1.00 . A A . 80 LYS HE2  1 1 
        4  5129 1 1 80 LYS HE3  H  -8.696  -3.000  19.098 1.00 . A A . 80 LYS HE3  1 1 
        4  5130 1 1 80 LYS HG2  H  -8.120  -5.193  21.139 1.00 . A A . 80 LYS HG2  1 1 
        4  5131 1 1 80 LYS HG3  H  -8.115  -5.410  19.389 1.00 . A A . 80 LYS HG3  1 1 
        4  5132 1 1 80 LYS HZ1  H -10.160  -1.308  19.197 1.00 . A A . 80 LYS HZ1  1 1 
        4  5133 1 1 80 LYS HZ2  H -10.654  -1.662  20.783 1.00 . A A . 80 LYS HZ2  1 1 
        4  5134 1 1 80 LYS HZ3  H -11.273  -2.555  19.477 1.00 . A A . 80 LYS HZ3  1 1 
        4  5135 1 1 80 LYS N    N  -7.435  -7.980  19.306 1.00 . A A . 80 LYS N    1 1 
        4  5136 1 1 80 LYS NZ   N -10.434  -2.068  19.850 1.00 . A A . 80 LYS NZ   1 1 
        4  5137 1 1 80 LYS O    O  -8.621  -9.542  22.219 1.00 . A A . 80 LYS O    1 1 
        4  5138 1 1 81 LYS C    C -10.003 -12.079  19.115 1.00 . A A . 81 LYS C    1 1 
        4  5139 1 1 81 LYS CA   C  -9.726 -11.301  20.398 1.00 . A A . 81 LYS CA   1 1 
        4  5140 1 1 81 LYS CB   C -11.020 -11.146  21.203 1.00 . A A . 81 LYS CB   1 1 
        4  5141 1 1 81 LYS CD   C -12.837 -12.357  22.420 1.00 . A A . 81 LYS CD   1 1 
        4  5142 1 1 81 LYS CE   C -13.424 -13.732  22.742 1.00 . A A . 81 LYS CE   1 1 
        4  5143 1 1 81 LYS CG   C -11.573 -12.526  21.575 1.00 . A A . 81 LYS CG   1 1 
        4  5144 1 1 81 LYS H    H  -9.192  -9.667  19.157 1.00 . A A . 81 LYS H    1 1 
        4  5145 1 1 81 LYS HA   H  -9.009 -11.846  20.992 1.00 . A A . 81 LYS HA   1 1 
        4  5146 1 1 81 LYS HB2  H -10.818 -10.586  22.103 1.00 . A A . 81 LYS HB2  1 1 
        4  5147 1 1 81 LYS HB3  H -11.751 -10.618  20.608 1.00 . A A . 81 LYS HB3  1 1 
        4  5148 1 1 81 LYS HD2  H -12.588 -11.846  23.339 1.00 . A A . 81 LYS HD2  1 1 
        4  5149 1 1 81 LYS HD3  H -13.562 -11.777  21.871 1.00 . A A . 81 LYS HD3  1 1 
        4  5150 1 1 81 LYS HE2  H -14.340 -13.609  23.301 1.00 . A A . 81 LYS HE2  1 1 
        4  5151 1 1 81 LYS HE3  H -13.632 -14.258  21.822 1.00 . A A . 81 LYS HE3  1 1 
        4  5152 1 1 81 LYS HG2  H -11.814 -13.076  20.676 1.00 . A A . 81 LYS HG2  1 1 
        4  5153 1 1 81 LYS HG3  H -10.833 -13.070  22.143 1.00 . A A . 81 LYS HG3  1 1 
        4  5154 1 1 81 LYS HZ1  H -12.843 -15.451  23.762 1.00 . A A . 81 LYS HZ1  1 1 
        4  5155 1 1 81 LYS HZ2  H -12.256 -14.009  24.443 1.00 . A A . 81 LYS HZ2  1 1 
        4  5156 1 1 81 LYS HZ3  H -11.563 -14.623  23.018 1.00 . A A . 81 LYS HZ3  1 1 
        4  5157 1 1 81 LYS N    N  -9.180  -9.985  20.085 1.00 . A A . 81 LYS N    1 1 
        4  5158 1 1 81 LYS NZ   N -12.448 -14.512  23.552 1.00 . A A . 81 LYS NZ   1 1 
        4  5159 1 1 81 LYS O    O -10.344 -11.451  18.126 1.00 . A A . 81 LYS O    1 1 
        4  5160 1 1 81 LYS OXT  O  -9.869 -13.292  19.141 1.00 . A A . 81 LYS OXT  1 1 
        5  5161 1 1  1 MET C    C   1.849   9.747  -4.483 1.00 . A A .  1 MET C    1 1 
        5  5162 1 1  1 MET CA   C   2.550  11.024  -4.944 1.00 . A A .  1 MET CA   1 1 
        5  5163 1 1  1 MET CB   C   1.961  11.510  -6.281 1.00 . A A .  1 MET CB   1 1 
        5  5164 1 1  1 MET CE   C   5.026  12.273  -8.910 1.00 . A A .  1 MET CE   1 1 
        5  5165 1 1  1 MET CG   C   3.029  12.270  -7.072 1.00 . A A .  1 MET CG   1 1 
        5  5166 1 1  1 MET H1   H   4.406  10.433  -4.206 1.00 . A A .  1 MET H1   1 1 
        5  5167 1 1  1 MET H2   H   4.488  11.631  -5.407 1.00 . A A .  1 MET H2   1 1 
        5  5168 1 1  1 MET H3   H   4.147  10.022  -5.831 1.00 . A A .  1 MET H3   1 1 
        5  5169 1 1  1 MET HA   H   2.416  11.791  -4.195 1.00 . A A .  1 MET HA   1 1 
        5  5170 1 1  1 MET HB2  H   1.627  10.662  -6.864 1.00 . A A .  1 MET HB2  1 1 
        5  5171 1 1  1 MET HB3  H   1.124  12.165  -6.091 1.00 . A A .  1 MET HB3  1 1 
        5  5172 1 1  1 MET HE1  H   4.397  12.516  -9.756 1.00 . A A .  1 MET HE1  1 1 
        5  5173 1 1  1 MET HE2  H   5.947  11.837  -9.264 1.00 . A A .  1 MET HE2  1 1 
        5  5174 1 1  1 MET HE3  H   5.247  13.169  -8.349 1.00 . A A .  1 MET HE3  1 1 
        5  5175 1 1  1 MET HG2  H   2.553  12.864  -7.839 1.00 . A A .  1 MET HG2  1 1 
        5  5176 1 1  1 MET HG3  H   3.579  12.919  -6.406 1.00 . A A .  1 MET HG3  1 1 
        5  5177 1 1  1 MET N    N   4.008  10.757  -5.109 1.00 . A A .  1 MET N    1 1 
        5  5178 1 1  1 MET O    O   2.433   8.663  -4.501 1.00 . A A .  1 MET O    1 1 
        5  5179 1 1  1 MET SD   S   4.167  11.091  -7.843 1.00 . A A .  1 MET SD   1 1 
        5  5180 1 1  2 LYS C    C  -1.684   8.993  -3.825 1.00 . A A .  2 LYS C    1 1 
        5  5181 1 1  2 LYS CA   C  -0.191   8.741  -3.611 1.00 . A A .  2 LYS CA   1 1 
        5  5182 1 1  2 LYS CB   C   0.100   8.496  -2.126 1.00 . A A .  2 LYS CB   1 1 
        5  5183 1 1  2 LYS CD   C   0.033   9.499   0.163 1.00 . A A .  2 LYS CD   1 1 
        5  5184 1 1  2 LYS CE   C  -0.333  10.746   0.968 1.00 . A A .  2 LYS CE   1 1 
        5  5185 1 1  2 LYS CG   C  -0.284   9.737  -1.316 1.00 . A A .  2 LYS CG   1 1 
        5  5186 1 1  2 LYS H    H   0.178  10.775  -4.083 1.00 . A A .  2 LYS H    1 1 
        5  5187 1 1  2 LYS HA   H   0.098   7.864  -4.173 1.00 . A A .  2 LYS HA   1 1 
        5  5188 1 1  2 LYS HB2  H  -0.471   7.649  -1.782 1.00 . A A .  2 LYS HB2  1 1 
        5  5189 1 1  2 LYS HB3  H   1.153   8.297  -1.995 1.00 . A A .  2 LYS HB3  1 1 
        5  5190 1 1  2 LYS HD2  H  -0.540   8.656   0.522 1.00 . A A .  2 LYS HD2  1 1 
        5  5191 1 1  2 LYS HD3  H   1.086   9.295   0.277 1.00 . A A .  2 LYS HD3  1 1 
        5  5192 1 1  2 LYS HE2  H   0.246  11.586   0.613 1.00 . A A .  2 LYS HE2  1 1 
        5  5193 1 1  2 LYS HE3  H  -1.384  10.957   0.846 1.00 . A A .  2 LYS HE3  1 1 
        5  5194 1 1  2 LYS HG2  H   0.279  10.587  -1.673 1.00 . A A .  2 LYS HG2  1 1 
        5  5195 1 1  2 LYS HG3  H  -1.340   9.930  -1.427 1.00 . A A .  2 LYS HG3  1 1 
        5  5196 1 1  2 LYS HZ1  H   0.871  10.014   2.501 1.00 . A A .  2 LYS HZ1  1 1 
        5  5197 1 1  2 LYS HZ2  H  -0.794   9.936   2.828 1.00 . A A .  2 LYS HZ2  1 1 
        5  5198 1 1  2 LYS HZ3  H   0.021  11.425   2.904 1.00 . A A .  2 LYS HZ3  1 1 
        5  5199 1 1  2 LYS N    N   0.590   9.885  -4.073 1.00 . A A .  2 LYS N    1 1 
        5  5200 1 1  2 LYS NZ   N  -0.036  10.513   2.409 1.00 . A A .  2 LYS NZ   1 1 
        5  5201 1 1  2 LYS O    O  -2.159  10.117  -3.669 1.00 . A A .  2 LYS O    1 1 
        5  5202 1 1  3 ASP C    C  -4.658   8.291  -3.139 1.00 . A A .  3 ASP C    1 1 
        5  5203 1 1  3 ASP CA   C  -3.853   8.070  -4.435 1.00 . A A .  3 ASP CA   1 1 
        5  5204 1 1  3 ASP CB   C  -4.372   6.852  -5.218 1.00 . A A .  3 ASP CB   1 1 
        5  5205 1 1  3 ASP CG   C  -3.879   6.914  -6.664 1.00 . A A .  3 ASP CG   1 1 
        5  5206 1 1  3 ASP H    H  -1.984   7.073  -4.311 1.00 . A A .  3 ASP H    1 1 
        5  5207 1 1  3 ASP HA   H  -4.000   8.945  -5.048 1.00 . A A .  3 ASP HA   1 1 
        5  5208 1 1  3 ASP HB2  H  -4.008   5.947  -4.765 1.00 . A A .  3 ASP HB2  1 1 
        5  5209 1 1  3 ASP HB3  H  -5.451   6.851  -5.208 1.00 . A A .  3 ASP HB3  1 1 
        5  5210 1 1  3 ASP N    N  -2.416   7.944  -4.193 1.00 . A A .  3 ASP N    1 1 
        5  5211 1 1  3 ASP O    O  -5.487   9.199  -3.092 1.00 . A A .  3 ASP O    1 1 
        5  5212 1 1  3 ASP OD1  O  -3.544   8.000  -7.106 1.00 . A A .  3 ASP OD1  1 1 
        5  5213 1 1  3 ASP OD2  O  -3.827   5.873  -7.299 1.00 . A A .  3 ASP OD2  1 1 
        5  5214 1 1  4 PRO C    C  -4.750   8.941  -0.044 1.00 . A A .  4 PRO C    1 1 
        5  5215 1 1  4 PRO CA   C  -5.216   7.700  -0.811 1.00 . A A .  4 PRO CA   1 1 
        5  5216 1 1  4 PRO CB   C  -4.908   6.417  -0.025 1.00 . A A .  4 PRO CB   1 1 
        5  5217 1 1  4 PRO CD   C  -3.508   6.377  -1.982 1.00 . A A .  4 PRO CD   1 1 
        5  5218 1 1  4 PRO CG   C  -3.554   6.012  -0.497 1.00 . A A .  4 PRO CG   1 1 
        5  5219 1 1  4 PRO HA   H  -6.273   7.760  -1.012 1.00 . A A .  4 PRO HA   1 1 
        5  5220 1 1  4 PRO HB2  H  -4.898   6.610   1.041 1.00 . A A .  4 PRO HB2  1 1 
        5  5221 1 1  4 PRO HB3  H  -5.628   5.648  -0.263 1.00 . A A .  4 PRO HB3  1 1 
        5  5222 1 1  4 PRO HD2  H  -2.511   6.667  -2.263 1.00 . A A .  4 PRO HD2  1 1 
        5  5223 1 1  4 PRO HD3  H  -3.848   5.547  -2.576 1.00 . A A .  4 PRO HD3  1 1 
        5  5224 1 1  4 PRO HG2  H  -2.792   6.555   0.049 1.00 . A A .  4 PRO HG2  1 1 
        5  5225 1 1  4 PRO HG3  H  -3.414   4.948  -0.376 1.00 . A A .  4 PRO HG3  1 1 
        5  5226 1 1  4 PRO N    N  -4.454   7.512  -2.089 1.00 . A A .  4 PRO N    1 1 
        5  5227 1 1  4 PRO O    O  -4.121   8.829   1.007 1.00 . A A .  4 PRO O    1 1 
        5  5228 1 1  5 LYS C    C  -5.591  11.725   1.256 1.00 . A A .  5 LYS C    1 1 
        5  5229 1 1  5 LYS CA   C  -4.678  11.371   0.075 1.00 . A A .  5 LYS CA   1 1 
        5  5230 1 1  5 LYS CB   C  -4.750  12.508  -0.961 1.00 . A A .  5 LYS CB   1 1 
        5  5231 1 1  5 LYS CD   C  -2.335  13.200  -1.317 1.00 . A A .  5 LYS CD   1 1 
        5  5232 1 1  5 LYS CE   C  -2.425  14.692  -1.663 1.00 . A A .  5 LYS CE   1 1 
        5  5233 1 1  5 LYS CG   C  -3.538  12.440  -1.913 1.00 . A A .  5 LYS CG   1 1 
        5  5234 1 1  5 LYS H    H  -5.587  10.164  -1.399 1.00 . A A .  5 LYS H    1 1 
        5  5235 1 1  5 LYS HA   H  -3.655  11.287   0.406 1.00 . A A .  5 LYS HA   1 1 
        5  5236 1 1  5 LYS HB2  H  -5.661  12.404  -1.534 1.00 . A A .  5 LYS HB2  1 1 
        5  5237 1 1  5 LYS HB3  H  -4.757  13.461  -0.453 1.00 . A A .  5 LYS HB3  1 1 
        5  5238 1 1  5 LYS HD2  H  -2.327  13.083  -0.243 1.00 . A A .  5 LYS HD2  1 1 
        5  5239 1 1  5 LYS HD3  H  -1.419  12.797  -1.725 1.00 . A A .  5 LYS HD3  1 1 
        5  5240 1 1  5 LYS HE2  H  -3.359  15.095  -1.302 1.00 . A A .  5 LYS HE2  1 1 
        5  5241 1 1  5 LYS HE3  H  -1.604  15.218  -1.199 1.00 . A A .  5 LYS HE3  1 1 
        5  5242 1 1  5 LYS HG2  H  -3.263  11.406  -2.068 1.00 . A A .  5 LYS HG2  1 1 
        5  5243 1 1  5 LYS HG3  H  -3.805  12.879  -2.864 1.00 . A A .  5 LYS HG3  1 1 
        5  5244 1 1  5 LYS HZ1  H  -3.310  14.952  -3.530 1.00 . A A .  5 LYS HZ1  1 1 
        5  5245 1 1  5 LYS HZ2  H  -1.880  14.034  -3.562 1.00 . A A .  5 LYS HZ2  1 1 
        5  5246 1 1  5 LYS HZ3  H  -1.806  15.720  -3.365 1.00 . A A .  5 LYS HZ3  1 1 
        5  5247 1 1  5 LYS N    N  -5.064  10.120  -0.572 1.00 . A A .  5 LYS N    1 1 
        5  5248 1 1  5 LYS NZ   N  -2.349  14.863  -3.142 1.00 . A A .  5 LYS NZ   1 1 
        5  5249 1 1  5 LYS O    O  -5.136  11.963   2.373 1.00 . A A .  5 LYS O    1 1 
        5  5250 1 1  6 THR C    C  -8.210  10.698   2.798 1.00 . A A .  6 THR C    1 1 
        5  5251 1 1  6 THR CA   C  -7.942  11.952   1.958 1.00 . A A .  6 THR CA   1 1 
        5  5252 1 1  6 THR CB   C  -9.230  12.378   1.250 1.00 . A A .  6 THR CB   1 1 
        5  5253 1 1  6 THR CG2  C  -8.973  13.651   0.442 1.00 . A A .  6 THR CG2  1 1 
        5  5254 1 1  6 THR H    H  -7.154  11.364   0.085 1.00 . A A .  6 THR H    1 1 
        5  5255 1 1  6 THR HA   H  -7.626  12.742   2.611 1.00 . A A .  6 THR HA   1 1 
        5  5256 1 1  6 THR HB   H  -9.996  12.572   1.985 1.00 . A A .  6 THR HB   1 1 
        5  5257 1 1  6 THR HG1  H -10.618  11.345   0.361 1.00 . A A .  6 THR HG1  1 1 
        5  5258 1 1  6 THR HG21 H  -8.198  13.464  -0.287 1.00 . A A .  6 THR HG21 1 1 
        5  5259 1 1  6 THR HG22 H  -8.659  14.443   1.106 1.00 . A A .  6 THR HG22 1 1 
        5  5260 1 1  6 THR HG23 H  -9.880  13.945  -0.065 1.00 . A A .  6 THR HG23 1 1 
        5  5261 1 1  6 THR N    N  -6.891  11.698   0.968 1.00 . A A .  6 THR N    1 1 
        5  5262 1 1  6 THR O    O  -8.571  10.757   3.972 1.00 . A A .  6 THR O    1 1 
        5  5263 1 1  6 THR OG1  O  -9.658  11.339   0.381 1.00 . A A .  6 THR OG1  1 1 
        5  5264 1 1  7 LEU C    C  -7.136   8.138   3.949 1.00 . A A .  7 LEU C    1 1 
        5  5265 1 1  7 LEU CA   C  -8.134   8.268   2.786 1.00 . A A .  7 LEU CA   1 1 
        5  5266 1 1  7 LEU CB   C  -7.907   7.148   1.765 1.00 . A A .  7 LEU CB   1 1 
        5  5267 1 1  7 LEU CD1  C -10.315   6.348   1.686 1.00 . A A .  7 LEU CD1  1 1 
        5  5268 1 1  7 LEU CD2  C  -9.578   8.325   0.310 1.00 . A A .  7 LEU CD2  1 1 
        5  5269 1 1  7 LEU CG   C  -9.153   6.965   0.880 1.00 . A A .  7 LEU CG   1 1 
        5  5270 1 1  7 LEU H    H  -7.568   9.711   1.265 1.00 . A A .  7 LEU H    1 1 
        5  5271 1 1  7 LEU HA   H  -9.133   8.191   3.184 1.00 . A A .  7 LEU HA   1 1 
        5  5272 1 1  7 LEU HB2  H  -7.068   7.408   1.141 1.00 . A A .  7 LEU HB2  1 1 
        5  5273 1 1  7 LEU HB3  H  -7.692   6.223   2.281 1.00 . A A .  7 LEU HB3  1 1 
        5  5274 1 1  7 LEU HD11 H  -9.928   5.687   2.447 1.00 . A A .  7 LEU HD11 1 1 
        5  5275 1 1  7 LEU HD12 H -10.949   5.784   1.018 1.00 . A A .  7 LEU HD12 1 1 
        5  5276 1 1  7 LEU HD13 H -10.900   7.130   2.152 1.00 . A A .  7 LEU HD13 1 1 
        5  5277 1 1  7 LEU HD21 H -10.050   8.909   1.087 1.00 . A A .  7 LEU HD21 1 1 
        5  5278 1 1  7 LEU HD22 H -10.277   8.172  -0.500 1.00 . A A .  7 LEU HD22 1 1 
        5  5279 1 1  7 LEU HD23 H  -8.708   8.849  -0.057 1.00 . A A .  7 LEU HD23 1 1 
        5  5280 1 1  7 LEU HG   H  -8.906   6.302   0.063 1.00 . A A .  7 LEU HG   1 1 
        5  5281 1 1  7 LEU N    N  -7.977   9.575   2.145 1.00 . A A .  7 LEU N    1 1 
        5  5282 1 1  7 LEU O    O  -7.495   7.738   5.056 1.00 . A A .  7 LEU O    1 1 
        5  5283 1 1  8 LEU C    C  -4.869   9.725   5.607 1.00 . A A .  8 LEU C    1 1 
        5  5284 1 1  8 LEU CA   C  -4.785   8.537   4.638 1.00 . A A .  8 LEU CA   1 1 
        5  5285 1 1  8 LEU CB   C  -3.450   8.596   3.873 1.00 . A A .  8 LEU CB   1 1 
        5  5286 1 1  8 LEU CD1  C  -1.199   7.439   4.021 1.00 . A A .  8 LEU CD1  1 1 
        5  5287 1 1  8 LEU CD2  C  -1.596   9.525   5.350 1.00 . A A .  8 LEU CD2  1 1 
        5  5288 1 1  8 LEU CG   C  -2.251   8.241   4.802 1.00 . A A .  8 LEU CG   1 1 
        5  5289 1 1  8 LEU H    H  -5.681   8.886   2.792 1.00 . A A .  8 LEU H    1 1 
        5  5290 1 1  8 LEU HA   H  -4.821   7.606   5.182 1.00 . A A .  8 LEU HA   1 1 
        5  5291 1 1  8 LEU HB2  H  -3.494   7.891   3.054 1.00 . A A .  8 LEU HB2  1 1 
        5  5292 1 1  8 LEU HB3  H  -3.316   9.591   3.471 1.00 . A A .  8 LEU HB3  1 1 
        5  5293 1 1  8 LEU HD11 H  -1.597   6.465   3.776 1.00 . A A .  8 LEU HD11 1 1 
        5  5294 1 1  8 LEU HD12 H  -0.312   7.324   4.626 1.00 . A A .  8 LEU HD12 1 1 
        5  5295 1 1  8 LEU HD13 H  -0.949   7.966   3.112 1.00 . A A .  8 LEU HD13 1 1 
        5  5296 1 1  8 LEU HD21 H  -1.071   9.297   6.266 1.00 . A A .  8 LEU HD21 1 1 
        5  5297 1 1  8 LEU HD22 H  -2.354  10.265   5.548 1.00 . A A .  8 LEU HD22 1 1 
        5  5298 1 1  8 LEU HD23 H  -0.896   9.917   4.626 1.00 . A A .  8 LEU HD23 1 1 
        5  5299 1 1  8 LEU HG   H  -2.595   7.638   5.632 1.00 . A A .  8 LEU HG   1 1 
        5  5300 1 1  8 LEU N    N  -5.897   8.525   3.677 1.00 . A A .  8 LEU N    1 1 
        5  5301 1 1  8 LEU O    O  -4.324   9.705   6.710 1.00 . A A .  8 LEU O    1 1 
        5  5302 1 1  9 ARG C    C  -6.633  11.701   7.175 1.00 . A A .  9 ARG C    1 1 
        5  5303 1 1  9 ARG CA   C  -5.804  11.966   5.923 1.00 . A A .  9 ARG CA   1 1 
        5  5304 1 1  9 ARG CB   C  -6.511  13.022   5.081 1.00 . A A .  9 ARG CB   1 1 
        5  5305 1 1  9 ARG CD   C  -6.943  15.482   4.926 1.00 . A A .  9 ARG CD   1 1 
        5  5306 1 1  9 ARG CG   C  -6.634  14.325   5.881 1.00 . A A .  9 ARG CG   1 1 
        5  5307 1 1  9 ARG CZ   C  -5.753  16.733   3.204 1.00 . A A .  9 ARG CZ   1 1 
        5  5308 1 1  9 ARG H    H  -6.128  10.535   4.357 1.00 . A A .  9 ARG H    1 1 
        5  5309 1 1  9 ARG HA   H  -4.839  12.358   6.213 1.00 . A A .  9 ARG HA   1 1 
        5  5310 1 1  9 ARG HB2  H  -5.949  13.202   4.177 1.00 . A A .  9 ARG HB2  1 1 
        5  5311 1 1  9 ARG HB3  H  -7.498  12.669   4.836 1.00 . A A .  9 ARG HB3  1 1 
        5  5312 1 1  9 ARG HD2  H  -7.753  15.200   4.269 1.00 . A A .  9 ARG HD2  1 1 
        5  5313 1 1  9 ARG HD3  H  -7.228  16.355   5.495 1.00 . A A .  9 ARG HD3  1 1 
        5  5314 1 1  9 ARG HE   H  -4.931  15.280   4.302 1.00 . A A .  9 ARG HE   1 1 
        5  5315 1 1  9 ARG HG2  H  -7.432  14.230   6.602 1.00 . A A .  9 ARG HG2  1 1 
        5  5316 1 1  9 ARG HG3  H  -5.705  14.526   6.394 1.00 . A A .  9 ARG HG3  1 1 
        5  5317 1 1  9 ARG HH11 H  -7.689  17.185   3.445 1.00 . A A .  9 ARG HH11 1 1 
        5  5318 1 1  9 ARG HH12 H  -6.846  18.110   2.247 1.00 . A A .  9 ARG HH12 1 1 
        5  5319 1 1  9 ARG HH21 H  -3.818  16.498   2.751 1.00 . A A .  9 ARG HH21 1 1 
        5  5320 1 1  9 ARG HH22 H  -4.654  17.721   1.855 1.00 . A A .  9 ARG HH22 1 1 
        5  5321 1 1  9 ARG N    N  -5.587  10.740   5.148 1.00 . A A .  9 ARG N    1 1 
        5  5322 1 1  9 ARG NE   N  -5.756  15.781   4.133 1.00 . A A .  9 ARG NE   1 1 
        5  5323 1 1  9 ARG NH1  N  -6.848  17.394   2.945 1.00 . A A .  9 ARG NH1  1 1 
        5  5324 1 1  9 ARG NH2  N  -4.656  17.005   2.553 1.00 . A A .  9 ARG NH2  1 1 
        5  5325 1 1  9 ARG O    O  -6.451  12.353   8.199 1.00 . A A .  9 ARG O    1 1 
        5  5326 1 1 10 VAL C    C  -7.588   9.803   9.386 1.00 . A A . 10 VAL C    1 1 
        5  5327 1 1 10 VAL CA   C  -8.390  10.357   8.209 1.00 . A A . 10 VAL CA   1 1 
        5  5328 1 1 10 VAL CB   C  -9.431   9.329   7.748 1.00 . A A . 10 VAL CB   1 1 
        5  5329 1 1 10 VAL CG1  C -10.206   8.787   8.954 1.00 . A A . 10 VAL CG1  1 1 
        5  5330 1 1 10 VAL CG2  C -10.407  10.000   6.779 1.00 . A A . 10 VAL CG2  1 1 
        5  5331 1 1 10 VAL H    H  -7.602  10.194   6.270 1.00 . A A . 10 VAL H    1 1 
        5  5332 1 1 10 VAL HA   H  -8.906  11.216   8.609 1.00 . A A . 10 VAL HA   1 1 
        5  5333 1 1 10 VAL HB   H  -8.931   8.512   7.247 1.00 . A A . 10 VAL HB   1 1 
        5  5334 1 1 10 VAL HG11 H  -9.581   8.096   9.501 1.00 . A A . 10 VAL HG11 1 1 
        5  5335 1 1 10 VAL HG12 H -11.094   8.277   8.612 1.00 . A A . 10 VAL HG12 1 1 
        5  5336 1 1 10 VAL HG13 H -10.486   9.606   9.599 1.00 . A A . 10 VAL HG13 1 1 
        5  5337 1 1 10 VAL HG21 H -11.094   9.262   6.391 1.00 . A A . 10 VAL HG21 1 1 
        5  5338 1 1 10 VAL HG22 H  -9.856  10.442   5.962 1.00 . A A . 10 VAL HG22 1 1 
        5  5339 1 1 10 VAL HG23 H -10.960  10.770   7.298 1.00 . A A . 10 VAL HG23 1 1 
        5  5340 1 1 10 VAL N    N  -7.533  10.729   7.088 1.00 . A A . 10 VAL N    1 1 
        5  5341 1 1 10 VAL O    O  -7.914  10.109  10.532 1.00 . A A . 10 VAL O    1 1 
        5  5342 1 1 11 SER C    C  -5.156   9.649  11.069 1.00 . A A . 11 SER C    1 1 
        5  5343 1 1 11 SER CA   C  -5.777   8.501  10.274 1.00 . A A . 11 SER CA   1 1 
        5  5344 1 1 11 SER CB   C  -4.677   7.564   9.772 1.00 . A A . 11 SER CB   1 1 
        5  5345 1 1 11 SER H    H  -6.264   8.802   8.233 1.00 . A A . 11 SER H    1 1 
        5  5346 1 1 11 SER HA   H  -6.406   7.964  10.967 1.00 . A A . 11 SER HA   1 1 
        5  5347 1 1 11 SER HB2  H  -4.076   8.072   9.037 1.00 . A A . 11 SER HB2  1 1 
        5  5348 1 1 11 SER HB3  H  -4.051   7.268  10.604 1.00 . A A . 11 SER HB3  1 1 
        5  5349 1 1 11 SER HG   H  -6.220   6.463   9.329 1.00 . A A . 11 SER HG   1 1 
        5  5350 1 1 11 SER N    N  -6.548   9.014   9.147 1.00 . A A . 11 SER N    1 1 
        5  5351 1 1 11 SER O    O  -5.302   9.693  12.260 1.00 . A A . 11 SER O    1 1 
        5  5352 1 1 11 SER OG   O  -5.272   6.418   9.179 1.00 . A A . 11 SER OG   1 1 
        5  5353 1 1 12 ILE C    C  -4.845  12.423  12.015 1.00 . A A . 12 ILE C    1 1 
        5  5354 1 1 12 ILE CA   C  -3.809  11.648  11.173 1.00 . A A . 12 ILE CA   1 1 
        5  5355 1 1 12 ILE CB   C  -3.148  12.608  10.177 1.00 . A A . 12 ILE CB   1 1 
        5  5356 1 1 12 ILE CD1  C  -1.480  12.735   8.317 1.00 . A A . 12 ILE CD1  1 1 
        5  5357 1 1 12 ILE CG1  C  -1.971  11.900   9.501 1.00 . A A . 12 ILE CG1  1 1 
        5  5358 1 1 12 ILE CG2  C  -2.634  13.850  10.915 1.00 . A A . 12 ILE CG2  1 1 
        5  5359 1 1 12 ILE H    H  -4.313  10.414   9.466 1.00 . A A . 12 ILE H    1 1 
        5  5360 1 1 12 ILE HA   H  -3.039  11.233  11.805 1.00 . A A . 12 ILE HA   1 1 
        5  5361 1 1 12 ILE HB   H  -3.870  12.906   9.430 1.00 . A A . 12 ILE HB   1 1 
        5  5362 1 1 12 ILE HD11 H  -2.313  12.979   7.677 1.00 . A A . 12 ILE HD11 1 1 
        5  5363 1 1 12 ILE HD12 H  -0.748  12.171   7.758 1.00 . A A . 12 ILE HD12 1 1 
        5  5364 1 1 12 ILE HD13 H  -1.028  13.647   8.682 1.00 . A A . 12 ILE HD13 1 1 
        5  5365 1 1 12 ILE HG12 H  -1.169  11.776  10.213 1.00 . A A . 12 ILE HG12 1 1 
        5  5366 1 1 12 ILE HG13 H  -2.290  10.931   9.147 1.00 . A A . 12 ILE HG13 1 1 
        5  5367 1 1 12 ILE HG21 H  -3.468  14.487  11.169 1.00 . A A . 12 ILE HG21 1 1 
        5  5368 1 1 12 ILE HG22 H  -1.949  14.391  10.278 1.00 . A A . 12 ILE HG22 1 1 
        5  5369 1 1 12 ILE HG23 H  -2.124  13.547  11.818 1.00 . A A . 12 ILE HG23 1 1 
        5  5370 1 1 12 ILE N    N  -4.457  10.555  10.425 1.00 . A A . 12 ILE N    1 1 
        5  5371 1 1 12 ILE O    O  -4.663  12.695  13.200 1.00 . A A . 12 ILE O    1 1 
        5  5372 1 1 13 ILE C    C  -7.620  12.638  13.164 1.00 . A A . 13 ILE C    1 1 
        5  5373 1 1 13 ILE CA   C  -7.052  13.435  11.955 1.00 . A A . 13 ILE CA   1 1 
        5  5374 1 1 13 ILE CB   C  -8.157  13.701  10.921 1.00 . A A . 13 ILE CB   1 1 
        5  5375 1 1 13 ILE CD1  C  -7.291  16.067  10.518 1.00 . A A . 13 ILE CD1  1 1 
        5  5376 1 1 13 ILE CG1  C  -7.670  14.722   9.871 1.00 . A A . 13 ILE CG1  1 1 
        5  5377 1 1 13 ILE CG2  C  -9.418  14.225  11.616 1.00 . A A . 13 ILE CG2  1 1 
        5  5378 1 1 13 ILE H    H  -5.892  12.356  10.433 1.00 . A A . 13 ILE H    1 1 
        5  5379 1 1 13 ILE HA   H  -6.693  14.375  12.345 1.00 . A A . 13 ILE HA   1 1 
        5  5380 1 1 13 ILE HB   H  -8.396  12.771  10.425 1.00 . A A . 13 ILE HB   1 1 
        5  5381 1 1 13 ILE HD11 H  -7.876  16.235  11.409 1.00 . A A . 13 ILE HD11 1 1 
        5  5382 1 1 13 ILE HD12 H  -7.477  16.864   9.816 1.00 . A A . 13 ILE HD12 1 1 
        5  5383 1 1 13 ILE HD13 H  -6.242  16.056  10.776 1.00 . A A . 13 ILE HD13 1 1 
        5  5384 1 1 13 ILE HG12 H  -6.804  14.324   9.368 1.00 . A A . 13 ILE HG12 1 1 
        5  5385 1 1 13 ILE HG13 H  -8.454  14.887   9.148 1.00 . A A . 13 ILE HG13 1 1 
        5  5386 1 1 13 ILE HG21 H  -9.143  14.988  12.330 1.00 . A A . 13 ILE HG21 1 1 
        5  5387 1 1 13 ILE HG22 H  -9.911  13.413  12.129 1.00 . A A . 13 ILE HG22 1 1 
        5  5388 1 1 13 ILE HG23 H -10.086  14.646  10.880 1.00 . A A . 13 ILE HG23 1 1 
        5  5389 1 1 13 ILE N    N  -5.923  12.722  11.341 1.00 . A A . 13 ILE N    1 1 
        5  5390 1 1 13 ILE O    O  -7.876  13.211  14.220 1.00 . A A . 13 ILE O    1 1 
        5  5391 1 1 14 GLY C    C  -6.993  10.115  15.071 1.00 . A A . 14 GLY C    1 1 
        5  5392 1 1 14 GLY CA   C  -8.186  10.457  14.138 1.00 . A A . 14 GLY CA   1 1 
        5  5393 1 1 14 GLY H    H  -7.375  10.957  12.179 1.00 . A A . 14 GLY H    1 1 
        5  5394 1 1 14 GLY HA2  H  -8.946  10.977  14.703 1.00 . A A . 14 GLY HA2  1 1 
        5  5395 1 1 14 GLY HA3  H  -8.598   9.542  13.740 1.00 . A A . 14 GLY HA3  1 1 
        5  5396 1 1 14 GLY N    N  -7.737  11.323  13.014 1.00 . A A . 14 GLY N    1 1 
        5  5397 1 1 14 GLY O    O  -7.054  10.212  16.296 1.00 . A A . 14 GLY O    1 1 
        5  5398 1 1 15 THR C    C  -4.033  10.300  15.867 1.00 . A A . 15 THR C    1 1 
        5  5399 1 1 15 THR CA   C  -4.690   9.214  15.013 1.00 . A A . 15 THR CA   1 1 
        5  5400 1 1 15 THR CB   C  -3.676   8.729  13.969 1.00 . A A . 15 THR CB   1 1 
        5  5401 1 1 15 THR CG2  C  -2.472   8.105  14.680 1.00 . A A . 15 THR CG2  1 1 
        5  5402 1 1 15 THR H    H  -6.154   9.602  13.446 1.00 . A A . 15 THR H    1 1 
        5  5403 1 1 15 THR HA   H  -4.922   8.386  15.665 1.00 . A A . 15 THR HA   1 1 
        5  5404 1 1 15 THR HB   H  -3.335   9.560  13.376 1.00 . A A . 15 THR HB   1 1 
        5  5405 1 1 15 THR HG1  H  -4.192   8.041  12.227 1.00 . A A . 15 THR HG1  1 1 
        5  5406 1 1 15 THR HG21 H  -2.814   7.431  15.452 1.00 . A A . 15 THR HG21 1 1 
        5  5407 1 1 15 THR HG22 H  -1.872   8.885  15.125 1.00 . A A . 15 THR HG22 1 1 
        5  5408 1 1 15 THR HG23 H  -1.876   7.557  13.965 1.00 . A A . 15 THR HG23 1 1 
        5  5409 1 1 15 THR N    N  -5.955   9.669  14.398 1.00 . A A . 15 THR N    1 1 
        5  5410 1 1 15 THR O    O  -3.328   9.986  16.827 1.00 . A A . 15 THR O    1 1 
        5  5411 1 1 15 THR OG1  O  -4.282   7.751  13.136 1.00 . A A . 15 THR OG1  1 1 
        5  5412 1 1 16 THR C    C  -4.443  12.884  17.642 1.00 . A A . 16 THR C    1 1 
        5  5413 1 1 16 THR CA   C  -3.704  12.674  16.322 1.00 . A A . 16 THR CA   1 1 
        5  5414 1 1 16 THR CB   C  -3.729  13.968  15.505 1.00 . A A . 16 THR CB   1 1 
        5  5415 1 1 16 THR CG2  C  -3.168  15.116  16.345 1.00 . A A . 16 THR CG2  1 1 
        5  5416 1 1 16 THR H    H  -4.889  11.799  14.822 1.00 . A A . 16 THR H    1 1 
        5  5417 1 1 16 THR HA   H  -2.678  12.436  16.558 1.00 . A A . 16 THR HA   1 1 
        5  5418 1 1 16 THR HB   H  -4.745  14.197  15.223 1.00 . A A . 16 THR HB   1 1 
        5  5419 1 1 16 THR HG1  H  -3.501  13.959  13.573 1.00 . A A . 16 THR HG1  1 1 
        5  5420 1 1 16 THR HG21 H  -3.900  15.415  17.081 1.00 . A A . 16 THR HG21 1 1 
        5  5421 1 1 16 THR HG22 H  -2.942  15.955  15.703 1.00 . A A . 16 THR HG22 1 1 
        5  5422 1 1 16 THR HG23 H  -2.268  14.792  16.844 1.00 . A A . 16 THR HG23 1 1 
        5  5423 1 1 16 THR N    N  -4.271  11.569  15.548 1.00 . A A . 16 THR N    1 1 
        5  5424 1 1 16 THR O    O  -3.855  13.328  18.629 1.00 . A A . 16 THR O    1 1 
        5  5425 1 1 16 THR OG1  O  -2.938  13.803  14.336 1.00 . A A . 16 THR OG1  1 1 
        5  5426 1 1 17 LEU C    C  -6.418  11.803  19.927 1.00 . A A . 17 LEU C    1 1 
        5  5427 1 1 17 LEU CA   C  -6.615  12.810  18.790 1.00 . A A . 17 LEU CA   1 1 
        5  5428 1 1 17 LEU CB   C  -8.089  12.804  18.329 1.00 . A A . 17 LEU CB   1 1 
        5  5429 1 1 17 LEU CD1  C  -8.713  15.163  19.046 1.00 . A A . 17 LEU CD1  1 1 
        5  5430 1 1 17 LEU CD2  C  -7.479  14.787  16.884 1.00 . A A . 17 LEU CD2  1 1 
        5  5431 1 1 17 LEU CG   C  -8.527  14.208  17.850 1.00 . A A . 17 LEU CG   1 1 
        5  5432 1 1 17 LEU H    H  -6.186  12.278  16.829 1.00 . A A . 17 LEU H    1 1 
        5  5433 1 1 17 LEU HA   H  -6.402  13.772  19.222 1.00 . A A . 17 LEU HA   1 1 
        5  5434 1 1 17 LEU HB2  H  -8.197  12.107  17.511 1.00 . A A . 17 LEU HB2  1 1 
        5  5435 1 1 17 LEU HB3  H  -8.730  12.491  19.142 1.00 . A A . 17 LEU HB3  1 1 
        5  5436 1 1 17 LEU HD11 H  -9.088  14.618  19.900 1.00 . A A . 17 LEU HD11 1 1 
        5  5437 1 1 17 LEU HD12 H  -9.422  15.932  18.779 1.00 . A A . 17 LEU HD12 1 1 
        5  5438 1 1 17 LEU HD13 H  -7.770  15.625  19.301 1.00 . A A . 17 LEU HD13 1 1 
        5  5439 1 1 17 LEU HD21 H  -7.942  15.545  16.269 1.00 . A A . 17 LEU HD21 1 1 
        5  5440 1 1 17 LEU HD22 H  -7.094  14.004  16.252 1.00 . A A . 17 LEU HD22 1 1 
        5  5441 1 1 17 LEU HD23 H  -6.669  15.229  17.444 1.00 . A A . 17 LEU HD23 1 1 
        5  5442 1 1 17 LEU HG   H  -9.470  14.117  17.330 1.00 . A A . 17 LEU HG   1 1 
        5  5443 1 1 17 LEU N    N  -5.742  12.613  17.635 1.00 . A A . 17 LEU N    1 1 
        5  5444 1 1 17 LEU O    O  -6.755  12.127  21.067 1.00 . A A . 17 LEU O    1 1 
        5  5445 1 1 18 VAL C    C  -4.969  10.325  21.907 1.00 . A A . 18 VAL C    1 1 
        5  5446 1 1 18 VAL CA   C  -5.786   9.666  20.796 1.00 . A A . 18 VAL CA   1 1 
        5  5447 1 1 18 VAL CB   C  -5.113   8.367  20.329 1.00 . A A . 18 VAL CB   1 1 
        5  5448 1 1 18 VAL CG1  C  -3.706   8.657  19.790 1.00 . A A . 18 VAL CG1  1 1 
        5  5449 1 1 18 VAL CG2  C  -5.021   7.394  21.508 1.00 . A A . 18 VAL CG2  1 1 
        5  5450 1 1 18 VAL H    H  -5.619  10.327  18.786 1.00 . A A . 18 VAL H    1 1 
        5  5451 1 1 18 VAL HA   H  -6.789   9.437  21.123 1.00 . A A . 18 VAL HA   1 1 
        5  5452 1 1 18 VAL HB   H  -5.709   7.922  19.544 1.00 . A A . 18 VAL HB   1 1 
        5  5453 1 1 18 VAL HG11 H  -3.015   8.766  20.613 1.00 . A A . 18 VAL HG11 1 1 
        5  5454 1 1 18 VAL HG12 H  -3.723   9.566  19.208 1.00 . A A . 18 VAL HG12 1 1 
        5  5455 1 1 18 VAL HG13 H  -3.390   7.837  19.163 1.00 . A A . 18 VAL HG13 1 1 
        5  5456 1 1 18 VAL HG21 H  -4.729   6.418  21.148 1.00 . A A . 18 VAL HG21 1 1 
        5  5457 1 1 18 VAL HG22 H  -5.983   7.325  21.995 1.00 . A A . 18 VAL HG22 1 1 
        5  5458 1 1 18 VAL HG23 H  -4.286   7.752  22.214 1.00 . A A . 18 VAL HG23 1 1 
        5  5459 1 1 18 VAL N    N  -5.920  10.596  19.679 1.00 . A A . 18 VAL N    1 1 
        5  5460 1 1 18 VAL O    O  -5.367  10.356  23.071 1.00 . A A . 18 VAL O    1 1 
        5  5461 1 1 19 ALA C    C  -3.496  12.667  23.133 1.00 . A A . 19 ALA C    1 1 
        5  5462 1 1 19 ALA CA   C  -2.866  11.478  22.414 1.00 . A A . 19 ALA CA   1 1 
        5  5463 1 1 19 ALA CB   C  -1.642  11.954  21.631 1.00 . A A . 19 ALA CB   1 1 
        5  5464 1 1 19 ALA H    H  -3.547  10.701  20.573 1.00 . A A . 19 ALA H    1 1 
        5  5465 1 1 19 ALA HA   H  -2.540  10.757  23.147 1.00 . A A . 19 ALA HA   1 1 
        5  5466 1 1 19 ALA HB1  H  -0.962  12.462  22.298 1.00 . A A . 19 ALA HB1  1 1 
        5  5467 1 1 19 ALA HB2  H  -1.955  12.632  20.851 1.00 . A A . 19 ALA HB2  1 1 
        5  5468 1 1 19 ALA HB3  H  -1.143  11.103  21.190 1.00 . A A . 19 ALA HB3  1 1 
        5  5469 1 1 19 ALA N    N  -3.805  10.827  21.508 1.00 . A A . 19 ALA N    1 1 
        5  5470 1 1 19 ALA O    O  -3.147  12.963  24.276 1.00 . A A . 19 ALA O    1 1 
        5  5471 1 1 20 LEU C    C  -5.957  14.020  24.271 1.00 . A A . 20 LEU C    1 1 
        5  5472 1 1 20 LEU CA   C  -5.095  14.482  23.096 1.00 . A A . 20 LEU CA   1 1 
        5  5473 1 1 20 LEU CB   C  -5.938  15.244  22.066 1.00 . A A . 20 LEU CB   1 1 
        5  5474 1 1 20 LEU CD1  C  -5.595  17.418  23.301 1.00 . A A . 20 LEU CD1  1 1 
        5  5475 1 1 20 LEU CD2  C  -7.482  17.167  21.662 1.00 . A A . 20 LEU CD2  1 1 
        5  5476 1 1 20 LEU CG   C  -6.638  16.446  22.721 1.00 . A A . 20 LEU CG   1 1 
        5  5477 1 1 20 LEU H    H  -4.707  13.032  21.585 1.00 . A A . 20 LEU H    1 1 
        5  5478 1 1 20 LEU HA   H  -4.343  15.137  23.505 1.00 . A A . 20 LEU HA   1 1 
        5  5479 1 1 20 LEU HB2  H  -5.295  15.595  21.271 1.00 . A A . 20 LEU HB2  1 1 
        5  5480 1 1 20 LEU HB3  H  -6.683  14.579  21.654 1.00 . A A . 20 LEU HB3  1 1 
        5  5481 1 1 20 LEU HD11 H  -6.019  18.411  23.366 1.00 . A A . 20 LEU HD11 1 1 
        5  5482 1 1 20 LEU HD12 H  -4.724  17.443  22.662 1.00 . A A . 20 LEU HD12 1 1 
        5  5483 1 1 20 LEU HD13 H  -5.308  17.089  24.287 1.00 . A A . 20 LEU HD13 1 1 
        5  5484 1 1 20 LEU HD21 H  -6.907  17.276  20.753 1.00 . A A . 20 LEU HD21 1 1 
        5  5485 1 1 20 LEU HD22 H  -7.760  18.144  22.029 1.00 . A A . 20 LEU HD22 1 1 
        5  5486 1 1 20 LEU HD23 H  -8.373  16.592  21.458 1.00 . A A . 20 LEU HD23 1 1 
        5  5487 1 1 20 LEU HG   H  -7.283  16.100  23.515 1.00 . A A . 20 LEU HG   1 1 
        5  5488 1 1 20 LEU N    N  -4.432  13.340  22.473 1.00 . A A . 20 LEU N    1 1 
        5  5489 1 1 20 LEU O    O  -5.903  14.612  25.349 1.00 . A A . 20 LEU O    1 1 
        5  5490 1 1 21 SER C    C  -6.793  11.648  26.157 1.00 . A A . 21 SER C    1 1 
        5  5491 1 1 21 SER CA   C  -7.599  12.458  25.145 1.00 . A A . 21 SER CA   1 1 
        5  5492 1 1 21 SER CB   C  -8.699  11.576  24.552 1.00 . A A . 21 SER CB   1 1 
        5  5493 1 1 21 SER H    H  -6.772  12.523  23.200 1.00 . A A . 21 SER H    1 1 
        5  5494 1 1 21 SER HA   H  -8.064  13.301  25.635 1.00 . A A . 21 SER HA   1 1 
        5  5495 1 1 21 SER HB2  H  -8.256  10.798  23.953 1.00 . A A . 21 SER HB2  1 1 
        5  5496 1 1 21 SER HB3  H  -9.271  11.129  25.354 1.00 . A A . 21 SER HB3  1 1 
        5  5497 1 1 21 SER HG   H  -9.716  13.196  24.195 1.00 . A A . 21 SER HG   1 1 
        5  5498 1 1 21 SER N    N  -6.746  12.967  24.073 1.00 . A A . 21 SER N    1 1 
        5  5499 1 1 21 SER O    O  -7.220  11.448  27.282 1.00 . A A . 21 SER O    1 1 
        5  5500 1 1 21 SER OG   O  -9.546  12.372  23.734 1.00 . A A . 21 SER OG   1 1 
        5  5501 1 1 22 SER C    C  -3.834  11.138  27.429 1.00 . A A . 22 SER C    1 1 
        5  5502 1 1 22 SER CA   C  -4.775  10.316  26.535 1.00 . A A . 22 SER CA   1 1 
        5  5503 1 1 22 SER CB   C  -3.950   9.379  25.654 1.00 . A A . 22 SER CB   1 1 
        5  5504 1 1 22 SER H    H  -5.428  11.361  24.771 1.00 . A A . 22 SER H    1 1 
        5  5505 1 1 22 SER HA   H  -5.386   9.715  27.191 1.00 . A A . 22 SER HA   1 1 
        5  5506 1 1 22 SER HB2  H  -4.565   8.989  24.862 1.00 . A A . 22 SER HB2  1 1 
        5  5507 1 1 22 SER HB3  H  -3.121   9.927  25.229 1.00 . A A . 22 SER HB3  1 1 
        5  5508 1 1 22 SER HG   H  -4.001   7.529  26.256 1.00 . A A . 22 SER HG   1 1 
        5  5509 1 1 22 SER N    N  -5.652  11.152  25.702 1.00 . A A . 22 SER N    1 1 
        5  5510 1 1 22 SER O    O  -3.318  10.622  28.420 1.00 . A A . 22 SER O    1 1 
        5  5511 1 1 22 SER OG   O  -3.463   8.302  26.444 1.00 . A A . 22 SER OG   1 1 
        5  5512 1 1 23 PHE C    C  -3.530  13.756  29.223 1.00 . A A . 23 PHE C    1 1 
        5  5513 1 1 23 PHE CA   C  -2.771  13.241  27.971 1.00 . A A . 23 PHE CA   1 1 
        5  5514 1 1 23 PHE CB   C  -2.172  14.414  27.168 1.00 . A A . 23 PHE CB   1 1 
        5  5515 1 1 23 PHE CD1  C  -0.575  12.767  26.094 1.00 . A A . 23 PHE CD1  1 1 
        5  5516 1 1 23 PHE CD2  C   0.223  14.994  26.631 1.00 . A A . 23 PHE CD2  1 1 
        5  5517 1 1 23 PHE CE1  C   0.686  12.439  25.582 1.00 . A A . 23 PHE CE1  1 1 
        5  5518 1 1 23 PHE CE2  C   1.484  14.665  26.119 1.00 . A A . 23 PHE CE2  1 1 
        5  5519 1 1 23 PHE CG   C  -0.806  14.045  26.619 1.00 . A A . 23 PHE CG   1 1 
        5  5520 1 1 23 PHE CZ   C   1.715  13.388  25.594 1.00 . A A . 23 PHE CZ   1 1 
        5  5521 1 1 23 PHE H    H  -4.150  12.762  26.349 1.00 . A A . 23 PHE H    1 1 
        5  5522 1 1 23 PHE HA   H  -1.976  12.634  28.384 1.00 . A A . 23 PHE HA   1 1 
        5  5523 1 1 23 PHE HB2  H  -2.831  14.650  26.345 1.00 . A A . 23 PHE HB2  1 1 
        5  5524 1 1 23 PHE HB3  H  -2.075  15.284  27.804 1.00 . A A . 23 PHE HB3  1 1 
        5  5525 1 1 23 PHE HD1  H  -1.368  12.035  26.084 1.00 . A A . 23 PHE HD1  1 1 
        5  5526 1 1 23 PHE HD2  H   0.044  15.978  27.036 1.00 . A A . 23 PHE HD2  1 1 
        5  5527 1 1 23 PHE HE1  H   0.865  11.454  25.177 1.00 . A A . 23 PHE HE1  1 1 
        5  5528 1 1 23 PHE HE2  H   2.277  15.397  26.129 1.00 . A A . 23 PHE HE2  1 1 
        5  5529 1 1 23 PHE HZ   H   2.686  13.136  25.200 1.00 . A A . 23 PHE HZ   1 1 
        5  5530 1 1 23 PHE N    N  -3.637  12.414  27.109 1.00 . A A . 23 PHE N    1 1 
        5  5531 1 1 23 PHE O    O  -2.935  13.798  30.300 1.00 . A A . 23 PHE O    1 1 
        5  5532 1 1 24 THR C    C  -5.841  13.749  31.394 1.00 . A A . 24 THR C    1 1 
        5  5533 1 1 24 THR CA   C  -5.491  14.768  30.282 1.00 . A A . 24 THR CA   1 1 
        5  5534 1 1 24 THR CB   C  -6.785  15.468  29.784 1.00 . A A . 24 THR CB   1 1 
        5  5535 1 1 24 THR CG2  C  -6.782  16.958  30.163 1.00 . A A . 24 THR CG2  1 1 
        5  5536 1 1 24 THR H    H  -5.203  14.331  28.233 1.00 . A A . 24 THR H    1 1 
        5  5537 1 1 24 THR HA   H  -4.845  15.514  30.718 1.00 . A A . 24 THR HA   1 1 
        5  5538 1 1 24 THR HB   H  -7.658  14.997  30.217 1.00 . A A . 24 THR HB   1 1 
        5  5539 1 1 24 THR HG1  H  -6.590  16.195  27.990 1.00 . A A . 24 THR HG1  1 1 
        5  5540 1 1 24 THR HG21 H  -7.690  17.421  29.803 1.00 . A A . 24 THR HG21 1 1 
        5  5541 1 1 24 THR HG22 H  -5.929  17.442  29.712 1.00 . A A . 24 THR HG22 1 1 
        5  5542 1 1 24 THR HG23 H  -6.728  17.057  31.236 1.00 . A A . 24 THR HG23 1 1 
        5  5543 1 1 24 THR N    N  -4.782  14.203  29.109 1.00 . A A . 24 THR N    1 1 
        5  5544 1 1 24 THR O    O  -5.786  14.081  32.579 1.00 . A A . 24 THR O    1 1 
        5  5545 1 1 24 THR OG1  O  -6.853  15.353  28.370 1.00 . A A . 24 THR OG1  1 1 
        5  5546 1 1 25 PRO C    C  -5.751  11.278  33.198 1.00 . A A . 25 PRO C    1 1 
        5  5547 1 1 25 PRO CA   C  -6.681  11.507  32.010 1.00 . A A . 25 PRO CA   1 1 
        5  5548 1 1 25 PRO CB   C  -6.767  10.249  31.146 1.00 . A A . 25 PRO CB   1 1 
        5  5549 1 1 25 PRO CD   C  -6.354  12.090  29.662 1.00 . A A . 25 PRO CD   1 1 
        5  5550 1 1 25 PRO CG   C  -7.110  10.763  29.796 1.00 . A A . 25 PRO CG   1 1 
        5  5551 1 1 25 PRO HA   H  -7.669  11.741  32.372 1.00 . A A . 25 PRO HA   1 1 
        5  5552 1 1 25 PRO HB2  H  -5.813   9.736  31.128 1.00 . A A . 25 PRO HB2  1 1 
        5  5553 1 1 25 PRO HB3  H  -7.545   9.591  31.503 1.00 . A A . 25 PRO HB3  1 1 
        5  5554 1 1 25 PRO HD2  H  -5.382  11.923  29.246 1.00 . A A . 25 PRO HD2  1 1 
        5  5555 1 1 25 PRO HD3  H  -6.912  12.801  29.073 1.00 . A A . 25 PRO HD3  1 1 
        5  5556 1 1 25 PRO HG2  H  -6.786  10.058  29.042 1.00 . A A . 25 PRO HG2  1 1 
        5  5557 1 1 25 PRO HG3  H  -8.172  10.938  29.716 1.00 . A A . 25 PRO HG3  1 1 
        5  5558 1 1 25 PRO N    N  -6.247  12.565  31.041 1.00 . A A . 25 PRO N    1 1 
        5  5559 1 1 25 PRO O    O  -6.207  10.791  34.234 1.00 . A A . 25 PRO O    1 1 
        5  5560 1 1 26 VAL C    C  -4.045  12.276  35.414 1.00 . A A . 26 VAL C    1 1 
        5  5561 1 1 26 VAL CA   C  -3.586  11.422  34.233 1.00 . A A . 26 VAL CA   1 1 
        5  5562 1 1 26 VAL CB   C  -2.150  11.793  33.845 1.00 . A A . 26 VAL CB   1 1 
        5  5563 1 1 26 VAL CG1  C  -1.255  11.788  35.088 1.00 . A A . 26 VAL CG1  1 1 
        5  5564 1 1 26 VAL CG2  C  -1.619  10.775  32.833 1.00 . A A . 26 VAL CG2  1 1 
        5  5565 1 1 26 VAL H    H  -4.112  12.060  32.298 1.00 . A A . 26 VAL H    1 1 
        5  5566 1 1 26 VAL HA   H  -3.612  10.384  34.529 1.00 . A A . 26 VAL HA   1 1 
        5  5567 1 1 26 VAL HB   H  -2.141  12.779  33.402 1.00 . A A . 26 VAL HB   1 1 
        5  5568 1 1 26 VAL HG11 H  -1.468  12.660  35.689 1.00 . A A . 26 VAL HG11 1 1 
        5  5569 1 1 26 VAL HG12 H  -0.218  11.805  34.785 1.00 . A A . 26 VAL HG12 1 1 
        5  5570 1 1 26 VAL HG13 H  -1.446  10.895  35.666 1.00 . A A . 26 VAL HG13 1 1 
        5  5571 1 1 26 VAL HG21 H  -1.400   9.845  33.338 1.00 . A A . 26 VAL HG21 1 1 
        5  5572 1 1 26 VAL HG22 H  -0.717  11.157  32.377 1.00 . A A . 26 VAL HG22 1 1 
        5  5573 1 1 26 VAL HG23 H  -2.363  10.604  32.070 1.00 . A A . 26 VAL HG23 1 1 
        5  5574 1 1 26 VAL N    N  -4.474  11.622  33.097 1.00 . A A . 26 VAL N    1 1 
        5  5575 1 1 26 VAL O    O  -4.090  11.803  36.549 1.00 . A A . 26 VAL O    1 1 
        5  5576 1 1 27 LEU C    C  -5.846  13.925  37.085 1.00 . A A . 27 LEU C    1 1 
        5  5577 1 1 27 LEU CA   C  -4.740  14.488  36.195 1.00 . A A . 27 LEU CA   1 1 
        5  5578 1 1 27 LEU CB   C  -5.262  15.772  35.535 1.00 . A A . 27 LEU CB   1 1 
        5  5579 1 1 27 LEU CD1  C  -4.006  17.504  36.893 1.00 . A A . 27 LEU CD1  1 1 
        5  5580 1 1 27 LEU CD2  C  -6.299  18.002  36.025 1.00 . A A . 27 LEU CD2  1 1 
        5  5581 1 1 27 LEU CG   C  -5.384  16.902  36.574 1.00 . A A . 27 LEU CG   1 1 
        5  5582 1 1 27 LEU H    H  -4.222  13.914  34.248 1.00 . A A . 27 LEU H    1 1 
        5  5583 1 1 27 LEU HA   H  -3.860  14.734  36.760 1.00 . A A . 27 LEU HA   1 1 
        5  5584 1 1 27 LEU HB2  H  -4.583  16.070  34.750 1.00 . A A . 27 LEU HB2  1 1 
        5  5585 1 1 27 LEU HB3  H  -6.235  15.577  35.105 1.00 . A A . 27 LEU HB3  1 1 
        5  5586 1 1 27 LEU HD11 H  -3.460  17.673  35.976 1.00 . A A . 27 LEU HD11 1 1 
        5  5587 1 1 27 LEU HD12 H  -3.449  16.833  37.526 1.00 . A A . 27 LEU HD12 1 1 
        5  5588 1 1 27 LEU HD13 H  -4.137  18.445  37.406 1.00 . A A . 27 LEU HD13 1 1 
        5  5589 1 1 27 LEU HD21 H  -6.216  18.882  36.645 1.00 . A A . 27 LEU HD21 1 1 
        5  5590 1 1 27 LEU HD22 H  -7.321  17.654  36.030 1.00 . A A . 27 LEU HD22 1 1 
        5  5591 1 1 27 LEU HD23 H  -6.006  18.245  35.014 1.00 . A A . 27 LEU HD23 1 1 
        5  5592 1 1 27 LEU HG   H  -5.813  16.505  37.482 1.00 . A A . 27 LEU HG   1 1 
        5  5593 1 1 27 LEU N    N  -4.340  13.549  35.150 1.00 . A A . 27 LEU N    1 1 
        5  5594 1 1 27 LEU O    O  -5.964  14.295  38.253 1.00 . A A . 27 LEU O    1 1 
        5  5595 1 1 28 VAL C    C  -7.264  11.449  38.312 1.00 . A A . 28 VAL C    1 1 
        5  5596 1 1 28 VAL CA   C  -7.765  12.421  37.250 1.00 . A A . 28 VAL CA   1 1 
        5  5597 1 1 28 VAL CB   C  -8.668  11.676  36.262 1.00 . A A . 28 VAL CB   1 1 
        5  5598 1 1 28 VAL CG1  C  -9.757  10.914  37.025 1.00 . A A . 28 VAL CG1  1 1 
        5  5599 1 1 28 VAL CG2  C  -9.324  12.683  35.314 1.00 . A A . 28 VAL CG2  1 1 
        5  5600 1 1 28 VAL H    H  -6.519  12.745  35.599 1.00 . A A . 28 VAL H    1 1 
        5  5601 1 1 28 VAL HA   H  -8.344  13.202  37.717 1.00 . A A . 28 VAL HA   1 1 
        5  5602 1 1 28 VAL HB   H  -8.076  10.976  35.692 1.00 . A A . 28 VAL HB   1 1 
        5  5603 1 1 28 VAL HG11 H -10.531  10.605  36.338 1.00 . A A . 28 VAL HG11 1 1 
        5  5604 1 1 28 VAL HG12 H -10.182  11.557  37.782 1.00 . A A . 28 VAL HG12 1 1 
        5  5605 1 1 28 VAL HG13 H  -9.323  10.043  37.495 1.00 . A A . 28 VAL HG13 1 1 
        5  5606 1 1 28 VAL HG21 H  -9.869  12.153  34.548 1.00 . A A . 28 VAL HG21 1 1 
        5  5607 1 1 28 VAL HG22 H  -8.560  13.294  34.856 1.00 . A A . 28 VAL HG22 1 1 
        5  5608 1 1 28 VAL HG23 H -10.003  13.312  35.870 1.00 . A A . 28 VAL HG23 1 1 
        5  5609 1 1 28 VAL N    N  -6.658  13.035  36.524 1.00 . A A . 28 VAL N    1 1 
        5  5610 1 1 28 VAL O    O  -7.873  11.296  39.371 1.00 . A A . 28 VAL O    1 1 
        5  5611 1 1 29 ILE C    C  -5.186  10.538  40.248 1.00 . A A . 29 ILE C    1 1 
        5  5612 1 1 29 ILE CA   C  -5.552   9.846  38.937 1.00 . A A . 29 ILE CA   1 1 
        5  5613 1 1 29 ILE CB   C  -4.301   9.216  38.317 1.00 . A A . 29 ILE CB   1 1 
        5  5614 1 1 29 ILE CD1  C  -5.734   7.377  37.307 1.00 . A A . 29 ILE CD1  1 1 
        5  5615 1 1 29 ILE CG1  C  -4.673   8.454  37.031 1.00 . A A . 29 ILE CG1  1 1 
        5  5616 1 1 29 ILE CG2  C  -3.647   8.257  39.318 1.00 . A A . 29 ILE CG2  1 1 
        5  5617 1 1 29 ILE H    H  -5.679  11.023  37.181 1.00 . A A . 29 ILE H    1 1 
        5  5618 1 1 29 ILE HA   H  -6.264   9.072  39.178 1.00 . A A . 29 ILE HA   1 1 
        5  5619 1 1 29 ILE HB   H  -3.597  10.000  38.074 1.00 . A A . 29 ILE HB   1 1 
        5  5620 1 1 29 ILE HD11 H  -5.583   6.948  38.286 1.00 . A A . 29 ILE HD11 1 1 
        5  5621 1 1 29 ILE HD12 H  -5.656   6.599  36.562 1.00 . A A . 29 ILE HD12 1 1 
        5  5622 1 1 29 ILE HD13 H  -6.717   7.821  37.258 1.00 . A A . 29 ILE HD13 1 1 
        5  5623 1 1 29 ILE HG12 H  -5.061   9.154  36.305 1.00 . A A . 29 ILE HG12 1 1 
        5  5624 1 1 29 ILE HG13 H  -3.787   7.984  36.630 1.00 . A A . 29 ILE HG13 1 1 
        5  5625 1 1 29 ILE HG21 H  -4.390   7.569  39.693 1.00 . A A . 29 ILE HG21 1 1 
        5  5626 1 1 29 ILE HG22 H  -3.231   8.821  40.140 1.00 . A A . 29 ILE HG22 1 1 
        5  5627 1 1 29 ILE HG23 H  -2.861   7.705  38.826 1.00 . A A . 29 ILE HG23 1 1 
        5  5628 1 1 29 ILE N    N  -6.147  10.801  38.013 1.00 . A A . 29 ILE N    1 1 
        5  5629 1 1 29 ILE O    O  -5.405   9.979  41.322 1.00 . A A . 29 ILE O    1 1 
        5  5630 1 1 30 LEU C    C  -5.391  12.740  42.316 1.00 . A A . 30 LEU C    1 1 
        5  5631 1 1 30 LEU CA   C  -4.217  12.468  41.375 1.00 . A A . 30 LEU CA   1 1 
        5  5632 1 1 30 LEU CB   C  -3.586  13.804  40.972 1.00 . A A . 30 LEU CB   1 1 
        5  5633 1 1 30 LEU CD1  C  -1.746  14.895  39.680 1.00 . A A . 30 LEU CD1  1 1 
        5  5634 1 1 30 LEU CD2  C  -1.199  12.996  41.234 1.00 . A A . 30 LEU CD2  1 1 
        5  5635 1 1 30 LEU CG   C  -2.247  13.565  40.254 1.00 . A A . 30 LEU CG   1 1 
        5  5636 1 1 30 LEU H    H  -4.419  12.174  39.322 1.00 . A A . 30 LEU H    1 1 
        5  5637 1 1 30 LEU HA   H  -3.487  11.894  41.912 1.00 . A A . 30 LEU HA   1 1 
        5  5638 1 1 30 LEU HB2  H  -4.259  14.326  40.307 1.00 . A A . 30 LEU HB2  1 1 
        5  5639 1 1 30 LEU HB3  H  -3.419  14.404  41.853 1.00 . A A . 30 LEU HB3  1 1 
        5  5640 1 1 30 LEU HD11 H  -2.535  15.361  39.109 1.00 . A A . 30 LEU HD11 1 1 
        5  5641 1 1 30 LEU HD12 H  -0.898  14.712  39.036 1.00 . A A . 30 LEU HD12 1 1 
        5  5642 1 1 30 LEU HD13 H  -1.451  15.547  40.488 1.00 . A A . 30 LEU HD13 1 1 
        5  5643 1 1 30 LEU HD21 H  -0.205  13.259  40.899 1.00 . A A . 30 LEU HD21 1 1 
        5  5644 1 1 30 LEU HD22 H  -1.285  11.922  41.269 1.00 . A A . 30 LEU HD22 1 1 
        5  5645 1 1 30 LEU HD23 H  -1.360  13.401  42.223 1.00 . A A . 30 LEU HD23 1 1 
        5  5646 1 1 30 LEU HG   H  -2.400  12.865  39.444 1.00 . A A . 30 LEU HG   1 1 
        5  5647 1 1 30 LEU N    N  -4.618  11.738  40.176 1.00 . A A . 30 LEU N    1 1 
        5  5648 1 1 30 LEU O    O  -5.207  12.804  43.529 1.00 . A A . 30 LEU O    1 1 
        5  5649 1 1 31 LEU C    C  -8.173  11.769  43.318 1.00 . A A . 31 LEU C    1 1 
        5  5650 1 1 31 LEU CA   C  -7.767  13.080  42.633 1.00 . A A . 31 LEU CA   1 1 
        5  5651 1 1 31 LEU CB   C  -8.932  13.596  41.776 1.00 . A A . 31 LEU CB   1 1 
        5  5652 1 1 31 LEU CD1  C  -9.879  14.895  43.721 1.00 . A A . 31 LEU CD1  1 1 
        5  5653 1 1 31 LEU CD2  C -11.319  14.330  41.745 1.00 . A A . 31 LEU CD2  1 1 
        5  5654 1 1 31 LEU CG   C -10.178  13.839  42.643 1.00 . A A . 31 LEU CG   1 1 
        5  5655 1 1 31 LEU H    H  -6.738  12.719  40.823 1.00 . A A . 31 LEU H    1 1 
        5  5656 1 1 31 LEU HA   H  -7.521  13.829  43.368 1.00 . A A . 31 LEU HA   1 1 
        5  5657 1 1 31 LEU HB2  H  -8.643  14.521  41.301 1.00 . A A . 31 LEU HB2  1 1 
        5  5658 1 1 31 LEU HB3  H  -9.166  12.864  41.017 1.00 . A A . 31 LEU HB3  1 1 
        5  5659 1 1 31 LEU HD11 H  -9.220  15.651  43.319 1.00 . A A . 31 LEU HD11 1 1 
        5  5660 1 1 31 LEU HD12 H  -9.408  14.420  44.569 1.00 . A A . 31 LEU HD12 1 1 
        5  5661 1 1 31 LEU HD13 H -10.802  15.358  44.044 1.00 . A A . 31 LEU HD13 1 1 
        5  5662 1 1 31 LEU HD21 H -11.502  13.602  40.967 1.00 . A A . 31 LEU HD21 1 1 
        5  5663 1 1 31 LEU HD22 H -11.046  15.273  41.298 1.00 . A A . 31 LEU HD22 1 1 
        5  5664 1 1 31 LEU HD23 H -12.213  14.456  42.336 1.00 . A A . 31 LEU HD23 1 1 
        5  5665 1 1 31 LEU HG   H -10.473  12.916  43.121 1.00 . A A . 31 LEU HG   1 1 
        5  5666 1 1 31 LEU N    N  -6.599  12.868  41.782 1.00 . A A . 31 LEU N    1 1 
        5  5667 1 1 31 LEU O    O  -8.502  11.721  44.503 1.00 . A A . 31 LEU O    1 1 
        5  5668 1 1 32 GLY C    C  -7.556   8.805  43.993 1.00 . A A . 32 GLY C    1 1 
        5  5669 1 1 32 GLY CA   C  -8.512   9.369  42.935 1.00 . A A . 32 GLY CA   1 1 
        5  5670 1 1 32 GLY H    H  -7.832  10.901  41.592 1.00 . A A . 32 GLY H    1 1 
        5  5671 1 1 32 GLY HA2  H  -9.510   9.393  43.347 1.00 . A A . 32 GLY HA2  1 1 
        5  5672 1 1 32 GLY HA3  H  -8.505   8.715  42.077 1.00 . A A . 32 GLY HA3  1 1 
        5  5673 1 1 32 GLY N    N  -8.146  10.720  42.502 1.00 . A A . 32 GLY N    1 1 
        5  5674 1 1 32 GLY O    O  -7.986   8.327  45.039 1.00 . A A . 32 GLY O    1 1 
        5  5675 1 1 33 VAL C    C  -5.608   9.120  46.034 1.00 . A A . 33 VAL C    1 1 
        5  5676 1 1 33 VAL CA   C  -5.277   8.429  44.709 1.00 . A A . 33 VAL CA   1 1 
        5  5677 1 1 33 VAL CB   C  -3.838   8.724  44.279 1.00 . A A . 33 VAL CB   1 1 
        5  5678 1 1 33 VAL CG1  C  -3.534   7.992  42.968 1.00 . A A . 33 VAL CG1  1 1 
        5  5679 1 1 33 VAL CG2  C  -3.659  10.224  44.085 1.00 . A A . 33 VAL CG2  1 1 
        5  5680 1 1 33 VAL H    H  -6.033   9.380  42.897 1.00 . A A . 33 VAL H    1 1 
        5  5681 1 1 33 VAL HA   H  -5.401   7.364  44.852 1.00 . A A . 33 VAL HA   1 1 
        5  5682 1 1 33 VAL HB   H  -3.160   8.376  45.046 1.00 . A A . 33 VAL HB   1 1 
        5  5683 1 1 33 VAL HG11 H  -3.383   6.942  43.170 1.00 . A A . 33 VAL HG11 1 1 
        5  5684 1 1 33 VAL HG12 H  -2.639   8.405  42.524 1.00 . A A . 33 VAL HG12 1 1 
        5  5685 1 1 33 VAL HG13 H  -4.362   8.113  42.287 1.00 . A A . 33 VAL HG13 1 1 
        5  5686 1 1 33 VAL HG21 H  -4.500  10.610  43.533 1.00 . A A . 33 VAL HG21 1 1 
        5  5687 1 1 33 VAL HG22 H  -2.747  10.411  43.539 1.00 . A A . 33 VAL HG22 1 1 
        5  5688 1 1 33 VAL HG23 H  -3.609  10.706  45.048 1.00 . A A . 33 VAL HG23 1 1 
        5  5689 1 1 33 VAL N    N  -6.259   8.907  43.725 1.00 . A A . 33 VAL N    1 1 
        5  5690 1 1 33 VAL O    O  -5.674   8.478  47.083 1.00 . A A . 33 VAL O    1 1 
        5  5691 1 1 34 VAL C    C  -7.417  10.591  47.792 1.00 . A A . 34 VAL C    1 1 
        5  5692 1 1 34 VAL CA   C  -6.146  11.187  47.181 1.00 . A A . 34 VAL CA   1 1 
        5  5693 1 1 34 VAL CB   C  -6.367  12.671  46.851 1.00 . A A . 34 VAL CB   1 1 
        5  5694 1 1 34 VAL CG1  C  -6.960  13.391  48.068 1.00 . A A . 34 VAL CG1  1 1 
        5  5695 1 1 34 VAL CG2  C  -5.026  13.320  46.499 1.00 . A A . 34 VAL CG2  1 1 
        5  5696 1 1 34 VAL H    H  -5.661  10.881  45.116 1.00 . A A . 34 VAL H    1 1 
        5  5697 1 1 34 VAL HA   H  -5.304  11.099  47.852 1.00 . A A . 34 VAL HA   1 1 
        5  5698 1 1 34 VAL HB   H  -7.043  12.759  46.015 1.00 . A A . 34 VAL HB   1 1 
        5  5699 1 1 34 VAL HG11 H  -6.891  14.459  47.923 1.00 . A A . 34 VAL HG11 1 1 
        5  5700 1 1 34 VAL HG12 H  -6.412  13.110  48.955 1.00 . A A . 34 VAL HG12 1 1 
        5  5701 1 1 34 VAL HG13 H  -7.996  13.109  48.181 1.00 . A A . 34 VAL HG13 1 1 
        5  5702 1 1 34 VAL HG21 H  -5.199  14.311  46.107 1.00 . A A . 34 VAL HG21 1 1 
        5  5703 1 1 34 VAL HG22 H  -4.521  12.723  45.759 1.00 . A A . 34 VAL HG22 1 1 
        5  5704 1 1 34 VAL HG23 H  -4.415  13.385  47.386 1.00 . A A . 34 VAL HG23 1 1 
        5  5705 1 1 34 VAL N    N  -5.818  10.433  45.973 1.00 . A A . 34 VAL N    1 1 
        5  5706 1 1 34 VAL O    O  -7.546  10.426  49.003 1.00 . A A . 34 VAL O    1 1 
        5  5707 1 1 35 GLY C    C  -9.339   8.349  48.046 1.00 . A A . 35 GLY C    1 1 
        5  5708 1 1 35 GLY CA   C  -9.610   9.665  47.314 1.00 . A A . 35 GLY CA   1 1 
        5  5709 1 1 35 GLY H    H  -8.123  10.437  45.964 1.00 . A A . 35 GLY H    1 1 
        5  5710 1 1 35 GLY HA2  H -10.132  10.346  47.972 1.00 . A A . 35 GLY HA2  1 1 
        5  5711 1 1 35 GLY HA3  H -10.216   9.471  46.443 1.00 . A A . 35 GLY HA3  1 1 
        5  5712 1 1 35 GLY N    N  -8.344  10.264  46.903 1.00 . A A . 35 GLY N    1 1 
        5  5713 1 1 35 GLY O    O  -9.887   8.092  49.117 1.00 . A A . 35 GLY O    1 1 
        5  5714 1 1 36 LEU C    C  -7.218   6.469  49.284 1.00 . A A . 36 LEU C    1 1 
        5  5715 1 1 36 LEU CA   C  -8.086   6.249  48.038 1.00 . A A . 36 LEU CA   1 1 
        5  5716 1 1 36 LEU CB   C  -7.301   5.421  46.991 1.00 . A A . 36 LEU CB   1 1 
        5  5717 1 1 36 LEU CD1  C  -8.861   3.413  47.083 1.00 . A A . 36 LEU CD1  1 1 
        5  5718 1 1 36 LEU CD2  C  -9.353   5.332  45.521 1.00 . A A . 36 LEU CD2  1 1 
        5  5719 1 1 36 LEU CG   C  -8.242   4.500  46.179 1.00 . A A . 36 LEU CG   1 1 
        5  5720 1 1 36 LEU H    H  -8.073   7.812  46.606 1.00 . A A . 36 LEU H    1 1 
        5  5721 1 1 36 LEU HA   H  -8.983   5.716  48.305 1.00 . A A . 36 LEU HA   1 1 
        5  5722 1 1 36 LEU HB2  H  -6.802   6.095  46.312 1.00 . A A . 36 LEU HB2  1 1 
        5  5723 1 1 36 LEU HB3  H  -6.559   4.810  47.488 1.00 . A A . 36 LEU HB3  1 1 
        5  5724 1 1 36 LEU HD11 H  -8.196   3.196  47.909 1.00 . A A . 36 LEU HD11 1 1 
        5  5725 1 1 36 LEU HD12 H  -9.008   2.513  46.504 1.00 . A A . 36 LEU HD12 1 1 
        5  5726 1 1 36 LEU HD13 H  -9.815   3.744  47.469 1.00 . A A . 36 LEU HD13 1 1 
        5  5727 1 1 36 LEU HD21 H -10.064   5.648  46.269 1.00 . A A . 36 LEU HD21 1 1 
        5  5728 1 1 36 LEU HD22 H  -9.859   4.731  44.780 1.00 . A A . 36 LEU HD22 1 1 
        5  5729 1 1 36 LEU HD23 H  -8.921   6.196  45.046 1.00 . A A . 36 LEU HD23 1 1 
        5  5730 1 1 36 LEU HG   H  -7.662   4.015  45.405 1.00 . A A . 36 LEU HG   1 1 
        5  5731 1 1 36 LEU N    N  -8.470   7.535  47.456 1.00 . A A . 36 LEU N    1 1 
        5  5732 1 1 36 LEU O    O  -7.262   5.693  50.239 1.00 . A A . 36 LEU O    1 1 
        5  5733 1 1 37 SER C    C  -6.532   8.129  51.619 1.00 . A A . 37 SER C    1 1 
        5  5734 1 1 37 SER CA   C  -5.629   7.925  50.408 1.00 . A A . 37 SER CA   1 1 
        5  5735 1 1 37 SER CB   C  -4.811   9.188  50.137 1.00 . A A . 37 SER CB   1 1 
        5  5736 1 1 37 SER H    H  -6.581   8.173  48.502 1.00 . A A . 37 SER H    1 1 
        5  5737 1 1 37 SER HA   H  -4.963   7.109  50.639 1.00 . A A . 37 SER HA   1 1 
        5  5738 1 1 37 SER HB2  H  -5.464   9.998  49.881 1.00 . A A . 37 SER HB2  1 1 
        5  5739 1 1 37 SER HB3  H  -4.256   9.450  51.029 1.00 . A A . 37 SER HB3  1 1 
        5  5740 1 1 37 SER HG   H  -3.019   8.951  49.417 1.00 . A A . 37 SER HG   1 1 
        5  5741 1 1 37 SER N    N  -6.468   7.568  49.265 1.00 . A A . 37 SER N    1 1 
        5  5742 1 1 37 SER O    O  -6.204   7.741  52.710 1.00 . A A . 37 SER O    1 1 
        5  5743 1 1 37 SER OG   O  -3.911   8.944  49.064 1.00 . A A . 37 SER OG   1 1 
        5  5744 1 1 38 ALA C    C  -9.017   7.582  53.117 1.00 . A A . 38 ALA C    1 1 
        5  5745 1 1 38 ALA CA   C  -8.641   8.931  52.480 1.00 . A A . 38 ALA CA   1 1 
        5  5746 1 1 38 ALA CB   C  -9.894   9.640  51.962 1.00 . A A . 38 ALA CB   1 1 
        5  5747 1 1 38 ALA H    H  -7.856   8.997  50.470 1.00 . A A . 38 ALA H    1 1 
        5  5748 1 1 38 ALA HA   H  -8.205   9.507  53.282 1.00 . A A . 38 ALA HA   1 1 
        5  5749 1 1 38 ALA HB1  H  -9.615  10.581  51.512 1.00 . A A . 38 ALA HB1  1 1 
        5  5750 1 1 38 ALA HB2  H -10.570   9.820  52.785 1.00 . A A . 38 ALA HB2  1 1 
        5  5751 1 1 38 ALA HB3  H -10.381   9.019  51.225 1.00 . A A . 38 ALA HB3  1 1 
        5  5752 1 1 38 ALA N    N  -7.681   8.716  51.393 1.00 . A A . 38 ALA N    1 1 
        5  5753 1 1 38 ALA O    O  -9.191   7.493  54.332 1.00 . A A . 38 ALA O    1 1 
        5  5754 1 1 39 LEU C    C  -8.215   4.612  53.601 1.00 . A A . 39 LEU C    1 1 
        5  5755 1 1 39 LEU CA   C  -9.432   5.217  52.850 1.00 . A A . 39 LEU CA   1 1 
        5  5756 1 1 39 LEU CB   C  -9.864   4.278  51.708 1.00 . A A . 39 LEU CB   1 1 
        5  5757 1 1 39 LEU CD1  C -11.638   5.918  51.060 1.00 . A A . 39 LEU CD1  1 1 
        5  5758 1 1 39 LEU CD2  C -11.760   3.561  50.245 1.00 . A A . 39 LEU CD2  1 1 
        5  5759 1 1 39 LEU CG   C -11.358   4.458  51.419 1.00 . A A . 39 LEU CG   1 1 
        5  5760 1 1 39 LEU H    H  -8.905   6.716  51.362 1.00 . A A . 39 LEU H    1 1 
        5  5761 1 1 39 LEU HA   H -10.244   5.316  53.557 1.00 . A A . 39 LEU HA   1 1 
        5  5762 1 1 39 LEU HB2  H  -9.297   4.512  50.819 1.00 . A A . 39 LEU HB2  1 1 
        5  5763 1 1 39 LEU HB3  H  -9.679   3.251  51.990 1.00 . A A . 39 LEU HB3  1 1 
        5  5764 1 1 39 LEU HD11 H -11.572   6.526  51.950 1.00 . A A . 39 LEU HD11 1 1 
        5  5765 1 1 39 LEU HD12 H -12.630   6.003  50.640 1.00 . A A . 39 LEU HD12 1 1 
        5  5766 1 1 39 LEU HD13 H -10.911   6.257  50.338 1.00 . A A . 39 LEU HD13 1 1 
        5  5767 1 1 39 LEU HD21 H -11.426   2.551  50.434 1.00 . A A . 39 LEU HD21 1 1 
        5  5768 1 1 39 LEU HD22 H -11.302   3.928  49.339 1.00 . A A . 39 LEU HD22 1 1 
        5  5769 1 1 39 LEU HD23 H -12.835   3.571  50.136 1.00 . A A . 39 LEU HD23 1 1 
        5  5770 1 1 39 LEU HG   H -11.930   4.186  52.294 1.00 . A A . 39 LEU HG   1 1 
        5  5771 1 1 39 LEU N    N  -9.109   6.545  52.305 1.00 . A A . 39 LEU N    1 1 
        5  5772 1 1 39 LEU O    O  -8.332   4.165  54.741 1.00 . A A . 39 LEU O    1 1 
        5  5773 1 1 40 THR C    C  -4.955   5.115  54.153 1.00 . A A . 40 THR C    1 1 
        5  5774 1 1 40 THR CA   C  -5.822   4.027  53.494 1.00 . A A . 40 THR CA   1 1 
        5  5775 1 1 40 THR CB   C  -5.024   3.342  52.371 1.00 . A A . 40 THR CB   1 1 
        5  5776 1 1 40 THR CG2  C  -4.070   2.293  52.959 1.00 . A A . 40 THR CG2  1 1 
        5  5777 1 1 40 THR H    H  -7.116   4.944  52.010 1.00 . A A . 40 THR H    1 1 
        5  5778 1 1 40 THR HA   H  -6.083   3.285  54.235 1.00 . A A . 40 THR HA   1 1 
        5  5779 1 1 40 THR HB   H  -4.451   4.080  51.831 1.00 . A A . 40 THR HB   1 1 
        5  5780 1 1 40 THR HG1  H  -6.519   2.154  52.001 1.00 . A A . 40 THR HG1  1 1 
        5  5781 1 1 40 THR HG21 H  -3.289   2.081  52.244 1.00 . A A . 40 THR HG21 1 1 
        5  5782 1 1 40 THR HG22 H  -4.619   1.388  53.170 1.00 . A A . 40 THR HG22 1 1 
        5  5783 1 1 40 THR HG23 H  -3.633   2.669  53.871 1.00 . A A . 40 THR HG23 1 1 
        5  5784 1 1 40 THR N    N  -7.070   4.593  52.924 1.00 . A A . 40 THR N    1 1 
        5  5785 1 1 40 THR O    O  -3.867   4.848  54.662 1.00 . A A . 40 THR O    1 1 
        5  5786 1 1 40 THR OG1  O  -5.928   2.703  51.480 1.00 . A A . 40 THR OG1  1 1 
        5  5787 1 1 41 GLY C    C  -3.430   7.726  54.418 1.00 . A A . 41 GLY C    1 1 
        5  5788 1 1 41 GLY CA   C  -4.851   7.433  54.896 1.00 . A A . 41 GLY CA   1 1 
        5  5789 1 1 41 GLY H    H  -6.446   6.383  53.946 1.00 . A A . 41 GLY H    1 1 
        5  5790 1 1 41 GLY HA2  H  -5.447   8.323  54.768 1.00 . A A . 41 GLY HA2  1 1 
        5  5791 1 1 41 GLY HA3  H  -4.813   7.203  55.951 1.00 . A A . 41 GLY HA3  1 1 
        5  5792 1 1 41 GLY N    N  -5.506   6.310  54.211 1.00 . A A . 41 GLY N    1 1 
        5  5793 1 1 41 GLY O    O  -2.475   7.509  55.163 1.00 . A A . 41 GLY O    1 1 
        5  5794 1 1 42 TYR C    C  -1.834  10.115  52.552 1.00 . A A . 42 TYR C    1 1 
        5  5795 1 1 42 TYR CA   C  -1.952   8.590  52.670 1.00 . A A . 42 TYR CA   1 1 
        5  5796 1 1 42 TYR CB   C  -1.773   7.934  51.270 1.00 . A A . 42 TYR CB   1 1 
        5  5797 1 1 42 TYR CD1  C  -0.853   5.835  52.342 1.00 . A A . 42 TYR CD1  1 1 
        5  5798 1 1 42 TYR CD2  C   0.270   6.732  50.388 1.00 . A A . 42 TYR CD2  1 1 
        5  5799 1 1 42 TYR CE1  C   0.086   4.798  52.405 1.00 . A A . 42 TYR CE1  1 1 
        5  5800 1 1 42 TYR CE2  C   1.210   5.695  50.452 1.00 . A A . 42 TYR CE2  1 1 
        5  5801 1 1 42 TYR CG   C  -0.760   6.802  51.333 1.00 . A A . 42 TYR CG   1 1 
        5  5802 1 1 42 TYR CZ   C   1.117   4.728  51.460 1.00 . A A . 42 TYR CZ   1 1 
        5  5803 1 1 42 TYR H    H  -4.038   8.420  52.610 1.00 . A A . 42 TYR H    1 1 
        5  5804 1 1 42 TYR HA   H  -1.167   8.231  53.321 1.00 . A A . 42 TYR HA   1 1 
        5  5805 1 1 42 TYR HB2  H  -2.719   7.536  50.946 1.00 . A A . 42 TYR HB2  1 1 
        5  5806 1 1 42 TYR HB3  H  -1.438   8.671  50.551 1.00 . A A . 42 TYR HB3  1 1 
        5  5807 1 1 42 TYR HD1  H  -1.648   5.888  53.070 1.00 . A A . 42 TYR HD1  1 1 
        5  5808 1 1 42 TYR HD2  H   0.343   7.478  49.610 1.00 . A A . 42 TYR HD2  1 1 
        5  5809 1 1 42 TYR HE1  H   0.015   4.052  53.182 1.00 . A A . 42 TYR HE1  1 1 
        5  5810 1 1 42 TYR HE2  H   2.004   5.642  49.723 1.00 . A A . 42 TYR HE2  1 1 
        5  5811 1 1 42 TYR HH   H   2.545   3.810  52.334 1.00 . A A . 42 TYR HH   1 1 
        5  5812 1 1 42 TYR N    N  -3.274   8.246  53.199 1.00 . A A . 42 TYR N    1 1 
        5  5813 1 1 42 TYR O    O  -1.014  10.627  51.791 1.00 . A A . 42 TYR O    1 1 
        5  5814 1 1 42 TYR OH   O   2.042   3.706  51.522 1.00 . A A . 42 TYR OH   1 1 
        5  5815 1 1 43 LEU C    C  -1.310  12.908  53.351 1.00 . A A . 43 LEU C    1 1 
        5  5816 1 1 43 LEU CA   C  -2.704  12.289  53.268 1.00 . A A . 43 LEU CA   1 1 
        5  5817 1 1 43 LEU CB   C  -3.418  12.725  54.554 1.00 . A A . 43 LEU CB   1 1 
        5  5818 1 1 43 LEU CD1  C  -5.491  12.541  55.935 1.00 . A A . 43 LEU CD1  1 1 
        5  5819 1 1 43 LEU CD2  C  -5.692  12.813  53.448 1.00 . A A . 43 LEU CD2  1 1 
        5  5820 1 1 43 LEU CG   C  -4.858  12.189  54.585 1.00 . A A . 43 LEU CG   1 1 
        5  5821 1 1 43 LEU H    H  -3.324  10.372  53.871 1.00 . A A . 43 LEU H    1 1 
        5  5822 1 1 43 LEU HA   H  -3.300  12.682  52.459 1.00 . A A . 43 LEU HA   1 1 
        5  5823 1 1 43 LEU HB2  H  -2.877  12.340  55.406 1.00 . A A . 43 LEU HB2  1 1 
        5  5824 1 1 43 LEU HB3  H  -3.438  13.803  54.604 1.00 . A A . 43 LEU HB3  1 1 
        5  5825 1 1 43 LEU HD11 H  -5.408  13.604  56.105 1.00 . A A . 43 LEU HD11 1 1 
        5  5826 1 1 43 LEU HD12 H  -4.978  12.008  56.723 1.00 . A A . 43 LEU HD12 1 1 
        5  5827 1 1 43 LEU HD13 H  -6.533  12.258  55.929 1.00 . A A . 43 LEU HD13 1 1 
        5  5828 1 1 43 LEU HD21 H  -5.366  13.828  53.270 1.00 . A A . 43 LEU HD21 1 1 
        5  5829 1 1 43 LEU HD22 H  -6.738  12.815  53.719 1.00 . A A . 43 LEU HD22 1 1 
        5  5830 1 1 43 LEU HD23 H  -5.562  12.232  52.547 1.00 . A A . 43 LEU HD23 1 1 
        5  5831 1 1 43 LEU HG   H  -4.841  11.114  54.471 1.00 . A A . 43 LEU HG   1 1 
        5  5832 1 1 43 LEU N    N  -2.677  10.827  53.293 1.00 . A A . 43 LEU N    1 1 
        5  5833 1 1 43 LEU O    O  -0.902  13.688  52.491 1.00 . A A . 43 LEU O    1 1 
        5  5834 1 1 44 ASP C    C   1.693  12.473  53.531 1.00 . A A . 44 ASP C    1 1 
        5  5835 1 1 44 ASP CA   C   0.769  13.029  54.612 1.00 . A A . 44 ASP CA   1 1 
        5  5836 1 1 44 ASP CB   C   1.274  12.620  55.997 1.00 . A A . 44 ASP CB   1 1 
        5  5837 1 1 44 ASP CG   C   1.095  11.113  56.151 1.00 . A A . 44 ASP CG   1 1 
        5  5838 1 1 44 ASP H    H  -0.989  11.883  55.016 1.00 . A A . 44 ASP H    1 1 
        5  5839 1 1 44 ASP HA   H   0.765  14.102  54.510 1.00 . A A . 44 ASP HA   1 1 
        5  5840 1 1 44 ASP HB2  H   2.319  12.877  56.092 1.00 . A A . 44 ASP HB2  1 1 
        5  5841 1 1 44 ASP HB3  H   0.703  13.130  56.758 1.00 . A A . 44 ASP HB3  1 1 
        5  5842 1 1 44 ASP N    N  -0.589  12.532  54.401 1.00 . A A . 44 ASP N    1 1 
        5  5843 1 1 44 ASP O    O   2.596  13.165  53.059 1.00 . A A . 44 ASP O    1 1 
        5  5844 1 1 44 ASP OD1  O   0.046  10.633  55.756 1.00 . A A . 44 ASP OD1  1 1 
        5  5845 1 1 44 ASP OD2  O   2.024  10.455  56.590 1.00 . A A . 44 ASP OD2  1 1 
        5  5846 1 1 45 TYR C    C   2.298  11.321  50.820 1.00 . A A . 45 TYR C    1 1 
        5  5847 1 1 45 TYR CA   C   2.319  10.572  52.159 1.00 . A A . 45 TYR CA   1 1 
        5  5848 1 1 45 TYR CB   C   1.843   9.127  51.932 1.00 . A A . 45 TYR CB   1 1 
        5  5849 1 1 45 TYR CD1  C   1.729   8.039  54.215 1.00 . A A . 45 TYR CD1  1 1 
        5  5850 1 1 45 TYR CD2  C   3.560   7.467  52.732 1.00 . A A . 45 TYR CD2  1 1 
        5  5851 1 1 45 TYR CE1  C   2.228   7.150  55.174 1.00 . A A . 45 TYR CE1  1 1 
        5  5852 1 1 45 TYR CE2  C   4.059   6.579  53.691 1.00 . A A . 45 TYR CE2  1 1 
        5  5853 1 1 45 TYR CG   C   2.395   8.198  52.993 1.00 . A A . 45 TYR CG   1 1 
        5  5854 1 1 45 TYR CZ   C   3.393   6.420  54.913 1.00 . A A . 45 TYR CZ   1 1 
        5  5855 1 1 45 TYR H    H   0.778  10.701  53.614 1.00 . A A . 45 TYR H    1 1 
        5  5856 1 1 45 TYR HA   H   3.341  10.550  52.508 1.00 . A A . 45 TYR HA   1 1 
        5  5857 1 1 45 TYR HB2  H   0.766   9.100  51.966 1.00 . A A . 45 TYR HB2  1 1 
        5  5858 1 1 45 TYR HB3  H   2.174   8.785  50.960 1.00 . A A . 45 TYR HB3  1 1 
        5  5859 1 1 45 TYR HD1  H   0.834   8.604  54.419 1.00 . A A . 45 TYR HD1  1 1 
        5  5860 1 1 45 TYR HD2  H   4.074   7.590  51.789 1.00 . A A . 45 TYR HD2  1 1 
        5  5861 1 1 45 TYR HE1  H   1.714   7.028  56.116 1.00 . A A . 45 TYR HE1  1 1 
        5  5862 1 1 45 TYR HE2  H   4.958   6.015  53.489 1.00 . A A . 45 TYR HE2  1 1 
        5  5863 1 1 45 TYR HH   H   4.804   5.768  56.022 1.00 . A A . 45 TYR HH   1 1 
        5  5864 1 1 45 TYR N    N   1.479  11.217  53.163 1.00 . A A . 45 TYR N    1 1 
        5  5865 1 1 45 TYR O    O   3.351  11.474  50.215 1.00 . A A . 45 TYR O    1 1 
        5  5866 1 1 45 TYR OH   O   3.885   5.543  55.858 1.00 . A A . 45 TYR OH   1 1 
        5  5867 1 1 46 VAL C    C   2.229  12.861  48.371 1.00 . A A . 46 VAL C    1 1 
        5  5868 1 1 46 VAL CA   C   0.926  12.447  49.066 1.00 . A A . 46 VAL CA   1 1 
        5  5869 1 1 46 VAL CB   C   0.070  13.702  49.272 1.00 . A A . 46 VAL CB   1 1 
        5  5870 1 1 46 VAL CG1  C  -1.338  13.297  49.715 1.00 . A A . 46 VAL CG1  1 1 
        5  5871 1 1 46 VAL CG2  C   0.708  14.596  50.343 1.00 . A A . 46 VAL CG2  1 1 
        5  5872 1 1 46 VAL H    H   0.296  11.567  50.886 1.00 . A A . 46 VAL H    1 1 
        5  5873 1 1 46 VAL HA   H   0.392  11.797  48.394 1.00 . A A . 46 VAL HA   1 1 
        5  5874 1 1 46 VAL HB   H   0.007  14.247  48.340 1.00 . A A . 46 VAL HB   1 1 
        5  5875 1 1 46 VAL HG11 H  -1.885  12.910  48.868 1.00 . A A . 46 VAL HG11 1 1 
        5  5876 1 1 46 VAL HG12 H  -1.854  14.159  50.111 1.00 . A A . 46 VAL HG12 1 1 
        5  5877 1 1 46 VAL HG13 H  -1.270  12.537  50.476 1.00 . A A . 46 VAL HG13 1 1 
        5  5878 1 1 46 VAL HG21 H   1.558  15.111  49.922 1.00 . A A . 46 VAL HG21 1 1 
        5  5879 1 1 46 VAL HG22 H   1.030  13.991  51.177 1.00 . A A . 46 VAL HG22 1 1 
        5  5880 1 1 46 VAL HG23 H  -0.017  15.321  50.686 1.00 . A A . 46 VAL HG23 1 1 
        5  5881 1 1 46 VAL N    N   1.106  11.751  50.365 1.00 . A A . 46 VAL N    1 1 
        5  5882 1 1 46 VAL O    O   2.394  12.615  47.175 1.00 . A A . 46 VAL O    1 1 
        5  5883 1 1 47 LEU C    C   5.101  12.795  47.737 1.00 . A A . 47 LEU C    1 1 
        5  5884 1 1 47 LEU CA   C   4.385  13.946  48.480 1.00 . A A . 47 LEU CA   1 1 
        5  5885 1 1 47 LEU CB   C   5.295  14.495  49.598 1.00 . A A . 47 LEU CB   1 1 
        5  5886 1 1 47 LEU CD1  C   7.056  15.026  47.870 1.00 . A A . 47 LEU CD1  1 1 
        5  5887 1 1 47 LEU CD2  C   5.492  16.841  48.642 1.00 . A A . 47 LEU CD2  1 1 
        5  5888 1 1 47 LEU CG   C   6.264  15.571  49.063 1.00 . A A . 47 LEU CG   1 1 
        5  5889 1 1 47 LEU H    H   2.942  13.701  50.026 1.00 . A A . 47 LEU H    1 1 
        5  5890 1 1 47 LEU HA   H   4.158  14.752  47.801 1.00 . A A . 47 LEU HA   1 1 
        5  5891 1 1 47 LEU HB2  H   4.677  14.929  50.370 1.00 . A A . 47 LEU HB2  1 1 
        5  5892 1 1 47 LEU HB3  H   5.866  13.686  50.025 1.00 . A A . 47 LEU HB3  1 1 
        5  5893 1 1 47 LEU HD11 H   7.360  14.010  48.070 1.00 . A A . 47 LEU HD11 1 1 
        5  5894 1 1 47 LEU HD12 H   7.933  15.638  47.713 1.00 . A A . 47 LEU HD12 1 1 
        5  5895 1 1 47 LEU HD13 H   6.438  15.054  46.985 1.00 . A A . 47 LEU HD13 1 1 
        5  5896 1 1 47 LEU HD21 H   6.124  17.704  48.789 1.00 . A A . 47 LEU HD21 1 1 
        5  5897 1 1 47 LEU HD22 H   4.599  16.949  49.241 1.00 . A A . 47 LEU HD22 1 1 
        5  5898 1 1 47 LEU HD23 H   5.215  16.781  47.598 1.00 . A A . 47 LEU HD23 1 1 
        5  5899 1 1 47 LEU HG   H   6.960  15.829  49.849 1.00 . A A . 47 LEU HG   1 1 
        5  5900 1 1 47 LEU N    N   3.132  13.499  49.086 1.00 . A A . 47 LEU N    1 1 
        5  5901 1 1 47 LEU O    O   5.538  12.943  46.596 1.00 . A A . 47 LEU O    1 1 
        5  5902 1 1 48 LEU C    C   5.252   9.913  46.590 1.00 . A A . 48 LEU C    1 1 
        5  5903 1 1 48 LEU CA   C   5.923  10.486  47.861 1.00 . A A . 48 LEU CA   1 1 
        5  5904 1 1 48 LEU CB   C   6.085   9.392  48.933 1.00 . A A . 48 LEU CB   1 1 
        5  5905 1 1 48 LEU CD1  C   7.078  11.053  50.527 1.00 . A A . 48 LEU CD1  1 1 
        5  5906 1 1 48 LEU CD2  C   7.437   8.603  50.884 1.00 . A A . 48 LEU CD2  1 1 
        5  5907 1 1 48 LEU CG   C   7.288   9.706  49.832 1.00 . A A . 48 LEU CG   1 1 
        5  5908 1 1 48 LEU H    H   4.849  11.647  49.327 1.00 . A A . 48 LEU H    1 1 
        5  5909 1 1 48 LEU HA   H   6.905  10.807  47.544 1.00 . A A . 48 LEU HA   1 1 
        5  5910 1 1 48 LEU HB2  H   5.195   9.353  49.541 1.00 . A A . 48 LEU HB2  1 1 
        5  5911 1 1 48 LEU HB3  H   6.239   8.434  48.458 1.00 . A A . 48 LEU HB3  1 1 
        5  5912 1 1 48 LEU HD11 H   7.758  11.138  51.363 1.00 . A A . 48 LEU HD11 1 1 
        5  5913 1 1 48 LEU HD12 H   6.060  11.123  50.881 1.00 . A A . 48 LEU HD12 1 1 
        5  5914 1 1 48 LEU HD13 H   7.272  11.849  49.826 1.00 . A A . 48 LEU HD13 1 1 
        5  5915 1 1 48 LEU HD21 H   7.319   7.638  50.415 1.00 . A A . 48 LEU HD21 1 1 
        5  5916 1 1 48 LEU HD22 H   6.684   8.728  51.647 1.00 . A A . 48 LEU HD22 1 1 
        5  5917 1 1 48 LEU HD23 H   8.418   8.667  51.334 1.00 . A A . 48 LEU HD23 1 1 
        5  5918 1 1 48 LEU HG   H   8.184   9.751  49.228 1.00 . A A . 48 LEU HG   1 1 
        5  5919 1 1 48 LEU N    N   5.232  11.661  48.425 1.00 . A A . 48 LEU N    1 1 
        5  5920 1 1 48 LEU O    O   5.910   9.826  45.553 1.00 . A A . 48 LEU O    1 1 
        5  5921 1 1 49 PRO C    C   3.237   9.958  44.247 1.00 . A A . 49 PRO C    1 1 
        5  5922 1 1 49 PRO CA   C   3.328   8.949  45.397 1.00 . A A . 49 PRO CA   1 1 
        5  5923 1 1 49 PRO CB   C   1.931   8.545  45.905 1.00 . A A . 49 PRO CB   1 1 
        5  5924 1 1 49 PRO CD   C   3.088   9.543  47.758 1.00 . A A . 49 PRO CD   1 1 
        5  5925 1 1 49 PRO CG   C   1.713   9.389  47.114 1.00 . A A . 49 PRO CG   1 1 
        5  5926 1 1 49 PRO HA   H   3.856   8.068  45.066 1.00 . A A . 49 PRO HA   1 1 
        5  5927 1 1 49 PRO HB2  H   1.175   8.747  45.155 1.00 . A A . 49 PRO HB2  1 1 
        5  5928 1 1 49 PRO HB3  H   1.916   7.499  46.178 1.00 . A A . 49 PRO HB3  1 1 
        5  5929 1 1 49 PRO HD2  H   3.158  10.476  48.270 1.00 . A A . 49 PRO HD2  1 1 
        5  5930 1 1 49 PRO HD3  H   3.291   8.718  48.419 1.00 . A A . 49 PRO HD3  1 1 
        5  5931 1 1 49 PRO HG2  H   1.322  10.356  46.824 1.00 . A A . 49 PRO HG2  1 1 
        5  5932 1 1 49 PRO HG3  H   1.039   8.902  47.803 1.00 . A A . 49 PRO HG3  1 1 
        5  5933 1 1 49 PRO N    N   4.000   9.516  46.613 1.00 . A A . 49 PRO N    1 1 
        5  5934 1 1 49 PRO O    O   3.241   9.569  43.079 1.00 . A A . 49 PRO O    1 1 
        5  5935 1 1 50 ALA C    C   4.504  12.485  42.897 1.00 . A A . 50 ALA C    1 1 
        5  5936 1 1 50 ALA CA   C   3.141  12.295  43.554 1.00 . A A . 50 ALA CA   1 1 
        5  5937 1 1 50 ALA CB   C   2.680  13.614  44.179 1.00 . A A . 50 ALA CB   1 1 
        5  5938 1 1 50 ALA H    H   3.237  11.538  45.507 1.00 . A A . 50 ALA H    1 1 
        5  5939 1 1 50 ALA HA   H   2.458  12.026  42.764 1.00 . A A . 50 ALA HA   1 1 
        5  5940 1 1 50 ALA HB1  H   3.476  14.023  44.782 1.00 . A A . 50 ALA HB1  1 1 
        5  5941 1 1 50 ALA HB2  H   1.814  13.435  44.799 1.00 . A A . 50 ALA HB2  1 1 
        5  5942 1 1 50 ALA HB3  H   2.425  14.313  43.396 1.00 . A A . 50 ALA HB3  1 1 
        5  5943 1 1 50 ALA N    N   3.191  11.247  44.572 1.00 . A A . 50 ALA N    1 1 
        5  5944 1 1 50 ALA O    O   4.586  12.841  41.722 1.00 . A A . 50 ALA O    1 1 
        5  5945 1 1 51 LEU C    C   7.152  11.355  42.007 1.00 . A A . 51 LEU C    1 1 
        5  5946 1 1 51 LEU CA   C   6.915  12.387  43.106 1.00 . A A . 51 LEU CA   1 1 
        5  5947 1 1 51 LEU CB   C   7.947  12.205  44.227 1.00 . A A . 51 LEU CB   1 1 
        5  5948 1 1 51 LEU CD1  C   9.570  13.758  43.075 1.00 . A A . 51 LEU CD1  1 1 
        5  5949 1 1 51 LEU CD2  C  10.369  12.151  44.829 1.00 . A A . 51 LEU CD2  1 1 
        5  5950 1 1 51 LEU CG   C   9.375  12.358  43.680 1.00 . A A . 51 LEU CG   1 1 
        5  5951 1 1 51 LEU H    H   5.460  11.931  44.572 1.00 . A A . 51 LEU H    1 1 
        5  5952 1 1 51 LEU HA   H   7.017  13.377  42.692 1.00 . A A . 51 LEU HA   1 1 
        5  5953 1 1 51 LEU HB2  H   7.776  12.950  44.990 1.00 . A A . 51 LEU HB2  1 1 
        5  5954 1 1 51 LEU HB3  H   7.835  11.222  44.659 1.00 . A A . 51 LEU HB3  1 1 
        5  5955 1 1 51 LEU HD11 H   9.021  14.486  43.657 1.00 . A A . 51 LEU HD11 1 1 
        5  5956 1 1 51 LEU HD12 H   9.208  13.764  42.059 1.00 . A A . 51 LEU HD12 1 1 
        5  5957 1 1 51 LEU HD13 H  10.620  14.015  43.079 1.00 . A A . 51 LEU HD13 1 1 
        5  5958 1 1 51 LEU HD21 H  10.323  12.995  45.501 1.00 . A A . 51 LEU HD21 1 1 
        5  5959 1 1 51 LEU HD22 H  11.368  12.062  44.430 1.00 . A A . 51 LEU HD22 1 1 
        5  5960 1 1 51 LEU HD23 H  10.115  11.248  45.367 1.00 . A A . 51 LEU HD23 1 1 
        5  5961 1 1 51 LEU HG   H   9.552  11.612  42.919 1.00 . A A . 51 LEU HG   1 1 
        5  5962 1 1 51 LEU N    N   5.570  12.241  43.648 1.00 . A A . 51 LEU N    1 1 
        5  5963 1 1 51 LEU O    O   7.715  11.659  40.959 1.00 . A A . 51 LEU O    1 1 
        5  5964 1 1 52 ALA C    C   6.123   9.465  39.980 1.00 . A A . 52 ALA C    1 1 
        5  5965 1 1 52 ALA CA   C   6.831   9.071  41.274 1.00 . A A . 52 ALA CA   1 1 
        5  5966 1 1 52 ALA CB   C   6.241   7.768  41.817 1.00 . A A . 52 ALA CB   1 1 
        5  5967 1 1 52 ALA H    H   6.205   9.997  43.096 1.00 . A A . 52 ALA H    1 1 
        5  5968 1 1 52 ALA HA   H   7.877   8.924  41.051 1.00 . A A . 52 ALA HA   1 1 
        5  5969 1 1 52 ALA HB1  H   5.163   7.828  41.805 1.00 . A A . 52 ALA HB1  1 1 
        5  5970 1 1 52 ALA HB2  H   6.582   7.613  42.830 1.00 . A A . 52 ALA HB2  1 1 
        5  5971 1 1 52 ALA HB3  H   6.563   6.942  41.199 1.00 . A A . 52 ALA HB3  1 1 
        5  5972 1 1 52 ALA N    N   6.687  10.140  42.255 1.00 . A A . 52 ALA N    1 1 
        5  5973 1 1 52 ALA O    O   6.649   9.251  38.887 1.00 . A A . 52 ALA O    1 1 
        5  5974 1 1 53 ILE C    C   4.939  11.573  38.161 1.00 . A A . 53 ILE C    1 1 
        5  5975 1 1 53 ILE CA   C   4.188  10.480  38.929 1.00 . A A . 53 ILE CA   1 1 
        5  5976 1 1 53 ILE CB   C   2.806  10.990  39.350 1.00 . A A . 53 ILE CB   1 1 
        5  5977 1 1 53 ILE CD1  C   0.703  10.339  40.550 1.00 . A A . 53 ILE CD1  1 1 
        5  5978 1 1 53 ILE CG1  C   1.983   9.817  39.893 1.00 . A A . 53 ILE CG1  1 1 
        5  5979 1 1 53 ILE CG2  C   2.085  11.596  38.141 1.00 . A A . 53 ILE CG2  1 1 
        5  5980 1 1 53 ILE H    H   4.571  10.198  41.002 1.00 . A A . 53 ILE H    1 1 
        5  5981 1 1 53 ILE HA   H   4.060   9.661  38.237 1.00 . A A . 53 ILE HA   1 1 
        5  5982 1 1 53 ILE HB   H   2.920  11.742  40.117 1.00 . A A . 53 ILE HB   1 1 
        5  5983 1 1 53 ILE HD11 H   0.010  10.656  39.785 1.00 . A A . 53 ILE HD11 1 1 
        5  5984 1 1 53 ILE HD12 H   0.938  11.174  41.192 1.00 . A A . 53 ILE HD12 1 1 
        5  5985 1 1 53 ILE HD13 H   0.253   9.551  41.136 1.00 . A A . 53 ILE HD13 1 1 
        5  5986 1 1 53 ILE HG12 H   1.725   9.153  39.080 1.00 . A A . 53 ILE HG12 1 1 
        5  5987 1 1 53 ILE HG13 H   2.566   9.278  40.625 1.00 . A A . 53 ILE HG13 1 1 
        5  5988 1 1 53 ILE HG21 H   1.041  11.739  38.377 1.00 . A A . 53 ILE HG21 1 1 
        5  5989 1 1 53 ILE HG22 H   2.176  10.930  37.296 1.00 . A A . 53 ILE HG22 1 1 
        5  5990 1 1 53 ILE HG23 H   2.532  12.549  37.897 1.00 . A A . 53 ILE HG23 1 1 
        5  5991 1 1 53 ILE N    N   4.939  10.052  40.106 1.00 . A A . 53 ILE N    1 1 
        5  5992 1 1 53 ILE O    O   5.120  11.451  36.950 1.00 . A A . 53 ILE O    1 1 
        5  5993 1 1 54 PHE C    C   7.376  13.197  37.496 1.00 . A A . 54 PHE C    1 1 
        5  5994 1 1 54 PHE CA   C   6.096  13.711  38.150 1.00 . A A . 54 PHE CA   1 1 
        5  5995 1 1 54 PHE CB   C   6.431  14.828  39.140 1.00 . A A . 54 PHE CB   1 1 
        5  5996 1 1 54 PHE CD1  C   6.403  16.894  37.697 1.00 . A A . 54 PHE CD1  1 1 
        5  5997 1 1 54 PHE CD2  C   8.537  16.048  38.477 1.00 . A A . 54 PHE CD2  1 1 
        5  5998 1 1 54 PHE CE1  C   7.059  17.937  37.032 1.00 . A A . 54 PHE CE1  1 1 
        5  5999 1 1 54 PHE CE2  C   9.194  17.091  37.813 1.00 . A A . 54 PHE CE2  1 1 
        5  6000 1 1 54 PHE CG   C   7.142  15.950  38.419 1.00 . A A . 54 PHE CG   1 1 
        5  6001 1 1 54 PHE CZ   C   8.454  18.035  37.091 1.00 . A A . 54 PHE CZ   1 1 
        5  6002 1 1 54 PHE H    H   5.214  12.742  39.794 1.00 . A A . 54 PHE H    1 1 
        5  6003 1 1 54 PHE HA   H   5.472  14.113  37.367 1.00 . A A . 54 PHE HA   1 1 
        5  6004 1 1 54 PHE HB2  H   5.520  15.204  39.580 1.00 . A A . 54 PHE HB2  1 1 
        5  6005 1 1 54 PHE HB3  H   7.072  14.438  39.917 1.00 . A A . 54 PHE HB3  1 1 
        5  6006 1 1 54 PHE HD1  H   5.327  16.817  37.652 1.00 . A A . 54 PHE HD1  1 1 
        5  6007 1 1 54 PHE HD2  H   9.107  15.319  39.035 1.00 . A A . 54 PHE HD2  1 1 
        5  6008 1 1 54 PHE HE1  H   6.490  18.665  36.475 1.00 . A A . 54 PHE HE1  1 1 
        5  6009 1 1 54 PHE HE2  H  10.270  17.168  37.858 1.00 . A A . 54 PHE HE2  1 1 
        5  6010 1 1 54 PHE HZ   H   8.961  18.840  36.578 1.00 . A A . 54 PHE HZ   1 1 
        5  6011 1 1 54 PHE N    N   5.377  12.636  38.835 1.00 . A A . 54 PHE N    1 1 
        5  6012 1 1 54 PHE O    O   7.683  13.560  36.360 1.00 . A A . 54 PHE O    1 1 
        5  6013 1 1 55 ILE C    C   8.969  10.913  36.413 1.00 . A A . 55 ILE C    1 1 
        5  6014 1 1 55 ILE CA   C   9.324  11.768  37.626 1.00 . A A . 55 ILE CA   1 1 
        5  6015 1 1 55 ILE CB   C  10.039  10.904  38.679 1.00 . A A . 55 ILE CB   1 1 
        5  6016 1 1 55 ILE CD1  C  11.646  12.805  39.263 1.00 . A A . 55 ILE CD1  1 1 
        5  6017 1 1 55 ILE CG1  C  10.612  11.798  39.803 1.00 . A A . 55 ILE CG1  1 1 
        5  6018 1 1 55 ILE CG2  C  11.168  10.096  38.028 1.00 . A A . 55 ILE CG2  1 1 
        5  6019 1 1 55 ILE H    H   7.800  12.035  39.073 1.00 . A A . 55 ILE H    1 1 
        5  6020 1 1 55 ILE HA   H   9.980  12.575  37.339 1.00 . A A . 55 ILE HA   1 1 
        5  6021 1 1 55 ILE HB   H   9.323  10.217  39.107 1.00 . A A . 55 ILE HB   1 1 
        5  6022 1 1 55 ILE HD11 H  12.096  12.435  38.354 1.00 . A A . 55 ILE HD11 1 1 
        5  6023 1 1 55 ILE HD12 H  12.416  12.957  40.004 1.00 . A A . 55 ILE HD12 1 1 
        5  6024 1 1 55 ILE HD13 H  11.155  13.745  39.061 1.00 . A A . 55 ILE HD13 1 1 
        5  6025 1 1 55 ILE HG12 H   9.806  12.344  40.264 1.00 . A A . 55 ILE HG12 1 1 
        5  6026 1 1 55 ILE HG13 H  11.084  11.172  40.545 1.00 . A A . 55 ILE HG13 1 1 
        5  6027 1 1 55 ILE HG21 H  11.836   9.727  38.793 1.00 . A A . 55 ILE HG21 1 1 
        5  6028 1 1 55 ILE HG22 H  11.717  10.728  37.346 1.00 . A A . 55 ILE HG22 1 1 
        5  6029 1 1 55 ILE HG23 H  10.748   9.262  37.486 1.00 . A A . 55 ILE HG23 1 1 
        5  6030 1 1 55 ILE N    N   8.105  12.335  38.191 1.00 . A A . 55 ILE N    1 1 
        5  6031 1 1 55 ILE O    O   9.634  10.948  35.377 1.00 . A A . 55 ILE O    1 1 
        5  6032 1 1 56 GLY C    C   6.896  10.107  34.315 1.00 . A A . 56 GLY C    1 1 
        5  6033 1 1 56 GLY CA   C   7.379   9.293  35.517 1.00 . A A . 56 GLY CA   1 1 
        5  6034 1 1 56 GLY H    H   7.395  10.239  37.418 1.00 . A A . 56 GLY H    1 1 
        5  6035 1 1 56 GLY HA2  H   8.161   8.619  35.204 1.00 . A A . 56 GLY HA2  1 1 
        5  6036 1 1 56 GLY HA3  H   6.551   8.716  35.902 1.00 . A A . 56 GLY HA3  1 1 
        5  6037 1 1 56 GLY N    N   7.885  10.160  36.573 1.00 . A A . 56 GLY N    1 1 
        5  6038 1 1 56 GLY O    O   7.100   9.724  33.166 1.00 . A A . 56 GLY O    1 1 
        5  6039 1 1 57 LEU C    C   6.770  12.838  32.785 1.00 . A A . 57 LEU C    1 1 
        5  6040 1 1 57 LEU CA   C   5.680  12.085  33.554 1.00 . A A . 57 LEU CA   1 1 
        5  6041 1 1 57 LEU CB   C   4.709  13.091  34.190 1.00 . A A . 57 LEU CB   1 1 
        5  6042 1 1 57 LEU CD1  C   3.285  13.139  32.105 1.00 . A A . 57 LEU CD1  1 1 
        5  6043 1 1 57 LEU CD2  C   3.124  14.980  33.802 1.00 . A A . 57 LEU CD2  1 1 
        5  6044 1 1 57 LEU CG   C   4.072  13.990  33.116 1.00 . A A . 57 LEU CG   1 1 
        5  6045 1 1 57 LEU H    H   6.075  11.467  35.534 1.00 . A A . 57 LEU H    1 1 
        5  6046 1 1 57 LEU HA   H   5.125  11.463  32.872 1.00 . A A . 57 LEU HA   1 1 
        5  6047 1 1 57 LEU HB2  H   3.931  12.551  34.710 1.00 . A A . 57 LEU HB2  1 1 
        5  6048 1 1 57 LEU HB3  H   5.247  13.706  34.895 1.00 . A A . 57 LEU HB3  1 1 
        5  6049 1 1 57 LEU HD11 H   3.960  12.765  31.349 1.00 . A A . 57 LEU HD11 1 1 
        5  6050 1 1 57 LEU HD12 H   2.524  13.744  31.632 1.00 . A A . 57 LEU HD12 1 1 
        5  6051 1 1 57 LEU HD13 H   2.817  12.308  32.613 1.00 . A A . 57 LEU HD13 1 1 
        5  6052 1 1 57 LEU HD21 H   2.477  14.445  34.482 1.00 . A A . 57 LEU HD21 1 1 
        5  6053 1 1 57 LEU HD22 H   2.526  15.482  33.056 1.00 . A A . 57 LEU HD22 1 1 
        5  6054 1 1 57 LEU HD23 H   3.700  15.709  34.352 1.00 . A A . 57 LEU HD23 1 1 
        5  6055 1 1 57 LEU HG   H   4.845  14.539  32.597 1.00 . A A . 57 LEU HG   1 1 
        5  6056 1 1 57 LEU N    N   6.228  11.220  34.598 1.00 . A A . 57 LEU N    1 1 
        5  6057 1 1 57 LEU O    O   6.609  13.137  31.601 1.00 . A A . 57 LEU O    1 1 
        5  6058 1 1 58 THR C    C   9.725  12.981  31.827 1.00 . A A . 58 THR C    1 1 
        5  6059 1 1 58 THR CA   C   8.980  13.862  32.831 1.00 . A A . 58 THR CA   1 1 
        5  6060 1 1 58 THR CB   C   9.957  14.359  33.900 1.00 . A A . 58 THR CB   1 1 
        5  6061 1 1 58 THR CG2  C  11.112  15.107  33.233 1.00 . A A . 58 THR CG2  1 1 
        5  6062 1 1 58 THR H    H   7.967  12.834  34.387 1.00 . A A . 58 THR H    1 1 
        5  6063 1 1 58 THR HA   H   8.585  14.714  32.301 1.00 . A A . 58 THR HA   1 1 
        5  6064 1 1 58 THR HB   H  10.348  13.517  34.450 1.00 . A A . 58 THR HB   1 1 
        5  6065 1 1 58 THR HG1  H   9.895  15.907  35.076 1.00 . A A . 58 THR HG1  1 1 
        5  6066 1 1 58 THR HG21 H  11.649  15.675  33.978 1.00 . A A . 58 THR HG21 1 1 
        5  6067 1 1 58 THR HG22 H  10.722  15.776  32.480 1.00 . A A . 58 THR HG22 1 1 
        5  6068 1 1 58 THR HG23 H  11.782  14.397  32.771 1.00 . A A . 58 THR HG23 1 1 
        5  6069 1 1 58 THR N    N   7.873  13.143  33.461 1.00 . A A . 58 THR N    1 1 
        5  6070 1 1 58 THR O    O  10.081  13.427  30.737 1.00 . A A . 58 THR O    1 1 
        5  6071 1 1 58 THR OG1  O   9.274  15.233  34.789 1.00 . A A . 58 THR OG1  1 1 
        5  6072 1 1 59 ILE C    C   9.749  10.575  30.052 1.00 . A A . 59 ILE C    1 1 
        5  6073 1 1 59 ILE CA   C  10.608  10.795  31.299 1.00 . A A . 59 ILE CA   1 1 
        5  6074 1 1 59 ILE CB   C  10.934   9.470  31.997 1.00 . A A . 59 ILE CB   1 1 
        5  6075 1 1 59 ILE CD1  C   9.947   7.468  33.127 1.00 . A A . 59 ILE CD1  1 1 
        5  6076 1 1 59 ILE CG1  C   9.670   8.887  32.623 1.00 . A A . 59 ILE CG1  1 1 
        5  6077 1 1 59 ILE CG2  C  11.972   9.716  33.092 1.00 . A A . 59 ILE CG2  1 1 
        5  6078 1 1 59 ILE H    H   9.558  11.443  33.061 1.00 . A A . 59 ILE H    1 1 
        5  6079 1 1 59 ILE HA   H  11.529  11.249  30.967 1.00 . A A . 59 ILE HA   1 1 
        5  6080 1 1 59 ILE HB   H  11.334   8.777  31.271 1.00 . A A . 59 ILE HB   1 1 
        5  6081 1 1 59 ILE HD11 H   9.010   6.970  33.332 1.00 . A A . 59 ILE HD11 1 1 
        5  6082 1 1 59 ILE HD12 H  10.533   7.516  34.033 1.00 . A A . 59 ILE HD12 1 1 
        5  6083 1 1 59 ILE HD13 H  10.490   6.915  32.376 1.00 . A A . 59 ILE HD13 1 1 
        5  6084 1 1 59 ILE HG12 H   9.373   9.510  33.450 1.00 . A A . 59 ILE HG12 1 1 
        5  6085 1 1 59 ILE HG13 H   8.880   8.859  31.889 1.00 . A A . 59 ILE HG13 1 1 
        5  6086 1 1 59 ILE HG21 H  12.838  10.201  32.665 1.00 . A A . 59 ILE HG21 1 1 
        5  6087 1 1 59 ILE HG22 H  12.268   8.771  33.527 1.00 . A A . 59 ILE HG22 1 1 
        5  6088 1 1 59 ILE HG23 H  11.546  10.347  33.858 1.00 . A A . 59 ILE HG23 1 1 
        5  6089 1 1 59 ILE N    N   9.931  11.725  32.199 1.00 . A A . 59 ILE N    1 1 
        5  6090 1 1 59 ILE O    O  10.273  10.468  28.949 1.00 . A A . 59 ILE O    1 1 
        5  6091 1 1 60 TYR C    C   7.842  11.292  27.939 1.00 . A A . 60 TYR C    1 1 
        5  6092 1 1 60 TYR CA   C   7.535  10.313  29.082 1.00 . A A . 60 TYR CA   1 1 
        5  6093 1 1 60 TYR CB   C   6.052  10.426  29.530 1.00 . A A . 60 TYR CB   1 1 
        5  6094 1 1 60 TYR CD1  C   5.058   8.410  28.387 1.00 . A A . 60 TYR CD1  1 1 
        5  6095 1 1 60 TYR CD2  C   5.200   8.408  30.808 1.00 . A A . 60 TYR CD2  1 1 
        5  6096 1 1 60 TYR CE1  C   4.486   7.134  28.419 1.00 . A A . 60 TYR CE1  1 1 
        5  6097 1 1 60 TYR CE2  C   4.627   7.130  30.839 1.00 . A A . 60 TYR CE2  1 1 
        5  6098 1 1 60 TYR CG   C   5.415   9.048  29.582 1.00 . A A . 60 TYR CG   1 1 
        5  6099 1 1 60 TYR CZ   C   4.270   6.494  29.645 1.00 . A A . 60 TYR CZ   1 1 
        5  6100 1 1 60 TYR H    H   8.053  10.569  31.122 1.00 . A A . 60 TYR H    1 1 
        5  6101 1 1 60 TYR HA   H   7.710   9.320  28.692 1.00 . A A . 60 TYR HA   1 1 
        5  6102 1 1 60 TYR HB2  H   6.012  10.871  30.513 1.00 . A A . 60 TYR HB2  1 1 
        5  6103 1 1 60 TYR HB3  H   5.498  11.046  28.838 1.00 . A A . 60 TYR HB3  1 1 
        5  6104 1 1 60 TYR HD1  H   5.224   8.905  27.442 1.00 . A A . 60 TYR HD1  1 1 
        5  6105 1 1 60 TYR HD2  H   5.472   8.898  31.728 1.00 . A A . 60 TYR HD2  1 1 
        5  6106 1 1 60 TYR HE1  H   4.211   6.642  27.498 1.00 . A A . 60 TYR HE1  1 1 
        5  6107 1 1 60 TYR HE2  H   4.461   6.636  31.786 1.00 . A A . 60 TYR HE2  1 1 
        5  6108 1 1 60 TYR HH   H   3.823   4.879  30.560 1.00 . A A . 60 TYR HH   1 1 
        5  6109 1 1 60 TYR N    N   8.433  10.515  30.221 1.00 . A A . 60 TYR N    1 1 
        5  6110 1 1 60 TYR O    O   7.665  10.951  26.778 1.00 . A A . 60 TYR O    1 1 
        5  6111 1 1 60 TYR OH   O   3.706   5.234  29.677 1.00 . A A . 60 TYR OH   1 1 
        5  6112 1 1 61 ALA C    C   9.930  13.137  26.451 1.00 . A A . 61 ALA C    1 1 
        5  6113 1 1 61 ALA CA   C   8.642  13.479  27.218 1.00 . A A . 61 ALA CA   1 1 
        5  6114 1 1 61 ALA CB   C   8.777  14.865  27.849 1.00 . A A . 61 ALA CB   1 1 
        5  6115 1 1 61 ALA H    H   8.478  12.762  29.173 1.00 . A A . 61 ALA H    1 1 
        5  6116 1 1 61 ALA HA   H   7.881  13.523  26.455 1.00 . A A . 61 ALA HA   1 1 
        5  6117 1 1 61 ALA HB1  H   9.726  14.936  28.362 1.00 . A A . 61 ALA HB1  1 1 
        5  6118 1 1 61 ALA HB2  H   7.974  15.018  28.556 1.00 . A A . 61 ALA HB2  1 1 
        5  6119 1 1 61 ALA HB3  H   8.727  15.620  27.078 1.00 . A A . 61 ALA HB3  1 1 
        5  6120 1 1 61 ALA N    N   8.305  12.493  28.247 1.00 . A A . 61 ALA N    1 1 
        5  6121 1 1 61 ALA O    O  10.079  13.555  25.303 1.00 . A A . 61 ALA O    1 1 
        5  6122 1 1 62 ILE C    C  11.862  10.987  25.260 1.00 . A A . 62 ILE C    1 1 
        5  6123 1 1 62 ILE CA   C  12.101  12.062  26.333 1.00 . A A . 62 ILE CA   1 1 
        5  6124 1 1 62 ILE CB   C  13.208  11.616  27.322 1.00 . A A . 62 ILE CB   1 1 
        5  6125 1 1 62 ILE CD1  C  13.914   9.225  26.795 1.00 . A A . 62 ILE CD1  1 1 
        5  6126 1 1 62 ILE CG1  C  13.060  10.118  27.713 1.00 . A A . 62 ILE CG1  1 1 
        5  6127 1 1 62 ILE CG2  C  13.137  12.489  28.582 1.00 . A A . 62 ILE CG2  1 1 
        5  6128 1 1 62 ILE H    H  10.700  12.035  27.947 1.00 . A A . 62 ILE H    1 1 
        5  6129 1 1 62 ILE HA   H  12.447  12.965  25.847 1.00 . A A . 62 ILE HA   1 1 
        5  6130 1 1 62 ILE HB   H  14.173  11.772  26.855 1.00 . A A . 62 ILE HB   1 1 
        5  6131 1 1 62 ILE HD11 H  14.892   9.094  27.232 1.00 . A A . 62 ILE HD11 1 1 
        5  6132 1 1 62 ILE HD12 H  14.017   9.681  25.821 1.00 . A A . 62 ILE HD12 1 1 
        5  6133 1 1 62 ILE HD13 H  13.439   8.261  26.690 1.00 . A A . 62 ILE HD13 1 1 
        5  6134 1 1 62 ILE HG12 H  13.387   9.974  28.733 1.00 . A A . 62 ILE HG12 1 1 
        5  6135 1 1 62 ILE HG13 H  12.032   9.821  27.635 1.00 . A A . 62 ILE HG13 1 1 
        5  6136 1 1 62 ILE HG21 H  13.889  12.164  29.286 1.00 . A A . 62 ILE HG21 1 1 
        5  6137 1 1 62 ILE HG22 H  12.161  12.399  29.035 1.00 . A A . 62 ILE HG22 1 1 
        5  6138 1 1 62 ILE HG23 H  13.317  13.520  28.316 1.00 . A A . 62 ILE HG23 1 1 
        5  6139 1 1 62 ILE N    N  10.862  12.396  27.050 1.00 . A A . 62 ILE N    1 1 
        5  6140 1 1 62 ILE O    O  12.454  11.025  24.180 1.00 . A A . 62 ILE O    1 1 
        5  6141 1 1 63 GLN C    C  10.026   9.521  23.373 1.00 . A A . 63 GLN C    1 1 
        5  6142 1 1 63 GLN CA   C  10.666   8.954  24.642 1.00 . A A . 63 GLN CA   1 1 
        5  6143 1 1 63 GLN CB   C   9.745   7.903  25.302 1.00 . A A . 63 GLN CB   1 1 
        5  6144 1 1 63 GLN CD   C   7.664   7.875  23.854 1.00 . A A . 63 GLN CD   1 1 
        5  6145 1 1 63 GLN CG   C   8.263   8.321  25.191 1.00 . A A . 63 GLN CG   1 1 
        5  6146 1 1 63 GLN H    H  10.547  10.113  26.449 1.00 . A A . 63 GLN H    1 1 
        5  6147 1 1 63 GLN HA   H  11.580   8.475  24.321 1.00 . A A . 63 GLN HA   1 1 
        5  6148 1 1 63 GLN HB2  H   9.889   6.945  24.824 1.00 . A A . 63 GLN HB2  1 1 
        5  6149 1 1 63 GLN HB3  H  10.009   7.816  26.346 1.00 . A A . 63 GLN HB3  1 1 
        5  6150 1 1 63 GLN HE21 H   9.354   7.102  23.157 1.00 . A A . 63 GLN HE21 1 1 
        5  6151 1 1 63 GLN HE22 H   8.021   6.987  22.116 1.00 . A A . 63 GLN HE22 1 1 
        5  6152 1 1 63 GLN HG2  H   7.703   7.871  25.996 1.00 . A A . 63 GLN HG2  1 1 
        5  6153 1 1 63 GLN HG3  H   8.191   9.388  25.264 1.00 . A A . 63 GLN HG3  1 1 
        5  6154 1 1 63 GLN N    N  10.988  10.036  25.577 1.00 . A A . 63 GLN N    1 1 
        5  6155 1 1 63 GLN NE2  N   8.409   7.271  22.970 1.00 . A A . 63 GLN NE2  1 1 
        5  6156 1 1 63 GLN O    O  10.261   9.007  22.278 1.00 . A A . 63 GLN O    1 1 
        5  6157 1 1 63 GLN OE1  O   6.479   8.108  23.611 1.00 . A A . 63 GLN OE1  1 1 
        5  6158 1 1 64 ARG C    C   9.804  11.743  21.438 1.00 . A A . 64 ARG C    1 1 
        5  6159 1 1 64 ARG CA   C   8.678  11.200  22.312 1.00 . A A . 64 ARG CA   1 1 
        5  6160 1 1 64 ARG CB   C   7.725  12.331  22.695 1.00 . A A . 64 ARG CB   1 1 
        5  6161 1 1 64 ARG CD   C   5.535  12.862  23.766 1.00 . A A . 64 ARG CD   1 1 
        5  6162 1 1 64 ARG CG   C   6.528  11.748  23.445 1.00 . A A . 64 ARG CG   1 1 
        5  6163 1 1 64 ARG CZ   C   3.961  12.753  21.921 1.00 . A A . 64 ARG CZ   1 1 
        5  6164 1 1 64 ARG H    H   9.150  10.996  24.391 1.00 . A A . 64 ARG H    1 1 
        5  6165 1 1 64 ARG HA   H   8.148  10.469  21.720 1.00 . A A . 64 ARG HA   1 1 
        5  6166 1 1 64 ARG HB2  H   8.240  13.037  23.330 1.00 . A A . 64 ARG HB2  1 1 
        5  6167 1 1 64 ARG HB3  H   7.380  12.831  21.803 1.00 . A A . 64 ARG HB3  1 1 
        5  6168 1 1 64 ARG HD2  H   4.751  12.470  24.393 1.00 . A A . 64 ARG HD2  1 1 
        5  6169 1 1 64 ARG HD3  H   6.047  13.657  24.291 1.00 . A A . 64 ARG HD3  1 1 
        5  6170 1 1 64 ARG HE   H   5.308  14.216  22.150 1.00 . A A . 64 ARG HE   1 1 
        5  6171 1 1 64 ARG HG2  H   6.046  11.003  22.829 1.00 . A A . 64 ARG HG2  1 1 
        5  6172 1 1 64 ARG HG3  H   6.864  11.293  24.364 1.00 . A A . 64 ARG HG3  1 1 
        5  6173 1 1 64 ARG HH11 H   3.850  11.288  23.282 1.00 . A A . 64 ARG HH11 1 1 
        5  6174 1 1 64 ARG HH12 H   2.728  11.177  21.966 1.00 . A A . 64 ARG HH12 1 1 
        5  6175 1 1 64 ARG HH21 H   3.845  14.071  20.419 1.00 . A A . 64 ARG HH21 1 1 
        5  6176 1 1 64 ARG HH22 H   2.725  12.752  20.346 1.00 . A A . 64 ARG HH22 1 1 
        5  6177 1 1 64 ARG N    N   9.264  10.598  23.503 1.00 . A A . 64 ARG N    1 1 
        5  6178 1 1 64 ARG NE   N   4.955  13.386  22.536 1.00 . A A . 64 ARG NE   1 1 
        5  6179 1 1 64 ARG NH1  N   3.475  11.654  22.429 1.00 . A A . 64 ARG NH1  1 1 
        5  6180 1 1 64 ARG NH2  N   3.473  13.229  20.808 1.00 . A A . 64 ARG NH2  1 1 
        5  6181 1 1 64 ARG O    O   9.861  11.451  20.274 1.00 . A A . 64 ARG O    1 1 
        5  6182 1 1 65 LYS C    C  12.611  12.178  20.436 1.00 . A A . 65 LYS C    1 1 
        5  6183 1 1 65 LYS CA   C  11.747  13.183  21.224 1.00 . A A . 65 LYS CA   1 1 
        5  6184 1 1 65 LYS CB   C  12.632  14.039  22.130 1.00 . A A . 65 LYS CB   1 1 
        5  6185 1 1 65 LYS CD   C  12.731  16.118  23.513 1.00 . A A . 65 LYS CD   1 1 
        5  6186 1 1 65 LYS CE   C  11.948  17.346  23.979 1.00 . A A . 65 LYS CE   1 1 
        5  6187 1 1 65 LYS CG   C  11.846  15.263  22.603 1.00 . A A . 65 LYS CG   1 1 
        5  6188 1 1 65 LYS H    H  10.470  12.858  22.914 1.00 . A A . 65 LYS H    1 1 
        5  6189 1 1 65 LYS HA   H  11.325  13.809  20.456 1.00 . A A . 65 LYS HA   1 1 
        5  6190 1 1 65 LYS HB2  H  12.941  13.456  22.985 1.00 . A A . 65 LYS HB2  1 1 
        5  6191 1 1 65 LYS HB3  H  13.503  14.363  21.580 1.00 . A A . 65 LYS HB3  1 1 
        5  6192 1 1 65 LYS HD2  H  13.034  15.536  24.371 1.00 . A A . 65 LYS HD2  1 1 
        5  6193 1 1 65 LYS HD3  H  13.607  16.437  22.967 1.00 . A A . 65 LYS HD3  1 1 
        5  6194 1 1 65 LYS HE2  H  11.653  17.931  23.121 1.00 . A A . 65 LYS HE2  1 1 
        5  6195 1 1 65 LYS HE3  H  11.069  17.029  24.519 1.00 . A A . 65 LYS HE3  1 1 
        5  6196 1 1 65 LYS HG2  H  11.540  15.847  21.747 1.00 . A A . 65 LYS HG2  1 1 
        5  6197 1 1 65 LYS HG3  H  10.974  14.942  23.152 1.00 . A A . 65 LYS HG3  1 1 
        5  6198 1 1 65 LYS HZ1  H  12.851  19.146  24.506 1.00 . A A . 65 LYS HZ1  1 1 
        5  6199 1 1 65 LYS HZ2  H  13.766  17.770  24.903 1.00 . A A . 65 LYS HZ2  1 1 
        5  6200 1 1 65 LYS HZ3  H  12.403  18.185  25.830 1.00 . A A . 65 LYS HZ3  1 1 
        5  6201 1 1 65 LYS N    N  10.665  12.559  22.001 1.00 . A A . 65 LYS N    1 1 
        5  6202 1 1 65 LYS NZ   N  12.807  18.175  24.872 1.00 . A A . 65 LYS NZ   1 1 
        5  6203 1 1 65 LYS O    O  13.144  12.542  19.389 1.00 . A A . 65 LYS O    1 1 
        5  6204 1 1 66 ARG C    C  12.583   9.339  18.899 1.00 . A A . 66 ARG C    1 1 
        5  6205 1 1 66 ARG CA   C  13.440   9.924  20.053 1.00 . A A . 66 ARG CA   1 1 
        5  6206 1 1 66 ARG CB   C  13.944   8.805  20.970 1.00 . A A . 66 ARG CB   1 1 
        5  6207 1 1 66 ARG CD   C  15.274   6.712  21.136 1.00 . A A . 66 ARG CD   1 1 
        5  6208 1 1 66 ARG CG   C  14.716   7.754  20.166 1.00 . A A . 66 ARG CG   1 1 
        5  6209 1 1 66 ARG CZ   C  17.194   5.728  20.007 1.00 . A A . 66 ARG CZ   1 1 
        5  6210 1 1 66 ARG H    H  12.145  10.623  21.601 1.00 . A A . 66 ARG H    1 1 
        5  6211 1 1 66 ARG HA   H  14.281  10.401  19.571 1.00 . A A . 66 ARG HA   1 1 
        5  6212 1 1 66 ARG HB2  H  14.595   9.226  21.721 1.00 . A A . 66 ARG HB2  1 1 
        5  6213 1 1 66 ARG HB3  H  13.101   8.335  21.453 1.00 . A A . 66 ARG HB3  1 1 
        5  6214 1 1 66 ARG HD2  H  15.986   7.184  21.794 1.00 . A A . 66 ARG HD2  1 1 
        5  6215 1 1 66 ARG HD3  H  14.462   6.309  21.725 1.00 . A A . 66 ARG HD3  1 1 
        5  6216 1 1 66 ARG HE   H  15.448   4.789  20.265 1.00 . A A . 66 ARG HE   1 1 
        5  6217 1 1 66 ARG HG2  H  14.052   7.275  19.460 1.00 . A A . 66 ARG HG2  1 1 
        5  6218 1 1 66 ARG HG3  H  15.530   8.226  19.638 1.00 . A A . 66 ARG HG3  1 1 
        5  6219 1 1 66 ARG HH11 H  17.386   7.637  20.582 1.00 . A A . 66 ARG HH11 1 1 
        5  6220 1 1 66 ARG HH12 H  18.787   6.929  19.850 1.00 . A A . 66 ARG HH12 1 1 
        5  6221 1 1 66 ARG HH21 H  17.291   3.844  19.338 1.00 . A A . 66 ARG HH21 1 1 
        5  6222 1 1 66 ARG HH22 H  18.733   4.782  19.146 1.00 . A A . 66 ARG HH22 1 1 
        5  6223 1 1 66 ARG N    N  12.698  10.923  20.850 1.00 . A A . 66 ARG N    1 1 
        5  6224 1 1 66 ARG NE   N  15.933   5.626  20.417 1.00 . A A . 66 ARG NE   1 1 
        5  6225 1 1 66 ARG NH1  N  17.839   6.852  20.158 1.00 . A A . 66 ARG NH1  1 1 
        5  6226 1 1 66 ARG NH2  N  17.785   4.705  19.454 1.00 . A A . 66 ARG NH2  1 1 
        5  6227 1 1 66 ARG O    O  12.981   9.339  17.735 1.00 . A A . 66 ARG O    1 1 
        5  6228 1 1 67 GLN C    C   9.507   9.490  17.728 1.00 . A A . 67 GLN C    1 1 
        5  6229 1 1 67 GLN CA   C  10.361   8.371  18.348 1.00 . A A . 67 GLN CA   1 1 
        5  6230 1 1 67 GLN CB   C   9.482   7.354  19.080 1.00 . A A . 67 GLN CB   1 1 
        5  6231 1 1 67 GLN CD   C   9.585   5.155  20.305 1.00 . A A . 67 GLN CD   1 1 
        5  6232 1 1 67 GLN CG   C  10.330   6.119  19.389 1.00 . A A . 67 GLN CG   1 1 
        5  6233 1 1 67 GLN H    H  11.140   9.109  20.197 1.00 . A A . 67 GLN H    1 1 
        5  6234 1 1 67 GLN HA   H  10.857   7.873  17.527 1.00 . A A . 67 GLN HA   1 1 
        5  6235 1 1 67 GLN HB2  H   9.115   7.786  20.001 1.00 . A A . 67 GLN HB2  1 1 
        5  6236 1 1 67 GLN HB3  H   8.650   7.072  18.454 1.00 . A A . 67 GLN HB3  1 1 
        5  6237 1 1 67 GLN HE21 H  10.698   3.597  19.779 1.00 . A A . 67 GLN HE21 1 1 
        5  6238 1 1 67 GLN HE22 H   9.486   3.269  20.921 1.00 . A A . 67 GLN HE22 1 1 
        5  6239 1 1 67 GLN HG2  H  10.570   5.614  18.465 1.00 . A A . 67 GLN HG2  1 1 
        5  6240 1 1 67 GLN HG3  H  11.246   6.429  19.871 1.00 . A A . 67 GLN HG3  1 1 
        5  6241 1 1 67 GLN N    N  11.386   8.909  19.270 1.00 . A A . 67 GLN N    1 1 
        5  6242 1 1 67 GLN NE2  N   9.954   3.903  20.338 1.00 . A A . 67 GLN NE2  1 1 
        5  6243 1 1 67 GLN O    O   8.663   9.261  16.866 1.00 . A A . 67 GLN O    1 1 
        5  6244 1 1 67 GLN OE1  O   8.678   5.550  21.037 1.00 . A A . 67 GLN OE1  1 1 
        5  6245 1 1 68 ALA C    C   8.717  11.866  16.377 1.00 . A A . 68 ALA C    1 1 
        5  6246 1 1 68 ALA CA   C   8.899  11.846  17.901 1.00 . A A . 68 ALA CA   1 1 
        5  6247 1 1 68 ALA CB   C   9.637  13.135  18.331 1.00 . A A . 68 ALA CB   1 1 
        5  6248 1 1 68 ALA H    H  10.403  10.667  18.954 1.00 . A A . 68 ALA H    1 1 
        5  6249 1 1 68 ALA HA   H   7.957  11.790  18.432 1.00 . A A . 68 ALA HA   1 1 
        5  6250 1 1 68 ALA HB1  H   9.465  13.924  17.609 1.00 . A A . 68 ALA HB1  1 1 
        5  6251 1 1 68 ALA HB2  H  10.696  12.935  18.390 1.00 . A A . 68 ALA HB2  1 1 
        5  6252 1 1 68 ALA HB3  H   9.281  13.458  19.300 1.00 . A A . 68 ALA HB3  1 1 
        5  6253 1 1 68 ALA N    N   9.695  10.667  18.278 1.00 . A A . 68 ALA N    1 1 
        5  6254 1 1 68 ALA O    O   7.622  12.128  15.879 1.00 . A A . 68 ALA O    1 1 
        5  6255 1 1 69 ASP C    C   8.627  10.354  13.857 1.00 . A A . 69 ASP C    1 1 
        5  6256 1 1 69 ASP CA   C   9.682  11.403  14.200 1.00 . A A . 69 ASP CA   1 1 
        5  6257 1 1 69 ASP CB   C  11.033  10.953  13.637 1.00 . A A . 69 ASP CB   1 1 
        5  6258 1 1 69 ASP CG   C  10.953  10.845  12.118 1.00 . A A . 69 ASP CG   1 1 
        5  6259 1 1 69 ASP H    H  10.598  11.244  16.110 1.00 . A A . 69 ASP H    1 1 
        5  6260 1 1 69 ASP HA   H   9.409  12.339  13.733 1.00 . A A . 69 ASP HA   1 1 
        5  6261 1 1 69 ASP HB2  H  11.791  11.674  13.906 1.00 . A A . 69 ASP HB2  1 1 
        5  6262 1 1 69 ASP HB3  H  11.291   9.990  14.051 1.00 . A A . 69 ASP HB3  1 1 
        5  6263 1 1 69 ASP N    N   9.772  11.507  15.653 1.00 . A A . 69 ASP N    1 1 
        5  6264 1 1 69 ASP O    O   7.716  10.597  13.066 1.00 . A A . 69 ASP O    1 1 
        5  6265 1 1 69 ASP OD1  O   9.856  10.940  11.595 1.00 . A A . 69 ASP OD1  1 1 
        5  6266 1 1 69 ASP OD2  O  11.988  10.649  11.502 1.00 . A A . 69 ASP OD2  1 1 
        5  6267 1 1 70 ALA C    C   6.436   8.454  14.649 1.00 . A A . 70 ALA C    1 1 
        5  6268 1 1 70 ALA CA   C   7.854   8.075  14.233 1.00 . A A . 70 ALA CA   1 1 
        5  6269 1 1 70 ALA CB   C   8.306   6.842  15.018 1.00 . A A . 70 ALA CB   1 1 
        5  6270 1 1 70 ALA H    H   9.561   9.057  15.039 1.00 . A A . 70 ALA H    1 1 
        5  6271 1 1 70 ALA HA   H   7.856   7.834  13.180 1.00 . A A . 70 ALA HA   1 1 
        5  6272 1 1 70 ALA HB1  H   8.336   7.076  16.072 1.00 . A A . 70 ALA HB1  1 1 
        5  6273 1 1 70 ALA HB2  H   9.291   6.545  14.687 1.00 . A A . 70 ALA HB2  1 1 
        5  6274 1 1 70 ALA HB3  H   7.611   6.032  14.849 1.00 . A A . 70 ALA HB3  1 1 
        5  6275 1 1 70 ALA N    N   8.777   9.182  14.464 1.00 . A A . 70 ALA N    1 1 
        5  6276 1 1 70 ALA O    O   5.468   8.109  13.970 1.00 . A A . 70 ALA O    1 1 
        5  6277 1 1 71 SER C    C   4.068   8.387  16.356 1.00 . A A . 71 SER C    1 1 
        5  6278 1 1 71 SER CA   C   5.009   9.584  16.255 1.00 . A A . 71 SER CA   1 1 
        5  6279 1 1 71 SER CB   C   4.409  10.631  15.315 1.00 . A A . 71 SER CB   1 1 
        5  6280 1 1 71 SER H    H   7.120   9.414  16.265 1.00 . A A . 71 SER H    1 1 
        5  6281 1 1 71 SER HA   H   5.126  10.021  17.235 1.00 . A A . 71 SER HA   1 1 
        5  6282 1 1 71 SER HB2  H   5.168  11.342  15.033 1.00 . A A . 71 SER HB2  1 1 
        5  6283 1 1 71 SER HB3  H   4.030  10.143  14.427 1.00 . A A . 71 SER HB3  1 1 
        5  6284 1 1 71 SER HG   H   2.546  10.815  15.845 1.00 . A A . 71 SER HG   1 1 
        5  6285 1 1 71 SER N    N   6.317   9.166  15.764 1.00 . A A . 71 SER N    1 1 
        5  6286 1 1 71 SER O    O   2.929   8.441  15.893 1.00 . A A . 71 SER O    1 1 
        5  6287 1 1 71 SER OG   O   3.356  11.313  15.983 1.00 . A A . 71 SER OG   1 1 
        5  6288 1 1 72 SER C    C   4.234   5.284  18.315 1.00 . A A . 72 SER C    1 1 
        5  6289 1 1 72 SER CA   C   3.747   6.100  17.121 1.00 . A A . 72 SER CA   1 1 
        5  6290 1 1 72 SER CB   C   3.829   5.250  15.853 1.00 . A A . 72 SER CB   1 1 
        5  6291 1 1 72 SER H    H   5.469   7.324  17.312 1.00 . A A . 72 SER H    1 1 
        5  6292 1 1 72 SER HA   H   2.717   6.380  17.287 1.00 . A A . 72 SER HA   1 1 
        5  6293 1 1 72 SER HB2  H   3.153   4.415  15.933 1.00 . A A . 72 SER HB2  1 1 
        5  6294 1 1 72 SER HB3  H   3.552   5.854  14.998 1.00 . A A . 72 SER HB3  1 1 
        5  6295 1 1 72 SER HG   H   5.666   5.437  15.240 1.00 . A A . 72 SER HG   1 1 
        5  6296 1 1 72 SER N    N   4.553   7.308  16.964 1.00 . A A . 72 SER N    1 1 
        5  6297 1 1 72 SER O    O   5.353   5.470  18.791 1.00 . A A . 72 SER O    1 1 
        5  6298 1 1 72 SER OG   O   5.156   4.765  15.697 1.00 . A A . 72 SER OG   1 1 
        5  6299 1 1 73 THR C    C   4.813   2.523  19.521 1.00 . A A . 73 THR C    1 1 
        5  6300 1 1 73 THR CA   C   3.741   3.539  19.930 1.00 . A A . 73 THR CA   1 1 
        5  6301 1 1 73 THR CB   C   2.488   2.803  20.419 1.00 . A A . 73 THR CB   1 1 
        5  6302 1 1 73 THR CG2  C   1.387   3.817  20.731 1.00 . A A . 73 THR CG2  1 1 
        5  6303 1 1 73 THR H    H   2.507   4.274  18.371 1.00 . A A . 73 THR H    1 1 
        5  6304 1 1 73 THR HA   H   4.114   4.167  20.723 1.00 . A A . 73 THR HA   1 1 
        5  6305 1 1 73 THR HB   H   2.716   2.243  21.311 1.00 . A A . 73 THR HB   1 1 
        5  6306 1 1 73 THR HG1  H   1.954   2.411  18.591 1.00 . A A . 73 THR HG1  1 1 
        5  6307 1 1 73 THR HG21 H   0.589   3.328  21.269 1.00 . A A . 73 THR HG21 1 1 
        5  6308 1 1 73 THR HG22 H   1.002   4.226  19.809 1.00 . A A . 73 THR HG22 1 1 
        5  6309 1 1 73 THR HG23 H   1.792   4.615  21.337 1.00 . A A . 73 THR HG23 1 1 
        5  6310 1 1 73 THR N    N   3.386   4.379  18.791 1.00 . A A . 73 THR N    1 1 
        5  6311 1 1 73 THR O    O   4.854   2.102  18.365 1.00 . A A . 73 THR O    1 1 
        5  6312 1 1 73 THR OG1  O   2.040   1.913  19.406 1.00 . A A . 73 THR OG1  1 1 
        5  6313 1 1 74 PRO C    C   6.165  -0.271  19.839 1.00 . A A . 74 PRO C    1 1 
        5  6314 1 1 74 PRO CA   C   6.743   1.117  20.118 1.00 . A A . 74 PRO CA   1 1 
        5  6315 1 1 74 PRO CB   C   7.623   1.123  21.378 1.00 . A A . 74 PRO CB   1 1 
        5  6316 1 1 74 PRO CD   C   5.731   2.545  21.842 1.00 . A A . 74 PRO CD   1 1 
        5  6317 1 1 74 PRO CG   C   6.709   1.556  22.476 1.00 . A A . 74 PRO CG   1 1 
        5  6318 1 1 74 PRO HA   H   7.322   1.451  19.270 1.00 . A A . 74 PRO HA   1 1 
        5  6319 1 1 74 PRO HB2  H   8.018   0.133  21.574 1.00 . A A . 74 PRO HB2  1 1 
        5  6320 1 1 74 PRO HB3  H   8.431   1.833  21.269 1.00 . A A . 74 PRO HB3  1 1 
        5  6321 1 1 74 PRO HD2  H   4.763   2.471  22.311 1.00 . A A . 74 PRO HD2  1 1 
        5  6322 1 1 74 PRO HD3  H   6.111   3.553  21.906 1.00 . A A . 74 PRO HD3  1 1 
        5  6323 1 1 74 PRO HG2  H   6.175   0.700  22.874 1.00 . A A . 74 PRO HG2  1 1 
        5  6324 1 1 74 PRO HG3  H   7.266   2.044  23.262 1.00 . A A . 74 PRO HG3  1 1 
        5  6325 1 1 74 PRO N    N   5.671   2.113  20.430 1.00 . A A . 74 PRO N    1 1 
        5  6326 1 1 74 PRO O    O   6.804  -1.103  19.196 1.00 . A A . 74 PRO O    1 1 
        5  6327 1 1 75 LYS C    C   2.776  -1.638  20.184 1.00 . A A . 75 LYS C    1 1 
        5  6328 1 1 75 LYS CA   C   4.292  -1.799  20.135 1.00 . A A . 75 LYS CA   1 1 
        5  6329 1 1 75 LYS CB   C   4.749  -2.787  21.214 1.00 . A A . 75 LYS CB   1 1 
        5  6330 1 1 75 LYS CD   C   4.832  -3.249  23.670 1.00 . A A . 75 LYS CD   1 1 
        5  6331 1 1 75 LYS CE   C   4.420  -2.741  25.052 1.00 . A A . 75 LYS CE   1 1 
        5  6332 1 1 75 LYS CG   C   4.337  -2.275  22.599 1.00 . A A . 75 LYS CG   1 1 
        5  6333 1 1 75 LYS H    H   4.492   0.191  20.837 1.00 . A A . 75 LYS H    1 1 
        5  6334 1 1 75 LYS HA   H   4.568  -2.192  19.167 1.00 . A A . 75 LYS HA   1 1 
        5  6335 1 1 75 LYS HB2  H   4.292  -3.750  21.036 1.00 . A A . 75 LYS HB2  1 1 
        5  6336 1 1 75 LYS HB3  H   5.823  -2.887  21.177 1.00 . A A . 75 LYS HB3  1 1 
        5  6337 1 1 75 LYS HD2  H   4.397  -4.224  23.499 1.00 . A A . 75 LYS HD2  1 1 
        5  6338 1 1 75 LYS HD3  H   5.908  -3.321  23.621 1.00 . A A . 75 LYS HD3  1 1 
        5  6339 1 1 75 LYS HE2  H   4.857  -1.768  25.223 1.00 . A A . 75 LYS HE2  1 1 
        5  6340 1 1 75 LYS HE3  H   3.344  -2.664  25.101 1.00 . A A . 75 LYS HE3  1 1 
        5  6341 1 1 75 LYS HG2  H   4.773  -1.302  22.767 1.00 . A A . 75 LYS HG2  1 1 
        5  6342 1 1 75 LYS HG3  H   3.262  -2.204  22.655 1.00 . A A . 75 LYS HG3  1 1 
        5  6343 1 1 75 LYS HZ1  H   4.807  -4.665  25.746 1.00 . A A . 75 LYS HZ1  1 1 
        5  6344 1 1 75 LYS HZ2  H   4.326  -3.575  26.958 1.00 . A A . 75 LYS HZ2  1 1 
        5  6345 1 1 75 LYS HZ3  H   5.896  -3.495  26.312 1.00 . A A . 75 LYS HZ3  1 1 
        5  6346 1 1 75 LYS N    N   4.952  -0.511  20.331 1.00 . A A . 75 LYS N    1 1 
        5  6347 1 1 75 LYS NZ   N   4.898  -3.691  26.095 1.00 . A A . 75 LYS NZ   1 1 
        5  6348 1 1 75 LYS O    O   2.264  -0.657  20.722 1.00 . A A . 75 LYS O    1 1 
        5  6349 1 1 76 PHE C    C   0.030  -3.959  19.899 1.00 . A A . 76 PHE C    1 1 
        5  6350 1 1 76 PHE CA   C   0.596  -2.573  19.600 1.00 . A A . 76 PHE CA   1 1 
        5  6351 1 1 76 PHE CB   C   0.119  -2.099  18.224 1.00 . A A . 76 PHE CB   1 1 
        5  6352 1 1 76 PHE CD1  C  -2.040  -0.970  18.868 1.00 . A A . 76 PHE CD1  1 1 
        5  6353 1 1 76 PHE CD2  C  -2.136  -2.974  17.505 1.00 . A A . 76 PHE CD2  1 1 
        5  6354 1 1 76 PHE CE1  C  -3.437  -0.885  18.840 1.00 . A A . 76 PHE CE1  1 1 
        5  6355 1 1 76 PHE CE2  C  -3.534  -2.888  17.478 1.00 . A A . 76 PHE CE2  1 1 
        5  6356 1 1 76 PHE CG   C  -1.390  -2.015  18.201 1.00 . A A . 76 PHE CG   1 1 
        5  6357 1 1 76 PHE CZ   C  -4.184  -1.843  18.144 1.00 . A A . 76 PHE CZ   1 1 
        5  6358 1 1 76 PHE H    H   2.524  -3.367  19.205 1.00 . A A . 76 PHE H    1 1 
        5  6359 1 1 76 PHE HA   H   0.240  -1.881  20.352 1.00 . A A . 76 PHE HA   1 1 
        5  6360 1 1 76 PHE HB2  H   0.535  -1.124  18.018 1.00 . A A . 76 PHE HB2  1 1 
        5  6361 1 1 76 PHE HB3  H   0.453  -2.797  17.470 1.00 . A A . 76 PHE HB3  1 1 
        5  6362 1 1 76 PHE HD1  H  -1.464  -0.231  19.404 1.00 . A A . 76 PHE HD1  1 1 
        5  6363 1 1 76 PHE HD2  H  -1.635  -3.780  16.991 1.00 . A A . 76 PHE HD2  1 1 
        5  6364 1 1 76 PHE HE1  H  -3.939  -0.078  19.354 1.00 . A A . 76 PHE HE1  1 1 
        5  6365 1 1 76 PHE HE2  H  -4.110  -3.627  16.941 1.00 . A A . 76 PHE HE2  1 1 
        5  6366 1 1 76 PHE HZ   H  -5.262  -1.776  18.122 1.00 . A A . 76 PHE HZ   1 1 
        5  6367 1 1 76 PHE N    N   2.060  -2.610  19.617 1.00 . A A . 76 PHE N    1 1 
        5  6368 1 1 76 PHE O    O   0.013  -4.834  19.034 1.00 . A A . 76 PHE O    1 1 
        5  6369 1 1 77 ASN C    C  -2.243  -5.767  20.753 1.00 . A A . 77 ASN C    1 1 
        5  6370 1 1 77 ASN CA   C  -0.983  -5.436  21.546 1.00 . A A . 77 ASN CA   1 1 
        5  6371 1 1 77 ASN CB   C  -1.314  -5.408  23.040 1.00 . A A . 77 ASN CB   1 1 
        5  6372 1 1 77 ASN CG   C  -1.649  -6.813  23.525 1.00 . A A . 77 ASN CG   1 1 
        5  6373 1 1 77 ASN H    H  -0.379  -3.418  21.784 1.00 . A A . 77 ASN H    1 1 
        5  6374 1 1 77 ASN HA   H  -0.248  -6.207  21.371 1.00 . A A . 77 ASN HA   1 1 
        5  6375 1 1 77 ASN HB2  H  -0.462  -5.031  23.588 1.00 . A A . 77 ASN HB2  1 1 
        5  6376 1 1 77 ASN HB3  H  -2.161  -4.760  23.206 1.00 . A A . 77 ASN HB3  1 1 
        5  6377 1 1 77 ASN HD21 H  -2.996  -6.196  24.846 1.00 . A A . 77 ASN HD21 1 1 
        5  6378 1 1 77 ASN HD22 H  -2.765  -7.876  24.777 1.00 . A A . 77 ASN HD22 1 1 
        5  6379 1 1 77 ASN N    N  -0.424  -4.151  21.135 1.00 . A A . 77 ASN N    1 1 
        5  6380 1 1 77 ASN ND2  N  -2.544  -6.975  24.460 1.00 . A A . 77 ASN ND2  1 1 
        5  6381 1 1 77 ASN O    O  -2.436  -6.906  20.325 1.00 . A A . 77 ASN O    1 1 
        5  6382 1 1 77 ASN OD1  O  -1.080  -7.790  23.039 1.00 . A A . 77 ASN OD1  1 1 
        5  6383 1 1 78 GLY C    C  -5.389  -5.648  20.699 1.00 . A A . 78 GLY C    1 1 
        5  6384 1 1 78 GLY CA   C  -4.340  -4.970  19.825 1.00 . A A . 78 GLY CA   1 1 
        5  6385 1 1 78 GLY H    H  -2.894  -3.883  20.931 1.00 . A A . 78 GLY H    1 1 
        5  6386 1 1 78 GLY HA2  H  -4.717  -4.012  19.500 1.00 . A A . 78 GLY HA2  1 1 
        5  6387 1 1 78 GLY HA3  H  -4.145  -5.589  18.962 1.00 . A A . 78 GLY HA3  1 1 
        5  6388 1 1 78 GLY N    N  -3.098  -4.769  20.564 1.00 . A A . 78 GLY N    1 1 
        5  6389 1 1 78 GLY O    O  -5.201  -5.801  21.906 1.00 . A A . 78 GLY O    1 1 
        5  6390 1 1 79 VAL C    C  -7.844  -8.107  20.214 1.00 . A A . 79 VAL C    1 1 
        5  6391 1 1 79 VAL CA   C  -7.586  -6.722  20.799 1.00 . A A . 79 VAL CA   1 1 
        5  6392 1 1 79 VAL CB   C  -8.862  -5.884  20.700 1.00 . A A . 79 VAL CB   1 1 
        5  6393 1 1 79 VAL CG1  C -10.002  -6.599  21.428 1.00 . A A . 79 VAL CG1  1 1 
        5  6394 1 1 79 VAL CG2  C  -8.623  -4.517  21.348 1.00 . A A . 79 VAL CG2  1 1 
        5  6395 1 1 79 VAL H    H  -6.586  -5.905  19.115 1.00 . A A . 79 VAL H    1 1 
        5  6396 1 1 79 VAL HA   H  -7.322  -6.829  21.844 1.00 . A A . 79 VAL HA   1 1 
        5  6397 1 1 79 VAL HB   H  -9.125  -5.751  19.661 1.00 . A A . 79 VAL HB   1 1 
        5  6398 1 1 79 VAL HG11 H  -9.666  -6.909  22.406 1.00 . A A . 79 VAL HG11 1 1 
        5  6399 1 1 79 VAL HG12 H -10.303  -7.466  20.859 1.00 . A A . 79 VAL HG12 1 1 
        5  6400 1 1 79 VAL HG13 H -10.840  -5.927  21.531 1.00 . A A . 79 VAL HG13 1 1 
        5  6401 1 1 79 VAL HG21 H  -7.811  -4.016  20.842 1.00 . A A . 79 VAL HG21 1 1 
        5  6402 1 1 79 VAL HG22 H  -8.371  -4.652  22.389 1.00 . A A . 79 VAL HG22 1 1 
        5  6403 1 1 79 VAL HG23 H  -9.520  -3.920  21.268 1.00 . A A . 79 VAL HG23 1 1 
        5  6404 1 1 79 VAL N    N  -6.497  -6.056  20.079 1.00 . A A . 79 VAL N    1 1 
        5  6405 1 1 79 VAL O    O  -8.037  -8.255  19.008 1.00 . A A . 79 VAL O    1 1 
        5  6406 1 1 80 LYS C    C  -9.458 -10.608  19.995 1.00 . A A . 80 LYS C    1 1 
        5  6407 1 1 80 LYS CA   C  -8.079 -10.487  20.634 1.00 . A A . 80 LYS CA   1 1 
        5  6408 1 1 80 LYS CB   C  -7.981 -11.443  21.827 1.00 . A A . 80 LYS CB   1 1 
        5  6409 1 1 80 LYS CD   C  -7.968 -13.857  22.522 1.00 . A A . 80 LYS CD   1 1 
        5  6410 1 1 80 LYS CE   C  -6.544 -13.754  23.095 1.00 . A A . 80 LYS CE   1 1 
        5  6411 1 1 80 LYS CG   C  -8.147 -12.888  21.344 1.00 . A A . 80 LYS CG   1 1 
        5  6412 1 1 80 LYS H    H  -7.684  -8.939  22.027 1.00 . A A . 80 LYS H    1 1 
        5  6413 1 1 80 LYS HA   H  -7.328 -10.756  19.907 1.00 . A A . 80 LYS HA   1 1 
        5  6414 1 1 80 LYS HB2  H  -7.016 -11.326  22.297 1.00 . A A . 80 LYS HB2  1 1 
        5  6415 1 1 80 LYS HB3  H  -8.759 -11.213  22.539 1.00 . A A . 80 LYS HB3  1 1 
        5  6416 1 1 80 LYS HD2  H  -8.683 -13.613  23.294 1.00 . A A . 80 LYS HD2  1 1 
        5  6417 1 1 80 LYS HD3  H  -8.144 -14.867  22.179 1.00 . A A . 80 LYS HD3  1 1 
        5  6418 1 1 80 LYS HE2  H  -6.249 -14.711  23.505 1.00 . A A . 80 LYS HE2  1 1 
        5  6419 1 1 80 LYS HE3  H  -5.849 -13.471  22.316 1.00 . A A . 80 LYS HE3  1 1 
        5  6420 1 1 80 LYS HG2  H  -9.133 -13.015  20.922 1.00 . A A . 80 LYS HG2  1 1 
        5  6421 1 1 80 LYS HG3  H  -7.404 -13.102  20.590 1.00 . A A . 80 LYS HG3  1 1 
        5  6422 1 1 80 LYS HZ1  H  -7.379 -12.147  24.122 1.00 . A A . 80 LYS HZ1  1 1 
        5  6423 1 1 80 LYS HZ2  H  -5.681 -12.125  24.064 1.00 . A A . 80 LYS HZ2  1 1 
        5  6424 1 1 80 LYS HZ3  H  -6.485 -13.203  25.103 1.00 . A A . 80 LYS HZ3  1 1 
        5  6425 1 1 80 LYS N    N  -7.844  -9.118  21.077 1.00 . A A . 80 LYS N    1 1 
        5  6426 1 1 80 LYS NZ   N  -6.520 -12.730  24.178 1.00 . A A . 80 LYS NZ   1 1 
        5  6427 1 1 80 LYS O    O  -9.617 -11.241  18.950 1.00 . A A . 80 LYS O    1 1 
        5  6428 1 1 81 LYS C    C -12.655  -8.920  20.730 1.00 . A A . 81 LYS C    1 1 
        5  6429 1 1 81 LYS CA   C -11.818 -10.038  20.115 1.00 . A A . 81 LYS CA   1 1 
        5  6430 1 1 81 LYS CB   C -12.454 -11.402  20.435 1.00 . A A . 81 LYS CB   1 1 
        5  6431 1 1 81 LYS CD   C -13.131 -12.316  18.179 1.00 . A A . 81 LYS CD   1 1 
        5  6432 1 1 81 LYS CE   C -14.321 -12.603  17.262 1.00 . A A . 81 LYS CE   1 1 
        5  6433 1 1 81 LYS CG   C -13.634 -11.684  19.484 1.00 . A A . 81 LYS CG   1 1 
        5  6434 1 1 81 LYS H    H -10.267  -9.507  21.457 1.00 . A A . 81 LYS H    1 1 
        5  6435 1 1 81 LYS HA   H -11.791  -9.904  19.046 1.00 . A A . 81 LYS HA   1 1 
        5  6436 1 1 81 LYS HB2  H -11.708 -12.177  20.325 1.00 . A A . 81 LYS HB2  1 1 
        5  6437 1 1 81 LYS HB3  H -12.811 -11.400  21.455 1.00 . A A . 81 LYS HB3  1 1 
        5  6438 1 1 81 LYS HD2  H -12.451 -11.640  17.684 1.00 . A A . 81 LYS HD2  1 1 
        5  6439 1 1 81 LYS HD3  H -12.621 -13.241  18.401 1.00 . A A . 81 LYS HD3  1 1 
        5  6440 1 1 81 LYS HE2  H -14.855 -11.685  17.067 1.00 . A A . 81 LYS HE2  1 1 
        5  6441 1 1 81 LYS HE3  H -13.965 -13.018  16.330 1.00 . A A . 81 LYS HE3  1 1 
        5  6442 1 1 81 LYS HG2  H -14.325 -12.363  19.963 1.00 . A A . 81 LYS HG2  1 1 
        5  6443 1 1 81 LYS HG3  H -14.146 -10.759  19.257 1.00 . A A . 81 LYS HG3  1 1 
        5  6444 1 1 81 LYS HZ1  H -14.687 -14.181  18.571 1.00 . A A . 81 LYS HZ1  1 1 
        5  6445 1 1 81 LYS HZ2  H -15.690 -14.171  17.199 1.00 . A A . 81 LYS HZ2  1 1 
        5  6446 1 1 81 LYS HZ3  H -15.960 -13.065  18.460 1.00 . A A . 81 LYS HZ3  1 1 
        5  6447 1 1 81 LYS N    N -10.454  -9.995  20.628 1.00 . A A . 81 LYS N    1 1 
        5  6448 1 1 81 LYS NZ   N -15.233 -13.579  17.923 1.00 . A A . 81 LYS NZ   1 1 
        5  6449 1 1 81 LYS O    O -13.233  -8.155  19.975 1.00 . A A . 81 LYS O    1 1 
        5  6450 1 1 81 LYS OXT  O -12.705  -8.844  21.947 1.00 . A A . 81 LYS OXT  1 1 
        6  6451 1 1  1 MET C    C  -6.117   3.805  -4.921 1.00 . A A .  1 MET C    1 1 
        6  6452 1 1  1 MET CA   C  -5.804   2.611  -4.025 1.00 . A A .  1 MET CA   1 1 
        6  6453 1 1  1 MET CB   C  -6.540   1.366  -4.527 1.00 . A A .  1 MET CB   1 1 
        6  6454 1 1  1 MET CE   C  -8.572   0.046  -6.581 1.00 . A A .  1 MET CE   1 1 
        6  6455 1 1  1 MET CG   C  -6.117   1.062  -5.965 1.00 . A A .  1 MET CG   1 1 
        6  6456 1 1  1 MET H1   H  -6.376   2.024  -2.111 1.00 . A A .  1 MET H1   1 1 
        6  6457 1 1  1 MET H2   H  -7.131   3.446  -2.656 1.00 . A A .  1 MET H2   1 1 
        6  6458 1 1  1 MET H3   H  -5.507   3.479  -2.156 1.00 . A A .  1 MET H3   1 1 
        6  6459 1 1  1 MET HA   H  -4.739   2.426  -4.036 1.00 . A A .  1 MET HA   1 1 
        6  6460 1 1  1 MET HB2  H  -6.295   0.525  -3.893 1.00 . A A .  1 MET HB2  1 1 
        6  6461 1 1  1 MET HB3  H  -7.605   1.543  -4.496 1.00 . A A .  1 MET HB3  1 1 
        6  6462 1 1  1 MET HE1  H  -9.126  -0.609  -7.241 1.00 . A A .  1 MET HE1  1 1 
        6  6463 1 1  1 MET HE2  H  -8.613   1.052  -6.964 1.00 . A A .  1 MET HE2  1 1 
        6  6464 1 1  1 MET HE3  H  -9.009   0.021  -5.592 1.00 . A A .  1 MET HE3  1 1 
        6  6465 1 1  1 MET HG2  H  -6.453   1.855  -6.617 1.00 . A A .  1 MET HG2  1 1 
        6  6466 1 1  1 MET HG3  H  -5.041   0.990  -6.015 1.00 . A A .  1 MET HG3  1 1 
        6  6467 1 1  1 MET N    N  -6.237   2.913  -2.631 1.00 . A A .  1 MET N    1 1 
        6  6468 1 1  1 MET O    O  -5.212   4.463  -5.430 1.00 . A A .  1 MET O    1 1 
        6  6469 1 1  1 MET SD   S  -6.851  -0.508  -6.493 1.00 . A A .  1 MET SD   1 1 
        6  6470 1 1  2 LYS C    C  -7.422   6.527  -5.323 1.00 . A A .  2 LYS C    1 1 
        6  6471 1 1  2 LYS CA   C  -7.825   5.191  -5.953 1.00 . A A .  2 LYS CA   1 1 
        6  6472 1 1  2 LYS CB   C  -9.347   5.140  -6.148 1.00 . A A .  2 LYS CB   1 1 
        6  6473 1 1  2 LYS CD   C  -9.155   6.239  -8.413 1.00 . A A .  2 LYS CD   1 1 
        6  6474 1 1  2 LYS CE   C  -9.993   7.011  -9.436 1.00 . A A .  2 LYS CE   1 1 
        6  6475 1 1  2 LYS CG   C  -9.827   6.303  -7.032 1.00 . A A .  2 LYS CG   1 1 
        6  6476 1 1  2 LYS H    H  -8.082   3.507  -4.691 1.00 . A A .  2 LYS H    1 1 
        6  6477 1 1  2 LYS HA   H  -7.347   5.098  -6.914 1.00 . A A .  2 LYS HA   1 1 
        6  6478 1 1  2 LYS HB2  H  -9.612   4.204  -6.618 1.00 . A A .  2 LYS HB2  1 1 
        6  6479 1 1  2 LYS HB3  H  -9.831   5.203  -5.185 1.00 . A A .  2 LYS HB3  1 1 
        6  6480 1 1  2 LYS HD2  H  -8.172   6.683  -8.356 1.00 . A A .  2 LYS HD2  1 1 
        6  6481 1 1  2 LYS HD3  H  -9.068   5.209  -8.728 1.00 . A A .  2 LYS HD3  1 1 
        6  6482 1 1  2 LYS HE2  H  -9.522   6.953 -10.405 1.00 . A A .  2 LYS HE2  1 1 
        6  6483 1 1  2 LYS HE3  H -10.982   6.581  -9.489 1.00 . A A .  2 LYS HE3  1 1 
        6  6484 1 1  2 LYS HG2  H -10.899   6.236  -7.149 1.00 . A A .  2 LYS HG2  1 1 
        6  6485 1 1  2 LYS HG3  H  -9.581   7.242  -6.559 1.00 . A A .  2 LYS HG3  1 1 
        6  6486 1 1  2 LYS HZ1  H -10.490   9.000  -9.799 1.00 . A A .  2 LYS HZ1  1 1 
        6  6487 1 1  2 LYS HZ2  H  -9.149   8.797  -8.776 1.00 . A A .  2 LYS HZ2  1 1 
        6  6488 1 1  2 LYS HZ3  H -10.719   8.515  -8.191 1.00 . A A .  2 LYS HZ3  1 1 
        6  6489 1 1  2 LYS N    N  -7.404   4.072  -5.116 1.00 . A A .  2 LYS N    1 1 
        6  6490 1 1  2 LYS NZ   N -10.096   8.439  -9.019 1.00 . A A .  2 LYS NZ   1 1 
        6  6491 1 1  2 LYS O    O  -6.921   7.421  -6.006 1.00 . A A .  2 LYS O    1 1 
        6  6492 1 1  3 ASP C    C  -6.567   7.562  -1.992 1.00 . A A .  3 ASP C    1 1 
        6  6493 1 1  3 ASP CA   C  -7.332   7.887  -3.278 1.00 . A A .  3 ASP CA   1 1 
        6  6494 1 1  3 ASP CB   C  -8.628   8.622  -2.930 1.00 . A A .  3 ASP CB   1 1 
        6  6495 1 1  3 ASP CG   C  -9.364   8.993  -4.212 1.00 . A A .  3 ASP CG   1 1 
        6  6496 1 1  3 ASP H    H  -8.065   5.909  -3.529 1.00 . A A .  3 ASP H    1 1 
        6  6497 1 1  3 ASP HA   H  -6.728   8.533  -3.897 1.00 . A A .  3 ASP HA   1 1 
        6  6498 1 1  3 ASP HB2  H  -9.254   7.980  -2.327 1.00 . A A .  3 ASP HB2  1 1 
        6  6499 1 1  3 ASP HB3  H  -8.396   9.520  -2.377 1.00 . A A .  3 ASP HB3  1 1 
        6  6500 1 1  3 ASP N    N  -7.656   6.656  -4.013 1.00 . A A .  3 ASP N    1 1 
        6  6501 1 1  3 ASP O    O  -7.114   7.679  -0.896 1.00 . A A .  3 ASP O    1 1 
        6  6502 1 1  3 ASP OD1  O  -8.724   9.006  -5.251 1.00 . A A .  3 ASP OD1  1 1 
        6  6503 1 1  3 ASP OD2  O -10.553   9.259  -4.140 1.00 . A A .  3 ASP OD2  1 1 
        6  6504 1 1  4 PRO C    C  -3.969   7.989  -0.159 1.00 . A A .  4 PRO C    1 1 
        6  6505 1 1  4 PRO CA   C  -4.492   6.772  -0.925 1.00 . A A .  4 PRO CA   1 1 
        6  6506 1 1  4 PRO CB   C  -3.346   5.971  -1.555 1.00 . A A .  4 PRO CB   1 1 
        6  6507 1 1  4 PRO CD   C  -4.587   6.986  -3.368 1.00 . A A .  4 PRO CD   1 1 
        6  6508 1 1  4 PRO CG   C  -3.184   6.559  -2.919 1.00 . A A .  4 PRO CG   1 1 
        6  6509 1 1  4 PRO HA   H  -5.046   6.131  -0.264 1.00 . A A .  4 PRO HA   1 1 
        6  6510 1 1  4 PRO HB2  H  -2.436   6.088  -0.976 1.00 . A A .  4 PRO HB2  1 1 
        6  6511 1 1  4 PRO HB3  H  -3.611   4.927  -1.631 1.00 . A A .  4 PRO HB3  1 1 
        6  6512 1 1  4 PRO HD2  H  -4.536   7.923  -3.905 1.00 . A A .  4 PRO HD2  1 1 
        6  6513 1 1  4 PRO HD3  H  -5.045   6.226  -3.974 1.00 . A A .  4 PRO HD3  1 1 
        6  6514 1 1  4 PRO HG2  H  -2.524   7.418  -2.876 1.00 . A A .  4 PRO HG2  1 1 
        6  6515 1 1  4 PRO HG3  H  -2.788   5.822  -3.603 1.00 . A A .  4 PRO HG3  1 1 
        6  6516 1 1  4 PRO N    N  -5.332   7.143  -2.103 1.00 . A A .  4 PRO N    1 1 
        6  6517 1 1  4 PRO O    O  -3.400   7.856   0.918 1.00 . A A .  4 PRO O    1 1 
        6  6518 1 1  5 LYS C    C  -4.606  10.877   1.047 1.00 . A A .  5 LYS C    1 1 
        6  6519 1 1  5 LYS CA   C  -3.686  10.395  -0.086 1.00 . A A .  5 LYS CA   1 1 
        6  6520 1 1  5 LYS CB   C  -3.596  11.500  -1.144 1.00 . A A .  5 LYS CB   1 1 
        6  6521 1 1  5 LYS CD   C  -2.503  12.126  -3.326 1.00 . A A .  5 LYS CD   1 1 
        6  6522 1 1  5 LYS CE   C  -2.170  13.566  -2.918 1.00 . A A .  5 LYS CE   1 1 
        6  6523 1 1  5 LYS CG   C  -2.444  11.195  -2.106 1.00 . A A .  5 LYS CG   1 1 
        6  6524 1 1  5 LYS H    H  -4.628   9.227  -1.582 1.00 . A A .  5 LYS H    1 1 
        6  6525 1 1  5 LYS HA   H  -2.692  10.226   0.296 1.00 . A A .  5 LYS HA   1 1 
        6  6526 1 1  5 LYS HB2  H  -4.526  11.548  -1.694 1.00 . A A .  5 LYS HB2  1 1 
        6  6527 1 1  5 LYS HB3  H  -3.416  12.444  -0.654 1.00 . A A .  5 LYS HB3  1 1 
        6  6528 1 1  5 LYS HD2  H  -1.790  11.791  -4.065 1.00 . A A .  5 LYS HD2  1 1 
        6  6529 1 1  5 LYS HD3  H  -3.496  12.097  -3.749 1.00 . A A .  5 LYS HD3  1 1 
        6  6530 1 1  5 LYS HE2  H  -2.959  13.960  -2.298 1.00 . A A .  5 LYS HE2  1 1 
        6  6531 1 1  5 LYS HE3  H  -1.239  13.582  -2.374 1.00 . A A .  5 LYS HE3  1 1 
        6  6532 1 1  5 LYS HG2  H  -1.503  11.338  -1.594 1.00 . A A .  5 LYS HG2  1 1 
        6  6533 1 1  5 LYS HG3  H  -2.518  10.170  -2.439 1.00 . A A .  5 LYS HG3  1 1 
        6  6534 1 1  5 LYS HZ1  H  -2.929  14.357  -4.689 1.00 . A A .  5 LYS HZ1  1 1 
        6  6535 1 1  5 LYS HZ2  H  -1.257  14.061  -4.722 1.00 . A A .  5 LYS HZ2  1 1 
        6  6536 1 1  5 LYS HZ3  H  -1.870  15.395  -3.867 1.00 . A A .  5 LYS HZ3  1 1 
        6  6537 1 1  5 LYS N    N  -4.152   9.170  -0.727 1.00 . A A .  5 LYS N    1 1 
        6  6538 1 1  5 LYS NZ   N  -2.048  14.409  -4.141 1.00 . A A .  5 LYS NZ   1 1 
        6  6539 1 1  5 LYS O    O  -4.170  11.109   2.169 1.00 . A A .  5 LYS O    1 1 
        6  6540 1 1  6 THR C    C  -7.435  10.204   2.532 1.00 . A A .  6 THR C    1 1 
        6  6541 1 1  6 THR CA   C  -6.963  11.370   1.644 1.00 . A A .  6 THR CA   1 1 
        6  6542 1 1  6 THR CB   C  -8.156  11.915   0.853 1.00 . A A .  6 THR CB   1 1 
        6  6543 1 1  6 THR CG2  C  -9.271  12.315   1.821 1.00 . A A .  6 THR CG2  1 1 
        6  6544 1 1  6 THR H    H  -6.149  10.623  -0.169 1.00 . A A .  6 THR H    1 1 
        6  6545 1 1  6 THR HA   H  -6.593  12.149   2.284 1.00 . A A .  6 THR HA   1 1 
        6  6546 1 1  6 THR HB   H  -8.522  11.153   0.183 1.00 . A A .  6 THR HB   1 1 
        6  6547 1 1  6 THR HG1  H  -7.829  13.824   0.665 1.00 . A A .  6 THR HG1  1 1 
        6  6548 1 1  6 THR HG21 H  -8.852  12.883   2.639 1.00 . A A .  6 THR HG21 1 1 
        6  6549 1 1  6 THR HG22 H  -9.748  11.427   2.205 1.00 . A A .  6 THR HG22 1 1 
        6  6550 1 1  6 THR HG23 H -10.000  12.918   1.300 1.00 . A A .  6 THR HG23 1 1 
        6  6551 1 1  6 THR N    N  -5.893  10.970   0.712 1.00 . A A .  6 THR N    1 1 
        6  6552 1 1  6 THR O    O  -7.837  10.378   3.683 1.00 . A A .  6 THR O    1 1 
        6  6553 1 1  6 THR OG1  O  -7.744  13.050   0.104 1.00 . A A .  6 THR OG1  1 1 
        6  6554 1 1  7 LEU C    C  -6.838   7.587   3.894 1.00 . A A .  7 LEU C    1 1 
        6  6555 1 1  7 LEU CA   C  -7.729   7.795   2.656 1.00 . A A .  7 LEU CA   1 1 
        6  6556 1 1  7 LEU CB   C  -7.629   6.587   1.718 1.00 . A A .  7 LEU CB   1 1 
        6  6557 1 1  7 LEU CD1  C  -9.456   5.376   2.970 1.00 . A A .  7 LEU CD1  1 1 
        6  6558 1 1  7 LEU CD2  C  -7.876   4.113   1.485 1.00 . A A .  7 LEU CD2  1 1 
        6  6559 1 1  7 LEU CG   C  -8.009   5.292   2.456 1.00 . A A .  7 LEU CG   1 1 
        6  6560 1 1  7 LEU H    H  -6.880   9.056   1.090 1.00 . A A .  7 LEU H    1 1 
        6  6561 1 1  7 LEU HA   H  -8.748   7.894   2.996 1.00 . A A .  7 LEU HA   1 1 
        6  6562 1 1  7 LEU HB2  H  -8.300   6.728   0.884 1.00 . A A .  7 LEU HB2  1 1 
        6  6563 1 1  7 LEU HB3  H  -6.620   6.504   1.357 1.00 . A A .  7 LEU HB3  1 1 
        6  6564 1 1  7 LEU HD11 H  -9.472   5.896   3.917 1.00 . A A .  7 LEU HD11 1 1 
        6  6565 1 1  7 LEU HD12 H  -9.852   4.380   3.108 1.00 . A A .  7 LEU HD12 1 1 
        6  6566 1 1  7 LEU HD13 H -10.067   5.909   2.256 1.00 . A A .  7 LEU HD13 1 1 
        6  6567 1 1  7 LEU HD21 H  -8.578   4.236   0.673 1.00 . A A .  7 LEU HD21 1 1 
        6  6568 1 1  7 LEU HD22 H  -8.088   3.192   2.006 1.00 . A A .  7 LEU HD22 1 1 
        6  6569 1 1  7 LEU HD23 H  -6.871   4.083   1.091 1.00 . A A .  7 LEU HD23 1 1 
        6  6570 1 1  7 LEU HG   H  -7.341   5.140   3.292 1.00 . A A .  7 LEU HG   1 1 
        6  6571 1 1  7 LEU N    N  -7.345   9.026   1.952 1.00 . A A .  7 LEU N    1 1 
        6  6572 1 1  7 LEU O    O  -7.328   7.329   4.992 1.00 . A A .  7 LEU O    1 1 
        6  6573 1 1  8 LEU C    C  -4.458   8.883   5.639 1.00 . A A .  8 LEU C    1 1 
        6  6574 1 1  8 LEU CA   C  -4.512   7.631   4.745 1.00 . A A .  8 LEU CA   1 1 
        6  6575 1 1  8 LEU CB   C  -3.136   7.404   4.095 1.00 . A A .  8 LEU CB   1 1 
        6  6576 1 1  8 LEU CD1  C  -4.153   5.438   2.898 1.00 . A A .  8 LEU CD1  1 1 
        6  6577 1 1  8 LEU CD2  C  -1.668   5.743   2.932 1.00 . A A .  8 LEU CD2  1 1 
        6  6578 1 1  8 LEU CG   C  -2.961   5.920   3.733 1.00 . A A .  8 LEU CG   1 1 
        6  6579 1 1  8 LEU H    H  -5.210   8.008   2.811 1.00 . A A .  8 LEU H    1 1 
        6  6580 1 1  8 LEU HA   H  -4.756   6.753   5.328 1.00 . A A .  8 LEU HA   1 1 
        6  6581 1 1  8 LEU HB2  H  -3.058   8.004   3.203 1.00 . A A .  8 LEU HB2  1 1 
        6  6582 1 1  8 LEU HB3  H  -2.354   7.691   4.785 1.00 . A A .  8 LEU HB3  1 1 
        6  6583 1 1  8 LEU HD11 H  -3.899   4.506   2.412 1.00 . A A .  8 LEU HD11 1 1 
        6  6584 1 1  8 LEU HD12 H  -4.397   6.176   2.153 1.00 . A A .  8 LEU HD12 1 1 
        6  6585 1 1  8 LEU HD13 H  -5.005   5.283   3.541 1.00 . A A .  8 LEU HD13 1 1 
        6  6586 1 1  8 LEU HD21 H  -1.509   4.695   2.732 1.00 . A A .  8 LEU HD21 1 1 
        6  6587 1 1  8 LEU HD22 H  -0.836   6.130   3.503 1.00 . A A .  8 LEU HD22 1 1 
        6  6588 1 1  8 LEU HD23 H  -1.743   6.281   1.998 1.00 . A A .  8 LEU HD23 1 1 
        6  6589 1 1  8 LEU HG   H  -2.905   5.338   4.640 1.00 . A A .  8 LEU HG   1 1 
        6  6590 1 1  8 LEU N    N  -5.537   7.743   3.696 1.00 . A A .  8 LEU N    1 1 
        6  6591 1 1  8 LEU O    O  -3.964   8.856   6.767 1.00 . A A .  8 LEU O    1 1 
        6  6592 1 1  9 ARG C    C  -5.960  11.227   6.990 1.00 . A A .  9 ARG C    1 1 
        6  6593 1 1  9 ARG CA   C  -5.042  11.263   5.767 1.00 . A A .  9 ARG CA   1 1 
        6  6594 1 1  9 ARG CB   C  -5.546  12.344   4.815 1.00 . A A .  9 ARG CB   1 1 
        6  6595 1 1  9 ARG CD   C  -5.821  14.799   4.479 1.00 . A A .  9 ARG CD   1 1 
        6  6596 1 1  9 ARG CG   C  -5.455  13.711   5.489 1.00 . A A .  9 ARG CG   1 1 
        6  6597 1 1  9 ARG CZ   C  -5.946  17.218   4.384 1.00 . A A .  9 ARG CZ   1 1 
        6  6598 1 1  9 ARG H    H  -5.512   9.800   4.273 1.00 . A A .  9 ARG H    1 1 
        6  6599 1 1  9 ARG HA   H  -4.043  11.528   6.082 1.00 . A A .  9 ARG HA   1 1 
        6  6600 1 1  9 ARG HB2  H  -4.947  12.348   3.922 1.00 . A A .  9 ARG HB2  1 1 
        6  6601 1 1  9 ARG HB3  H  -6.575  12.143   4.565 1.00 . A A .  9 ARG HB3  1 1 
        6  6602 1 1  9 ARG HD2  H  -5.124  14.769   3.655 1.00 . A A .  9 ARG HD2  1 1 
        6  6603 1 1  9 ARG HD3  H  -6.819  14.616   4.106 1.00 . A A .  9 ARG HD3  1 1 
        6  6604 1 1  9 ARG HE   H  -5.606  16.187   6.066 1.00 . A A .  9 ARG HE   1 1 
        6  6605 1 1  9 ARG HG2  H  -6.140  13.744   6.319 1.00 . A A .  9 ARG HG2  1 1 
        6  6606 1 1  9 ARG HG3  H  -4.448  13.874   5.843 1.00 . A A .  9 ARG HG3  1 1 
        6  6607 1 1  9 ARG HH11 H  -6.189  16.238   2.655 1.00 . A A .  9 ARG HH11 1 1 
        6  6608 1 1  9 ARG HH12 H  -6.292  17.964   2.558 1.00 . A A .  9 ARG HH12 1 1 
        6  6609 1 1  9 ARG HH21 H  -5.743  18.453   5.947 1.00 . A A .  9 ARG HH21 1 1 
        6  6610 1 1  9 ARG HH22 H  -6.037  19.218   4.421 1.00 . A A .  9 ARG HH22 1 1 
        6  6611 1 1  9 ARG N    N  -4.988   9.965   5.084 1.00 . A A .  9 ARG N    1 1 
        6  6612 1 1  9 ARG NE   N  -5.770  16.115   5.103 1.00 . A A .  9 ARG NE   1 1 
        6  6613 1 1  9 ARG NH1  N  -6.159  17.133   3.099 1.00 . A A .  9 ARG NH1  1 1 
        6  6614 1 1  9 ARG NH2  N  -5.905  18.388   4.962 1.00 . A A .  9 ARG NH2  1 1 
        6  6615 1 1  9 ARG O    O  -5.716  11.909   7.984 1.00 . A A .  9 ARG O    1 1 
        6  6616 1 1 10 VAL C    C  -7.402   9.614   9.227 1.00 . A A . 10 VAL C    1 1 
        6  6617 1 1 10 VAL CA   C  -7.991  10.293   7.986 1.00 . A A . 10 VAL CA   1 1 
        6  6618 1 1 10 VAL CB   C  -9.212   9.512   7.489 1.00 . A A . 10 VAL CB   1 1 
        6  6619 1 1 10 VAL CG1  C -10.157   9.212   8.657 1.00 . A A . 10 VAL CG1  1 1 
        6  6620 1 1 10 VAL CG2  C  -9.951  10.346   6.440 1.00 . A A . 10 VAL CG2  1 1 
        6  6621 1 1 10 VAL H    H  -7.147   9.876   6.104 1.00 . A A . 10 VAL H    1 1 
        6  6622 1 1 10 VAL HA   H  -8.319  11.259   8.336 1.00 . A A . 10 VAL HA   1 1 
        6  6623 1 1 10 VAL HB   H  -8.886   8.582   7.046 1.00 . A A . 10 VAL HB   1 1 
        6  6624 1 1 10 VAL HG11 H -11.112   8.887   8.273 1.00 . A A . 10 VAL HG11 1 1 
        6  6625 1 1 10 VAL HG12 H -10.293  10.105   9.248 1.00 . A A . 10 VAL HG12 1 1 
        6  6626 1 1 10 VAL HG13 H  -9.734   8.434   9.273 1.00 . A A . 10 VAL HG13 1 1 
        6  6627 1 1 10 VAL HG21 H -10.281  11.273   6.884 1.00 . A A . 10 VAL HG21 1 1 
        6  6628 1 1 10 VAL HG22 H -10.808   9.794   6.081 1.00 . A A . 10 VAL HG22 1 1 
        6  6629 1 1 10 VAL HG23 H  -9.287  10.557   5.615 1.00 . A A . 10 VAL HG23 1 1 
        6  6630 1 1 10 VAL N    N  -7.019  10.431   6.903 1.00 . A A . 10 VAL N    1 1 
        6  6631 1 1 10 VAL O    O  -7.716  10.024  10.344 1.00 . A A . 10 VAL O    1 1 
        6  6632 1 1 11 SER C    C  -5.119   8.918  11.053 1.00 . A A . 11 SER C    1 1 
        6  6633 1 1 11 SER CA   C  -6.001   7.953  10.260 1.00 . A A . 11 SER CA   1 1 
        6  6634 1 1 11 SER CB   C  -5.183   6.728   9.850 1.00 . A A . 11 SER CB   1 1 
        6  6635 1 1 11 SER H    H  -6.290   8.288   8.185 1.00 . A A . 11 SER H    1 1 
        6  6636 1 1 11 SER HA   H  -6.777   7.640  10.941 1.00 . A A . 11 SER HA   1 1 
        6  6637 1 1 11 SER HB2  H  -4.772   6.257  10.727 1.00 . A A . 11 SER HB2  1 1 
        6  6638 1 1 11 SER HB3  H  -5.824   6.025   9.335 1.00 . A A . 11 SER HB3  1 1 
        6  6639 1 1 11 SER HG   H  -4.460   7.170   8.100 1.00 . A A . 11 SER HG   1 1 
        6  6640 1 1 11 SER N    N  -6.562   8.597   9.074 1.00 . A A . 11 SER N    1 1 
        6  6641 1 1 11 SER O    O  -5.318   9.070  12.232 1.00 . A A . 11 SER O    1 1 
        6  6642 1 1 11 SER OG   O  -4.121   7.136   8.997 1.00 . A A . 11 SER OG   1 1 
        6  6643 1 1 12 ILE C    C  -4.065  11.515  11.966 1.00 . A A . 12 ILE C    1 1 
        6  6644 1 1 12 ILE CA   C  -3.258  10.453  11.172 1.00 . A A . 12 ILE CA   1 1 
        6  6645 1 1 12 ILE CB   C  -2.273  11.128  10.194 1.00 . A A . 12 ILE CB   1 1 
        6  6646 1 1 12 ILE CD1  C  -2.039  12.432   8.075 1.00 . A A . 12 ILE CD1  1 1 
        6  6647 1 1 12 ILE CG1  C  -3.014  11.659   8.965 1.00 . A A . 12 ILE CG1  1 1 
        6  6648 1 1 12 ILE CG2  C  -1.222  10.109   9.735 1.00 . A A . 12 ILE CG2  1 1 
        6  6649 1 1 12 ILE H    H  -4.009   9.321   9.481 1.00 . A A . 12 ILE H    1 1 
        6  6650 1 1 12 ILE HA   H  -2.671   9.854  11.848 1.00 . A A . 12 ILE HA   1 1 
        6  6651 1 1 12 ILE HB   H  -1.778  11.946  10.697 1.00 . A A . 12 ILE HB   1 1 
        6  6652 1 1 12 ILE HD11 H  -1.379  11.737   7.577 1.00 . A A . 12 ILE HD11 1 1 
        6  6653 1 1 12 ILE HD12 H  -1.456  13.109   8.682 1.00 . A A . 12 ILE HD12 1 1 
        6  6654 1 1 12 ILE HD13 H  -2.592  12.995   7.337 1.00 . A A . 12 ILE HD13 1 1 
        6  6655 1 1 12 ILE HG12 H  -3.433  10.833   8.410 1.00 . A A . 12 ILE HG12 1 1 
        6  6656 1 1 12 ILE HG13 H  -3.799  12.315   9.276 1.00 . A A . 12 ILE HG13 1 1 
        6  6657 1 1 12 ILE HG21 H  -0.711   9.704  10.596 1.00 . A A . 12 ILE HG21 1 1 
        6  6658 1 1 12 ILE HG22 H  -0.505  10.595   9.090 1.00 . A A . 12 ILE HG22 1 1 
        6  6659 1 1 12 ILE HG23 H  -1.707   9.309   9.195 1.00 . A A . 12 ILE HG23 1 1 
        6  6660 1 1 12 ILE N    N  -4.149   9.547  10.424 1.00 . A A . 12 ILE N    1 1 
        6  6661 1 1 12 ILE O    O  -3.836  11.767  13.148 1.00 . A A . 12 ILE O    1 1 
        6  6662 1 1 13 ILE C    C  -6.745  12.520  13.040 1.00 . A A . 13 ILE C    1 1 
        6  6663 1 1 13 ILE CA   C  -5.932  13.082  11.837 1.00 . A A . 13 ILE CA   1 1 
        6  6664 1 1 13 ILE CB   C  -6.903  13.657  10.783 1.00 . A A . 13 ILE CB   1 1 
        6  6665 1 1 13 ILE CD1  C  -7.055  14.914   8.626 1.00 . A A . 13 ILE CD1  1 1 
        6  6666 1 1 13 ILE CG1  C  -6.138  14.543   9.794 1.00 . A A . 13 ILE CG1  1 1 
        6  6667 1 1 13 ILE CG2  C  -7.985  14.506  11.475 1.00 . A A . 13 ILE CG2  1 1 
        6  6668 1 1 13 ILE H    H  -5.067  11.664  10.371 1.00 . A A . 13 ILE H    1 1 
        6  6669 1 1 13 ILE HA   H  -5.329  13.893  12.220 1.00 . A A . 13 ILE HA   1 1 
        6  6670 1 1 13 ILE HB   H  -7.375  12.844  10.251 1.00 . A A . 13 ILE HB   1 1 
        6  6671 1 1 13 ILE HD11 H  -6.487  15.440   7.875 1.00 . A A . 13 ILE HD11 1 1 
        6  6672 1 1 13 ILE HD12 H  -7.852  15.550   8.985 1.00 . A A . 13 ILE HD12 1 1 
        6  6673 1 1 13 ILE HD13 H  -7.477  14.016   8.201 1.00 . A A . 13 ILE HD13 1 1 
        6  6674 1 1 13 ILE HG12 H  -5.812  15.442  10.295 1.00 . A A . 13 ILE HG12 1 1 
        6  6675 1 1 13 ILE HG13 H  -5.285  14.012   9.419 1.00 . A A . 13 ILE HG13 1 1 
        6  6676 1 1 13 ILE HG21 H  -7.522  15.153  12.205 1.00 . A A . 13 ILE HG21 1 1 
        6  6677 1 1 13 ILE HG22 H  -8.693  13.857  11.969 1.00 . A A . 13 ILE HG22 1 1 
        6  6678 1 1 13 ILE HG23 H  -8.504  15.105  10.743 1.00 . A A . 13 ILE HG23 1 1 
        6  6679 1 1 13 ILE N    N  -5.021  12.072  11.260 1.00 . A A . 13 ILE N    1 1 
        6  6680 1 1 13 ILE O    O  -6.835  13.165  14.085 1.00 . A A . 13 ILE O    1 1 
        6  6681 1 1 14 GLY C    C  -7.061   9.889  14.976 1.00 . A A . 14 GLY C    1 1 
        6  6682 1 1 14 GLY CA   C  -8.009  10.649  14.012 1.00 . A A . 14 GLY CA   1 1 
        6  6683 1 1 14 GLY H    H  -7.016  10.810  12.095 1.00 . A A . 14 GLY H    1 1 
        6  6684 1 1 14 GLY HA2  H  -8.545  11.402  14.570 1.00 . A A . 14 GLY HA2  1 1 
        6  6685 1 1 14 GLY HA3  H  -8.717   9.949  13.596 1.00 . A A . 14 GLY HA3  1 1 
        6  6686 1 1 14 GLY N    N  -7.271  11.306  12.901 1.00 . A A . 14 GLY N    1 1 
        6  6687 1 1 14 GLY O    O  -7.322   9.730  16.169 1.00 . A A . 14 GLY O    1 1 
        6  6688 1 1 15 THR C    C  -4.028   9.569  15.943 1.00 . A A . 15 THR C    1 1 
        6  6689 1 1 15 THR CA   C  -4.914   8.681  15.073 1.00 . A A . 15 THR CA   1 1 
        6  6690 1 1 15 THR CB   C  -4.035   7.881  14.109 1.00 . A A . 15 THR CB   1 1 
        6  6691 1 1 15 THR CG2  C  -3.050   7.025  14.908 1.00 . A A . 15 THR CG2  1 1 
        6  6692 1 1 15 THR H    H  -5.924   9.718  13.448 1.00 . A A . 15 THR H    1 1 
        6  6693 1 1 15 THR HA   H  -5.400   7.981  15.737 1.00 . A A . 15 THR HA   1 1 
        6  6694 1 1 15 THR HB   H  -3.482   8.552  13.484 1.00 . A A . 15 THR HB   1 1 
        6  6695 1 1 15 THR HG1  H  -5.584   6.732  13.855 1.00 . A A . 15 THR HG1  1 1 
        6  6696 1 1 15 THR HG21 H  -3.571   6.533  15.717 1.00 . A A . 15 THR HG21 1 1 
        6  6697 1 1 15 THR HG22 H  -2.272   7.655  15.312 1.00 . A A . 15 THR HG22 1 1 
        6  6698 1 1 15 THR HG23 H  -2.610   6.283  14.259 1.00 . A A . 15 THR HG23 1 1 
        6  6699 1 1 15 THR N    N  -5.975   9.441  14.382 1.00 . A A . 15 THR N    1 1 
        6  6700 1 1 15 THR O    O  -3.477   9.107  16.942 1.00 . A A . 15 THR O    1 1 
        6  6701 1 1 15 THR OG1  O  -4.851   7.032  13.312 1.00 . A A . 15 THR OG1  1 1 
        6  6702 1 1 16 THR C    C  -3.789  12.257  17.612 1.00 . A A . 16 THR C    1 1 
        6  6703 1 1 16 THR CA   C  -3.084  11.779  16.346 1.00 . A A . 16 THR CA   1 1 
        6  6704 1 1 16 THR CB   C  -2.711  12.985  15.481 1.00 . A A . 16 THR CB   1 1 
        6  6705 1 1 16 THR CG2  C  -1.864  13.962  16.299 1.00 . A A . 16 THR CG2  1 1 
        6  6706 1 1 16 THR H    H  -4.401  11.200  14.819 1.00 . A A . 16 THR H    1 1 
        6  6707 1 1 16 THR HA   H  -2.175  11.279  16.645 1.00 . A A . 16 THR HA   1 1 
        6  6708 1 1 16 THR HB   H  -3.609  13.485  15.150 1.00 . A A . 16 THR HB   1 1 
        6  6709 1 1 16 THR HG1  H  -1.890  13.283  13.743 1.00 . A A . 16 THR HG1  1 1 
        6  6710 1 1 16 THR HG21 H  -1.375  14.658  15.633 1.00 . A A . 16 THR HG21 1 1 
        6  6711 1 1 16 THR HG22 H  -1.119  13.415  16.857 1.00 . A A . 16 THR HG22 1 1 
        6  6712 1 1 16 THR HG23 H  -2.500  14.506  16.983 1.00 . A A . 16 THR HG23 1 1 
        6  6713 1 1 16 THR N    N  -3.897  10.841  15.579 1.00 . A A . 16 THR N    1 1 
        6  6714 1 1 16 THR O    O  -3.145  12.576  18.611 1.00 . A A . 16 THR O    1 1 
        6  6715 1 1 16 THR OG1  O  -1.968  12.545  14.353 1.00 . A A . 16 THR OG1  1 1 
        6  6716 1 1 17 LEU C    C  -6.139  11.919  19.806 1.00 . A A . 17 LEU C    1 1 
        6  6717 1 1 17 LEU CA   C  -5.942  12.873  18.625 1.00 . A A . 17 LEU CA   1 1 
        6  6718 1 1 17 LEU CB   C  -7.313  13.265  18.056 1.00 . A A . 17 LEU CB   1 1 
        6  6719 1 1 17 LEU CD1  C  -7.440  15.430  19.369 1.00 . A A . 17 LEU CD1  1 1 
        6  6720 1 1 17 LEU CD2  C  -9.537  14.319  18.522 1.00 . A A . 17 LEU CD2  1 1 
        6  6721 1 1 17 LEU CG   C  -8.126  14.078  19.082 1.00 . A A . 17 LEU CG   1 1 
        6  6722 1 1 17 LEU H    H  -5.602  12.128  16.723 1.00 . A A . 17 LEU H    1 1 
        6  6723 1 1 17 LEU HA   H  -5.483  13.756  19.030 1.00 . A A . 17 LEU HA   1 1 
        6  6724 1 1 17 LEU HB2  H  -7.171  13.858  17.164 1.00 . A A . 17 LEU HB2  1 1 
        6  6725 1 1 17 LEU HB3  H  -7.860  12.370  17.802 1.00 . A A . 17 LEU HB3  1 1 
        6  6726 1 1 17 LEU HD11 H  -6.739  15.312  20.181 1.00 . A A . 17 LEU HD11 1 1 
        6  6727 1 1 17 LEU HD12 H  -8.180  16.167  19.647 1.00 . A A . 17 LEU HD12 1 1 
        6  6728 1 1 17 LEU HD13 H  -6.913  15.769  18.487 1.00 . A A . 17 LEU HD13 1 1 
        6  6729 1 1 17 LEU HD21 H -10.008  15.124  19.067 1.00 . A A . 17 LEU HD21 1 1 
        6  6730 1 1 17 LEU HD22 H -10.125  13.420  18.631 1.00 . A A . 17 LEU HD22 1 1 
        6  6731 1 1 17 LEU HD23 H  -9.473  14.581  17.476 1.00 . A A . 17 LEU HD23 1 1 
        6  6732 1 1 17 LEU HG   H  -8.202  13.518  20.002 1.00 . A A . 17 LEU HG   1 1 
        6  6733 1 1 17 LEU N    N  -5.111  12.367  17.537 1.00 . A A . 17 LEU N    1 1 
        6  6734 1 1 17 LEU O    O  -6.399  12.388  20.914 1.00 . A A . 17 LEU O    1 1 
        6  6735 1 1 18 VAL C    C  -5.311  10.037  21.877 1.00 . A A . 18 VAL C    1 1 
        6  6736 1 1 18 VAL CA   C  -6.330   9.745  20.775 1.00 . A A . 18 VAL CA   1 1 
        6  6737 1 1 18 VAL CB   C  -6.238   8.273  20.356 1.00 . A A . 18 VAL CB   1 1 
        6  6738 1 1 18 VAL CG1  C  -6.299   7.374  21.594 1.00 . A A . 18 VAL CG1  1 1 
        6  6739 1 1 18 VAL CG2  C  -7.406   7.939  19.422 1.00 . A A . 18 VAL CG2  1 1 
        6  6740 1 1 18 VAL H    H  -5.850  10.209  18.754 1.00 . A A . 18 VAL H    1 1 
        6  6741 1 1 18 VAL HA   H  -7.342   9.955  21.087 1.00 . A A . 18 VAL HA   1 1 
        6  6742 1 1 18 VAL HB   H  -5.304   8.106  19.839 1.00 . A A . 18 VAL HB   1 1 
        6  6743 1 1 18 VAL HG11 H  -7.070   7.730  22.262 1.00 . A A . 18 VAL HG11 1 1 
        6  6744 1 1 18 VAL HG12 H  -5.346   7.395  22.102 1.00 . A A . 18 VAL HG12 1 1 
        6  6745 1 1 18 VAL HG13 H  -6.523   6.360  21.295 1.00 . A A . 18 VAL HG13 1 1 
        6  6746 1 1 18 VAL HG21 H  -8.313   7.845  20.001 1.00 . A A . 18 VAL HG21 1 1 
        6  6747 1 1 18 VAL HG22 H  -7.205   7.007  18.914 1.00 . A A . 18 VAL HG22 1 1 
        6  6748 1 1 18 VAL HG23 H  -7.522   8.728  18.693 1.00 . A A . 18 VAL HG23 1 1 
        6  6749 1 1 18 VAL N    N  -6.073  10.603  19.623 1.00 . A A . 18 VAL N    1 1 
        6  6750 1 1 18 VAL O    O  -5.660  10.260  23.036 1.00 . A A . 18 VAL O    1 1 
        6  6751 1 1 19 ALA C    C  -2.961  11.573  23.063 1.00 . A A . 19 ALA C    1 1 
        6  6752 1 1 19 ALA CA   C  -2.918  10.204  22.389 1.00 . A A . 19 ALA CA   1 1 
        6  6753 1 1 19 ALA CB   C  -1.606  10.064  21.614 1.00 . A A . 19 ALA CB   1 1 
        6  6754 1 1 19 ALA H    H  -3.851   9.724  20.558 1.00 . A A . 19 ALA H    1 1 
        6  6755 1 1 19 ALA HA   H  -2.943   9.438  23.145 1.00 . A A . 19 ALA HA   1 1 
        6  6756 1 1 19 ALA HB1  H  -1.415  10.972  21.058 1.00 . A A . 19 ALA HB1  1 1 
        6  6757 1 1 19 ALA HB2  H  -1.679   9.233  20.930 1.00 . A A . 19 ALA HB2  1 1 
        6  6758 1 1 19 ALA HB3  H  -0.796   9.891  22.307 1.00 . A A . 19 ALA HB3  1 1 
        6  6759 1 1 19 ALA N    N  -4.043   9.991  21.481 1.00 . A A . 19 ALA N    1 1 
        6  6760 1 1 19 ALA O    O  -2.512  11.727  24.199 1.00 . A A . 19 ALA O    1 1 
        6  6761 1 1 20 LEU C    C  -4.576  13.934  24.096 1.00 . A A . 20 LEU C    1 1 
        6  6762 1 1 20 LEU CA   C  -3.580  13.908  22.930 1.00 . A A . 20 LEU CA   1 1 
        6  6763 1 1 20 LEU CB   C  -3.982  14.920  21.843 1.00 . A A . 20 LEU CB   1 1 
        6  6764 1 1 20 LEU CD1  C  -3.773  17.272  21.022 1.00 . A A . 20 LEU CD1  1 1 
        6  6765 1 1 20 LEU CD2  C  -4.011  16.836  23.484 1.00 . A A . 20 LEU CD2  1 1 
        6  6766 1 1 20 LEU CG   C  -3.420  16.313  22.163 1.00 . A A . 20 LEU CG   1 1 
        6  6767 1 1 20 LEU H    H  -3.872  12.370  21.480 1.00 . A A . 20 LEU H    1 1 
        6  6768 1 1 20 LEU HA   H  -2.618  14.173  23.342 1.00 . A A . 20 LEU HA   1 1 
        6  6769 1 1 20 LEU HB2  H  -3.592  14.591  20.891 1.00 . A A . 20 LEU HB2  1 1 
        6  6770 1 1 20 LEU HB3  H  -5.059  14.977  21.782 1.00 . A A . 20 LEU HB3  1 1 
        6  6771 1 1 20 LEU HD11 H  -4.825  17.512  21.066 1.00 . A A . 20 LEU HD11 1 1 
        6  6772 1 1 20 LEU HD12 H  -3.550  16.804  20.075 1.00 . A A . 20 LEU HD12 1 1 
        6  6773 1 1 20 LEU HD13 H  -3.193  18.179  21.122 1.00 . A A . 20 LEU HD13 1 1 
        6  6774 1 1 20 LEU HD21 H  -5.039  16.517  23.578 1.00 . A A . 20 LEU HD21 1 1 
        6  6775 1 1 20 LEU HD22 H  -3.968  17.916  23.502 1.00 . A A . 20 LEU HD22 1 1 
        6  6776 1 1 20 LEU HD23 H  -3.436  16.446  24.310 1.00 . A A . 20 LEU HD23 1 1 
        6  6777 1 1 20 LEU HG   H  -2.345  16.249  22.251 1.00 . A A . 20 LEU HG   1 1 
        6  6778 1 1 20 LEU N    N  -3.499  12.564  22.365 1.00 . A A . 20 LEU N    1 1 
        6  6779 1 1 20 LEU O    O  -4.263  14.456  25.165 1.00 . A A . 20 LEU O    1 1 
        6  6780 1 1 21 SER C    C  -6.374  12.291  26.046 1.00 . A A . 21 SER C    1 1 
        6  6781 1 1 21 SER CA   C  -6.746  13.332  24.990 1.00 . A A . 21 SER CA   1 1 
        6  6782 1 1 21 SER CB   C  -8.131  13.018  24.422 1.00 . A A . 21 SER CB   1 1 
        6  6783 1 1 21 SER H    H  -5.974  12.935  23.054 1.00 . A A . 21 SER H    1 1 
        6  6784 1 1 21 SER HA   H  -6.776  14.311  25.446 1.00 . A A . 21 SER HA   1 1 
        6  6785 1 1 21 SER HB2  H  -8.873  13.131  25.194 1.00 . A A . 21 SER HB2  1 1 
        6  6786 1 1 21 SER HB3  H  -8.350  13.702  23.613 1.00 . A A . 21 SER HB3  1 1 
        6  6787 1 1 21 SER HG   H  -7.750  11.668  23.073 1.00 . A A . 21 SER HG   1 1 
        6  6788 1 1 21 SER N    N  -5.759  13.357  23.911 1.00 . A A . 21 SER N    1 1 
        6  6789 1 1 21 SER O    O  -6.886  12.304  27.154 1.00 . A A . 21 SER O    1 1 
        6  6790 1 1 21 SER OG   O  -8.152  11.679  23.945 1.00 . A A . 21 SER OG   1 1 
        6  6791 1 1 22 SER C    C  -4.098  10.757  27.605 1.00 . A A . 22 SER C    1 1 
        6  6792 1 1 22 SER CA   C  -5.101  10.278  26.544 1.00 . A A . 22 SER CA   1 1 
        6  6793 1 1 22 SER CB   C  -4.430   9.179  25.724 1.00 . A A . 22 SER CB   1 1 
        6  6794 1 1 22 SER H    H  -5.209  11.421  24.726 1.00 . A A . 22 SER H    1 1 
        6  6795 1 1 22 SER HA   H  -5.997   9.860  26.979 1.00 . A A . 22 SER HA   1 1 
        6  6796 1 1 22 SER HB2  H  -5.045   8.930  24.876 1.00 . A A . 22 SER HB2  1 1 
        6  6797 1 1 22 SER HB3  H  -3.468   9.531  25.381 1.00 . A A . 22 SER HB3  1 1 
        6  6798 1 1 22 SER HG   H  -4.609   7.270  26.059 1.00 . A A . 22 SER HG   1 1 
        6  6799 1 1 22 SER N    N  -5.520  11.364  25.654 1.00 . A A . 22 SER N    1 1 
        6  6800 1 1 22 SER O    O  -3.870  10.097  28.618 1.00 . A A . 22 SER O    1 1 
        6  6801 1 1 22 SER OG   O  -4.262   8.026  26.539 1.00 . A A . 22 SER OG   1 1 
        6  6802 1 1 23 PHE C    C  -3.208  13.262  29.459 1.00 . A A . 23 PHE C    1 1 
        6  6803 1 1 23 PHE CA   C  -2.536  12.506  28.280 1.00 . A A . 23 PHE CA   1 1 
        6  6804 1 1 23 PHE CB   C  -1.515  13.403  27.526 1.00 . A A . 23 PHE CB   1 1 
        6  6805 1 1 23 PHE CD1  C   0.667  13.166  28.776 1.00 . A A . 23 PHE CD1  1 1 
        6  6806 1 1 23 PHE CD2  C   0.401  11.965  26.686 1.00 . A A . 23 PHE CD2  1 1 
        6  6807 1 1 23 PHE CE1  C   1.955  12.634  28.917 1.00 . A A . 23 PHE CE1  1 1 
        6  6808 1 1 23 PHE CE2  C   1.688  11.433  26.828 1.00 . A A . 23 PHE CE2  1 1 
        6  6809 1 1 23 PHE CG   C  -0.110  12.831  27.660 1.00 . A A . 23 PHE CG   1 1 
        6  6810 1 1 23 PHE CZ   C   2.465  11.767  27.943 1.00 . A A . 23 PHE CZ   1 1 
        6  6811 1 1 23 PHE H    H  -3.874  12.386  26.550 1.00 . A A . 23 PHE H    1 1 
        6  6812 1 1 23 PHE HA   H  -2.005  11.692  28.757 1.00 . A A . 23 PHE HA   1 1 
        6  6813 1 1 23 PHE HB2  H  -1.783  13.442  26.481 1.00 . A A . 23 PHE HB2  1 1 
        6  6814 1 1 23 PHE HB3  H  -1.531  14.405  27.933 1.00 . A A . 23 PHE HB3  1 1 
        6  6815 1 1 23 PHE HD1  H   0.273  13.835  29.527 1.00 . A A . 23 PHE HD1  1 1 
        6  6816 1 1 23 PHE HD2  H  -0.198  11.706  25.826 1.00 . A A . 23 PHE HD2  1 1 
        6  6817 1 1 23 PHE HE1  H   2.553  12.893  29.778 1.00 . A A . 23 PHE HE1  1 1 
        6  6818 1 1 23 PHE HE2  H   2.082  10.764  26.077 1.00 . A A . 23 PHE HE2  1 1 
        6  6819 1 1 23 PHE HZ   H   3.457  11.363  28.052 1.00 . A A . 23 PHE HZ   1 1 
        6  6820 1 1 23 PHE N    N  -3.516  11.928  27.338 1.00 . A A . 23 PHE N    1 1 
        6  6821 1 1 23 PHE O    O  -2.698  13.179  30.577 1.00 . A A . 23 PHE O    1 1 
        6  6822 1 1 24 THR C    C  -5.545  13.929  31.471 1.00 . A A . 24 THR C    1 1 
        6  6823 1 1 24 THR CA   C  -4.886  14.797  30.368 1.00 . A A . 24 THR CA   1 1 
        6  6824 1 1 24 THR CB   C  -5.937  15.776  29.776 1.00 . A A . 24 THR CB   1 1 
        6  6825 1 1 24 THR CG2  C  -5.538  17.238  30.029 1.00 . A A . 24 THR CG2  1 1 
        6  6826 1 1 24 THR H    H  -4.621  14.229  28.354 1.00 . A A . 24 THR H    1 1 
        6  6827 1 1 24 THR HA   H  -4.095  15.377  30.821 1.00 . A A . 24 THR HA   1 1 
        6  6828 1 1 24 THR HB   H  -6.908  15.596  30.219 1.00 . A A . 24 THR HB   1 1 
        6  6829 1 1 24 THR HG1  H  -6.889  15.182  28.188 1.00 . A A . 24 THR HG1  1 1 
        6  6830 1 1 24 THR HG21 H  -6.269  17.892  29.579 1.00 . A A . 24 THR HG21 1 1 
        6  6831 1 1 24 THR HG22 H  -4.568  17.427  29.593 1.00 . A A . 24 THR HG22 1 1 
        6  6832 1 1 24 THR HG23 H  -5.496  17.421  31.092 1.00 . A A . 24 THR HG23 1 1 
        6  6833 1 1 24 THR N    N  -4.285  14.030  29.253 1.00 . A A . 24 THR N    1 1 
        6  6834 1 1 24 THR O    O  -5.457  14.256  32.654 1.00 . A A . 24 THR O    1 1 
        6  6835 1 1 24 THR OG1  O  -6.026  15.559  28.375 1.00 . A A . 24 THR OG1  1 1 
        6  6836 1 1 25 PRO C    C  -6.170  11.590  33.308 1.00 . A A . 25 PRO C    1 1 
        6  6837 1 1 25 PRO CA   C  -6.954  11.976  32.056 1.00 . A A . 25 PRO CA   1 1 
        6  6838 1 1 25 PRO CB   C  -7.257  10.749  31.200 1.00 . A A . 25 PRO CB   1 1 
        6  6839 1 1 25 PRO CD   C  -6.413  12.437  29.720 1.00 . A A . 25 PRO CD   1 1 
        6  6840 1 1 25 PRO CG   C  -7.441  11.310  29.834 1.00 . A A . 25 PRO CG   1 1 
        6  6841 1 1 25 PRO HA   H  -7.886  12.434  32.345 1.00 . A A . 25 PRO HA   1 1 
        6  6842 1 1 25 PRO HB2  H  -6.423  10.059  31.219 1.00 . A A . 25 PRO HB2  1 1 
        6  6843 1 1 25 PRO HB3  H  -8.163  10.264  31.531 1.00 . A A . 25 PRO HB3  1 1 
        6  6844 1 1 25 PRO HD2  H  -5.496  12.060  29.308 1.00 . A A . 25 PRO HD2  1 1 
        6  6845 1 1 25 PRO HD3  H  -6.797  13.255  29.133 1.00 . A A . 25 PRO HD3  1 1 
        6  6846 1 1 25 PRO HG2  H  -7.256  10.546  29.088 1.00 . A A . 25 PRO HG2  1 1 
        6  6847 1 1 25 PRO HG3  H  -8.437  11.710  29.722 1.00 . A A . 25 PRO HG3  1 1 
        6  6848 1 1 25 PRO N    N  -6.225  12.877  31.105 1.00 . A A . 25 PRO N    1 1 
        6  6849 1 1 25 PRO O    O  -6.776  11.255  34.326 1.00 . A A . 25 PRO O    1 1 
        6  6850 1 1 26 VAL C    C  -4.445  12.277  35.604 1.00 . A A . 26 VAL C    1 1 
        6  6851 1 1 26 VAL CA   C  -4.075  11.323  34.465 1.00 . A A . 26 VAL CA   1 1 
        6  6852 1 1 26 VAL CB   C  -2.576  11.423  34.161 1.00 . A A . 26 VAL CB   1 1 
        6  6853 1 1 26 VAL CG1  C  -1.768  11.291  35.455 1.00 . A A . 26 VAL CG1  1 1 
        6  6854 1 1 26 VAL CG2  C  -2.175  10.304  33.196 1.00 . A A . 26 VAL CG2  1 1 
        6  6855 1 1 26 VAL H    H  -4.369  11.968  32.478 1.00 . A A . 26 VAL H    1 1 
        6  6856 1 1 26 VAL HA   H  -4.305  10.317  34.787 1.00 . A A . 26 VAL HA   1 1 
        6  6857 1 1 26 VAL HB   H  -2.368  12.382  33.707 1.00 . A A . 26 VAL HB   1 1 
        6  6858 1 1 26 VAL HG11 H  -0.726  11.141  35.215 1.00 . A A . 26 VAL HG11 1 1 
        6  6859 1 1 26 VAL HG12 H  -2.133  10.447  36.022 1.00 . A A . 26 VAL HG12 1 1 
        6  6860 1 1 26 VAL HG13 H  -1.875  12.192  36.041 1.00 . A A . 26 VAL HG13 1 1 
        6  6861 1 1 26 VAL HG21 H  -2.131   9.367  33.730 1.00 . A A . 26 VAL HG21 1 1 
        6  6862 1 1 26 VAL HG22 H  -1.206  10.524  32.773 1.00 . A A . 26 VAL HG22 1 1 
        6  6863 1 1 26 VAL HG23 H  -2.906  10.233  32.403 1.00 . A A . 26 VAL HG23 1 1 
        6  6864 1 1 26 VAL N    N  -4.847  11.654  33.274 1.00 . A A . 26 VAL N    1 1 
        6  6865 1 1 26 VAL O    O  -4.598  11.854  36.746 1.00 . A A . 26 VAL O    1 1 
        6  6866 1 1 27 LEU C    C  -6.038  14.234  37.176 1.00 . A A . 27 LEU C    1 1 
        6  6867 1 1 27 LEU CA   C  -4.824  14.593  36.306 1.00 . A A . 27 LEU CA   1 1 
        6  6868 1 1 27 LEU CB   C  -5.105  15.928  35.585 1.00 . A A . 27 LEU CB   1 1 
        6  6869 1 1 27 LEU CD1  C  -2.963  15.780  34.296 1.00 . A A . 27 LEU CD1  1 1 
        6  6870 1 1 27 LEU CD2  C  -4.099  17.986  34.586 1.00 . A A . 27 LEU CD2  1 1 
        6  6871 1 1 27 LEU CG   C  -3.789  16.643  35.252 1.00 . A A . 27 LEU CG   1 1 
        6  6872 1 1 27 LEU H    H  -4.325  13.876  34.392 1.00 . A A . 27 LEU H    1 1 
        6  6873 1 1 27 LEU HA   H  -3.935  14.714  36.907 1.00 . A A . 27 LEU HA   1 1 
        6  6874 1 1 27 LEU HB2  H  -5.644  15.731  34.669 1.00 . A A . 27 LEU HB2  1 1 
        6  6875 1 1 27 LEU HB3  H  -5.703  16.569  36.219 1.00 . A A . 27 LEU HB3  1 1 
        6  6876 1 1 27 LEU HD11 H  -2.150  16.366  33.894 1.00 . A A . 27 LEU HD11 1 1 
        6  6877 1 1 27 LEU HD12 H  -3.592  15.435  33.489 1.00 . A A . 27 LEU HD12 1 1 
        6  6878 1 1 27 LEU HD13 H  -2.565  14.931  34.831 1.00 . A A . 27 LEU HD13 1 1 
        6  6879 1 1 27 LEU HD21 H  -4.454  17.815  33.580 1.00 . A A . 27 LEU HD21 1 1 
        6  6880 1 1 27 LEU HD22 H  -3.202  18.587  34.553 1.00 . A A . 27 LEU HD22 1 1 
        6  6881 1 1 27 LEU HD23 H  -4.858  18.502  35.153 1.00 . A A . 27 LEU HD23 1 1 
        6  6882 1 1 27 LEU HG   H  -3.229  16.811  36.161 1.00 . A A . 27 LEU HG   1 1 
        6  6883 1 1 27 LEU N    N  -4.536  13.568  35.298 1.00 . A A . 27 LEU N    1 1 
        6  6884 1 1 27 LEU O    O  -6.142  14.679  38.319 1.00 . A A . 27 LEU O    1 1 
        6  6885 1 1 28 VAL C    C  -7.848  12.092  38.509 1.00 . A A . 28 VAL C    1 1 
        6  6886 1 1 28 VAL CA   C  -8.161  13.028  37.340 1.00 . A A . 28 VAL CA   1 1 
        6  6887 1 1 28 VAL CB   C  -9.116  12.329  36.364 1.00 . A A . 28 VAL CB   1 1 
        6  6888 1 1 28 VAL CG1  C -10.322  11.764  37.122 1.00 . A A . 28 VAL CG1  1 1 
        6  6889 1 1 28 VAL CG2  C  -9.602  13.336  35.320 1.00 . A A . 28 VAL CG2  1 1 
        6  6890 1 1 28 VAL H    H  -6.815  13.085  35.724 1.00 . A A . 28 VAL H    1 1 
        6  6891 1 1 28 VAL HA   H  -8.652  13.906  37.729 1.00 . A A . 28 VAL HA   1 1 
        6  6892 1 1 28 VAL HB   H  -8.595  11.521  35.870 1.00 . A A . 28 VAL HB   1 1 
        6  6893 1 1 28 VAL HG11 H -10.714  12.519  37.787 1.00 . A A . 28 VAL HG11 1 1 
        6  6894 1 1 28 VAL HG12 H -10.016  10.901  37.695 1.00 . A A . 28 VAL HG12 1 1 
        6  6895 1 1 28 VAL HG13 H -11.086  11.473  36.416 1.00 . A A . 28 VAL HG13 1 1 
        6  6896 1 1 28 VAL HG21 H  -8.751  13.826  34.868 1.00 . A A . 28 VAL HG21 1 1 
        6  6897 1 1 28 VAL HG22 H -10.232  14.072  35.795 1.00 . A A . 28 VAL HG22 1 1 
        6  6898 1 1 28 VAL HG23 H -10.166  12.820  34.557 1.00 . A A . 28 VAL HG23 1 1 
        6  6899 1 1 28 VAL N    N  -6.950  13.440  36.627 1.00 . A A . 28 VAL N    1 1 
        6  6900 1 1 28 VAL O    O  -8.506  12.138  39.548 1.00 . A A . 28 VAL O    1 1 
        6  6901 1 1 29 ILE C    C  -6.221  11.146  40.710 1.00 . A A . 29 ILE C    1 1 
        6  6902 1 1 29 ILE CA   C  -6.406  10.367  39.406 1.00 . A A . 29 ILE CA   1 1 
        6  6903 1 1 29 ILE CB   C  -5.108   9.620  39.036 1.00 . A A . 29 ILE CB   1 1 
        6  6904 1 1 29 ILE CD1  C  -3.128  10.399  40.425 1.00 . A A . 29 ILE CD1  1 1 
        6  6905 1 1 29 ILE CG1  C  -3.884  10.581  39.101 1.00 . A A . 29 ILE CG1  1 1 
        6  6906 1 1 29 ILE CG2  C  -5.243   9.025  37.624 1.00 . A A . 29 ILE CG2  1 1 
        6  6907 1 1 29 ILE H    H  -6.279  11.372  37.529 1.00 . A A . 29 ILE H    1 1 
        6  6908 1 1 29 ILE HA   H  -7.183   9.643  39.607 1.00 . A A . 29 ILE HA   1 1 
        6  6909 1 1 29 ILE HB   H  -4.969   8.805  39.735 1.00 . A A . 29 ILE HB   1 1 
        6  6910 1 1 29 ILE HD11 H  -3.834  10.285  41.234 1.00 . A A . 29 ILE HD11 1 1 
        6  6911 1 1 29 ILE HD12 H  -2.509  11.264  40.608 1.00 . A A . 29 ILE HD12 1 1 
        6  6912 1 1 29 ILE HD13 H  -2.505   9.518  40.366 1.00 . A A . 29 ILE HD13 1 1 
        6  6913 1 1 29 ILE HG12 H  -3.207  10.368  38.284 1.00 . A A . 29 ILE HG12 1 1 
        6  6914 1 1 29 ILE HG13 H  -4.215  11.604  39.024 1.00 . A A . 29 ILE HG13 1 1 
        6  6915 1 1 29 ILE HG21 H  -4.270   8.719  37.271 1.00 . A A . 29 ILE HG21 1 1 
        6  6916 1 1 29 ILE HG22 H  -5.651   9.763  36.952 1.00 . A A . 29 ILE HG22 1 1 
        6  6917 1 1 29 ILE HG23 H  -5.898   8.167  37.656 1.00 . A A . 29 ILE HG23 1 1 
        6  6918 1 1 29 ILE N    N  -6.819  11.276  38.341 1.00 . A A . 29 ILE N    1 1 
        6  6919 1 1 29 ILE O    O  -6.472  10.610  41.790 1.00 . A A . 29 ILE O    1 1 
        6  6920 1 1 30 LEU C    C  -6.836  13.391  42.659 1.00 . A A . 30 LEU C    1 1 
        6  6921 1 1 30 LEU CA   C  -5.570  13.231  41.807 1.00 . A A . 30 LEU CA   1 1 
        6  6922 1 1 30 LEU CB   C  -5.069  14.614  41.364 1.00 . A A . 30 LEU CB   1 1 
        6  6923 1 1 30 LEU CD1  C  -3.700  14.890  43.470 1.00 . A A . 30 LEU CD1  1 1 
        6  6924 1 1 30 LEU CD2  C  -4.323  16.886  42.082 1.00 . A A . 30 LEU CD2  1 1 
        6  6925 1 1 30 LEU CG   C  -4.789  15.514  42.581 1.00 . A A . 30 LEU CG   1 1 
        6  6926 1 1 30 LEU H    H  -5.567  12.814  39.764 1.00 . A A . 30 LEU H    1 1 
        6  6927 1 1 30 LEU HA   H  -4.814  12.779  42.423 1.00 . A A . 30 LEU HA   1 1 
        6  6928 1 1 30 LEU HB2  H  -4.159  14.497  40.795 1.00 . A A . 30 LEU HB2  1 1 
        6  6929 1 1 30 LEU HB3  H  -5.819  15.081  40.743 1.00 . A A . 30 LEU HB3  1 1 
        6  6930 1 1 30 LEU HD11 H  -2.967  14.392  42.853 1.00 . A A . 30 LEU HD11 1 1 
        6  6931 1 1 30 LEU HD12 H  -4.150  14.174  44.143 1.00 . A A . 30 LEU HD12 1 1 
        6  6932 1 1 30 LEU HD13 H  -3.215  15.662  44.051 1.00 . A A . 30 LEU HD13 1 1 
        6  6933 1 1 30 LEU HD21 H  -3.975  17.474  42.919 1.00 . A A . 30 LEU HD21 1 1 
        6  6934 1 1 30 LEU HD22 H  -5.146  17.394  41.602 1.00 . A A . 30 LEU HD22 1 1 
        6  6935 1 1 30 LEU HD23 H  -3.517  16.757  41.374 1.00 . A A . 30 LEU HD23 1 1 
        6  6936 1 1 30 LEU HG   H  -5.694  15.636  43.158 1.00 . A A . 30 LEU HG   1 1 
        6  6937 1 1 30 LEU N    N  -5.783  12.399  40.624 1.00 . A A . 30 LEU N    1 1 
        6  6938 1 1 30 LEU O    O  -6.741  13.532  43.877 1.00 . A A . 30 LEU O    1 1 
        6  6939 1 1 31 LEU C    C  -9.558  12.139  43.558 1.00 . A A . 31 LEU C    1 1 
        6  6940 1 1 31 LEU CA   C  -9.254  13.453  42.820 1.00 . A A . 31 LEU CA   1 1 
        6  6941 1 1 31 LEU CB   C -10.411  13.789  41.868 1.00 . A A . 31 LEU CB   1 1 
        6  6942 1 1 31 LEU CD1  C -11.635  15.034  43.690 1.00 . A A . 31 LEU CD1  1 1 
        6  6943 1 1 31 LEU CD2  C -12.857  14.236  41.650 1.00 . A A . 31 LEU CD2  1 1 
        6  6944 1 1 31 LEU CG   C -11.734  13.913  42.642 1.00 . A A . 31 LEU CG   1 1 
        6  6945 1 1 31 LEU H    H  -8.072  13.141  41.094 1.00 . A A . 31 LEU H    1 1 
        6  6946 1 1 31 LEU HA   H  -9.145  14.261  43.526 1.00 . A A . 31 LEU HA   1 1 
        6  6947 1 1 31 LEU HB2  H -10.201  14.725  41.370 1.00 . A A . 31 LEU HB2  1 1 
        6  6948 1 1 31 LEU HB3  H -10.503  13.006  41.131 1.00 . A A . 31 LEU HB3  1 1 
        6  6949 1 1 31 LEU HD11 H -11.165  14.649  44.583 1.00 . A A . 31 LEU HD11 1 1 
        6  6950 1 1 31 LEU HD12 H -12.626  15.391  43.937 1.00 . A A . 31 LEU HD12 1 1 
        6  6951 1 1 31 LEU HD13 H -11.048  15.851  43.296 1.00 . A A . 31 LEU HD13 1 1 
        6  6952 1 1 31 LEU HD21 H -12.843  13.517  40.844 1.00 . A A . 31 LEU HD21 1 1 
        6  6953 1 1 31 LEU HD22 H -12.708  15.228  41.249 1.00 . A A . 31 LEU HD22 1 1 
        6  6954 1 1 31 LEU HD23 H -13.809  14.191  42.156 1.00 . A A . 31 LEU HD23 1 1 
        6  6955 1 1 31 LEU HG   H -11.955  12.979  43.137 1.00 . A A . 31 LEU HG   1 1 
        6  6956 1 1 31 LEU N    N  -8.013  13.347  42.050 1.00 . A A . 31 LEU N    1 1 
        6  6957 1 1 31 LEU O    O  -9.974  12.115  44.713 1.00 . A A . 31 LEU O    1 1 
        6  6958 1 1 32 GLY C    C  -8.675   9.317  44.477 1.00 . A A . 32 GLY C    1 1 
        6  6959 1 1 32 GLY CA   C  -9.596   9.699  43.309 1.00 . A A . 32 GLY CA   1 1 
        6  6960 1 1 32 GLY H    H  -8.991  11.234  41.921 1.00 . A A . 32 GLY H    1 1 
        6  6961 1 1 32 GLY HA2  H -10.622   9.628  43.639 1.00 . A A . 32 GLY HA2  1 1 
        6  6962 1 1 32 GLY HA3  H  -9.439   9.001  42.500 1.00 . A A . 32 GLY HA3  1 1 
        6  6963 1 1 32 GLY N    N  -9.350  11.059  42.816 1.00 . A A . 32 GLY N    1 1 
        6  6964 1 1 32 GLY O    O  -9.131   8.831  45.511 1.00 . A A . 32 GLY O    1 1 
        6  6965 1 1 33 VAL C    C  -6.966   9.971  46.661 1.00 . A A . 33 VAL C    1 1 
        6  6966 1 1 33 VAL CA   C  -6.433   9.294  45.391 1.00 . A A . 33 VAL CA   1 1 
        6  6967 1 1 33 VAL CB   C  -5.019   9.779  45.062 1.00 . A A . 33 VAL CB   1 1 
        6  6968 1 1 33 VAL CG1  C  -4.469   8.984  43.876 1.00 . A A . 33 VAL CG1  1 1 
        6  6969 1 1 33 VAL CG2  C  -5.061  11.254  44.699 1.00 . A A . 33 VAL CG2  1 1 
        6  6970 1 1 33 VAL H    H  -7.161  10.051  43.475 1.00 . A A . 33 VAL H    1 1 
        6  6971 1 1 33 VAL HA   H  -6.412   8.230  45.576 1.00 . A A . 33 VAL HA   1 1 
        6  6972 1 1 33 VAL HB   H  -4.379   9.634  45.921 1.00 . A A . 33 VAL HB   1 1 
        6  6973 1 1 33 VAL HG11 H  -4.264   7.970  44.187 1.00 . A A . 33 VAL HG11 1 1 
        6  6974 1 1 33 VAL HG12 H  -3.557   9.445  43.526 1.00 . A A . 33 VAL HG12 1 1 
        6  6975 1 1 33 VAL HG13 H  -5.198   8.976  43.079 1.00 . A A . 33 VAL HG13 1 1 
        6  6976 1 1 33 VAL HG21 H  -5.843  11.410  43.980 1.00 . A A . 33 VAL HG21 1 1 
        6  6977 1 1 33 VAL HG22 H  -4.112  11.549  44.276 1.00 . A A . 33 VAL HG22 1 1 
        6  6978 1 1 33 VAL HG23 H  -5.260  11.839  45.584 1.00 . A A . 33 VAL HG23 1 1 
        6  6979 1 1 33 VAL N    N  -7.385   9.586  44.309 1.00 . A A . 33 VAL N    1 1 
        6  6980 1 1 33 VAL O    O  -7.001   9.364  47.732 1.00 . A A . 33 VAL O    1 1 
        6  6981 1 1 34 VAL C    C  -9.116  11.182  48.232 1.00 . A A . 34 VAL C    1 1 
        6  6982 1 1 34 VAL CA   C  -7.916  11.960  47.680 1.00 . A A . 34 VAL CA   1 1 
        6  6983 1 1 34 VAL CB   C  -8.338  13.379  47.279 1.00 . A A . 34 VAL CB   1 1 
        6  6984 1 1 34 VAL CG1  C  -9.107  14.033  48.431 1.00 . A A . 34 VAL CG1  1 1 
        6  6985 1 1 34 VAL CG2  C  -7.090  14.210  46.973 1.00 . A A . 34 VAL CG2  1 1 
        6  6986 1 1 34 VAL H    H  -7.241  11.661  45.661 1.00 . A A . 34 VAL H    1 1 
        6  6987 1 1 34 VAL HA   H  -7.123  12.022  48.412 1.00 . A A . 34 VAL HA   1 1 
        6  6988 1 1 34 VAL HB   H  -8.968  13.337  46.406 1.00 . A A . 34 VAL HB   1 1 
        6  6989 1 1 34 VAL HG11 H  -9.188  15.096  48.253 1.00 . A A . 34 VAL HG11 1 1 
        6  6990 1 1 34 VAL HG12 H  -8.578  13.864  49.358 1.00 . A A . 34 VAL HG12 1 1 
        6  6991 1 1 34 VAL HG13 H -10.094  13.603  48.496 1.00 . A A . 34 VAL HG13 1 1 
        6  6992 1 1 34 VAL HG21 H  -6.496  14.309  47.870 1.00 . A A . 34 VAL HG21 1 1 
        6  6993 1 1 34 VAL HG22 H  -7.387  15.190  46.628 1.00 . A A . 34 VAL HG22 1 1 
        6  6994 1 1 34 VAL HG23 H  -6.509  13.720  46.209 1.00 . A A . 34 VAL HG23 1 1 
        6  6995 1 1 34 VAL N    N  -7.384  11.227  46.527 1.00 . A A . 34 VAL N    1 1 
        6  6996 1 1 34 VAL O    O  -9.321  11.060  49.436 1.00 . A A . 34 VAL O    1 1 
        6  6997 1 1 35 GLY C    C -10.575   8.679  48.552 1.00 . A A . 35 GLY C    1 1 
        6  6998 1 1 35 GLY CA   C -11.053   9.848  47.685 1.00 . A A . 35 GLY CA   1 1 
        6  6999 1 1 35 GLY H    H  -9.623  10.799  46.379 1.00 . A A . 35 GLY H    1 1 
        6  7000 1 1 35 GLY HA2  H -11.747  10.460  48.244 1.00 . A A . 35 GLY HA2  1 1 
        6  7001 1 1 35 GLY HA3  H -11.534   9.463  46.800 1.00 . A A . 35 GLY HA3  1 1 
        6  7002 1 1 35 GLY N    N  -9.889  10.644  47.308 1.00 . A A . 35 GLY N    1 1 
        6  7003 1 1 35 GLY O    O -11.153   8.370  49.591 1.00 . A A . 35 GLY O    1 1 
        6  7004 1 1 36 LEU C    C  -8.210   7.442  50.126 1.00 . A A . 36 LEU C    1 1 
        6  7005 1 1 36 LEU CA   C  -8.866   6.949  48.823 1.00 . A A . 36 LEU CA   1 1 
        6  7006 1 1 36 LEU CB   C  -7.802   6.266  47.932 1.00 . A A . 36 LEU CB   1 1 
        6  7007 1 1 36 LEU CD1  C  -9.404   5.833  46.041 1.00 . A A . 36 LEU CD1  1 1 
        6  7008 1 1 36 LEU CD2  C  -7.347   4.446  46.278 1.00 . A A . 36 LEU CD2  1 1 
        6  7009 1 1 36 LEU CG   C  -8.445   5.189  47.042 1.00 . A A . 36 LEU CG   1 1 
        6  7010 1 1 36 LEU H    H  -9.093   8.399  47.272 1.00 . A A . 36 LEU H    1 1 
        6  7011 1 1 36 LEU HA   H  -9.637   6.228  49.056 1.00 . A A . 36 LEU HA   1 1 
        6  7012 1 1 36 LEU HB2  H  -7.335   7.009  47.309 1.00 . A A . 36 LEU HB2  1 1 
        6  7013 1 1 36 LEU HB3  H  -7.049   5.802  48.554 1.00 . A A . 36 LEU HB3  1 1 
        6  7014 1 1 36 LEU HD11 H  -8.858   6.519  45.414 1.00 . A A . 36 LEU HD11 1 1 
        6  7015 1 1 36 LEU HD12 H -10.179   6.365  46.572 1.00 . A A . 36 LEU HD12 1 1 
        6  7016 1 1 36 LEU HD13 H  -9.851   5.065  45.428 1.00 . A A . 36 LEU HD13 1 1 
        6  7017 1 1 36 LEU HD21 H  -6.598   4.095  46.974 1.00 . A A . 36 LEU HD21 1 1 
        6  7018 1 1 36 LEU HD22 H  -6.889   5.115  45.564 1.00 . A A . 36 LEU HD22 1 1 
        6  7019 1 1 36 LEU HD23 H  -7.777   3.604  45.758 1.00 . A A . 36 LEU HD23 1 1 
        6  7020 1 1 36 LEU HG   H  -8.988   4.488  47.660 1.00 . A A . 36 LEU HG   1 1 
        6  7021 1 1 36 LEU N    N  -9.486   8.066  48.106 1.00 . A A . 36 LEU N    1 1 
        6  7022 1 1 36 LEU O    O  -8.161   6.726  51.123 1.00 . A A . 36 LEU O    1 1 
        6  7023 1 1 37 SER C    C  -8.232   9.311  52.404 1.00 . A A . 37 SER C    1 1 
        6  7024 1 1 37 SER CA   C  -7.165   9.308  51.302 1.00 . A A . 37 SER CA   1 1 
        6  7025 1 1 37 SER CB   C  -6.672  10.732  51.016 1.00 . A A . 37 SER CB   1 1 
        6  7026 1 1 37 SER H    H  -7.958   9.224  49.303 1.00 . A A . 37 SER H    1 1 
        6  7027 1 1 37 SER HA   H  -6.337   8.703  51.648 1.00 . A A . 37 SER HA   1 1 
        6  7028 1 1 37 SER HB2  H  -7.480  11.342  50.671 1.00 . A A . 37 SER HB2  1 1 
        6  7029 1 1 37 SER HB3  H  -6.271  11.162  51.921 1.00 . A A . 37 SER HB3  1 1 
        6  7030 1 1 37 SER HG   H  -5.655  11.522  49.559 1.00 . A A . 37 SER HG   1 1 
        6  7031 1 1 37 SER N    N  -7.759   8.697  50.105 1.00 . A A . 37 SER N    1 1 
        6  7032 1 1 37 SER O    O  -7.972   9.040  53.567 1.00 . A A . 37 SER O    1 1 
        6  7033 1 1 37 SER OG   O  -5.661  10.681  50.020 1.00 . A A . 37 SER OG   1 1 
        6  7034 1 1 38 ALA C    C -10.553   8.153  53.640 1.00 . A A . 38 ALA C    1 1 
        6  7035 1 1 38 ALA CA   C -10.530   9.542  52.994 1.00 . A A . 38 ALA CA   1 1 
        6  7036 1 1 38 ALA CB   C -11.878   9.848  52.338 1.00 . A A . 38 ALA CB   1 1 
        6  7037 1 1 38 ALA H    H  -9.605   9.762  51.070 1.00 . A A . 38 ALA H    1 1 
        6  7038 1 1 38 ALA HA   H -10.345  10.248  53.792 1.00 . A A . 38 ALA HA   1 1 
        6  7039 1 1 38 ALA HB1  H -12.653   9.850  53.090 1.00 . A A . 38 ALA HB1  1 1 
        6  7040 1 1 38 ALA HB2  H -12.099   9.094  51.599 1.00 . A A . 38 ALA HB2  1 1 
        6  7041 1 1 38 ALA HB3  H -11.836  10.817  51.863 1.00 . A A . 38 ALA HB3  1 1 
        6  7042 1 1 38 ALA N    N  -9.453   9.571  52.019 1.00 . A A . 38 ALA N    1 1 
        6  7043 1 1 38 ALA O    O -10.811   8.020  54.836 1.00 . A A . 38 ALA O    1 1 
        6  7044 1 1 39 LEU C    C  -8.936   5.464  54.162 1.00 . A A . 39 LEU C    1 1 
        6  7045 1 1 39 LEU CA   C -10.245   5.765  53.389 1.00 . A A . 39 LEU CA   1 1 
        6  7046 1 1 39 LEU CB   C -10.362   4.762  52.236 1.00 . A A . 39 LEU CB   1 1 
        6  7047 1 1 39 LEU CD1  C -11.701   4.039  50.255 1.00 . A A . 39 LEU CD1  1 1 
        6  7048 1 1 39 LEU CD2  C -12.882   4.903  52.295 1.00 . A A . 39 LEU CD2  1 1 
        6  7049 1 1 39 LEU CG   C -11.628   5.040  51.413 1.00 . A A . 39 LEU CG   1 1 
        6  7050 1 1 39 LEU H    H -10.049   7.327  51.911 1.00 . A A . 39 LEU H    1 1 
        6  7051 1 1 39 LEU HA   H -11.099   5.635  54.033 1.00 . A A . 39 LEU HA   1 1 
        6  7052 1 1 39 LEU HB2  H  -9.494   4.844  51.599 1.00 . A A . 39 LEU HB2  1 1 
        6  7053 1 1 39 LEU HB3  H -10.413   3.761  52.640 1.00 . A A . 39 LEU HB3  1 1 
        6  7054 1 1 39 LEU HD11 H -11.846   3.044  50.648 1.00 . A A . 39 LEU HD11 1 1 
        6  7055 1 1 39 LEU HD12 H -10.782   4.073  49.690 1.00 . A A . 39 LEU HD12 1 1 
        6  7056 1 1 39 LEU HD13 H -12.529   4.295  49.611 1.00 . A A . 39 LEU HD13 1 1 
        6  7057 1 1 39 LEU HD21 H -13.057   5.833  52.816 1.00 . A A . 39 LEU HD21 1 1 
        6  7058 1 1 39 LEU HD22 H -12.740   4.109  53.014 1.00 . A A . 39 LEU HD22 1 1 
        6  7059 1 1 39 LEU HD23 H -13.741   4.677  51.677 1.00 . A A . 39 LEU HD23 1 1 
        6  7060 1 1 39 LEU HG   H -11.577   6.043  51.012 1.00 . A A . 39 LEU HG   1 1 
        6  7061 1 1 39 LEU N    N -10.265   7.126  52.846 1.00 . A A . 39 LEU N    1 1 
        6  7062 1 1 39 LEU O    O  -8.967   4.982  55.293 1.00 . A A . 39 LEU O    1 1 
        6  7063 1 1 40 THR C    C  -5.642   6.605  54.469 1.00 . A A . 40 THR C    1 1 
        6  7064 1 1 40 THR CA   C  -6.461   5.371  54.054 1.00 . A A . 40 THR CA   1 1 
        6  7065 1 1 40 THR CB   C  -5.664   4.678  52.946 1.00 . A A . 40 THR CB   1 1 
        6  7066 1 1 40 THR CG2  C  -6.400   3.412  52.502 1.00 . A A . 40 THR CG2  1 1 
        6  7067 1 1 40 THR H    H  -7.865   5.968  52.558 1.00 . A A . 40 THR H    1 1 
        6  7068 1 1 40 THR HA   H  -6.561   4.643  54.846 1.00 . A A . 40 THR HA   1 1 
        6  7069 1 1 40 THR HB   H  -4.688   4.410  53.318 1.00 . A A . 40 THR HB   1 1 
        6  7070 1 1 40 THR HG1  H  -6.380   5.968  51.679 1.00 . A A . 40 THR HG1  1 1 
        6  7071 1 1 40 THR HG21 H  -6.437   2.711  53.323 1.00 . A A . 40 THR HG21 1 1 
        6  7072 1 1 40 THR HG22 H  -5.877   2.965  51.670 1.00 . A A . 40 THR HG22 1 1 
        6  7073 1 1 40 THR HG23 H  -7.405   3.667  52.201 1.00 . A A . 40 THR HG23 1 1 
        6  7074 1 1 40 THR N    N  -7.794   5.687  53.493 1.00 . A A . 40 THR N    1 1 
        6  7075 1 1 40 THR O    O  -4.665   6.507  55.211 1.00 . A A . 40 THR O    1 1 
        6  7076 1 1 40 THR OG1  O  -5.527   5.560  51.841 1.00 . A A . 40 THR OG1  1 1 
        6  7077 1 1 41 GLY C    C  -3.981   9.071  54.174 1.00 . A A . 41 GLY C    1 1 
        6  7078 1 1 41 GLY CA   C  -5.491   9.039  54.370 1.00 . A A . 41 GLY CA   1 1 
        6  7079 1 1 41 GLY H    H  -6.984   7.718  53.583 1.00 . A A . 41 GLY H    1 1 
        6  7080 1 1 41 GLY HA2  H  -5.917   9.817  53.764 1.00 . A A . 41 GLY HA2  1 1 
        6  7081 1 1 41 GLY HA3  H  -5.707   9.253  55.407 1.00 . A A . 41 GLY HA3  1 1 
        6  7082 1 1 41 GLY N    N  -6.109   7.752  54.019 1.00 . A A . 41 GLY N    1 1 
        6  7083 1 1 41 GLY O    O  -3.234   8.348  54.832 1.00 . A A . 41 GLY O    1 1 
        6  7084 1 1 42 TYR C    C  -1.763  11.568  52.915 1.00 . A A . 42 TYR C    1 1 
        6  7085 1 1 42 TYR CA   C  -2.140  10.078  52.888 1.00 . A A . 42 TYR CA   1 1 
        6  7086 1 1 42 TYR CB   C  -1.949   9.520  51.442 1.00 . A A . 42 TYR CB   1 1 
        6  7087 1 1 42 TYR CD1  C  -3.268  11.521  50.591 1.00 . A A . 42 TYR CD1  1 1 
        6  7088 1 1 42 TYR CD2  C  -1.436  10.689  49.237 1.00 . A A . 42 TYR CD2  1 1 
        6  7089 1 1 42 TYR CE1  C  -3.502  12.534  49.652 1.00 . A A . 42 TYR CE1  1 1 
        6  7090 1 1 42 TYR CE2  C  -1.671  11.701  48.299 1.00 . A A . 42 TYR CE2  1 1 
        6  7091 1 1 42 TYR CG   C  -2.236  10.599  50.384 1.00 . A A . 42 TYR CG   1 1 
        6  7092 1 1 42 TYR CZ   C  -2.704  12.623  48.506 1.00 . A A . 42 TYR CZ   1 1 
        6  7093 1 1 42 TYR H    H  -4.192  10.423  52.707 1.00 . A A . 42 TYR H    1 1 
        6  7094 1 1 42 TYR HA   H  -1.511   9.524  53.569 1.00 . A A . 42 TYR HA   1 1 
        6  7095 1 1 42 TYR HB2  H  -0.932   9.175  51.329 1.00 . A A . 42 TYR HB2  1 1 
        6  7096 1 1 42 TYR HB3  H  -2.623   8.689  51.294 1.00 . A A . 42 TYR HB3  1 1 
        6  7097 1 1 42 TYR HD1  H  -3.889  11.459  51.462 1.00 . A A . 42 TYR HD1  1 1 
        6  7098 1 1 42 TYR HD2  H  -0.643   9.978  49.077 1.00 . A A . 42 TYR HD2  1 1 
        6  7099 1 1 42 TYR HE1  H  -4.299  13.245  49.812 1.00 . A A . 42 TYR HE1  1 1 
        6  7100 1 1 42 TYR HE2  H  -1.054  11.770  47.414 1.00 . A A . 42 TYR HE2  1 1 
        6  7101 1 1 42 TYR HH   H  -3.882  13.690  47.450 1.00 . A A . 42 TYR HH   1 1 
        6  7102 1 1 42 TYR N    N  -3.551   9.916  53.240 1.00 . A A . 42 TYR N    1 1 
        6  7103 1 1 42 TYR O    O  -0.822  11.980  52.241 1.00 . A A . 42 TYR O    1 1 
        6  7104 1 1 42 TYR OH   O  -2.934  13.620  47.580 1.00 . A A . 42 TYR OH   1 1 
        6  7105 1 1 43 LEU C    C  -0.787  14.169  53.927 1.00 . A A . 43 LEU C    1 1 
        6  7106 1 1 43 LEU CA   C  -2.266  13.815  53.730 1.00 . A A . 43 LEU CA   1 1 
        6  7107 1 1 43 LEU CB   C  -3.037  14.312  54.980 1.00 . A A . 43 LEU CB   1 1 
        6  7108 1 1 43 LEU CD1  C  -2.200  16.644  54.514 1.00 . A A . 43 LEU CD1  1 1 
        6  7109 1 1 43 LEU CD2  C  -4.510  15.985  53.750 1.00 . A A . 43 LEU CD2  1 1 
        6  7110 1 1 43 LEU CG   C  -3.435  15.799  54.846 1.00 . A A . 43 LEU CG   1 1 
        6  7111 1 1 43 LEU H    H  -3.237  12.039  54.228 1.00 . A A . 43 LEU H    1 1 
        6  7112 1 1 43 LEU HA   H  -2.698  14.336  52.891 1.00 . A A . 43 LEU HA   1 1 
        6  7113 1 1 43 LEU HB2  H  -3.929  13.718  55.098 1.00 . A A . 43 LEU HB2  1 1 
        6  7114 1 1 43 LEU HB3  H  -2.424  14.191  55.864 1.00 . A A . 43 LEU HB3  1 1 
        6  7115 1 1 43 LEU HD11 H  -2.434  17.690  54.648 1.00 . A A . 43 LEU HD11 1 1 
        6  7116 1 1 43 LEU HD12 H  -1.909  16.471  53.489 1.00 . A A . 43 LEU HD12 1 1 
        6  7117 1 1 43 LEU HD13 H  -1.388  16.371  55.172 1.00 . A A . 43 LEU HD13 1 1 
        6  7118 1 1 43 LEU HD21 H  -4.041  16.215  52.802 1.00 . A A . 43 LEU HD21 1 1 
        6  7119 1 1 43 LEU HD22 H  -5.162  16.799  54.028 1.00 . A A . 43 LEU HD22 1 1 
        6  7120 1 1 43 LEU HD23 H  -5.097  15.083  53.648 1.00 . A A . 43 LEU HD23 1 1 
        6  7121 1 1 43 LEU HG   H  -3.838  16.135  55.793 1.00 . A A . 43 LEU HG   1 1 
        6  7122 1 1 43 LEU N    N  -2.512  12.376  53.661 1.00 . A A . 43 LEU N    1 1 
        6  7123 1 1 43 LEU O    O  -0.177  14.823  53.082 1.00 . A A . 43 LEU O    1 1 
        6  7124 1 1 44 ASP C    C   2.082  13.282  54.384 1.00 . A A . 44 ASP C    1 1 
        6  7125 1 1 44 ASP CA   C   1.172  14.028  55.352 1.00 . A A . 44 ASP CA   1 1 
        6  7126 1 1 44 ASP CB   C   1.510  13.666  56.799 1.00 . A A . 44 ASP CB   1 1 
        6  7127 1 1 44 ASP CG   C   2.901  14.175  57.158 1.00 . A A . 44 ASP CG   1 1 
        6  7128 1 1 44 ASP H    H  -0.774  13.214  55.675 1.00 . A A . 44 ASP H    1 1 
        6  7129 1 1 44 ASP HA   H   1.337  15.081  55.187 1.00 . A A . 44 ASP HA   1 1 
        6  7130 1 1 44 ASP HB2  H   0.782  14.116  57.458 1.00 . A A . 44 ASP HB2  1 1 
        6  7131 1 1 44 ASP HB3  H   1.482  12.593  56.915 1.00 . A A . 44 ASP HB3  1 1 
        6  7132 1 1 44 ASP N    N  -0.228  13.739  55.054 1.00 . A A . 44 ASP N    1 1 
        6  7133 1 1 44 ASP O    O   3.078  13.831  53.913 1.00 . A A . 44 ASP O    1 1 
        6  7134 1 1 44 ASP OD1  O   3.561  14.710  56.283 1.00 . A A . 44 ASP OD1  1 1 
        6  7135 1 1 44 ASP OD2  O   3.278  14.040  58.311 1.00 . A A . 44 ASP OD2  1 1 
        6  7136 1 1 45 TYR C    C   2.690  11.880  51.824 1.00 . A A . 45 TYR C    1 1 
        6  7137 1 1 45 TYR CA   C   2.582  11.234  53.204 1.00 . A A . 45 TYR CA   1 1 
        6  7138 1 1 45 TYR CB   C   1.997   9.824  53.057 1.00 . A A . 45 TYR CB   1 1 
        6  7139 1 1 45 TYR CD1  C   3.492   8.340  54.436 1.00 . A A . 45 TYR CD1  1 1 
        6  7140 1 1 45 TYR CD2  C   1.303   8.916  55.308 1.00 . A A . 45 TYR CD2  1 1 
        6  7141 1 1 45 TYR CE1  C   3.745   7.572  55.579 1.00 . A A . 45 TYR CE1  1 1 
        6  7142 1 1 45 TYR CE2  C   1.557   8.148  56.451 1.00 . A A . 45 TYR CE2  1 1 
        6  7143 1 1 45 TYR CG   C   2.271   9.013  54.302 1.00 . A A . 45 TYR CG   1 1 
        6  7144 1 1 45 TYR CZ   C   2.777   7.476  56.586 1.00 . A A . 45 TYR CZ   1 1 
        6  7145 1 1 45 TYR H    H   0.980  11.618  54.538 1.00 . A A . 45 TYR H    1 1 
        6  7146 1 1 45 TYR HA   H   3.579  11.154  53.611 1.00 . A A . 45 TYR HA   1 1 
        6  7147 1 1 45 TYR HB2  H   0.930   9.894  52.904 1.00 . A A . 45 TYR HB2  1 1 
        6  7148 1 1 45 TYR HB3  H   2.448   9.332  52.206 1.00 . A A . 45 TYR HB3  1 1 
        6  7149 1 1 45 TYR HD1  H   4.238   8.415  53.660 1.00 . A A . 45 TYR HD1  1 1 
        6  7150 1 1 45 TYR HD2  H   0.362   9.435  55.204 1.00 . A A . 45 TYR HD2  1 1 
        6  7151 1 1 45 TYR HE1  H   4.686   7.054  55.683 1.00 . A A . 45 TYR HE1  1 1 
        6  7152 1 1 45 TYR HE2  H   0.810   8.073  57.228 1.00 . A A . 45 TYR HE2  1 1 
        6  7153 1 1 45 TYR HH   H   3.367   7.303  58.394 1.00 . A A . 45 TYR HH   1 1 
        6  7154 1 1 45 TYR N    N   1.755  12.029  54.101 1.00 . A A . 45 TYR N    1 1 
        6  7155 1 1 45 TYR O    O   3.789  11.962  51.289 1.00 . A A . 45 TYR O    1 1 
        6  7156 1 1 45 TYR OH   O   3.026   6.718  57.712 1.00 . A A . 45 TYR OH   1 1 
        6  7157 1 1 46 VAL C    C   2.833  13.292  49.307 1.00 . A A . 46 VAL C    1 1 
        6  7158 1 1 46 VAL CA   C   1.478  12.940  49.929 1.00 . A A . 46 VAL CA   1 1 
        6  7159 1 1 46 VAL CB   C   0.629  14.211  50.013 1.00 . A A . 46 VAL CB   1 1 
        6  7160 1 1 46 VAL CG1  C   1.341  15.260  50.874 1.00 . A A . 46 VAL CG1  1 1 
        6  7161 1 1 46 VAL CG2  C   0.407  14.769  48.605 1.00 . A A . 46 VAL CG2  1 1 
        6  7162 1 1 46 VAL H    H   0.707  12.199  51.746 1.00 . A A . 46 VAL H    1 1 
        6  7163 1 1 46 VAL HA   H   0.979  12.262  49.257 1.00 . A A . 46 VAL HA   1 1 
        6  7164 1 1 46 VAL HB   H  -0.327  13.973  50.460 1.00 . A A . 46 VAL HB   1 1 
        6  7165 1 1 46 VAL HG11 H   0.628  16.004  51.195 1.00 . A A . 46 VAL HG11 1 1 
        6  7166 1 1 46 VAL HG12 H   2.121  15.736  50.297 1.00 . A A . 46 VAL HG12 1 1 
        6  7167 1 1 46 VAL HG13 H   1.775  14.783  51.742 1.00 . A A . 46 VAL HG13 1 1 
        6  7168 1 1 46 VAL HG21 H  -0.327  15.561  48.643 1.00 . A A . 46 VAL HG21 1 1 
        6  7169 1 1 46 VAL HG22 H   0.051  13.981  47.957 1.00 . A A . 46 VAL HG22 1 1 
        6  7170 1 1 46 VAL HG23 H   1.337  15.159  48.220 1.00 . A A . 46 VAL HG23 1 1 
        6  7171 1 1 46 VAL N    N   1.552  12.318  51.268 1.00 . A A . 46 VAL N    1 1 
        6  7172 1 1 46 VAL O    O   3.072  12.986  48.138 1.00 . A A . 46 VAL O    1 1 
        6  7173 1 1 47 LEU C    C   5.743  13.143  48.875 1.00 . A A . 47 LEU C    1 1 
        6  7174 1 1 47 LEU CA   C   5.001  14.337  49.515 1.00 . A A . 47 LEU CA   1 1 
        6  7175 1 1 47 LEU CB   C   5.849  14.912  50.668 1.00 . A A . 47 LEU CB   1 1 
        6  7176 1 1 47 LEU CD1  C   7.724  15.355  49.042 1.00 . A A . 47 LEU CD1  1 1 
        6  7177 1 1 47 LEU CD2  C   6.132  17.217  49.633 1.00 . A A . 47 LEU CD2  1 1 
        6  7178 1 1 47 LEU CG   C   6.863  15.958  50.156 1.00 . A A . 47 LEU CG   1 1 
        6  7179 1 1 47 LEU H    H   3.461  14.195  50.969 1.00 . A A . 47 LEU H    1 1 
        6  7180 1 1 47 LEU HA   H   4.843  15.117  48.789 1.00 . A A . 47 LEU HA   1 1 
        6  7181 1 1 47 LEU HB2  H   5.192  15.379  51.388 1.00 . A A . 47 LEU HB2  1 1 
        6  7182 1 1 47 LEU HB3  H   6.387  14.111  51.157 1.00 . A A . 47 LEU HB3  1 1 
        6  7183 1 1 47 LEU HD11 H   7.165  15.347  48.118 1.00 . A A . 47 LEU HD11 1 1 
        6  7184 1 1 47 LEU HD12 H   8.004  14.346  49.306 1.00 . A A . 47 LEU HD12 1 1 
        6  7185 1 1 47 LEU HD13 H   8.615  15.952  48.916 1.00 . A A . 47 LEU HD13 1 1 
        6  7186 1 1 47 LEU HD21 H   5.188  17.337  50.147 1.00 . A A . 47 LEU HD21 1 1 
        6  7187 1 1 47 LEU HD22 H   5.950  17.129  48.570 1.00 . A A . 47 LEU HD22 1 1 
        6  7188 1 1 47 LEU HD23 H   6.747  18.085  49.815 1.00 . A A . 47 LEU HD23 1 1 
        6  7189 1 1 47 LEU HG   H   7.508  16.243  50.975 1.00 . A A . 47 LEU HG   1 1 
        6  7190 1 1 47 LEU N    N   3.702  13.944  50.053 1.00 . A A . 47 LEU N    1 1 
        6  7191 1 1 47 LEU O    O   6.246  13.232  47.758 1.00 . A A . 47 LEU O    1 1 
        6  7192 1 1 48 LEU C    C   5.933  10.215  47.878 1.00 . A A . 48 LEU C    1 1 
        6  7193 1 1 48 LEU CA   C   6.527  10.837  49.165 1.00 . A A . 48 LEU CA   1 1 
        6  7194 1 1 48 LEU CB   C   6.626   9.812  50.310 1.00 . A A . 48 LEU CB   1 1 
        6  7195 1 1 48 LEU CD1  C   8.530   8.641  49.166 1.00 . A A . 48 LEU CD1  1 1 
        6  7196 1 1 48 LEU CD2  C   7.267   7.495  50.986 1.00 . A A . 48 LEU CD2  1 1 
        6  7197 1 1 48 LEU CG   C   7.149   8.459  49.802 1.00 . A A . 48 LEU CG   1 1 
        6  7198 1 1 48 LEU H    H   5.382  12.077  50.501 1.00 . A A . 48 LEU H    1 1 
        6  7199 1 1 48 LEU HA   H   7.526  11.139  48.895 1.00 . A A . 48 LEU HA   1 1 
        6  7200 1 1 48 LEU HB2  H   7.305  10.191  51.060 1.00 . A A . 48 LEU HB2  1 1 
        6  7201 1 1 48 LEU HB3  H   5.655   9.676  50.756 1.00 . A A . 48 LEU HB3  1 1 
        6  7202 1 1 48 LEU HD11 H   9.003   7.677  49.051 1.00 . A A . 48 LEU HD11 1 1 
        6  7203 1 1 48 LEU HD12 H   9.139   9.268  49.800 1.00 . A A . 48 LEU HD12 1 1 
        6  7204 1 1 48 LEU HD13 H   8.423   9.105  48.196 1.00 . A A . 48 LEU HD13 1 1 
        6  7205 1 1 48 LEU HD21 H   7.400   6.488  50.618 1.00 . A A . 48 LEU HD21 1 1 
        6  7206 1 1 48 LEU HD22 H   6.368   7.544  51.583 1.00 . A A . 48 LEU HD22 1 1 
        6  7207 1 1 48 LEU HD23 H   8.117   7.772  51.593 1.00 . A A . 48 LEU HD23 1 1 
        6  7208 1 1 48 LEU HG   H   6.466   8.046  49.076 1.00 . A A . 48 LEU HG   1 1 
        6  7209 1 1 48 LEU N    N   5.817  12.044  49.623 1.00 . A A . 48 LEU N    1 1 
        6  7210 1 1 48 LEU O    O   6.662  10.061  46.899 1.00 . A A . 48 LEU O    1 1 
        6  7211 1 1 49 PRO C    C   4.168  10.192  45.382 1.00 . A A . 49 PRO C    1 1 
        6  7212 1 1 49 PRO CA   C   4.080   9.250  46.585 1.00 . A A . 49 PRO CA   1 1 
        6  7213 1 1 49 PRO CB   C   2.620   8.955  46.974 1.00 . A A . 49 PRO CB   1 1 
        6  7214 1 1 49 PRO CD   C   3.673   9.954  48.886 1.00 . A A . 49 PRO CD   1 1 
        6  7215 1 1 49 PRO CG   C   2.351   9.851  48.133 1.00 . A A . 49 PRO CG   1 1 
        6  7216 1 1 49 PRO HA   H   4.584   8.323  46.356 1.00 . A A . 49 PRO HA   1 1 
        6  7217 1 1 49 PRO HB2  H   1.949   9.179  46.152 1.00 . A A . 49 PRO HB2  1 1 
        6  7218 1 1 49 PRO HB3  H   2.510   7.921  47.273 1.00 . A A . 49 PRO HB3  1 1 
        6  7219 1 1 49 PRO HD2  H   3.746  10.893  49.384 1.00 . A A . 49 PRO HD2  1 1 
        6  7220 1 1 49 PRO HD3  H   3.777   9.136  49.578 1.00 . A A . 49 PRO HD3  1 1 
        6  7221 1 1 49 PRO HG2  H   2.041  10.827  47.782 1.00 . A A . 49 PRO HG2  1 1 
        6  7222 1 1 49 PRO HG3  H   1.598   9.425  48.776 1.00 . A A . 49 PRO HG3  1 1 
        6  7223 1 1 49 PRO N    N   4.672   9.852  47.822 1.00 . A A . 49 PRO N    1 1 
        6  7224 1 1 49 PRO O    O   4.222   9.738  44.243 1.00 . A A . 49 PRO O    1 1 
        6  7225 1 1 50 ALA C    C   5.757  12.421  43.958 1.00 . A A . 50 ALA C    1 1 
        6  7226 1 1 50 ALA CA   C   4.364  12.486  44.570 1.00 . A A . 50 ALA CA   1 1 
        6  7227 1 1 50 ALA CB   C   4.098  13.891  45.114 1.00 . A A . 50 ALA CB   1 1 
        6  7228 1 1 50 ALA H    H   4.246  11.828  46.560 1.00 . A A . 50 ALA H    1 1 
        6  7229 1 1 50 ALA HA   H   3.679  12.285  43.760 1.00 . A A . 50 ALA HA   1 1 
        6  7230 1 1 50 ALA HB1  H   4.931  14.204  45.725 1.00 . A A . 50 ALA HB1  1 1 
        6  7231 1 1 50 ALA HB2  H   3.198  13.881  45.711 1.00 . A A . 50 ALA HB2  1 1 
        6  7232 1 1 50 ALA HB3  H   3.977  14.579  44.291 1.00 . A A . 50 ALA HB3  1 1 
        6  7233 1 1 50 ALA N    N   4.230  11.496  45.638 1.00 . A A . 50 ALA N    1 1 
        6  7234 1 1 50 ALA O    O   5.927  12.686  42.768 1.00 . A A . 50 ALA O    1 1 
        6  7235 1 1 51 LEU C    C   8.119  10.807  43.176 1.00 . A A . 51 LEU C    1 1 
        6  7236 1 1 51 LEU CA   C   8.097  11.907  44.230 1.00 . A A . 51 LEU CA   1 1 
        6  7237 1 1 51 LEU CB   C   9.078  11.554  45.353 1.00 . A A . 51 LEU CB   1 1 
        6  7238 1 1 51 LEU CD1  C  10.055  12.305  47.534 1.00 . A A . 51 LEU CD1  1 1 
        6  7239 1 1 51 LEU CD2  C   9.983  13.908  45.596 1.00 . A A . 51 LEU CD2  1 1 
        6  7240 1 1 51 LEU CG   C   9.250  12.749  46.307 1.00 . A A . 51 LEU CG   1 1 
        6  7241 1 1 51 LEU H    H   6.548  11.782  45.677 1.00 . A A . 51 LEU H    1 1 
        6  7242 1 1 51 LEU HA   H   8.393  12.842  43.783 1.00 . A A . 51 LEU HA   1 1 
        6  7243 1 1 51 LEU HB2  H   8.694  10.708  45.905 1.00 . A A . 51 LEU HB2  1 1 
        6  7244 1 1 51 LEU HB3  H  10.034  11.295  44.926 1.00 . A A . 51 LEU HB3  1 1 
        6  7245 1 1 51 LEU HD11 H   9.651  11.380  47.919 1.00 . A A . 51 LEU HD11 1 1 
        6  7246 1 1 51 LEU HD12 H   9.997  13.067  48.296 1.00 . A A . 51 LEU HD12 1 1 
        6  7247 1 1 51 LEU HD13 H  11.088  12.157  47.252 1.00 . A A . 51 LEU HD13 1 1 
        6  7248 1 1 51 LEU HD21 H  10.690  13.515  44.880 1.00 . A A . 51 LEU HD21 1 1 
        6  7249 1 1 51 LEU HD22 H  10.509  14.510  46.324 1.00 . A A . 51 LEU HD22 1 1 
        6  7250 1 1 51 LEU HD23 H   9.263  14.528  45.085 1.00 . A A . 51 LEU HD23 1 1 
        6  7251 1 1 51 LEU HG   H   8.277  13.085  46.628 1.00 . A A . 51 LEU HG   1 1 
        6  7252 1 1 51 LEU N    N   6.744  12.035  44.752 1.00 . A A . 51 LEU N    1 1 
        6  7253 1 1 51 LEU O    O   8.776  10.921  42.143 1.00 . A A . 51 LEU O    1 1 
        6  7254 1 1 52 ALA C    C   6.667   9.112  41.189 1.00 . A A . 52 ALA C    1 1 
        6  7255 1 1 52 ALA CA   C   7.256   8.635  42.518 1.00 . A A . 52 ALA CA   1 1 
        6  7256 1 1 52 ALA CB   C   6.383   7.524  43.107 1.00 . A A . 52 ALA CB   1 1 
        6  7257 1 1 52 ALA H    H   6.825   9.776  44.271 1.00 . A A . 52 ALA H    1 1 
        6  7258 1 1 52 ALA HA   H   8.243   8.243  42.325 1.00 . A A . 52 ALA HA   1 1 
        6  7259 1 1 52 ALA HB1  H   6.260   6.738  42.375 1.00 . A A . 52 ALA HB1  1 1 
        6  7260 1 1 52 ALA HB2  H   5.418   7.925  43.369 1.00 . A A . 52 ALA HB2  1 1 
        6  7261 1 1 52 ALA HB3  H   6.859   7.122  43.989 1.00 . A A . 52 ALA HB3  1 1 
        6  7262 1 1 52 ALA N    N   7.358   9.752  43.449 1.00 . A A . 52 ALA N    1 1 
        6  7263 1 1 52 ALA O    O   7.170   8.758  40.123 1.00 . A A . 52 ALA O    1 1 
        6  7264 1 1 53 ILE C    C   5.993  11.338  39.269 1.00 . A A . 53 ILE C    1 1 
        6  7265 1 1 53 ILE CA   C   5.004  10.451  40.026 1.00 . A A . 53 ILE CA   1 1 
        6  7266 1 1 53 ILE CB   C   3.704  11.229  40.352 1.00 . A A . 53 ILE CB   1 1 
        6  7267 1 1 53 ILE CD1  C   2.629   9.652  41.999 1.00 . A A . 53 ILE CD1  1 1 
        6  7268 1 1 53 ILE CG1  C   2.535  10.249  40.597 1.00 . A A . 53 ILE CG1  1 1 
        6  7269 1 1 53 ILE CG2  C   3.333  12.163  39.189 1.00 . A A . 53 ILE CG2  1 1 
        6  7270 1 1 53 ILE H    H   5.250  10.192  42.121 1.00 . A A . 53 ILE H    1 1 
        6  7271 1 1 53 ILE HA   H   4.768   9.638  39.358 1.00 . A A . 53 ILE HA   1 1 
        6  7272 1 1 53 ILE HB   H   3.863  11.822  41.242 1.00 . A A . 53 ILE HB   1 1 
        6  7273 1 1 53 ILE HD11 H   3.550   9.098  42.096 1.00 . A A . 53 ILE HD11 1 1 
        6  7274 1 1 53 ILE HD12 H   1.794   8.987  42.163 1.00 . A A . 53 ILE HD12 1 1 
        6  7275 1 1 53 ILE HD13 H   2.605  10.446  42.729 1.00 . A A . 53 ILE HD13 1 1 
        6  7276 1 1 53 ILE HG12 H   1.598  10.779  40.505 1.00 . A A . 53 ILE HG12 1 1 
        6  7277 1 1 53 ILE HG13 H   2.562   9.454  39.867 1.00 . A A . 53 ILE HG13 1 1 
        6  7278 1 1 53 ILE HG21 H   3.429  11.630  38.254 1.00 . A A . 53 ILE HG21 1 1 
        6  7279 1 1 53 ILE HG22 H   3.996  13.015  39.186 1.00 . A A . 53 ILE HG22 1 1 
        6  7280 1 1 53 ILE HG23 H   2.313  12.501  39.307 1.00 . A A . 53 ILE HG23 1 1 
        6  7281 1 1 53 ILE N    N   5.615   9.931  41.251 1.00 . A A . 53 ILE N    1 1 
        6  7282 1 1 53 ILE O    O   6.209  11.126  38.079 1.00 . A A . 53 ILE O    1 1 
        6  7283 1 1 54 PHE C    C   8.697  12.357  38.667 1.00 . A A . 54 PHE C    1 1 
        6  7284 1 1 54 PHE CA   C   7.553  13.186  39.235 1.00 . A A . 54 PHE CA   1 1 
        6  7285 1 1 54 PHE CB   C   8.103  14.247  40.191 1.00 . A A . 54 PHE CB   1 1 
        6  7286 1 1 54 PHE CD1  C   8.543  16.199  38.662 1.00 . A A . 54 PHE CD1  1 1 
        6  7287 1 1 54 PHE CD2  C  10.432  14.957  39.538 1.00 . A A . 54 PHE CD2  1 1 
        6  7288 1 1 54 PHE CE1  C   9.420  17.046  37.971 1.00 . A A . 54 PHE CE1  1 1 
        6  7289 1 1 54 PHE CE2  C  11.309  15.802  38.847 1.00 . A A . 54 PHE CE2  1 1 
        6  7290 1 1 54 PHE CG   C   9.050  15.156  39.445 1.00 . A A . 54 PHE CG   1 1 
        6  7291 1 1 54 PHE CZ   C  10.803  16.846  38.063 1.00 . A A . 54 PHE CZ   1 1 
        6  7292 1 1 54 PHE H    H   6.423  12.508  40.873 1.00 . A A . 54 PHE H    1 1 
        6  7293 1 1 54 PHE HA   H   7.058  13.676  38.410 1.00 . A A . 54 PHE HA   1 1 
        6  7294 1 1 54 PHE HB2  H   7.284  14.828  40.592 1.00 . A A . 54 PHE HB2  1 1 
        6  7295 1 1 54 PHE HB3  H   8.630  13.762  41.000 1.00 . A A . 54 PHE HB3  1 1 
        6  7296 1 1 54 PHE HD1  H   7.477  16.353  38.590 1.00 . A A . 54 PHE HD1  1 1 
        6  7297 1 1 54 PHE HD2  H  10.823  14.151  40.142 1.00 . A A . 54 PHE HD2  1 1 
        6  7298 1 1 54 PHE HE1  H   9.029  17.851  37.367 1.00 . A A . 54 PHE HE1  1 1 
        6  7299 1 1 54 PHE HE2  H  12.375  15.649  38.918 1.00 . A A . 54 PHE HE2  1 1 
        6  7300 1 1 54 PHE HZ   H  11.479  17.498  37.530 1.00 . A A . 54 PHE HZ   1 1 
        6  7301 1 1 54 PHE N    N   6.600  12.323  39.927 1.00 . A A . 54 PHE N    1 1 
        6  7302 1 1 54 PHE O    O   9.125  12.576  37.535 1.00 . A A . 54 PHE O    1 1 
        6  7303 1 1 55 ILE C    C   9.717   9.704  37.768 1.00 . A A . 55 ILE C    1 1 
        6  7304 1 1 55 ILE CA   C  10.226  10.506  38.963 1.00 . A A . 55 ILE CA   1 1 
        6  7305 1 1 55 ILE CB   C  10.644   9.549  40.095 1.00 . A A . 55 ILE CB   1 1 
        6  7306 1 1 55 ILE CD1  C  12.880  10.532  40.838 1.00 . A A . 55 ILE CD1  1 1 
        6  7307 1 1 55 ILE CG1  C  11.397  10.325  41.201 1.00 . A A . 55 ILE CG1  1 1 
        6  7308 1 1 55 ILE CG2  C  11.538   8.432  39.536 1.00 . A A . 55 ILE CG2  1 1 
        6  7309 1 1 55 ILE H    H   8.758  11.212  40.310 1.00 . A A . 55 ILE H    1 1 
        6  7310 1 1 55 ILE HA   H  11.074  11.108  38.682 1.00 . A A . 55 ILE HA   1 1 
        6  7311 1 1 55 ILE HB   H   9.755   9.103  40.519 1.00 . A A . 55 ILE HB   1 1 
        6  7312 1 1 55 ILE HD11 H  13.240  11.436  41.306 1.00 . A A . 55 ILE HD11 1 1 
        6  7313 1 1 55 ILE HD12 H  12.994  10.613  39.769 1.00 . A A . 55 ILE HD12 1 1 
        6  7314 1 1 55 ILE HD13 H  13.456   9.691  41.195 1.00 . A A . 55 ILE HD13 1 1 
        6  7315 1 1 55 ILE HG12 H  10.934  11.291  41.337 1.00 . A A . 55 ILE HG12 1 1 
        6  7316 1 1 55 ILE HG13 H  11.334   9.771  42.126 1.00 . A A . 55 ILE HG13 1 1 
        6  7317 1 1 55 ILE HG21 H  12.261   8.857  38.854 1.00 . A A . 55 ILE HG21 1 1 
        6  7318 1 1 55 ILE HG22 H  10.930   7.711  39.012 1.00 . A A . 55 ILE HG22 1 1 
        6  7319 1 1 55 ILE HG23 H  12.055   7.944  40.349 1.00 . A A . 55 ILE HG23 1 1 
        6  7320 1 1 55 ILE N    N   9.163  11.382  39.434 1.00 . A A . 55 ILE N    1 1 
        6  7321 1 1 55 ILE O    O  10.410   9.520  36.768 1.00 . A A . 55 ILE O    1 1 
        6  7322 1 1 56 GLY C    C   7.613   9.320  35.602 1.00 . A A . 56 GLY C    1 1 
        6  7323 1 1 56 GLY CA   C   7.812   8.479  36.860 1.00 . A A . 56 GLY CA   1 1 
        6  7324 1 1 56 GLY H    H   7.990   9.491  38.723 1.00 . A A . 56 GLY H    1 1 
        6  7325 1 1 56 GLY HA2  H   8.417   7.617  36.619 1.00 . A A . 56 GLY HA2  1 1 
        6  7326 1 1 56 GLY HA3  H   6.849   8.148  37.219 1.00 . A A . 56 GLY HA3  1 1 
        6  7327 1 1 56 GLY N    N   8.474   9.249  37.906 1.00 . A A . 56 GLY N    1 1 
        6  7328 1 1 56 GLY O    O   7.820   8.844  34.486 1.00 . A A . 56 GLY O    1 1 
        6  7329 1 1 57 LEU C    C   8.308  11.663  33.907 1.00 . A A . 57 LEU C    1 1 
        6  7330 1 1 57 LEU CA   C   6.995  11.465  34.653 1.00 . A A . 57 LEU CA   1 1 
        6  7331 1 1 57 LEU CB   C   6.449  12.815  35.139 1.00 . A A . 57 LEU CB   1 1 
        6  7332 1 1 57 LEU CD1  C   5.255  13.185  32.948 1.00 . A A . 57 LEU CD1  1 1 
        6  7333 1 1 57 LEU CD2  C   5.713  15.110  34.491 1.00 . A A . 57 LEU CD2  1 1 
        6  7334 1 1 57 LEU CG   C   6.253  13.778  33.957 1.00 . A A . 57 LEU CG   1 1 
        6  7335 1 1 57 LEU H    H   7.071  10.897  36.704 1.00 . A A . 57 LEU H    1 1 
        6  7336 1 1 57 LEU HA   H   6.284  11.017  33.978 1.00 . A A . 57 LEU HA   1 1 
        6  7337 1 1 57 LEU HB2  H   5.501  12.658  35.631 1.00 . A A . 57 LEU HB2  1 1 
        6  7338 1 1 57 LEU HB3  H   7.146  13.250  35.839 1.00 . A A . 57 LEU HB3  1 1 
        6  7339 1 1 57 LEU HD11 H   4.481  12.644  33.475 1.00 . A A . 57 LEU HD11 1 1 
        6  7340 1 1 57 LEU HD12 H   5.775  12.513  32.283 1.00 . A A . 57 LEU HD12 1 1 
        6  7341 1 1 57 LEU HD13 H   4.806  13.980  32.368 1.00 . A A . 57 LEU HD13 1 1 
        6  7342 1 1 57 LEU HD21 H   4.726  14.959  34.902 1.00 . A A . 57 LEU HD21 1 1 
        6  7343 1 1 57 LEU HD22 H   5.661  15.827  33.685 1.00 . A A . 57 LEU HD22 1 1 
        6  7344 1 1 57 LEU HD23 H   6.371  15.482  35.263 1.00 . A A . 57 LEU HD23 1 1 
        6  7345 1 1 57 LEU HG   H   7.200  13.948  33.466 1.00 . A A . 57 LEU HG   1 1 
        6  7346 1 1 57 LEU N    N   7.211  10.576  35.790 1.00 . A A . 57 LEU N    1 1 
        6  7347 1 1 57 LEU O    O   8.365  11.518  32.685 1.00 . A A . 57 LEU O    1 1 
        6  7348 1 1 58 THR C    C  11.028  11.076  33.140 1.00 . A A . 58 THR C    1 1 
        6  7349 1 1 58 THR CA   C  10.648  12.260  34.015 1.00 . A A . 58 THR CA   1 1 
        6  7350 1 1 58 THR CB   C  11.717  12.459  35.094 1.00 . A A . 58 THR CB   1 1 
        6  7351 1 1 58 THR CG2  C  11.441  13.750  35.872 1.00 . A A . 58 THR CG2  1 1 
        6  7352 1 1 58 THR H    H   9.237  12.196  35.597 1.00 . A A . 58 THR H    1 1 
        6  7353 1 1 58 THR HA   H  10.584  13.164  33.426 1.00 . A A . 58 THR HA   1 1 
        6  7354 1 1 58 THR HB   H  12.687  12.530  34.626 1.00 . A A . 58 THR HB   1 1 
        6  7355 1 1 58 THR HG1  H  12.076  11.638  36.819 1.00 . A A . 58 THR HG1  1 1 
        6  7356 1 1 58 THR HG21 H  11.812  14.595  35.311 1.00 . A A . 58 THR HG21 1 1 
        6  7357 1 1 58 THR HG22 H  11.939  13.707  36.829 1.00 . A A . 58 THR HG22 1 1 
        6  7358 1 1 58 THR HG23 H  10.376  13.863  36.026 1.00 . A A . 58 THR HG23 1 1 
        6  7359 1 1 58 THR N    N   9.356  12.020  34.640 1.00 . A A . 58 THR N    1 1 
        6  7360 1 1 58 THR O    O  11.551  11.245  32.040 1.00 . A A . 58 THR O    1 1 
        6  7361 1 1 58 THR OG1  O  11.704  11.351  35.983 1.00 . A A . 58 THR OG1  1 1 
        6  7362 1 1 59 ILE C    C  10.122   8.661  31.603 1.00 . A A . 59 ILE C    1 1 
        6  7363 1 1 59 ILE CA   C  10.981   8.666  32.865 1.00 . A A . 59 ILE CA   1 1 
        6  7364 1 1 59 ILE CB   C  10.702   7.421  33.713 1.00 . A A . 59 ILE CB   1 1 
        6  7365 1 1 59 ILE CD1  C  11.320   6.266  35.856 1.00 . A A . 59 ILE CD1  1 1 
        6  7366 1 1 59 ILE CG1  C  11.741   7.333  34.837 1.00 . A A . 59 ILE CG1  1 1 
        6  7367 1 1 59 ILE CG2  C  10.795   6.168  32.839 1.00 . A A . 59 ILE CG2  1 1 
        6  7368 1 1 59 ILE H    H  10.248   9.827  34.485 1.00 . A A . 59 ILE H    1 1 
        6  7369 1 1 59 ILE HA   H  12.014   8.662  32.548 1.00 . A A . 59 ILE HA   1 1 
        6  7370 1 1 59 ILE HB   H   9.712   7.490  34.139 1.00 . A A . 59 ILE HB   1 1 
        6  7371 1 1 59 ILE HD11 H  10.854   5.435  35.347 1.00 . A A . 59 ILE HD11 1 1 
        6  7372 1 1 59 ILE HD12 H  10.622   6.695  36.559 1.00 . A A . 59 ILE HD12 1 1 
        6  7373 1 1 59 ILE HD13 H  12.194   5.916  36.387 1.00 . A A . 59 ILE HD13 1 1 
        6  7374 1 1 59 ILE HG12 H  12.700   7.069  34.417 1.00 . A A . 59 ILE HG12 1 1 
        6  7375 1 1 59 ILE HG13 H  11.817   8.289  35.332 1.00 . A A . 59 ILE HG13 1 1 
        6  7376 1 1 59 ILE HG21 H   9.919   6.102  32.211 1.00 . A A . 59 ILE HG21 1 1 
        6  7377 1 1 59 ILE HG22 H  10.853   5.293  33.469 1.00 . A A . 59 ILE HG22 1 1 
        6  7378 1 1 59 ILE HG23 H  11.678   6.226  32.219 1.00 . A A . 59 ILE HG23 1 1 
        6  7379 1 1 59 ILE N    N  10.715   9.880  33.625 1.00 . A A . 59 ILE N    1 1 
        6  7380 1 1 59 ILE O    O  10.602   8.319  30.522 1.00 . A A . 59 ILE O    1 1 
        6  7381 1 1 60 TYR C    C   8.532   9.774  29.418 1.00 . A A . 60 TYR C    1 1 
        6  7382 1 1 60 TYR CA   C   7.932   9.020  30.605 1.00 . A A . 60 TYR CA   1 1 
        6  7383 1 1 60 TYR CB   C   6.594   9.655  31.024 1.00 . A A . 60 TYR CB   1 1 
        6  7384 1 1 60 TYR CD1  C   5.237   9.430  28.900 1.00 . A A . 60 TYR CD1  1 1 
        6  7385 1 1 60 TYR CD2  C   4.588   8.136  30.846 1.00 . A A . 60 TYR CD2  1 1 
        6  7386 1 1 60 TYR CE1  C   4.166   8.884  28.181 1.00 . A A . 60 TYR CE1  1 1 
        6  7387 1 1 60 TYR CE2  C   3.518   7.590  30.126 1.00 . A A . 60 TYR CE2  1 1 
        6  7388 1 1 60 TYR CG   C   5.448   9.056  30.233 1.00 . A A . 60 TYR CG   1 1 
        6  7389 1 1 60 TYR CZ   C   3.307   7.965  28.794 1.00 . A A . 60 TYR CZ   1 1 
        6  7390 1 1 60 TYR H    H   8.482   9.233  32.626 1.00 . A A . 60 TYR H    1 1 
        6  7391 1 1 60 TYR HA   H   7.759   8.004  30.281 1.00 . A A . 60 TYR HA   1 1 
        6  7392 1 1 60 TYR HB2  H   6.434   9.476  32.077 1.00 . A A . 60 TYR HB2  1 1 
        6  7393 1 1 60 TYR HB3  H   6.629  10.722  30.850 1.00 . A A . 60 TYR HB3  1 1 
        6  7394 1 1 60 TYR HD1  H   5.899  10.139  28.428 1.00 . A A . 60 TYR HD1  1 1 
        6  7395 1 1 60 TYR HD2  H   4.750   7.846  31.874 1.00 . A A . 60 TYR HD2  1 1 
        6  7396 1 1 60 TYR HE1  H   4.003   9.174  27.153 1.00 . A A . 60 TYR HE1  1 1 
        6  7397 1 1 60 TYR HE2  H   2.855   6.881  30.600 1.00 . A A . 60 TYR HE2  1 1 
        6  7398 1 1 60 TYR HH   H   1.794   8.146  27.644 1.00 . A A . 60 TYR HH   1 1 
        6  7399 1 1 60 TYR N    N   8.847   9.016  31.742 1.00 . A A . 60 TYR N    1 1 
        6  7400 1 1 60 TYR O    O   8.343   9.363  28.273 1.00 . A A . 60 TYR O    1 1 
        6  7401 1 1 60 TYR OH   O   2.252   7.428  28.085 1.00 . A A . 60 TYR OH   1 1 
        6  7402 1 1 61 ALA C    C  10.897  10.548  27.877 1.00 . A A . 61 ALA C    1 1 
        6  7403 1 1 61 ALA CA   C   9.944  11.520  28.555 1.00 . A A . 61 ALA CA   1 1 
        6  7404 1 1 61 ALA CB   C  10.710  12.747  29.055 1.00 . A A . 61 ALA CB   1 1 
        6  7405 1 1 61 ALA H    H   9.501  11.103  30.585 1.00 . A A . 61 ALA H    1 1 
        6  7406 1 1 61 ALA HA   H   9.259  11.816  27.773 1.00 . A A . 61 ALA HA   1 1 
        6  7407 1 1 61 ALA HB1  H  10.055  13.359  29.658 1.00 . A A . 61 ALA HB1  1 1 
        6  7408 1 1 61 ALA HB2  H  11.062  13.320  28.210 1.00 . A A . 61 ALA HB2  1 1 
        6  7409 1 1 61 ALA HB3  H  11.553  12.428  29.650 1.00 . A A . 61 ALA HB3  1 1 
        6  7410 1 1 61 ALA N    N   9.302  10.830  29.665 1.00 . A A . 61 ALA N    1 1 
        6  7411 1 1 61 ALA O    O  10.834  10.386  26.668 1.00 . A A . 61 ALA O    1 1 
        6  7412 1 1 62 ILE C    C  11.982   8.032  27.078 1.00 . A A . 62 ILE C    1 1 
        6  7413 1 1 62 ILE CA   C  12.739   9.000  27.997 1.00 . A A . 62 ILE CA   1 1 
        6  7414 1 1 62 ILE CB   C  13.513   8.220  29.083 1.00 . A A . 62 ILE CB   1 1 
        6  7415 1 1 62 ILE CD1  C  14.021  10.305  30.372 1.00 . A A . 62 ILE CD1  1 1 
        6  7416 1 1 62 ILE CG1  C  14.631   9.101  29.656 1.00 . A A . 62 ILE CG1  1 1 
        6  7417 1 1 62 ILE CG2  C  14.143   6.951  28.489 1.00 . A A . 62 ILE CG2  1 1 
        6  7418 1 1 62 ILE H    H  11.877  10.154  29.571 1.00 . A A . 62 ILE H    1 1 
        6  7419 1 1 62 ILE HA   H  13.441   9.576  27.410 1.00 . A A . 62 ILE HA   1 1 
        6  7420 1 1 62 ILE HB   H  12.833   7.941  29.876 1.00 . A A . 62 ILE HB   1 1 
        6  7421 1 1 62 ILE HD11 H  14.769  10.768  31.000 1.00 . A A . 62 ILE HD11 1 1 
        6  7422 1 1 62 ILE HD12 H  13.194   9.978  30.982 1.00 . A A . 62 ILE HD12 1 1 
        6  7423 1 1 62 ILE HD13 H  13.672  11.020  29.642 1.00 . A A . 62 ILE HD13 1 1 
        6  7424 1 1 62 ILE HG12 H  15.216   8.525  30.358 1.00 . A A . 62 ILE HG12 1 1 
        6  7425 1 1 62 ILE HG13 H  15.268   9.444  28.855 1.00 . A A . 62 ILE HG13 1 1 
        6  7426 1 1 62 ILE HG21 H  14.879   6.557  29.175 1.00 . A A . 62 ILE HG21 1 1 
        6  7427 1 1 62 ILE HG22 H  14.619   7.191  27.550 1.00 . A A . 62 ILE HG22 1 1 
        6  7428 1 1 62 ILE HG23 H  13.374   6.210  28.323 1.00 . A A . 62 ILE HG23 1 1 
        6  7429 1 1 62 ILE N    N  11.788   9.916  28.624 1.00 . A A . 62 ILE N    1 1 
        6  7430 1 1 62 ILE O    O  12.440   7.724  25.978 1.00 . A A . 62 ILE O    1 1 
        6  7431 1 1 63 GLN C    C   9.452   7.427  25.455 1.00 . A A . 63 GLN C    1 1 
        6  7432 1 1 63 GLN CA   C   9.976   6.710  26.703 1.00 . A A . 63 GLN CA   1 1 
        6  7433 1 1 63 GLN CB   C   8.788   6.206  27.537 1.00 . A A . 63 GLN CB   1 1 
        6  7434 1 1 63 GLN CD   C   6.792   4.678  27.521 1.00 . A A . 63 GLN CD   1 1 
        6  7435 1 1 63 GLN CG   C   7.865   5.346  26.667 1.00 . A A . 63 GLN CG   1 1 
        6  7436 1 1 63 GLN H    H  10.466   7.914  28.378 1.00 . A A . 63 GLN H    1 1 
        6  7437 1 1 63 GLN HA   H  10.564   5.868  26.376 1.00 . A A . 63 GLN HA   1 1 
        6  7438 1 1 63 GLN HB2  H   9.155   5.616  28.363 1.00 . A A . 63 GLN HB2  1 1 
        6  7439 1 1 63 GLN HB3  H   8.234   7.049  27.919 1.00 . A A . 63 GLN HB3  1 1 
        6  7440 1 1 63 GLN HE21 H   5.289   5.421  26.457 1.00 . A A . 63 GLN HE21 1 1 
        6  7441 1 1 63 GLN HE22 H   4.836   4.436  27.764 1.00 . A A . 63 GLN HE22 1 1 
        6  7442 1 1 63 GLN HG2  H   7.385   5.969  25.927 1.00 . A A . 63 GLN HG2  1 1 
        6  7443 1 1 63 GLN HG3  H   8.449   4.586  26.171 1.00 . A A . 63 GLN HG3  1 1 
        6  7444 1 1 63 GLN N    N  10.807   7.597  27.516 1.00 . A A . 63 GLN N    1 1 
        6  7445 1 1 63 GLN NE2  N   5.535   4.860  27.222 1.00 . A A . 63 GLN NE2  1 1 
        6  7446 1 1 63 GLN O    O   9.471   6.871  24.356 1.00 . A A . 63 GLN O    1 1 
        6  7447 1 1 63 GLN OE1  O   7.106   3.946  28.459 1.00 . A A . 63 GLN OE1  1 1 
        6  7448 1 1 64 ARG C    C   9.579  10.140  23.705 1.00 . A A . 64 ARG C    1 1 
        6  7449 1 1 64 ARG CA   C   8.473   9.492  24.547 1.00 . A A . 64 ARG CA   1 1 
        6  7450 1 1 64 ARG CB   C   7.571  10.586  25.130 1.00 . A A . 64 ARG CB   1 1 
        6  7451 1 1 64 ARG CD   C   5.894  12.359  24.542 1.00 . A A . 64 ARG CD   1 1 
        6  7452 1 1 64 ARG CG   C   6.918  11.368  23.987 1.00 . A A . 64 ARG CG   1 1 
        6  7453 1 1 64 ARG CZ   C   5.831  14.146  22.892 1.00 . A A . 64 ARG CZ   1 1 
        6  7454 1 1 64 ARG H    H   9.041   9.090  26.510 1.00 . A A . 64 ARG H    1 1 
        6  7455 1 1 64 ARG HA   H   7.864   8.859  23.921 1.00 . A A . 64 ARG HA   1 1 
        6  7456 1 1 64 ARG HB2  H   6.804  10.131  25.742 1.00 . A A . 64 ARG HB2  1 1 
        6  7457 1 1 64 ARG HB3  H   8.162  11.259  25.733 1.00 . A A . 64 ARG HB3  1 1 
        6  7458 1 1 64 ARG HD2  H   5.140  11.821  25.098 1.00 . A A . 64 ARG HD2  1 1 
        6  7459 1 1 64 ARG HD3  H   6.388  13.061  25.197 1.00 . A A . 64 ARG HD3  1 1 
        6  7460 1 1 64 ARG HE   H   4.422  12.737  23.066 1.00 . A A . 64 ARG HE   1 1 
        6  7461 1 1 64 ARG HG2  H   7.677  11.912  23.446 1.00 . A A . 64 ARG HG2  1 1 
        6  7462 1 1 64 ARG HG3  H   6.424  10.680  23.318 1.00 . A A . 64 ARG HG3  1 1 
        6  7463 1 1 64 ARG HH11 H   7.333  14.214  24.215 1.00 . A A . 64 ARG HH11 1 1 
        6  7464 1 1 64 ARG HH12 H   7.350  15.445  22.998 1.00 . A A . 64 ARG HH12 1 1 
        6  7465 1 1 64 ARG HH21 H   4.461  14.322  21.443 1.00 . A A . 64 ARG HH21 1 1 
        6  7466 1 1 64 ARG HH22 H   5.726  15.506  21.428 1.00 . A A . 64 ARG HH22 1 1 
        6  7467 1 1 64 ARG N    N   8.998   8.660  25.630 1.00 . A A . 64 ARG N    1 1 
        6  7468 1 1 64 ARG NE   N   5.263  13.075  23.439 1.00 . A A . 64 ARG NE   1 1 
        6  7469 1 1 64 ARG NH1  N   6.923  14.640  23.409 1.00 . A A . 64 ARG NH1  1 1 
        6  7470 1 1 64 ARG NH2  N   5.298  14.702  21.839 1.00 . A A . 64 ARG NH2  1 1 
        6  7471 1 1 64 ARG O    O   9.351  10.563  22.577 1.00 . A A . 64 ARG O    1 1 
        6  7472 1 1 65 LYS C    C  12.540  10.049  22.544 1.00 . A A . 65 LYS C    1 1 
        6  7473 1 1 65 LYS CA   C  11.927  10.874  23.674 1.00 . A A . 65 LYS CA   1 1 
        6  7474 1 1 65 LYS CB   C  13.007  11.051  24.749 1.00 . A A . 65 LYS CB   1 1 
        6  7475 1 1 65 LYS CD   C  15.282  12.031  25.229 1.00 . A A . 65 LYS CD   1 1 
        6  7476 1 1 65 LYS CE   C  14.887  12.933  26.404 1.00 . A A . 65 LYS CE   1 1 
        6  7477 1 1 65 LYS CG   C  14.137  11.944  24.210 1.00 . A A . 65 LYS CG   1 1 
        6  7478 1 1 65 LYS H    H  10.881   9.796  25.162 1.00 . A A . 65 LYS H    1 1 
        6  7479 1 1 65 LYS HA   H  11.633  11.867  23.370 1.00 . A A . 65 LYS HA   1 1 
        6  7480 1 1 65 LYS HB2  H  12.568  11.514  25.615 1.00 . A A . 65 LYS HB2  1 1 
        6  7481 1 1 65 LYS HB3  H  13.411  10.087  25.019 1.00 . A A . 65 LYS HB3  1 1 
        6  7482 1 1 65 LYS HD2  H  15.506  11.041  25.599 1.00 . A A . 65 LYS HD2  1 1 
        6  7483 1 1 65 LYS HD3  H  16.158  12.438  24.747 1.00 . A A . 65 LYS HD3  1 1 
        6  7484 1 1 65 LYS HE2  H  14.520  13.877  26.030 1.00 . A A . 65 LYS HE2  1 1 
        6  7485 1 1 65 LYS HE3  H  14.119  12.454  26.990 1.00 . A A . 65 LYS HE3  1 1 
        6  7486 1 1 65 LYS HG2  H  14.515  11.530  23.286 1.00 . A A . 65 LYS HG2  1 1 
        6  7487 1 1 65 LYS HG3  H  13.750  12.934  24.024 1.00 . A A . 65 LYS HG3  1 1 
        6  7488 1 1 65 LYS HZ1  H  16.854  12.542  26.966 1.00 . A A . 65 LYS HZ1  1 1 
        6  7489 1 1 65 LYS HZ2  H  15.837  12.971  28.257 1.00 . A A . 65 LYS HZ2  1 1 
        6  7490 1 1 65 LYS HZ3  H  16.385  14.160  27.173 1.00 . A A . 65 LYS HZ3  1 1 
        6  7491 1 1 65 LYS N    N  10.763  10.239  24.299 1.00 . A A . 65 LYS N    1 1 
        6  7492 1 1 65 LYS NZ   N  16.081  13.169  27.265 1.00 . A A . 65 LYS NZ   1 1 
        6  7493 1 1 65 LYS O    O  12.988  10.578  21.529 1.00 . A A . 65 LYS O    1 1 
        6  7494 1 1 66 ARG C    C  11.736   7.925  20.567 1.00 . A A . 66 ARG C    1 1 
        6  7495 1 1 66 ARG CA   C  12.848   7.863  21.608 1.00 . A A . 66 ARG CA   1 1 
        6  7496 1 1 66 ARG CB   C  13.053   6.432  22.113 1.00 . A A . 66 ARG CB   1 1 
        6  7497 1 1 66 ARG CD   C  14.114   4.234  21.618 1.00 . A A . 66 ARG CD   1 1 
        6  7498 1 1 66 ARG CG   C  13.703   5.581  21.020 1.00 . A A . 66 ARG CG   1 1 
        6  7499 1 1 66 ARG CZ   C  15.497   3.460  23.465 1.00 . A A . 66 ARG CZ   1 1 
        6  7500 1 1 66 ARG H    H  11.787   8.463  23.395 1.00 . A A . 66 ARG H    1 1 
        6  7501 1 1 66 ARG HA   H  13.753   8.230  21.143 1.00 . A A . 66 ARG HA   1 1 
        6  7502 1 1 66 ARG HB2  H  13.692   6.448  22.984 1.00 . A A . 66 ARG HB2  1 1 
        6  7503 1 1 66 ARG HB3  H  12.097   6.005  22.377 1.00 . A A . 66 ARG HB3  1 1 
        6  7504 1 1 66 ARG HD2  H  13.246   3.748  22.037 1.00 . A A . 66 ARG HD2  1 1 
        6  7505 1 1 66 ARG HD3  H  14.535   3.611  20.841 1.00 . A A . 66 ARG HD3  1 1 
        6  7506 1 1 66 ARG HE   H  15.481   5.342  22.792 1.00 . A A . 66 ARG HE   1 1 
        6  7507 1 1 66 ARG HG2  H  12.997   5.423  20.217 1.00 . A A . 66 ARG HG2  1 1 
        6  7508 1 1 66 ARG HG3  H  14.577   6.087  20.640 1.00 . A A . 66 ARG HG3  1 1 
        6  7509 1 1 66 ARG HH11 H  14.355   2.078  22.573 1.00 . A A . 66 ARG HH11 1 1 
        6  7510 1 1 66 ARG HH12 H  15.312   1.515  23.902 1.00 . A A . 66 ARG HH12 1 1 
        6  7511 1 1 66 ARG HH21 H  16.729   4.615  24.540 1.00 . A A . 66 ARG HH21 1 1 
        6  7512 1 1 66 ARG HH22 H  16.656   2.951  25.015 1.00 . A A . 66 ARG HH22 1 1 
        6  7513 1 1 66 ARG N    N  12.423   8.735  22.701 1.00 . A A . 66 ARG N    1 1 
        6  7514 1 1 66 ARG NE   N  15.104   4.446  22.665 1.00 . A A . 66 ARG NE   1 1 
        6  7515 1 1 66 ARG NH1  N  15.017   2.257  23.300 1.00 . A A . 66 ARG NH1  1 1 
        6  7516 1 1 66 ARG NH2  N  16.362   3.693  24.414 1.00 . A A . 66 ARG NH2  1 1 
        6  7517 1 1 66 ARG O    O  11.955   8.316  19.420 1.00 . A A . 66 ARG O    1 1 
        6  7518 1 1 67 GLN C    C   8.998   8.897  19.634 1.00 . A A . 67 GLN C    1 1 
        6  7519 1 1 67 GLN CA   C   9.367   7.499  20.130 1.00 . A A . 67 GLN CA   1 1 
        6  7520 1 1 67 GLN CB   C   8.183   6.931  20.920 1.00 . A A . 67 GLN CB   1 1 
        6  7521 1 1 67 GLN CD   C   7.240   4.839  21.931 1.00 . A A . 67 GLN CD   1 1 
        6  7522 1 1 67 GLN CG   C   8.447   5.456  21.231 1.00 . A A . 67 GLN CG   1 1 
        6  7523 1 1 67 GLN H    H  10.478   7.106  21.873 1.00 . A A . 67 GLN H    1 1 
        6  7524 1 1 67 GLN HA   H   9.566   6.825  19.310 1.00 . A A . 67 GLN HA   1 1 
        6  7525 1 1 67 GLN HB2  H   8.070   7.482  21.842 1.00 . A A . 67 GLN HB2  1 1 
        6  7526 1 1 67 GLN HB3  H   7.282   7.019  20.333 1.00 . A A . 67 GLN HB3  1 1 
        6  7527 1 1 67 GLN HE21 H   8.324   3.954  23.338 1.00 . A A . 67 GLN HE21 1 1 
        6  7528 1 1 67 GLN HE22 H   6.649   3.704  23.449 1.00 . A A . 67 GLN HE22 1 1 
        6  7529 1 1 67 GLN HG2  H   8.635   4.924  20.310 1.00 . A A . 67 GLN HG2  1 1 
        6  7530 1 1 67 GLN HG3  H   9.310   5.375  21.873 1.00 . A A . 67 GLN HG3  1 1 
        6  7531 1 1 67 GLN N    N  10.545   7.522  20.988 1.00 . A A . 67 GLN N    1 1 
        6  7532 1 1 67 GLN NE2  N   7.419   4.105  22.995 1.00 . A A . 67 GLN NE2  1 1 
        6  7533 1 1 67 GLN O    O   8.158   9.054  18.754 1.00 . A A . 67 GLN O    1 1 
        6  7534 1 1 67 GLN OE1  O   6.107   5.007  21.479 1.00 . A A . 67 GLN OE1  1 1 
        6  7535 1 1 68 ALA C    C   9.162  11.455  18.438 1.00 . A A . 68 ALA C    1 1 
        6  7536 1 1 68 ALA CA   C   9.251  11.302  19.959 1.00 . A A . 68 ALA CA   1 1 
        6  7537 1 1 68 ALA CB   C  10.358  12.233  20.486 1.00 . A A . 68 ALA CB   1 1 
        6  7538 1 1 68 ALA H    H  10.206   9.662  20.992 1.00 . A A . 68 ALA H    1 1 
        6  7539 1 1 68 ALA HA   H   8.324  11.551  20.457 1.00 . A A . 68 ALA HA   1 1 
        6  7540 1 1 68 ALA HB1  H  11.317  11.750  20.369 1.00 . A A . 68 ALA HB1  1 1 
        6  7541 1 1 68 ALA HB2  H  10.190  12.446  21.531 1.00 . A A . 68 ALA HB2  1 1 
        6  7542 1 1 68 ALA HB3  H  10.354  13.160  19.931 1.00 . A A . 68 ALA HB3  1 1 
        6  7543 1 1 68 ALA N    N   9.585   9.907  20.275 1.00 . A A . 68 ALA N    1 1 
        6  7544 1 1 68 ALA O    O   8.266  12.118  17.915 1.00 . A A . 68 ALA O    1 1 
        6  7545 1 1 69 ASP C    C   8.686  10.184  15.820 1.00 . A A . 69 ASP C    1 1 
        6  7546 1 1 69 ASP CA   C  10.026  10.749  16.286 1.00 . A A . 69 ASP CA   1 1 
        6  7547 1 1 69 ASP CB   C  11.134   9.819  15.784 1.00 . A A . 69 ASP CB   1 1 
        6  7548 1 1 69 ASP CG   C  11.150   9.810  14.260 1.00 . A A . 69 ASP CG   1 1 
        6  7549 1 1 69 ASP H    H  10.703  10.219  18.242 1.00 . A A . 69 ASP H    1 1 
        6  7550 1 1 69 ASP HA   H  10.167  11.711  15.813 1.00 . A A . 69 ASP HA   1 1 
        6  7551 1 1 69 ASP HB2  H  12.088  10.167  16.153 1.00 . A A . 69 ASP HB2  1 1 
        6  7552 1 1 69 ASP HB3  H  10.953   8.818  16.146 1.00 . A A . 69 ASP HB3  1 1 
        6  7553 1 1 69 ASP N    N  10.057  10.762  17.744 1.00 . A A . 69 ASP N    1 1 
        6  7554 1 1 69 ASP O    O   7.957  10.834  15.072 1.00 . A A . 69 ASP O    1 1 
        6  7555 1 1 69 ASP OD1  O  10.216  10.335  13.677 1.00 . A A . 69 ASP OD1  1 1 
        6  7556 1 1 69 ASP OD2  O  12.094   9.281  13.698 1.00 . A A . 69 ASP OD2  1 1 
        6  7557 1 1 70 ALA C    C   5.904   9.116  16.347 1.00 . A A . 70 ALA C    1 1 
        6  7558 1 1 70 ALA CA   C   7.118   8.325  15.864 1.00 . A A . 70 ALA CA   1 1 
        6  7559 1 1 70 ALA CB   C   7.062   6.908  16.437 1.00 . A A . 70 ALA CB   1 1 
        6  7560 1 1 70 ALA H    H   9.016   8.467  16.796 1.00 . A A . 70 ALA H    1 1 
        6  7561 1 1 70 ALA HA   H   7.083   8.262  14.786 1.00 . A A . 70 ALA HA   1 1 
        6  7562 1 1 70 ALA HB1  H   6.222   6.380  16.008 1.00 . A A . 70 ALA HB1  1 1 
        6  7563 1 1 70 ALA HB2  H   6.947   6.957  17.509 1.00 . A A . 70 ALA HB2  1 1 
        6  7564 1 1 70 ALA HB3  H   7.976   6.385  16.196 1.00 . A A . 70 ALA HB3  1 1 
        6  7565 1 1 70 ALA N    N   8.370   8.969  16.256 1.00 . A A . 70 ALA N    1 1 
        6  7566 1 1 70 ALA O    O   4.909   9.239  15.632 1.00 . A A . 70 ALA O    1 1 
        6  7567 1 1 71 SER C    C   3.643   9.508  18.259 1.00 . A A . 71 SER C    1 1 
        6  7568 1 1 71 SER CA   C   4.875  10.400  18.130 1.00 . A A . 71 SER CA   1 1 
        6  7569 1 1 71 SER CB   C   4.557  11.606  17.244 1.00 . A A . 71 SER CB   1 1 
        6  7570 1 1 71 SER H    H   6.791   9.505  18.094 1.00 . A A . 71 SER H    1 1 
        6  7571 1 1 71 SER HA   H   5.156  10.751  19.112 1.00 . A A . 71 SER HA   1 1 
        6  7572 1 1 71 SER HB2  H   5.475  12.056  16.903 1.00 . A A . 71 SER HB2  1 1 
        6  7573 1 1 71 SER HB3  H   3.976  11.285  16.389 1.00 . A A . 71 SER HB3  1 1 
        6  7574 1 1 71 SER HG   H   4.310  13.387  17.989 1.00 . A A . 71 SER HG   1 1 
        6  7575 1 1 71 SER N    N   5.982   9.639  17.565 1.00 . A A . 71 SER N    1 1 
        6  7576 1 1 71 SER O    O   2.676   9.662  17.514 1.00 . A A . 71 SER O    1 1 
        6  7577 1 1 71 SER OG   O   3.823  12.560  18.000 1.00 . A A . 71 SER OG   1 1 
        6  7578 1 1 72 SER C    C   2.726   6.439  18.478 1.00 . A A . 72 SER C    1 1 
        6  7579 1 1 72 SER CA   C   2.602   7.625  19.429 1.00 . A A . 72 SER CA   1 1 
        6  7580 1 1 72 SER CB   C   1.246   8.313  19.227 1.00 . A A . 72 SER CB   1 1 
        6  7581 1 1 72 SER H    H   4.511   8.492  19.750 1.00 . A A . 72 SER H    1 1 
        6  7582 1 1 72 SER HA   H   2.663   7.262  20.445 1.00 . A A . 72 SER HA   1 1 
        6  7583 1 1 72 SER HB2  H   0.500   7.845  19.849 1.00 . A A . 72 SER HB2  1 1 
        6  7584 1 1 72 SER HB3  H   1.332   9.358  19.496 1.00 . A A . 72 SER HB3  1 1 
        6  7585 1 1 72 SER HG   H   1.653   8.194  17.328 1.00 . A A . 72 SER HG   1 1 
        6  7586 1 1 72 SER N    N   3.702   8.565  19.200 1.00 . A A . 72 SER N    1 1 
        6  7587 1 1 72 SER O    O   3.103   6.603  17.319 1.00 . A A . 72 SER O    1 1 
        6  7588 1 1 72 SER OG   O   0.858   8.194  17.865 1.00 . A A . 72 SER OG   1 1 
        6  7589 1 1 73 THR C    C   1.655   4.174  16.891 1.00 . A A . 73 THR C    1 1 
        6  7590 1 1 73 THR CA   C   2.516   4.040  18.158 1.00 . A A . 73 THR CA   1 1 
        6  7591 1 1 73 THR CB   C   2.013   2.844  18.969 1.00 . A A . 73 THR CB   1 1 
        6  7592 1 1 73 THR CG2  C   2.020   1.588  18.095 1.00 . A A . 73 THR CG2  1 1 
        6  7593 1 1 73 THR H    H   2.132   5.170  19.911 1.00 . A A . 73 THR H    1 1 
        6  7594 1 1 73 THR HA   H   3.545   3.865  17.905 1.00 . A A . 73 THR HA   1 1 
        6  7595 1 1 73 THR HB   H   1.005   3.036  19.305 1.00 . A A . 73 THR HB   1 1 
        6  7596 1 1 73 THR HG1  H   2.641   3.315  20.748 1.00 . A A . 73 THR HG1  1 1 
        6  7597 1 1 73 THR HG21 H   1.901   0.715  18.719 1.00 . A A . 73 THR HG21 1 1 
        6  7598 1 1 73 THR HG22 H   2.957   1.526  17.562 1.00 . A A . 73 THR HG22 1 1 
        6  7599 1 1 73 THR HG23 H   1.206   1.637  17.386 1.00 . A A . 73 THR HG23 1 1 
        6  7600 1 1 73 THR N    N   2.418   5.244  18.976 1.00 . A A . 73 THR N    1 1 
        6  7601 1 1 73 THR O    O   0.428   4.183  16.988 1.00 . A A . 73 THR O    1 1 
        6  7602 1 1 73 THR OG1  O   2.857   2.646  20.094 1.00 . A A . 73 THR OG1  1 1 
        6  7603 1 1 74 PRO C    C   0.482   3.178  14.265 1.00 . A A . 74 PRO C    1 1 
        6  7604 1 1 74 PRO CA   C   1.443   4.355  14.440 1.00 . A A . 74 PRO CA   1 1 
        6  7605 1 1 74 PRO CB   C   2.511   4.356  13.330 1.00 . A A . 74 PRO CB   1 1 
        6  7606 1 1 74 PRO CD   C   3.694   4.277  15.418 1.00 . A A . 74 PRO CD   1 1 
        6  7607 1 1 74 PRO CG   C   3.755   4.832  13.999 1.00 . A A . 74 PRO CG   1 1 
        6  7608 1 1 74 PRO HA   H   0.898   5.286  14.420 1.00 . A A . 74 PRO HA   1 1 
        6  7609 1 1 74 PRO HB2  H   2.655   3.356  12.937 1.00 . A A . 74 PRO HB2  1 1 
        6  7610 1 1 74 PRO HB3  H   2.233   5.035  12.536 1.00 . A A . 74 PRO HB3  1 1 
        6  7611 1 1 74 PRO HD2  H   4.116   3.280  15.455 1.00 . A A . 74 PRO HD2  1 1 
        6  7612 1 1 74 PRO HD3  H   4.206   4.940  16.096 1.00 . A A . 74 PRO HD3  1 1 
        6  7613 1 1 74 PRO HG2  H   4.628   4.454  13.481 1.00 . A A . 74 PRO HG2  1 1 
        6  7614 1 1 74 PRO HG3  H   3.776   5.912  14.030 1.00 . A A . 74 PRO HG3  1 1 
        6  7615 1 1 74 PRO N    N   2.240   4.253  15.706 1.00 . A A . 74 PRO N    1 1 
        6  7616 1 1 74 PRO O    O   0.821   2.036  14.577 1.00 . A A . 74 PRO O    1 1 
        6  7617 1 1 75 LYS C    C  -1.313   1.605  12.285 1.00 . A A . 75 LYS C    1 1 
        6  7618 1 1 75 LYS CA   C  -1.699   2.423  13.513 1.00 . A A . 75 LYS CA   1 1 
        6  7619 1 1 75 LYS CB   C  -3.081   3.055  13.304 1.00 . A A . 75 LYS CB   1 1 
        6  7620 1 1 75 LYS CD   C  -4.293   2.697  15.505 1.00 . A A . 75 LYS CD   1 1 
        6  7621 1 1 75 LYS CE   C  -5.770   2.596  15.100 1.00 . A A . 75 LYS CE   1 1 
        6  7622 1 1 75 LYS CG   C  -3.563   3.720  14.611 1.00 . A A . 75 LYS CG   1 1 
        6  7623 1 1 75 LYS H    H  -0.915   4.390  13.505 1.00 . A A . 75 LYS H    1 1 
        6  7624 1 1 75 LYS HA   H  -1.736   1.770  14.372 1.00 . A A . 75 LYS HA   1 1 
        6  7625 1 1 75 LYS HB2  H  -3.014   3.801  12.524 1.00 . A A . 75 LYS HB2  1 1 
        6  7626 1 1 75 LYS HB3  H  -3.781   2.290  13.004 1.00 . A A . 75 LYS HB3  1 1 
        6  7627 1 1 75 LYS HD2  H  -3.827   1.726  15.401 1.00 . A A . 75 LYS HD2  1 1 
        6  7628 1 1 75 LYS HD3  H  -4.229   3.013  16.536 1.00 . A A . 75 LYS HD3  1 1 
        6  7629 1 1 75 LYS HE2  H  -5.846   2.449  14.034 1.00 . A A . 75 LYS HE2  1 1 
        6  7630 1 1 75 LYS HE3  H  -6.226   1.762  15.611 1.00 . A A . 75 LYS HE3  1 1 
        6  7631 1 1 75 LYS HG2  H  -2.712   4.119  15.148 1.00 . A A . 75 LYS HG2  1 1 
        6  7632 1 1 75 LYS HG3  H  -4.238   4.531  14.370 1.00 . A A . 75 LYS HG3  1 1 
        6  7633 1 1 75 LYS HZ1  H  -5.964   4.669  15.080 1.00 . A A . 75 LYS HZ1  1 1 
        6  7634 1 1 75 LYS HZ2  H  -6.501   3.936  16.515 1.00 . A A . 75 LYS HZ2  1 1 
        6  7635 1 1 75 LYS HZ3  H  -7.441   3.837  15.103 1.00 . A A . 75 LYS HZ3  1 1 
        6  7636 1 1 75 LYS N    N  -0.706   3.464  13.747 1.00 . A A . 75 LYS N    1 1 
        6  7637 1 1 75 LYS NZ   N  -6.472   3.854  15.478 1.00 . A A . 75 LYS NZ   1 1 
        6  7638 1 1 75 LYS O    O  -1.878   0.541  12.027 1.00 . A A . 75 LYS O    1 1 
        6  7639 1 1 76 PHE C    C   0.829   0.140  10.675 1.00 . A A . 76 PHE C    1 1 
        6  7640 1 1 76 PHE CA   C   0.123   1.447  10.326 1.00 . A A . 76 PHE CA   1 1 
        6  7641 1 1 76 PHE CB   C   1.083   2.362   9.565 1.00 . A A . 76 PHE CB   1 1 
        6  7642 1 1 76 PHE CD1  C  -0.281   3.410   7.723 1.00 . A A . 76 PHE CD1  1 1 
        6  7643 1 1 76 PHE CD2  C   0.182   4.709   9.717 1.00 . A A . 76 PHE CD2  1 1 
        6  7644 1 1 76 PHE CE1  C  -1.002   4.485   7.190 1.00 . A A . 76 PHE CE1  1 1 
        6  7645 1 1 76 PHE CE2  C  -0.539   5.784   9.185 1.00 . A A . 76 PHE CE2  1 1 
        6  7646 1 1 76 PHE CG   C   0.311   3.522   8.986 1.00 . A A . 76 PHE CG   1 1 
        6  7647 1 1 76 PHE CZ   C  -1.132   5.672   7.921 1.00 . A A . 76 PHE CZ   1 1 
        6  7648 1 1 76 PHE H    H   0.060   2.971  11.793 1.00 . A A . 76 PHE H    1 1 
        6  7649 1 1 76 PHE HA   H  -0.724   1.228   9.694 1.00 . A A . 76 PHE HA   1 1 
        6  7650 1 1 76 PHE HB2  H   1.841   2.732  10.241 1.00 . A A . 76 PHE HB2  1 1 
        6  7651 1 1 76 PHE HB3  H   1.553   1.808   8.765 1.00 . A A . 76 PHE HB3  1 1 
        6  7652 1 1 76 PHE HD1  H  -0.182   2.494   7.160 1.00 . A A . 76 PHE HD1  1 1 
        6  7653 1 1 76 PHE HD2  H   0.639   4.796  10.692 1.00 . A A . 76 PHE HD2  1 1 
        6  7654 1 1 76 PHE HE1  H  -1.458   4.398   6.216 1.00 . A A . 76 PHE HE1  1 1 
        6  7655 1 1 76 PHE HE2  H  -0.639   6.701   9.749 1.00 . A A . 76 PHE HE2  1 1 
        6  7656 1 1 76 PHE HZ   H  -1.688   6.501   7.510 1.00 . A A . 76 PHE HZ   1 1 
        6  7657 1 1 76 PHE N    N  -0.346   2.118  11.532 1.00 . A A . 76 PHE N    1 1 
        6  7658 1 1 76 PHE O    O   0.791  -0.821   9.907 1.00 . A A . 76 PHE O    1 1 
        6  7659 1 1 77 ASN C    C   1.240  -2.264  12.381 1.00 . A A . 77 ASN C    1 1 
        6  7660 1 1 77 ASN CA   C   2.196  -1.080  12.267 1.00 . A A . 77 ASN CA   1 1 
        6  7661 1 1 77 ASN CB   C   2.859  -0.830  13.622 1.00 . A A . 77 ASN CB   1 1 
        6  7662 1 1 77 ASN CG   C   3.682  -2.046  14.032 1.00 . A A . 77 ASN CG   1 1 
        6  7663 1 1 77 ASN H    H   1.480   0.910  12.405 1.00 . A A . 77 ASN H    1 1 
        6  7664 1 1 77 ASN HA   H   2.960  -1.315  11.541 1.00 . A A . 77 ASN HA   1 1 
        6  7665 1 1 77 ASN HB2  H   3.505   0.034  13.551 1.00 . A A . 77 ASN HB2  1 1 
        6  7666 1 1 77 ASN HB3  H   2.097  -0.647  14.366 1.00 . A A . 77 ASN HB3  1 1 
        6  7667 1 1 77 ASN HD21 H   2.655  -2.364  15.702 1.00 . A A . 77 ASN HD21 1 1 
        6  7668 1 1 77 ASN HD22 H   3.920  -3.457  15.409 1.00 . A A . 77 ASN HD22 1 1 
        6  7669 1 1 77 ASN N    N   1.480   0.114  11.835 1.00 . A A . 77 ASN N    1 1 
        6  7670 1 1 77 ASN ND2  N   3.396  -2.674  15.139 1.00 . A A . 77 ASN ND2  1 1 
        6  7671 1 1 77 ASN O    O   1.567  -3.379  11.978 1.00 . A A . 77 ASN O    1 1 
        6  7672 1 1 77 ASN OD1  O   4.611  -2.435  13.324 1.00 . A A . 77 ASN OD1  1 1 
        6  7673 1 1 78 GLY C    C  -0.548  -4.033  14.196 1.00 . A A . 78 GLY C    1 1 
        6  7674 1 1 78 GLY CA   C  -0.941  -3.065  13.085 1.00 . A A . 78 GLY CA   1 1 
        6  7675 1 1 78 GLY H    H  -0.153  -1.103  13.230 1.00 . A A . 78 GLY H    1 1 
        6  7676 1 1 78 GLY HA2  H  -1.896  -2.617  13.324 1.00 . A A . 78 GLY HA2  1 1 
        6  7677 1 1 78 GLY HA3  H  -1.028  -3.611  12.158 1.00 . A A . 78 GLY HA3  1 1 
        6  7678 1 1 78 GLY N    N   0.055  -2.012  12.929 1.00 . A A . 78 GLY N    1 1 
        6  7679 1 1 78 GLY O    O   0.235  -3.692  15.082 1.00 . A A . 78 GLY O    1 1 
        6  7680 1 1 79 VAL C    C  -1.151  -5.740  16.542 1.00 . A A . 79 VAL C    1 1 
        6  7681 1 1 79 VAL CA   C  -0.803  -6.254  15.148 1.00 . A A . 79 VAL CA   1 1 
        6  7682 1 1 79 VAL CB   C   0.681  -6.628  15.092 1.00 . A A . 79 VAL CB   1 1 
        6  7683 1 1 79 VAL CG1  C   0.908  -7.949  15.831 1.00 . A A . 79 VAL CG1  1 1 
        6  7684 1 1 79 VAL CG2  C   1.111  -6.783  13.632 1.00 . A A . 79 VAL CG2  1 1 
        6  7685 1 1 79 VAL H    H  -1.718  -5.454  13.412 1.00 . A A . 79 VAL H    1 1 
        6  7686 1 1 79 VAL HA   H  -1.393  -7.133  14.942 1.00 . A A . 79 VAL HA   1 1 
        6  7687 1 1 79 VAL HB   H   1.266  -5.849  15.560 1.00 . A A . 79 VAL HB   1 1 
        6  7688 1 1 79 VAL HG11 H   0.579  -7.851  16.855 1.00 . A A . 79 VAL HG11 1 1 
        6  7689 1 1 79 VAL HG12 H   1.960  -8.195  15.814 1.00 . A A . 79 VAL HG12 1 1 
        6  7690 1 1 79 VAL HG13 H   0.348  -8.734  15.345 1.00 . A A . 79 VAL HG13 1 1 
        6  7691 1 1 79 VAL HG21 H   0.390  -7.392  13.107 1.00 . A A . 79 VAL HG21 1 1 
        6  7692 1 1 79 VAL HG22 H   2.080  -7.257  13.590 1.00 . A A . 79 VAL HG22 1 1 
        6  7693 1 1 79 VAL HG23 H   1.165  -5.809  13.168 1.00 . A A . 79 VAL HG23 1 1 
        6  7694 1 1 79 VAL N    N  -1.100  -5.240  14.142 1.00 . A A . 79 VAL N    1 1 
        6  7695 1 1 79 VAL O    O  -0.315  -5.752  17.446 1.00 . A A . 79 VAL O    1 1 
        6  7696 1 1 80 LYS C    C  -2.774  -5.865  19.064 1.00 . A A . 80 LYS C    1 1 
        6  7697 1 1 80 LYS CA   C  -2.839  -4.776  17.998 1.00 . A A . 80 LYS CA   1 1 
        6  7698 1 1 80 LYS CB   C  -4.271  -4.242  17.876 1.00 . A A . 80 LYS CB   1 1 
        6  7699 1 1 80 LYS CD   C  -6.643  -4.827  17.349 1.00 . A A . 80 LYS CD   1 1 
        6  7700 1 1 80 LYS CE   C  -7.594  -5.962  16.964 1.00 . A A . 80 LYS CE   1 1 
        6  7701 1 1 80 LYS CG   C  -5.232  -5.388  17.542 1.00 . A A . 80 LYS CG   1 1 
        6  7702 1 1 80 LYS H    H  -3.013  -5.305  15.953 1.00 . A A . 80 LYS H    1 1 
        6  7703 1 1 80 LYS HA   H  -2.191  -3.962  18.291 1.00 . A A . 80 LYS HA   1 1 
        6  7704 1 1 80 LYS HB2  H  -4.564  -3.788  18.812 1.00 . A A . 80 LYS HB2  1 1 
        6  7705 1 1 80 LYS HB3  H  -4.312  -3.502  17.091 1.00 . A A . 80 LYS HB3  1 1 
        6  7706 1 1 80 LYS HD2  H  -6.978  -4.372  18.270 1.00 . A A . 80 LYS HD2  1 1 
        6  7707 1 1 80 LYS HD3  H  -6.632  -4.087  16.563 1.00 . A A . 80 LYS HD3  1 1 
        6  7708 1 1 80 LYS HE2  H  -8.577  -5.557  16.770 1.00 . A A . 80 LYS HE2  1 1 
        6  7709 1 1 80 LYS HE3  H  -7.226  -6.455  16.076 1.00 . A A . 80 LYS HE3  1 1 
        6  7710 1 1 80 LYS HG2  H  -4.909  -5.876  16.634 1.00 . A A . 80 LYS HG2  1 1 
        6  7711 1 1 80 LYS HG3  H  -5.243  -6.102  18.351 1.00 . A A . 80 LYS HG3  1 1 
        6  7712 1 1 80 LYS HZ1  H  -8.049  -6.475  18.930 1.00 . A A . 80 LYS HZ1  1 1 
        6  7713 1 1 80 LYS HZ2  H  -6.724  -7.318  18.282 1.00 . A A . 80 LYS HZ2  1 1 
        6  7714 1 1 80 LYS HZ3  H  -8.305  -7.725  17.813 1.00 . A A . 80 LYS HZ3  1 1 
        6  7715 1 1 80 LYS N    N  -2.390  -5.290  16.709 1.00 . A A . 80 LYS N    1 1 
        6  7716 1 1 80 LYS NZ   N  -7.674  -6.944  18.082 1.00 . A A . 80 LYS NZ   1 1 
        6  7717 1 1 80 LYS O    O  -2.705  -5.574  20.258 1.00 . A A . 80 LYS O    1 1 
        6  7718 1 1 81 LYS C    C  -3.874  -8.154  20.564 1.00 . A A . 81 LYS C    1 1 
        6  7719 1 1 81 LYS CA   C  -2.740  -8.246  19.546 1.00 . A A . 81 LYS CA   1 1 
        6  7720 1 1 81 LYS CB   C  -1.391  -8.259  20.271 1.00 . A A . 81 LYS CB   1 1 
        6  7721 1 1 81 LYS CD   C   0.061  -9.508  21.878 1.00 . A A . 81 LYS CD   1 1 
        6  7722 1 1 81 LYS CE   C   0.146 -10.729  22.796 1.00 . A A . 81 LYS CE   1 1 
        6  7723 1 1 81 LYS CG   C  -1.304  -9.483  21.187 1.00 . A A . 81 LYS CG   1 1 
        6  7724 1 1 81 LYS H    H  -2.852  -7.289  17.659 1.00 . A A . 81 LYS H    1 1 
        6  7725 1 1 81 LYS HA   H  -2.845  -9.163  18.986 1.00 . A A . 81 LYS HA   1 1 
        6  7726 1 1 81 LYS HB2  H  -0.593  -8.297  19.544 1.00 . A A . 81 LYS HB2  1 1 
        6  7727 1 1 81 LYS HB3  H  -1.293  -7.362  20.864 1.00 . A A . 81 LYS HB3  1 1 
        6  7728 1 1 81 LYS HD2  H   0.840  -9.560  21.133 1.00 . A A . 81 LYS HD2  1 1 
        6  7729 1 1 81 LYS HD3  H   0.183  -8.610  22.466 1.00 . A A . 81 LYS HD3  1 1 
        6  7730 1 1 81 LYS HE2  H  -0.628 -10.671  23.545 1.00 . A A . 81 LYS HE2  1 1 
        6  7731 1 1 81 LYS HE3  H   0.017 -11.628  22.212 1.00 . A A . 81 LYS HE3  1 1 
        6  7732 1 1 81 LYS HG2  H  -2.083  -9.433  21.935 1.00 . A A . 81 LYS HG2  1 1 
        6  7733 1 1 81 LYS HG3  H  -1.424 -10.381  20.601 1.00 . A A . 81 LYS HG3  1 1 
        6  7734 1 1 81 LYS HZ1  H   1.884 -11.712  23.389 1.00 . A A . 81 LYS HZ1  1 1 
        6  7735 1 1 81 LYS HZ2  H   1.373 -10.500  24.463 1.00 . A A . 81 LYS HZ2  1 1 
        6  7736 1 1 81 LYS HZ3  H   2.115 -10.080  22.994 1.00 . A A . 81 LYS HZ3  1 1 
        6  7737 1 1 81 LYS N    N  -2.797  -7.118  18.623 1.00 . A A . 81 LYS N    1 1 
        6  7738 1 1 81 LYS NZ   N   1.480 -10.758  23.461 1.00 . A A . 81 LYS NZ   1 1 
        6  7739 1 1 81 LYS O    O  -3.684  -7.496  21.574 1.00 . A A . 81 LYS O    1 1 
        6  7740 1 1 81 LYS OXT  O  -4.913  -8.744  20.319 1.00 . A A . 81 LYS OXT  1 1 
        7  7741 1 1  1 MET C    C -11.279   9.162  -2.944 1.00 . A A .  1 MET C    1 1 
        7  7742 1 1  1 MET CA   C -11.895   9.883  -4.141 1.00 . A A .  1 MET CA   1 1 
        7  7743 1 1  1 MET CB   C -13.158   9.146  -4.621 1.00 . A A .  1 MET CB   1 1 
        7  7744 1 1  1 MET CE   C -13.285   6.890  -7.148 1.00 . A A .  1 MET CE   1 1 
        7  7745 1 1  1 MET CG   C -13.370   9.404  -6.117 1.00 . A A .  1 MET CG   1 1 
        7  7746 1 1  1 MET H1   H -11.372  10.238  -6.125 1.00 . A A .  1 MET H1   1 1 
        7  7747 1 1  1 MET H2   H -10.485   8.992  -5.387 1.00 . A A .  1 MET H2   1 1 
        7  7748 1 1  1 MET H3   H -10.149  10.614  -5.011 1.00 . A A .  1 MET H3   1 1 
        7  7749 1 1  1 MET HA   H -12.157  10.891  -3.852 1.00 . A A .  1 MET HA   1 1 
        7  7750 1 1  1 MET HB2  H -13.046   8.083  -4.456 1.00 . A A .  1 MET HB2  1 1 
        7  7751 1 1  1 MET HB3  H -14.016   9.504  -4.073 1.00 . A A .  1 MET HB3  1 1 
        7  7752 1 1  1 MET HE1  H -12.799   6.134  -7.750 1.00 . A A .  1 MET HE1  1 1 
        7  7753 1 1  1 MET HE2  H -14.235   7.141  -7.590 1.00 . A A .  1 MET HE2  1 1 
        7  7754 1 1  1 MET HE3  H -13.444   6.513  -6.147 1.00 . A A .  1 MET HE3  1 1 
        7  7755 1 1  1 MET HG2  H -14.389   9.164  -6.381 1.00 . A A .  1 MET HG2  1 1 
        7  7756 1 1  1 MET HG3  H -13.178  10.444  -6.336 1.00 . A A .  1 MET HG3  1 1 
        7  7757 1 1  1 MET N    N -10.901   9.935  -5.250 1.00 . A A .  1 MET N    1 1 
        7  7758 1 1  1 MET O    O -11.782   9.256  -1.823 1.00 . A A .  1 MET O    1 1 
        7  7759 1 1  1 MET SD   S -12.240   8.366  -7.077 1.00 . A A .  1 MET SD   1 1 
        7  7760 1 1  2 LYS C    C  -8.027   7.539  -2.465 1.00 . A A .  2 LYS C    1 1 
        7  7761 1 1  2 LYS CA   C  -9.508   7.701  -2.131 1.00 . A A .  2 LYS CA   1 1 
        7  7762 1 1  2 LYS CB   C -10.146   6.319  -1.968 1.00 . A A .  2 LYS CB   1 1 
        7  7763 1 1  2 LYS CD   C -10.750   4.205  -3.210 1.00 . A A .  2 LYS CD   1 1 
        7  7764 1 1  2 LYS CE   C -12.259   4.113  -2.952 1.00 . A A .  2 LYS CE   1 1 
        7  7765 1 1  2 LYS CG   C -10.322   5.676  -3.349 1.00 . A A .  2 LYS CG   1 1 
        7  7766 1 1  2 LYS H    H  -9.836   8.402  -4.105 1.00 . A A .  2 LYS H    1 1 
        7  7767 1 1  2 LYS HA   H  -9.602   8.242  -1.200 1.00 . A A .  2 LYS HA   1 1 
        7  7768 1 1  2 LYS HB2  H  -9.507   5.699  -1.355 1.00 . A A .  2 LYS HB2  1 1 
        7  7769 1 1  2 LYS HB3  H -11.108   6.425  -1.494 1.00 . A A .  2 LYS HB3  1 1 
        7  7770 1 1  2 LYS HD2  H -10.513   3.678  -4.122 1.00 . A A .  2 LYS HD2  1 1 
        7  7771 1 1  2 LYS HD3  H -10.220   3.749  -2.388 1.00 . A A .  2 LYS HD3  1 1 
        7  7772 1 1  2 LYS HE2  H -12.530   3.082  -2.781 1.00 . A A .  2 LYS HE2  1 1 
        7  7773 1 1  2 LYS HE3  H -12.518   4.698  -2.084 1.00 . A A .  2 LYS HE3  1 1 
        7  7774 1 1  2 LYS HG2  H -11.075   6.219  -3.903 1.00 . A A .  2 LYS HG2  1 1 
        7  7775 1 1  2 LYS HG3  H  -9.385   5.723  -3.885 1.00 . A A .  2 LYS HG3  1 1 
        7  7776 1 1  2 LYS HZ1  H -14.007   4.398  -4.047 1.00 . A A .  2 LYS HZ1  1 1 
        7  7777 1 1  2 LYS HZ2  H -12.617   4.186  -5.001 1.00 . A A .  2 LYS HZ2  1 1 
        7  7778 1 1  2 LYS HZ3  H -12.883   5.659  -4.199 1.00 . A A .  2 LYS HZ3  1 1 
        7  7779 1 1  2 LYS N    N -10.189   8.441  -3.191 1.00 . A A .  2 LYS N    1 1 
        7  7780 1 1  2 LYS NZ   N -12.997   4.628  -4.139 1.00 . A A .  2 LYS NZ   1 1 
        7  7781 1 1  2 LYS O    O  -7.453   6.467  -2.272 1.00 . A A .  2 LYS O    1 1 
        7  7782 1 1  3 ASP C    C  -5.114   8.451  -2.094 1.00 . A A .  3 ASP C    1 1 
        7  7783 1 1  3 ASP CA   C  -6.006   8.554  -3.341 1.00 . A A .  3 ASP CA   1 1 
        7  7784 1 1  3 ASP CB   C  -5.635   9.799  -4.154 1.00 . A A .  3 ASP CB   1 1 
        7  7785 1 1  3 ASP CG   C  -6.258   9.716  -5.547 1.00 . A A .  3 ASP CG   1 1 
        7  7786 1 1  3 ASP H    H  -7.923   9.430  -3.115 1.00 . A A .  3 ASP H    1 1 
        7  7787 1 1  3 ASP HA   H  -5.862   7.687  -3.955 1.00 . A A .  3 ASP HA   1 1 
        7  7788 1 1  3 ASP HB2  H  -6.001  10.680  -3.649 1.00 . A A .  3 ASP HB2  1 1 
        7  7789 1 1  3 ASP HB3  H  -4.560   9.859  -4.247 1.00 . A A .  3 ASP HB3  1 1 
        7  7790 1 1  3 ASP N    N  -7.416   8.604  -2.975 1.00 . A A .  3 ASP N    1 1 
        7  7791 1 1  3 ASP O    O  -5.484   8.942  -1.028 1.00 . A A .  3 ASP O    1 1 
        7  7792 1 1  3 ASP OD1  O  -6.639   8.623  -5.933 1.00 . A A .  3 ASP OD1  1 1 
        7  7793 1 1  3 ASP OD2  O  -6.310  10.733  -6.219 1.00 . A A .  3 ASP OD2  1 1 
        7  7794 1 1  4 PRO C    C  -2.775   8.986  -0.271 1.00 . A A .  4 PRO C    1 1 
        7  7795 1 1  4 PRO CA   C  -3.009   7.683  -1.039 1.00 . A A .  4 PRO CA   1 1 
        7  7796 1 1  4 PRO CB   C  -1.699   7.221  -1.695 1.00 . A A .  4 PRO CB   1 1 
        7  7797 1 1  4 PRO CD   C  -3.390   7.198  -3.419 1.00 . A A .  4 PRO CD   1 1 
        7  7798 1 1  4 PRO CG   C  -2.120   6.496  -2.926 1.00 . A A .  4 PRO CG   1 1 
        7  7799 1 1  4 PRO HA   H  -3.362   6.915  -0.373 1.00 . A A .  4 PRO HA   1 1 
        7  7800 1 1  4 PRO HB2  H  -1.082   8.075  -1.952 1.00 . A A .  4 PRO HB2  1 1 
        7  7801 1 1  4 PRO HB3  H  -1.159   6.556  -1.037 1.00 . A A .  4 PRO HB3  1 1 
        7  7802 1 1  4 PRO HD2  H  -3.147   7.945  -4.165 1.00 . A A .  4 PRO HD2  1 1 
        7  7803 1 1  4 PRO HD3  H  -4.077   6.469  -3.816 1.00 . A A .  4 PRO HD3  1 1 
        7  7804 1 1  4 PRO HG2  H  -1.340   6.553  -3.678 1.00 . A A .  4 PRO HG2  1 1 
        7  7805 1 1  4 PRO HG3  H  -2.339   5.463  -2.696 1.00 . A A .  4 PRO HG3  1 1 
        7  7806 1 1  4 PRO N    N  -3.948   7.833  -2.199 1.00 . A A .  4 PRO N    1 1 
        7  7807 1 1  4 PRO O    O  -2.252   8.969   0.841 1.00 . A A .  4 PRO O    1 1 
        7  7808 1 1  5 LYS C    C  -4.012  11.662   0.887 1.00 . A A .  5 LYS C    1 1 
        7  7809 1 1  5 LYS CA   C  -2.968  11.398  -0.201 1.00 . A A .  5 LYS CA   1 1 
        7  7810 1 1  5 LYS CB   C  -3.063  12.508  -1.251 1.00 . A A .  5 LYS CB   1 1 
        7  7811 1 1  5 LYS CD   C  -2.689  14.977  -1.624 1.00 . A A .  5 LYS CD   1 1 
        7  7812 1 1  5 LYS CE   C  -3.994  15.261  -2.376 1.00 . A A .  5 LYS CE   1 1 
        7  7813 1 1  5 LYS CG   C  -2.905  13.876  -0.574 1.00 . A A .  5 LYS CG   1 1 
        7  7814 1 1  5 LYS H    H  -3.596  10.089  -1.734 1.00 . A A .  5 LYS H    1 1 
        7  7815 1 1  5 LYS HA   H  -1.976  11.428   0.224 1.00 . A A .  5 LYS HA   1 1 
        7  7816 1 1  5 LYS HB2  H  -2.282  12.373  -1.986 1.00 . A A .  5 LYS HB2  1 1 
        7  7817 1 1  5 LYS HB3  H  -4.025  12.451  -1.733 1.00 . A A .  5 LYS HB3  1 1 
        7  7818 1 1  5 LYS HD2  H  -2.358  15.880  -1.131 1.00 . A A .  5 LYS HD2  1 1 
        7  7819 1 1  5 LYS HD3  H  -1.934  14.658  -2.327 1.00 . A A .  5 LYS HD3  1 1 
        7  7820 1 1  5 LYS HE2  H  -3.828  16.060  -3.085 1.00 . A A .  5 LYS HE2  1 1 
        7  7821 1 1  5 LYS HE3  H  -4.315  14.380  -2.905 1.00 . A A .  5 LYS HE3  1 1 
        7  7822 1 1  5 LYS HG2  H  -3.795  14.098  -0.005 1.00 . A A .  5 LYS HG2  1 1 
        7  7823 1 1  5 LYS HG3  H  -2.055  13.849   0.091 1.00 . A A .  5 LYS HG3  1 1 
        7  7824 1 1  5 LYS HZ1  H  -5.601  14.846  -1.120 1.00 . A A .  5 LYS HZ1  1 1 
        7  7825 1 1  5 LYS HZ2  H  -5.674  16.376  -1.854 1.00 . A A .  5 LYS HZ2  1 1 
        7  7826 1 1  5 LYS HZ3  H  -4.599  16.098  -0.568 1.00 . A A .  5 LYS HZ3  1 1 
        7  7827 1 1  5 LYS N    N  -3.156  10.111  -0.858 1.00 . A A .  5 LYS N    1 1 
        7  7828 1 1  5 LYS NZ   N  -5.046  15.677  -1.407 1.00 . A A .  5 LYS NZ   1 1 
        7  7829 1 1  5 LYS O    O  -3.683  11.939   2.035 1.00 . A A .  5 LYS O    1 1 
        7  7830 1 1  6 THR C    C  -6.671  10.394   2.206 1.00 . A A .  6 THR C    1 1 
        7  7831 1 1  6 THR CA   C  -6.434  11.662   1.370 1.00 . A A .  6 THR CA   1 1 
        7  7832 1 1  6 THR CB   C  -7.681  11.962   0.533 1.00 . A A .  6 THR CB   1 1 
        7  7833 1 1  6 THR CG2  C  -8.890  12.139   1.454 1.00 . A A .  6 THR CG2  1 1 
        7  7834 1 1  6 THR H    H  -5.424  11.150  -0.411 1.00 . A A .  6 THR H    1 1 
        7  7835 1 1  6 THR HA   H  -6.262  12.484   2.039 1.00 . A A .  6 THR HA   1 1 
        7  7836 1 1  6 THR HB   H  -7.866  11.143  -0.144 1.00 . A A .  6 THR HB   1 1 
        7  7837 1 1  6 THR HG1  H  -7.939  13.867   0.236 1.00 . A A .  6 THR HG1  1 1 
        7  7838 1 1  6 THR HG21 H  -9.129  11.197   1.924 1.00 . A A .  6 THR HG21 1 1 
        7  7839 1 1  6 THR HG22 H  -9.737  12.478   0.876 1.00 . A A .  6 THR HG22 1 1 
        7  7840 1 1  6 THR HG23 H  -8.659  12.872   2.214 1.00 . A A .  6 THR HG23 1 1 
        7  7841 1 1  6 THR N    N  -5.271  11.512   0.486 1.00 . A A .  6 THR N    1 1 
        7  7842 1 1  6 THR O    O  -7.154  10.435   3.338 1.00 . A A .  6 THR O    1 1 
        7  7843 1 1  6 THR OG1  O  -7.474  13.156  -0.210 1.00 . A A .  6 THR OG1  1 1 
        7  7844 1 1  7 LEU C    C  -5.534   7.916   3.504 1.00 . A A .  7 LEU C    1 1 
        7  7845 1 1  7 LEU CA   C  -6.416   7.972   2.241 1.00 . A A .  7 LEU CA   1 1 
        7  7846 1 1  7 LEU CB   C  -6.010   6.861   1.254 1.00 . A A .  7 LEU CB   1 1 
        7  7847 1 1  7 LEU CD1  C  -6.427   5.123   3.037 1.00 . A A .  7 LEU CD1  1 1 
        7  7848 1 1  7 LEU CD2  C  -8.240   5.648   1.364 1.00 . A A .  7 LEU CD2  1 1 
        7  7849 1 1  7 LEU CG   C  -6.714   5.528   1.586 1.00 . A A .  7 LEU CG   1 1 
        7  7850 1 1  7 LEU H    H  -5.811   9.444   0.759 1.00 . A A .  7 LEU H    1 1 
        7  7851 1 1  7 LEU HA   H  -7.443   7.830   2.538 1.00 . A A .  7 LEU HA   1 1 
        7  7852 1 1  7 LEU HB2  H  -6.279   7.162   0.253 1.00 . A A .  7 LEU HB2  1 1 
        7  7853 1 1  7 LEU HB3  H  -4.941   6.715   1.301 1.00 . A A .  7 LEU HB3  1 1 
        7  7854 1 1  7 LEU HD11 H  -6.613   4.066   3.157 1.00 . A A .  7 LEU HD11 1 1 
        7  7855 1 1  7 LEU HD12 H  -7.076   5.676   3.700 1.00 . A A .  7 LEU HD12 1 1 
        7  7856 1 1  7 LEU HD13 H  -5.396   5.336   3.278 1.00 . A A .  7 LEU HD13 1 1 
        7  7857 1 1  7 LEU HD21 H  -8.626   4.695   1.033 1.00 . A A .  7 LEU HD21 1 1 
        7  7858 1 1  7 LEU HD22 H  -8.448   6.395   0.612 1.00 . A A .  7 LEU HD22 1 1 
        7  7859 1 1  7 LEU HD23 H  -8.729   5.927   2.288 1.00 . A A .  7 LEU HD23 1 1 
        7  7860 1 1  7 LEU HG   H  -6.324   4.761   0.931 1.00 . A A .  7 LEU HG   1 1 
        7  7861 1 1  7 LEU N    N  -6.291   9.287   1.599 1.00 . A A .  7 LEU N    1 1 
        7  7862 1 1  7 LEU O    O  -5.988   7.535   4.583 1.00 . A A .  7 LEU O    1 1 
        7  7863 1 1  8 LEU C    C  -3.534   9.618   5.364 1.00 . A A .  8 LEU C    1 1 
        7  7864 1 1  8 LEU CA   C  -3.293   8.421   4.431 1.00 . A A .  8 LEU CA   1 1 
        7  7865 1 1  8 LEU CB   C  -1.890   8.536   3.825 1.00 . A A .  8 LEU CB   1 1 
        7  7866 1 1  8 LEU CD1  C  -0.213   7.483   2.292 1.00 . A A .  8 LEU CD1  1 1 
        7  7867 1 1  8 LEU CD2  C  -1.473   6.039   3.917 1.00 . A A .  8 LEU CD2  1 1 
        7  7868 1 1  8 LEU CG   C  -1.558   7.278   3.001 1.00 . A A .  8 LEU CG   1 1 
        7  7869 1 1  8 LEU H    H  -3.999   8.702   2.489 1.00 . A A .  8 LEU H    1 1 
        7  7870 1 1  8 LEU HA   H  -3.343   7.497   4.982 1.00 . A A .  8 LEU HA   1 1 
        7  7871 1 1  8 LEU HB2  H  -1.851   9.406   3.184 1.00 . A A .  8 LEU HB2  1 1 
        7  7872 1 1  8 LEU HB3  H  -1.166   8.644   4.617 1.00 . A A .  8 LEU HB3  1 1 
        7  7873 1 1  8 LEU HD11 H  -0.183   8.465   1.848 1.00 . A A .  8 LEU HD11 1 1 
        7  7874 1 1  8 LEU HD12 H  -0.096   6.735   1.522 1.00 . A A .  8 LEU HD12 1 1 
        7  7875 1 1  8 LEU HD13 H   0.589   7.388   3.009 1.00 . A A .  8 LEU HD13 1 1 
        7  7876 1 1  8 LEU HD21 H  -2.456   5.605   4.026 1.00 . A A .  8 LEU HD21 1 1 
        7  7877 1 1  8 LEU HD22 H  -1.097   6.323   4.889 1.00 . A A .  8 LEU HD22 1 1 
        7  7878 1 1  8 LEU HD23 H  -0.810   5.304   3.480 1.00 . A A .  8 LEU HD23 1 1 
        7  7879 1 1  8 LEU HG   H  -2.332   7.125   2.262 1.00 . A A .  8 LEU HG   1 1 
        7  7880 1 1  8 LEU N    N  -4.289   8.346   3.354 1.00 . A A .  8 LEU N    1 1 
        7  7881 1 1  8 LEU O    O  -3.090   9.649   6.511 1.00 . A A .  8 LEU O    1 1 
        7  7882 1 1  9 ARG C    C  -5.568  11.516   6.716 1.00 . A A .  9 ARG C    1 1 
        7  7883 1 1  9 ARG CA   C  -4.629  11.805   5.548 1.00 . A A .  9 ARG CA   1 1 
        7  7884 1 1  9 ARG CB   C  -5.315  12.807   4.626 1.00 . A A .  9 ARG CB   1 1 
        7  7885 1 1  9 ARG CD   C  -6.046  15.184   4.420 1.00 . A A .  9 ARG CD   1 1 
        7  7886 1 1  9 ARG CG   C  -5.627  14.089   5.402 1.00 . A A .  9 ARG CG   1 1 
        7  7887 1 1  9 ARG CZ   C  -7.658  16.639   5.526 1.00 . A A .  9 ARG CZ   1 1 
        7  7888 1 1  9 ARG H    H  -4.715  10.333   3.986 1.00 . A A .  9 ARG H    1 1 
        7  7889 1 1  9 ARG HA   H  -3.725  12.258   5.925 1.00 . A A .  9 ARG HA   1 1 
        7  7890 1 1  9 ARG HB2  H  -4.673  13.037   3.794 1.00 . A A .  9 ARG HB2  1 1 
        7  7891 1 1  9 ARG HB3  H  -6.238  12.380   4.273 1.00 . A A .  9 ARG HB3  1 1 
        7  7892 1 1  9 ARG HD2  H  -5.222  15.398   3.757 1.00 . A A .  9 ARG HD2  1 1 
        7  7893 1 1  9 ARG HD3  H  -6.889  14.839   3.836 1.00 . A A .  9 ARG HD3  1 1 
        7  7894 1 1  9 ARG HE   H  -5.714  17.067   5.338 1.00 . A A .  9 ARG HE   1 1 
        7  7895 1 1  9 ARG HG2  H  -6.429  13.901   6.100 1.00 . A A .  9 ARG HG2  1 1 
        7  7896 1 1  9 ARG HG3  H  -4.746  14.408   5.940 1.00 . A A .  9 ARG HG3  1 1 
        7  7897 1 1  9 ARG HH11 H  -8.372  14.919   4.792 1.00 . A A .  9 ARG HH11 1 1 
        7  7898 1 1  9 ARG HH12 H  -9.534  15.943   5.564 1.00 . A A .  9 ARG HH12 1 1 
        7  7899 1 1  9 ARG HH21 H  -7.233  18.413   6.350 1.00 . A A .  9 ARG HH21 1 1 
        7  7900 1 1  9 ARG HH22 H  -8.891  17.919   6.449 1.00 . A A .  9 ARG HH22 1 1 
        7  7901 1 1  9 ARG N    N  -4.267  10.582   4.822 1.00 . A A .  9 ARG N    1 1 
        7  7902 1 1  9 ARG NE   N  -6.408  16.405   5.140 1.00 . A A .  9 ARG NE   1 1 
        7  7903 1 1  9 ARG NH1  N  -8.594  15.765   5.273 1.00 . A A .  9 ARG NH1  1 1 
        7  7904 1 1  9 ARG NH2  N  -7.950  17.743   6.157 1.00 . A A .  9 ARG NH2  1 1 
        7  7905 1 1  9 ARG O    O  -5.516  12.188   7.744 1.00 . A A .  9 ARG O    1 1 
        7  7906 1 1 10 VAL C    C  -6.723   9.529   8.812 1.00 . A A . 10 VAL C    1 1 
        7  7907 1 1 10 VAL CA   C  -7.388  10.137   7.577 1.00 . A A . 10 VAL CA   1 1 
        7  7908 1 1 10 VAL CB   C  -8.410   9.154   6.992 1.00 . A A . 10 VAL CB   1 1 
        7  7909 1 1 10 VAL CG1  C  -9.322   8.618   8.102 1.00 . A A . 10 VAL CG1  1 1 
        7  7910 1 1 10 VAL CG2  C  -9.257   9.875   5.940 1.00 . A A . 10 VAL CG2  1 1 
        7  7911 1 1 10 VAL H    H  -6.404   9.976   5.732 1.00 . A A . 10 VAL H    1 1 
        7  7912 1 1 10 VAL HA   H  -7.918  11.002   7.941 1.00 . A A . 10 VAL HA   1 1 
        7  7913 1 1 10 VAL HB   H  -7.887   8.328   6.530 1.00 . A A . 10 VAL HB   1 1 
        7  7914 1 1 10 VAL HG11 H  -8.785   7.886   8.687 1.00 . A A . 10 VAL HG11 1 1 
        7  7915 1 1 10 VAL HG12 H -10.194   8.158   7.662 1.00 . A A . 10 VAL HG12 1 1 
        7  7916 1 1 10 VAL HG13 H  -9.628   9.434   8.741 1.00 . A A . 10 VAL HG13 1 1 
        7  7917 1 1 10 VAL HG21 H  -9.833   9.150   5.383 1.00 . A A . 10 VAL HG21 1 1 
        7  7918 1 1 10 VAL HG22 H  -8.609  10.414   5.265 1.00 . A A . 10 VAL HG22 1 1 
        7  7919 1 1 10 VAL HG23 H  -9.925  10.567   6.429 1.00 . A A . 10 VAL HG23 1 1 
        7  7920 1 1 10 VAL N    N  -6.427  10.518   6.548 1.00 . A A . 10 VAL N    1 1 
        7  7921 1 1 10 VAL O    O  -7.176   9.784   9.927 1.00 . A A . 10 VAL O    1 1 
        7  7922 1 1 11 SER C    C  -4.297   9.166  10.670 1.00 . A A . 11 SER C    1 1 
        7  7923 1 1 11 SER CA   C  -5.071   8.133   9.844 1.00 . A A . 11 SER CA   1 1 
        7  7924 1 1 11 SER CB   C  -4.128   7.003   9.429 1.00 . A A . 11 SER CB   1 1 
        7  7925 1 1 11 SER H    H  -5.316   8.507   7.778 1.00 . A A . 11 SER H    1 1 
        7  7926 1 1 11 SER HA   H  -5.829   7.722  10.493 1.00 . A A . 11 SER HA   1 1 
        7  7927 1 1 11 SER HB2  H  -3.395   7.378   8.736 1.00 . A A . 11 SER HB2  1 1 
        7  7928 1 1 11 SER HB3  H  -3.627   6.614  10.305 1.00 . A A . 11 SER HB3  1 1 
        7  7929 1 1 11 SER HG   H  -4.925   6.167   7.864 1.00 . A A . 11 SER HG   1 1 
        7  7930 1 1 11 SER N    N  -5.685   8.719   8.661 1.00 . A A . 11 SER N    1 1 
        7  7931 1 1 11 SER O    O  -4.491   9.246  11.851 1.00 . A A . 11 SER O    1 1 
        7  7932 1 1 11 SER OG   O  -4.880   5.972   8.803 1.00 . A A . 11 SER OG   1 1 
        7  7933 1 1 12 ILE C    C  -3.422  11.898  11.606 1.00 . A A . 12 ILE C    1 1 
        7  7934 1 1 12 ILE CA   C  -2.572  10.863  10.834 1.00 . A A . 12 ILE CA   1 1 
        7  7935 1 1 12 ILE CB   C  -1.655  11.608   9.854 1.00 . A A . 12 ILE CB   1 1 
        7  7936 1 1 12 ILE CD1  C   0.096  11.272   8.097 1.00 . A A . 12 ILE CD1  1 1 
        7  7937 1 1 12 ILE CG1  C  -0.639  10.620   9.270 1.00 . A A . 12 ILE CG1  1 1 
        7  7938 1 1 12 ILE CG2  C  -0.903  12.726  10.588 1.00 . A A . 12 ILE CG2  1 1 
        7  7939 1 1 12 ILE H    H  -3.225   9.729   9.113 1.00 . A A . 12 ILE H    1 1 
        7  7940 1 1 12 ILE HA   H  -1.941  10.312  11.511 1.00 . A A . 12 ILE HA   1 1 
        7  7941 1 1 12 ILE HB   H  -2.246  12.034   9.057 1.00 . A A . 12 ILE HB   1 1 
        7  7942 1 1 12 ILE HD11 H   0.939  10.657   7.817 1.00 . A A . 12 ILE HD11 1 1 
        7  7943 1 1 12 ILE HD12 H   0.446  12.250   8.390 1.00 . A A . 12 ILE HD12 1 1 
        7  7944 1 1 12 ILE HD13 H  -0.575  11.365   7.257 1.00 . A A . 12 ILE HD13 1 1 
        7  7945 1 1 12 ILE HG12 H   0.074  10.345  10.034 1.00 . A A . 12 ILE HG12 1 1 
        7  7946 1 1 12 ILE HG13 H  -1.155   9.738   8.924 1.00 . A A . 12 ILE HG13 1 1 
        7  7947 1 1 12 ILE HG21 H  -1.574  13.552  10.770 1.00 . A A . 12 ILE HG21 1 1 
        7  7948 1 1 12 ILE HG22 H  -0.075  13.064   9.982 1.00 . A A . 12 ILE HG22 1 1 
        7  7949 1 1 12 ILE HG23 H  -0.530  12.351  11.529 1.00 . A A . 12 ILE HG23 1 1 
        7  7950 1 1 12 ILE N    N  -3.395   9.909  10.062 1.00 . A A . 12 ILE N    1 1 
        7  7951 1 1 12 ILE O    O  -3.262  12.119  12.804 1.00 . A A . 12 ILE O    1 1 
        7  7952 1 1 13 ILE C    C  -6.050  12.866  12.616 1.00 . A A . 13 ILE C    1 1 
        7  7953 1 1 13 ILE CA   C  -5.239  13.482  11.442 1.00 . A A . 13 ILE CA   1 1 
        7  7954 1 1 13 ILE CB   C  -6.170  14.084  10.372 1.00 . A A . 13 ILE CB   1 1 
        7  7955 1 1 13 ILE CD1  C  -8.502  13.082  10.608 1.00 . A A . 13 ILE CD1  1 1 
        7  7956 1 1 13 ILE CG1  C  -7.166  13.017   9.846 1.00 . A A . 13 ILE CG1  1 1 
        7  7957 1 1 13 ILE CG2  C  -5.319  14.627   9.213 1.00 . A A . 13 ILE CG2  1 1 
        7  7958 1 1 13 ILE H    H  -4.334  12.111   9.960 1.00 . A A . 13 ILE H    1 1 
        7  7959 1 1 13 ILE HA   H  -4.640  14.276  11.865 1.00 . A A . 13 ILE HA   1 1 
        7  7960 1 1 13 ILE HB   H  -6.716  14.908  10.810 1.00 . A A . 13 ILE HB   1 1 
        7  7961 1 1 13 ILE HD11 H  -8.346  13.454  11.609 1.00 . A A . 13 ILE HD11 1 1 
        7  7962 1 1 13 ILE HD12 H  -8.933  12.093  10.661 1.00 . A A . 13 ILE HD12 1 1 
        7  7963 1 1 13 ILE HD13 H  -9.181  13.738  10.084 1.00 . A A . 13 ILE HD13 1 1 
        7  7964 1 1 13 ILE HG12 H  -7.362  13.188   8.796 1.00 . A A . 13 ILE HG12 1 1 
        7  7965 1 1 13 ILE HG13 H  -6.737  12.036   9.965 1.00 . A A . 13 ILE HG13 1 1 
        7  7966 1 1 13 ILE HG21 H  -4.535  13.924   8.974 1.00 . A A . 13 ILE HG21 1 1 
        7  7967 1 1 13 ILE HG22 H  -4.880  15.570   9.500 1.00 . A A . 13 ILE HG22 1 1 
        7  7968 1 1 13 ILE HG23 H  -5.946  14.772   8.345 1.00 . A A . 13 ILE HG23 1 1 
        7  7969 1 1 13 ILE N    N  -4.325  12.482  10.867 1.00 . A A . 13 ILE N    1 1 
        7  7970 1 1 13 ILE O    O  -6.252  13.511  13.644 1.00 . A A . 13 ILE O    1 1 
        7  7971 1 1 14 GLY C    C  -6.110  10.263  14.573 1.00 . A A . 14 GLY C    1 1 
        7  7972 1 1 14 GLY CA   C  -7.125  10.860  13.559 1.00 . A A . 14 GLY CA   1 1 
        7  7973 1 1 14 GLY H    H  -6.090  11.152  11.665 1.00 . A A . 14 GLY H    1 1 
        7  7974 1 1 14 GLY HA2  H  -7.788  11.539  14.076 1.00 . A A . 14 GLY HA2  1 1 
        7  7975 1 1 14 GLY HA3  H  -7.705  10.058  13.128 1.00 . A A . 14 GLY HA3  1 1 
        7  7976 1 1 14 GLY N    N  -6.425  11.598  12.471 1.00 . A A . 14 GLY N    1 1 
        7  7977 1 1 14 GLY O    O  -6.228  10.388  15.792 1.00 . A A . 14 GLY O    1 1 
        7  7978 1 1 15 THR C    C  -3.259   9.736  15.585 1.00 . A A . 15 THR C    1 1 
        7  7979 1 1 15 THR CA   C  -4.089   8.835  14.669 1.00 . A A . 15 THR CA   1 1 
        7  7980 1 1 15 THR CB   C  -3.148   8.107  13.700 1.00 . A A . 15 THR CB   1 1 
        7  7981 1 1 15 THR CG2  C  -2.127   7.291  14.496 1.00 . A A . 15 THR CG2  1 1 
        7  7982 1 1 15 THR H    H  -5.312   9.543  13.009 1.00 . A A . 15 THR H    1 1 
        7  7983 1 1 15 THR HA   H  -4.560   8.090  15.293 1.00 . A A . 15 THR HA   1 1 
        7  7984 1 1 15 THR HB   H  -2.625   8.823  13.095 1.00 . A A . 15 THR HB   1 1 
        7  7985 1 1 15 THR HG1  H  -3.726   7.454  11.961 1.00 . A A . 15 THR HG1  1 1 
        7  7986 1 1 15 THR HG21 H  -1.374   7.952  14.900 1.00 . A A . 15 THR HG21 1 1 
        7  7987 1 1 15 THR HG22 H  -1.659   6.569  13.843 1.00 . A A . 15 THR HG22 1 1 
        7  7988 1 1 15 THR HG23 H  -2.624   6.774  15.303 1.00 . A A . 15 THR HG23 1 1 
        7  7989 1 1 15 THR N    N  -5.165   9.573  13.971 1.00 . A A . 15 THR N    1 1 
        7  7990 1 1 15 THR O    O  -2.723   9.266  16.588 1.00 . A A . 15 THR O    1 1 
        7  7991 1 1 15 THR OG1  O  -3.903   7.229  12.878 1.00 . A A . 15 THR OG1  1 1 
        7  7992 1 1 16 THR C    C  -3.215  12.325  17.368 1.00 . A A . 16 THR C    1 1 
        7  7993 1 1 16 THR CA   C  -2.431  11.965  16.108 1.00 . A A . 16 THR CA   1 1 
        7  7994 1 1 16 THR CB   C  -2.088  13.234  15.319 1.00 . A A . 16 THR CB   1 1 
        7  7995 1 1 16 THR CG2  C  -1.065  12.914  14.217 1.00 . A A . 16 THR CG2  1 1 
        7  7996 1 1 16 THR H    H  -3.671  11.388  14.511 1.00 . A A . 16 THR H    1 1 
        7  7997 1 1 16 THR HA   H  -1.510  11.494  16.416 1.00 . A A . 16 THR HA   1 1 
        7  7998 1 1 16 THR HB   H  -1.665  13.964  15.993 1.00 . A A . 16 THR HB   1 1 
        7  7999 1 1 16 THR HG1  H  -3.183  13.725  13.789 1.00 . A A . 16 THR HG1  1 1 
        7  8000 1 1 16 THR HG21 H  -1.193  13.607  13.398 1.00 . A A . 16 THR HG21 1 1 
        7  8001 1 1 16 THR HG22 H  -1.208  11.904  13.859 1.00 . A A . 16 THR HG22 1 1 
        7  8002 1 1 16 THR HG23 H  -0.064  13.011  14.613 1.00 . A A . 16 THR HG23 1 1 
        7  8003 1 1 16 THR N    N  -3.173  11.023  15.272 1.00 . A A . 16 THR N    1 1 
        7  8004 1 1 16 THR O    O  -2.633  12.669  18.397 1.00 . A A . 16 THR O    1 1 
        7  8005 1 1 16 THR OG1  O  -3.272  13.767  14.743 1.00 . A A . 16 THR OG1  1 1 
        7  8006 1 1 17 LEU C    C  -5.487  11.632  19.500 1.00 . A A . 17 LEU C    1 1 
        7  8007 1 1 17 LEU CA   C  -5.451  12.632  18.346 1.00 . A A . 17 LEU CA   1 1 
        7  8008 1 1 17 LEU CB   C  -6.868  12.813  17.795 1.00 . A A . 17 LEU CB   1 1 
        7  8009 1 1 17 LEU CD1  C  -8.304  14.053  16.159 1.00 . A A . 17 LEU CD1  1 1 
        7  8010 1 1 17 LEU CD2  C  -6.524  15.291  17.432 1.00 . A A . 17 LEU CD2  1 1 
        7  8011 1 1 17 LEU CG   C  -6.897  13.952  16.764 1.00 . A A . 17 LEU CG   1 1 
        7  8012 1 1 17 LEU H    H  -4.970  12.011  16.425 1.00 . A A . 17 LEU H    1 1 
        7  8013 1 1 17 LEU HA   H  -5.141  13.563  18.786 1.00 . A A . 17 LEU HA   1 1 
        7  8014 1 1 17 LEU HB2  H  -7.190  11.895  17.327 1.00 . A A . 17 LEU HB2  1 1 
        7  8015 1 1 17 LEU HB3  H  -7.539  13.052  18.609 1.00 . A A . 17 LEU HB3  1 1 
        7  8016 1 1 17 LEU HD11 H  -8.259  14.624  15.244 1.00 . A A . 17 LEU HD11 1 1 
        7  8017 1 1 17 LEU HD12 H  -8.962  14.546  16.859 1.00 . A A . 17 LEU HD12 1 1 
        7  8018 1 1 17 LEU HD13 H  -8.680  13.064  15.947 1.00 . A A . 17 LEU HD13 1 1 
        7  8019 1 1 17 LEU HD21 H  -5.450  15.403  17.434 1.00 . A A . 17 LEU HD21 1 1 
        7  8020 1 1 17 LEU HD22 H  -6.890  15.309  18.448 1.00 . A A . 17 LEU HD22 1 1 
        7  8021 1 1 17 LEU HD23 H  -6.964  16.111  16.880 1.00 . A A . 17 LEU HD23 1 1 
        7  8022 1 1 17 LEU HG   H  -6.189  13.734  15.978 1.00 . A A . 17 LEU HG   1 1 
        7  8023 1 1 17 LEU N    N  -4.537  12.281  17.261 1.00 . A A . 17 LEU N    1 1 
        7  8024 1 1 17 LEU O    O  -5.857  12.018  20.609 1.00 . A A . 17 LEU O    1 1 
        7  8025 1 1 18 VAL C    C  -4.414  10.003  21.590 1.00 . A A . 18 VAL C    1 1 
        7  8026 1 1 18 VAL CA   C  -5.222   9.436  20.422 1.00 . A A . 18 VAL CA   1 1 
        7  8027 1 1 18 VAL CB   C  -4.692   8.054  20.018 1.00 . A A . 18 VAL CB   1 1 
        7  8028 1 1 18 VAL CG1  C  -3.218   8.146  19.607 1.00 . A A . 18 VAL CG1  1 1 
        7  8029 1 1 18 VAL CG2  C  -4.836   7.093  21.201 1.00 . A A . 18 VAL CG2  1 1 
        7  8030 1 1 18 VAL H    H  -4.815  10.047  18.427 1.00 . A A . 18 VAL H    1 1 
        7  8031 1 1 18 VAL HA   H  -6.270   9.348  20.672 1.00 . A A . 18 VAL HA   1 1 
        7  8032 1 1 18 VAL HB   H  -5.270   7.683  19.184 1.00 . A A . 18 VAL HB   1 1 
        7  8033 1 1 18 VAL HG11 H  -2.594   8.182  20.488 1.00 . A A . 18 VAL HG11 1 1 
        7  8034 1 1 18 VAL HG12 H  -3.061   9.036  19.017 1.00 . A A . 18 VAL HG12 1 1 
        7  8035 1 1 18 VAL HG13 H  -2.958   7.278  19.020 1.00 . A A . 18 VAL HG13 1 1 
        7  8036 1 1 18 VAL HG21 H  -4.183   7.407  22.002 1.00 . A A . 18 VAL HG21 1 1 
        7  8037 1 1 18 VAL HG22 H  -4.567   6.094  20.888 1.00 . A A . 18 VAL HG22 1 1 
        7  8038 1 1 18 VAL HG23 H  -5.859   7.098  21.547 1.00 . A A . 18 VAL HG23 1 1 
        7  8039 1 1 18 VAL N    N  -5.144  10.362  19.295 1.00 . A A . 18 VAL N    1 1 
        7  8040 1 1 18 VAL O    O  -4.891  10.102  22.720 1.00 . A A . 18 VAL O    1 1 
        7  8041 1 1 19 ALA C    C  -2.794  12.153  22.923 1.00 . A A . 19 ALA C    1 1 
        7  8042 1 1 19 ALA CA   C  -2.232  10.905  22.247 1.00 . A A . 19 ALA CA   1 1 
        7  8043 1 1 19 ALA CB   C  -0.917  11.256  21.550 1.00 . A A . 19 ALA CB   1 1 
        7  8044 1 1 19 ALA H    H  -2.863  10.186  20.363 1.00 . A A . 19 ALA H    1 1 
        7  8045 1 1 19 ALA HA   H  -2.032  10.161  22.999 1.00 . A A . 19 ALA HA   1 1 
        7  8046 1 1 19 ALA HB1  H  -0.230  11.680  22.266 1.00 . A A . 19 ALA HB1  1 1 
        7  8047 1 1 19 ALA HB2  H  -1.107  11.974  20.766 1.00 . A A . 19 ALA HB2  1 1 
        7  8048 1 1 19 ALA HB3  H  -0.487  10.362  21.123 1.00 . A A . 19 ALA HB3  1 1 
        7  8049 1 1 19 ALA N    N  -3.172  10.356  21.277 1.00 . A A . 19 ALA N    1 1 
        7  8050 1 1 19 ALA O    O  -2.485  12.432  24.082 1.00 . A A . 19 ALA O    1 1 
        7  8051 1 1 20 LEU C    C  -5.228  13.754  23.854 1.00 . A A . 20 LEU C    1 1 
        7  8052 1 1 20 LEU CA   C  -4.215  14.108  22.757 1.00 . A A . 20 LEU CA   1 1 
        7  8053 1 1 20 LEU CB   C  -4.880  14.937  21.639 1.00 . A A . 20 LEU CB   1 1 
        7  8054 1 1 20 LEU CD1  C  -5.459  16.697  23.349 1.00 . A A . 20 LEU CD1  1 1 
        7  8055 1 1 20 LEU CD2  C  -3.385  16.969  21.941 1.00 . A A . 20 LEU CD2  1 1 
        7  8056 1 1 20 LEU CG   C  -4.840  16.445  21.968 1.00 . A A . 20 LEU CG   1 1 
        7  8057 1 1 20 LEU H    H  -3.852  12.601  21.293 1.00 . A A . 20 LEU H    1 1 
        7  8058 1 1 20 LEU HA   H  -3.438  14.686  23.230 1.00 . A A . 20 LEU HA   1 1 
        7  8059 1 1 20 LEU HB2  H  -4.358  14.761  20.710 1.00 . A A . 20 LEU HB2  1 1 
        7  8060 1 1 20 LEU HB3  H  -5.909  14.627  21.527 1.00 . A A . 20 LEU HB3  1 1 
        7  8061 1 1 20 LEU HD11 H  -4.735  16.465  24.115 1.00 . A A . 20 LEU HD11 1 1 
        7  8062 1 1 20 LEU HD12 H  -6.332  16.074  23.475 1.00 . A A . 20 LEU HD12 1 1 
        7  8063 1 1 20 LEU HD13 H  -5.746  17.735  23.431 1.00 . A A . 20 LEU HD13 1 1 
        7  8064 1 1 20 LEU HD21 H  -2.952  16.917  22.932 1.00 . A A . 20 LEU HD21 1 1 
        7  8065 1 1 20 LEU HD22 H  -3.384  17.996  21.610 1.00 . A A . 20 LEU HD22 1 1 
        7  8066 1 1 20 LEU HD23 H  -2.790  16.377  21.259 1.00 . A A . 20 LEU HD23 1 1 
        7  8067 1 1 20 LEU HG   H  -5.420  16.977  21.226 1.00 . A A . 20 LEU HG   1 1 
        7  8068 1 1 20 LEU N    N  -3.621  12.897  22.199 1.00 . A A . 20 LEU N    1 1 
        7  8069 1 1 20 LEU O    O  -5.185  14.330  24.941 1.00 . A A . 20 LEU O    1 1 
        7  8070 1 1 21 SER C    C  -6.496  11.534  25.676 1.00 . A A . 21 SER C    1 1 
        7  8071 1 1 21 SER CA   C  -7.117  12.421  24.597 1.00 . A A . 21 SER CA   1 1 
        7  8072 1 1 21 SER CB   C  -8.269  11.673  23.927 1.00 . A A . 21 SER CB   1 1 
        7  8073 1 1 21 SER H    H  -6.142  12.362  22.718 1.00 . A A . 21 SER H    1 1 
        7  8074 1 1 21 SER HA   H  -7.509  13.319  25.050 1.00 . A A . 21 SER HA   1 1 
        7  8075 1 1 21 SER HB2  H  -9.058  11.508  24.642 1.00 . A A . 21 SER HB2  1 1 
        7  8076 1 1 21 SER HB3  H  -8.651  12.265  23.105 1.00 . A A . 21 SER HB3  1 1 
        7  8077 1 1 21 SER HG   H  -8.064  10.336  22.527 1.00 . A A . 21 SER HG   1 1 
        7  8078 1 1 21 SER N    N  -6.128  12.808  23.590 1.00 . A A . 21 SER N    1 1 
        7  8079 1 1 21 SER O    O  -7.034  11.400  26.765 1.00 . A A . 21 SER O    1 1 
        7  8080 1 1 21 SER OG   O  -7.801  10.420  23.447 1.00 . A A . 21 SER OG   1 1 
        7  8081 1 1 22 SER C    C  -3.744  10.731  27.203 1.00 . A A . 22 SER C    1 1 
        7  8082 1 1 22 SER CA   C  -4.691   9.993  26.246 1.00 . A A . 22 SER CA   1 1 
        7  8083 1 1 22 SER CB   C  -3.905   8.946  25.462 1.00 . A A . 22 SER CB   1 1 
        7  8084 1 1 22 SER H    H  -5.063  11.074  24.414 1.00 . A A . 22 SER H    1 1 
        7  8085 1 1 22 SER HA   H  -5.424   9.482  26.851 1.00 . A A . 22 SER HA   1 1 
        7  8086 1 1 22 SER HB2  H  -3.195   9.433  24.823 1.00 . A A . 22 SER HB2  1 1 
        7  8087 1 1 22 SER HB3  H  -3.378   8.302  26.154 1.00 . A A . 22 SER HB3  1 1 
        7  8088 1 1 22 SER HG   H  -4.562   7.252  24.763 1.00 . A A . 22 SER HG   1 1 
        7  8089 1 1 22 SER N    N  -5.385  10.904  25.325 1.00 . A A . 22 SER N    1 1 
        7  8090 1 1 22 SER O    O  -3.335  10.173  28.221 1.00 . A A . 22 SER O    1 1 
        7  8091 1 1 22 SER OG   O  -4.803   8.178  24.671 1.00 . A A . 22 SER OG   1 1 
        7  8092 1 1 23 PHE C    C  -3.335  13.354  29.001 1.00 . A A . 23 PHE C    1 1 
        7  8093 1 1 23 PHE CA   C  -2.539  12.741  27.815 1.00 . A A . 23 PHE CA   1 1 
        7  8094 1 1 23 PHE CB   C  -1.773  13.832  27.041 1.00 . A A . 23 PHE CB   1 1 
        7  8095 1 1 23 PHE CD1  C  -0.318  12.012  26.038 1.00 . A A . 23 PHE CD1  1 1 
        7  8096 1 1 23 PHE CD2  C   0.694  14.143  26.601 1.00 . A A . 23 PHE CD2  1 1 
        7  8097 1 1 23 PHE CE1  C   0.920  11.546  25.578 1.00 . A A . 23 PHE CE1  1 1 
        7  8098 1 1 23 PHE CE2  C   1.931  13.676  26.140 1.00 . A A . 23 PHE CE2  1 1 
        7  8099 1 1 23 PHE CG   C  -0.431  13.310  26.550 1.00 . A A . 23 PHE CG   1 1 
        7  8100 1 1 23 PHE CZ   C   2.043  12.378  25.628 1.00 . A A . 23 PHE CZ   1 1 
        7  8101 1 1 23 PHE H    H  -3.842  12.367  26.102 1.00 . A A . 23 PHE H    1 1 
        7  8102 1 1 23 PHE HA   H  -1.841  12.066  28.291 1.00 . A A . 23 PHE HA   1 1 
        7  8103 1 1 23 PHE HB2  H  -2.362  14.142  26.190 1.00 . A A . 23 PHE HB2  1 1 
        7  8104 1 1 23 PHE HB3  H  -1.606  14.687  27.683 1.00 . A A . 23 PHE HB3  1 1 
        7  8105 1 1 23 PHE HD1  H  -1.185  11.369  25.999 1.00 . A A . 23 PHE HD1  1 1 
        7  8106 1 1 23 PHE HD2  H   0.606  15.145  26.995 1.00 . A A . 23 PHE HD2  1 1 
        7  8107 1 1 23 PHE HE1  H   1.006  10.544  25.183 1.00 . A A . 23 PHE HE1  1 1 
        7  8108 1 1 23 PHE HE2  H   2.798  14.319  26.180 1.00 . A A . 23 PHE HE2  1 1 
        7  8109 1 1 23 PHE HZ   H   2.994  12.024  25.266 1.00 . A A . 23 PHE HZ   1 1 
        7  8110 1 1 23 PHE N    N  -3.420  11.986  26.900 1.00 . A A . 23 PHE N    1 1 
        7  8111 1 1 23 PHE O    O  -2.826  13.348  30.122 1.00 . A A . 23 PHE O    1 1 
        7  8112 1 1 24 THR C    C  -5.828  13.639  30.979 1.00 . A A . 24 THR C    1 1 
        7  8113 1 1 24 THR CA   C  -5.259  14.587  29.900 1.00 . A A . 24 THR CA   1 1 
        7  8114 1 1 24 THR CB   C  -6.414  15.439  29.338 1.00 . A A . 24 THR CB   1 1 
        7  8115 1 1 24 THR CG2  C  -6.084  15.886  27.911 1.00 . A A . 24 THR CG2  1 1 
        7  8116 1 1 24 THR H    H  -4.859  14.094  27.882 1.00 . A A . 24 THR H    1 1 
        7  8117 1 1 24 THR HA   H  -4.569  15.258  30.390 1.00 . A A . 24 THR HA   1 1 
        7  8118 1 1 24 THR HB   H  -6.559  16.312  29.957 1.00 . A A . 24 THR HB   1 1 
        7  8119 1 1 24 THR HG1  H  -8.089  14.859  30.133 1.00 . A A . 24 THR HG1  1 1 
        7  8120 1 1 24 THR HG21 H  -6.729  16.708  27.632 1.00 . A A . 24 THR HG21 1 1 
        7  8121 1 1 24 THR HG22 H  -6.239  15.062  27.232 1.00 . A A . 24 THR HG22 1 1 
        7  8122 1 1 24 THR HG23 H  -5.053  16.205  27.862 1.00 . A A . 24 THR HG23 1 1 
        7  8123 1 1 24 THR N    N  -4.523  13.933  28.789 1.00 . A A . 24 THR N    1 1 
        7  8124 1 1 24 THR O    O  -5.884  14.002  32.154 1.00 . A A . 24 THR O    1 1 
        7  8125 1 1 24 THR OG1  O  -7.609  14.672  29.323 1.00 . A A . 24 THR OG1  1 1 
        7  8126 1 1 25 PRO C    C  -6.240  11.223  32.836 1.00 . A A . 25 PRO C    1 1 
        7  8127 1 1 25 PRO CA   C  -6.978  11.511  31.529 1.00 . A A . 25 PRO CA   1 1 
        7  8128 1 1 25 PRO CB   C  -7.090  10.244  30.681 1.00 . A A . 25 PRO CB   1 1 
        7  8129 1 1 25 PRO CD   C  -6.291  11.975  29.230 1.00 . A A . 25 PRO CD   1 1 
        7  8130 1 1 25 PRO CG   C  -7.211  10.754  29.292 1.00 . A A . 25 PRO CG   1 1 
        7  8131 1 1 25 PRO HA   H  -7.973  11.858  31.755 1.00 . A A . 25 PRO HA   1 1 
        7  8132 1 1 25 PRO HB2  H  -6.199   9.637  30.788 1.00 . A A . 25 PRO HB2  1 1 
        7  8133 1 1 25 PRO HB3  H  -7.971   9.678  30.950 1.00 . A A . 25 PRO HB3  1 1 
        7  8134 1 1 25 PRO HD2  H  -5.297  11.676  28.959 1.00 . A A . 25 PRO HD2  1 1 
        7  8135 1 1 25 PRO HD3  H  -6.669  12.717  28.550 1.00 . A A . 25 PRO HD3  1 1 
        7  8136 1 1 25 PRO HG2  H  -6.889   9.995  28.592 1.00 . A A . 25 PRO HG2  1 1 
        7  8137 1 1 25 PRO HG3  H  -8.227  11.052  29.085 1.00 . A A . 25 PRO HG3  1 1 
        7  8138 1 1 25 PRO N    N  -6.314  12.490  30.601 1.00 . A A . 25 PRO N    1 1 
        7  8139 1 1 25 PRO O    O  -6.870  10.812  33.803 1.00 . A A . 25 PRO O    1 1 
        7  8140 1 1 26 VAL C    C  -4.796  12.022  35.285 1.00 . A A . 26 VAL C    1 1 
        7  8141 1 1 26 VAL CA   C  -4.218  11.175  34.142 1.00 . A A . 26 VAL CA   1 1 
        7  8142 1 1 26 VAL CB   C  -2.731  11.492  33.962 1.00 . A A . 26 VAL CB   1 1 
        7  8143 1 1 26 VAL CG1  C  -2.540  13.004  33.804 1.00 . A A . 26 VAL CG1  1 1 
        7  8144 1 1 26 VAL CG2  C  -1.951  11.002  35.185 1.00 . A A . 26 VAL CG2  1 1 
        7  8145 1 1 26 VAL H    H  -4.450  11.807  32.131 1.00 . A A . 26 VAL H    1 1 
        7  8146 1 1 26 VAL HA   H  -4.325  10.137  34.421 1.00 . A A . 26 VAL HA   1 1 
        7  8147 1 1 26 VAL HB   H  -2.364  10.992  33.076 1.00 . A A . 26 VAL HB   1 1 
        7  8148 1 1 26 VAL HG11 H  -2.633  13.481  34.769 1.00 . A A . 26 VAL HG11 1 1 
        7  8149 1 1 26 VAL HG12 H  -3.294  13.394  33.136 1.00 . A A . 26 VAL HG12 1 1 
        7  8150 1 1 26 VAL HG13 H  -1.560  13.203  33.397 1.00 . A A . 26 VAL HG13 1 1 
        7  8151 1 1 26 VAL HG21 H  -0.921  11.316  35.103 1.00 . A A . 26 VAL HG21 1 1 
        7  8152 1 1 26 VAL HG22 H  -1.996   9.924  35.232 1.00 . A A . 26 VAL HG22 1 1 
        7  8153 1 1 26 VAL HG23 H  -2.384  11.420  36.081 1.00 . A A . 26 VAL HG23 1 1 
        7  8154 1 1 26 VAL N    N  -4.936  11.434  32.895 1.00 . A A . 26 VAL N    1 1 
        7  8155 1 1 26 VAL O    O  -4.912  11.547  36.414 1.00 . A A . 26 VAL O    1 1 
        7  8156 1 1 27 LEU C    C  -6.784  13.656  36.834 1.00 . A A . 27 LEU C    1 1 
        7  8157 1 1 27 LEU CA   C  -5.612  14.216  36.014 1.00 . A A . 27 LEU CA   1 1 
        7  8158 1 1 27 LEU CB   C  -6.071  15.498  35.304 1.00 . A A . 27 LEU CB   1 1 
        7  8159 1 1 27 LEU CD1  C  -5.431  16.918  37.291 1.00 . A A . 27 LEU CD1  1 1 
        7  8160 1 1 27 LEU CD2  C  -7.021  17.793  35.559 1.00 . A A . 27 LEU CD2  1 1 
        7  8161 1 1 27 LEU CG   C  -6.563  16.543  36.321 1.00 . A A . 27 LEU CG   1 1 
        7  8162 1 1 27 LEU H    H  -4.923  13.649  34.111 1.00 . A A . 27 LEU H    1 1 
        7  8163 1 1 27 LEU HA   H  -4.784  14.473  36.652 1.00 . A A . 27 LEU HA   1 1 
        7  8164 1 1 27 LEU HB2  H  -5.242  15.910  34.745 1.00 . A A . 27 LEU HB2  1 1 
        7  8165 1 1 27 LEU HB3  H  -6.874  15.259  34.624 1.00 . A A . 27 LEU HB3  1 1 
        7  8166 1 1 27 LEU HD11 H  -5.620  17.896  37.712 1.00 . A A . 27 LEU HD11 1 1 
        7  8167 1 1 27 LEU HD12 H  -4.488  16.932  36.763 1.00 . A A . 27 LEU HD12 1 1 
        7  8168 1 1 27 LEU HD13 H  -5.386  16.191  38.088 1.00 . A A . 27 LEU HD13 1 1 
        7  8169 1 1 27 LEU HD21 H  -6.278  18.057  34.821 1.00 . A A . 27 LEU HD21 1 1 
        7  8170 1 1 27 LEU HD22 H  -7.146  18.611  36.252 1.00 . A A . 27 LEU HD22 1 1 
        7  8171 1 1 27 LEU HD23 H  -7.962  17.590  35.068 1.00 . A A . 27 LEU HD23 1 1 
        7  8172 1 1 27 LEU HG   H  -7.397  16.143  36.880 1.00 . A A . 27 LEU HG   1 1 
        7  8173 1 1 27 LEU N    N  -5.106  13.282  35.002 1.00 . A A . 27 LEU N    1 1 
        7  8174 1 1 27 LEU O    O  -6.992  14.063  37.977 1.00 . A A . 27 LEU O    1 1 
        7  8175 1 1 28 VAL C    C  -8.306  11.235  38.062 1.00 . A A . 28 VAL C    1 1 
        7  8176 1 1 28 VAL CA   C  -8.723  12.169  36.925 1.00 . A A . 28 VAL CA   1 1 
        7  8177 1 1 28 VAL CB   C  -9.593  11.397  35.918 1.00 . A A . 28 VAL CB   1 1 
        7  8178 1 1 28 VAL CG1  C  -9.727  12.224  34.635 1.00 . A A . 28 VAL CG1  1 1 
        7  8179 1 1 28 VAL CG2  C  -8.975  10.015  35.602 1.00 . A A . 28 VAL CG2  1 1 
        7  8180 1 1 28 VAL H    H  -7.349  12.442  35.339 1.00 . A A . 28 VAL H    1 1 
        7  8181 1 1 28 VAL HA   H  -9.313  12.974  37.333 1.00 . A A . 28 VAL HA   1 1 
        7  8182 1 1 28 VAL HB   H -10.578  11.260  36.344 1.00 . A A . 28 VAL HB   1 1 
        7  8183 1 1 28 VAL HG11 H -10.136  13.195  34.873 1.00 . A A . 28 VAL HG11 1 1 
        7  8184 1 1 28 VAL HG12 H -10.386  11.716  33.946 1.00 . A A . 28 VAL HG12 1 1 
        7  8185 1 1 28 VAL HG13 H  -8.755  12.344  34.180 1.00 . A A . 28 VAL HG13 1 1 
        7  8186 1 1 28 VAL HG21 H  -9.367   9.281  36.292 1.00 . A A . 28 VAL HG21 1 1 
        7  8187 1 1 28 VAL HG22 H  -7.902  10.059  35.706 1.00 . A A . 28 VAL HG22 1 1 
        7  8188 1 1 28 VAL HG23 H  -9.225   9.720  34.591 1.00 . A A . 28 VAL HG23 1 1 
        7  8189 1 1 28 VAL N    N  -7.559  12.750  36.245 1.00 . A A . 28 VAL N    1 1 
        7  8190 1 1 28 VAL O    O  -9.021  11.081  39.053 1.00 . A A . 28 VAL O    1 1 
        7  8191 1 1 29 ILE C    C  -6.452  10.423  40.253 1.00 . A A . 29 ILE C    1 1 
        7  8192 1 1 29 ILE CA   C  -6.620   9.709  38.910 1.00 . A A . 29 ILE CA   1 1 
        7  8193 1 1 29 ILE CB   C  -5.281   9.123  38.447 1.00 . A A . 29 ILE CB   1 1 
        7  8194 1 1 29 ILE CD1  C  -4.185   7.822  36.612 1.00 . A A . 29 ILE CD1  1 1 
        7  8195 1 1 29 ILE CG1  C  -5.523   8.195  37.253 1.00 . A A . 29 ILE CG1  1 1 
        7  8196 1 1 29 ILE CG2  C  -4.640   8.323  39.585 1.00 . A A . 29 ILE CG2  1 1 
        7  8197 1 1 29 ILE H    H  -6.604  10.847  37.116 1.00 . A A . 29 ILE H    1 1 
        7  8198 1 1 29 ILE HA   H  -7.319   8.903  39.078 1.00 . A A . 29 ILE HA   1 1 
        7  8199 1 1 29 ILE HB   H  -4.621   9.926  38.154 1.00 . A A . 29 ILE HB   1 1 
        7  8200 1 1 29 ILE HD11 H  -3.635   7.174  37.278 1.00 . A A . 29 ILE HD11 1 1 
        7  8201 1 1 29 ILE HD12 H  -3.612   8.717  36.426 1.00 . A A . 29 ILE HD12 1 1 
        7  8202 1 1 29 ILE HD13 H  -4.364   7.309  35.679 1.00 . A A . 29 ILE HD13 1 1 
        7  8203 1 1 29 ILE HG12 H  -6.024   7.299  37.591 1.00 . A A . 29 ILE HG12 1 1 
        7  8204 1 1 29 ILE HG13 H  -6.141   8.700  36.524 1.00 . A A . 29 ILE HG13 1 1 
        7  8205 1 1 29 ILE HG21 H  -5.379   7.672  40.029 1.00 . A A . 29 ILE HG21 1 1 
        7  8206 1 1 29 ILE HG22 H  -4.263   9.003  40.335 1.00 . A A . 29 ILE HG22 1 1 
        7  8207 1 1 29 ILE HG23 H  -3.826   7.730  39.196 1.00 . A A . 29 ILE HG23 1 1 
        7  8208 1 1 29 ILE N    N  -7.142  10.624  37.903 1.00 . A A . 29 ILE N    1 1 
        7  8209 1 1 29 ILE O    O  -6.792   9.857  41.292 1.00 . A A . 29 ILE O    1 1 
        7  8210 1 1 30 LEU C    C  -7.067  12.365  42.325 1.00 . A A . 30 LEU C    1 1 
        7  8211 1 1 30 LEU CA   C  -5.763  12.368  41.516 1.00 . A A . 30 LEU CA   1 1 
        7  8212 1 1 30 LEU CB   C  -5.320  13.814  41.228 1.00 . A A . 30 LEU CB   1 1 
        7  8213 1 1 30 LEU CD1  C  -4.081  15.813  42.076 1.00 . A A . 30 LEU CD1  1 1 
        7  8214 1 1 30 LEU CD2  C  -5.335  14.356  43.688 1.00 . A A . 30 LEU CD2  1 1 
        7  8215 1 1 30 LEU CG   C  -4.499  14.376  42.399 1.00 . A A . 30 LEU CG   1 1 
        7  8216 1 1 30 LEU H    H  -5.669  12.085  39.420 1.00 . A A . 30 LEU H    1 1 
        7  8217 1 1 30 LEU HA   H  -5.019  11.879  42.128 1.00 . A A . 30 LEU HA   1 1 
        7  8218 1 1 30 LEU HB2  H  -4.713  13.825  40.334 1.00 . A A . 30 LEU HB2  1 1 
        7  8219 1 1 30 LEU HB3  H  -6.190  14.436  41.073 1.00 . A A . 30 LEU HB3  1 1 
        7  8220 1 1 30 LEU HD11 H  -3.410  15.812  41.230 1.00 . A A . 30 LEU HD11 1 1 
        7  8221 1 1 30 LEU HD12 H  -3.581  16.244  42.931 1.00 . A A . 30 LEU HD12 1 1 
        7  8222 1 1 30 LEU HD13 H  -4.957  16.398  41.839 1.00 . A A . 30 LEU HD13 1 1 
        7  8223 1 1 30 LEU HD21 H  -6.362  14.608  43.462 1.00 . A A . 30 LEU HD21 1 1 
        7  8224 1 1 30 LEU HD22 H  -4.936  15.074  44.392 1.00 . A A . 30 LEU HD22 1 1 
        7  8225 1 1 30 LEU HD23 H  -5.293  13.371  44.125 1.00 . A A . 30 LEU HD23 1 1 
        7  8226 1 1 30 LEU HG   H  -3.614  13.770  42.535 1.00 . A A . 30 LEU HG   1 1 
        7  8227 1 1 30 LEU N    N  -5.939  11.649  40.255 1.00 . A A . 30 LEU N    1 1 
        7  8228 1 1 30 LEU O    O  -7.061  11.997  43.497 1.00 . A A . 30 LEU O    1 1 
        7  8229 1 1 31 LEU C    C  -9.697  11.448  43.121 1.00 . A A . 31 LEU C    1 1 
        7  8230 1 1 31 LEU CA   C  -9.424  12.825  42.513 1.00 . A A . 31 LEU CA   1 1 
        7  8231 1 1 31 LEU CB   C -10.585  13.200  41.574 1.00 . A A . 31 LEU CB   1 1 
        7  8232 1 1 31 LEU CD1  C  -9.278  15.174  40.760 1.00 . A A . 31 LEU CD1  1 1 
        7  8233 1 1 31 LEU CD2  C -11.745  15.069  40.383 1.00 . A A . 31 LEU CD2  1 1 
        7  8234 1 1 31 LEU CG   C -10.612  14.717  41.352 1.00 . A A . 31 LEU CG   1 1 
        7  8235 1 1 31 LEU H    H  -8.179  13.145  40.833 1.00 . A A . 31 LEU H    1 1 
        7  8236 1 1 31 LEU HA   H  -9.330  13.593  43.269 1.00 . A A . 31 LEU HA   1 1 
        7  8237 1 1 31 LEU HB2  H -10.452  12.703  40.625 1.00 . A A . 31 LEU HB2  1 1 
        7  8238 1 1 31 LEU HB3  H -11.523  12.889  42.012 1.00 . A A . 31 LEU HB3  1 1 
        7  8239 1 1 31 LEU HD11 H  -8.521  15.163  41.530 1.00 . A A . 31 LEU HD11 1 1 
        7  8240 1 1 31 LEU HD12 H  -9.379  16.176  40.371 1.00 . A A . 31 LEU HD12 1 1 
        7  8241 1 1 31 LEU HD13 H  -8.989  14.506  39.962 1.00 . A A . 31 LEU HD13 1 1 
        7  8242 1 1 31 LEU HD21 H -11.811  16.142  40.282 1.00 . A A . 31 LEU HD21 1 1 
        7  8243 1 1 31 LEU HD22 H -12.678  14.684  40.766 1.00 . A A . 31 LEU HD22 1 1 
        7  8244 1 1 31 LEU HD23 H -11.543  14.629  39.419 1.00 . A A . 31 LEU HD23 1 1 
        7  8245 1 1 31 LEU HG   H -10.776  15.215  42.296 1.00 . A A . 31 LEU HG   1 1 
        7  8246 1 1 31 LEU N    N  -8.181  12.790  41.746 1.00 . A A . 31 LEU N    1 1 
        7  8247 1 1 31 LEU O    O -10.115  11.317  44.269 1.00 . A A . 31 LEU O    1 1 
        7  8248 1 1 32 GLY C    C  -8.653   8.756  43.933 1.00 . A A . 32 GLY C    1 1 
        7  8249 1 1 32 GLY CA   C  -9.591   9.051  42.760 1.00 . A A . 32 GLY CA   1 1 
        7  8250 1 1 32 GLY H    H  -9.046  10.654  41.443 1.00 . A A . 32 GLY H    1 1 
        7  8251 1 1 32 GLY HA2  H -10.616   8.900  43.071 1.00 . A A . 32 GLY HA2  1 1 
        7  8252 1 1 32 GLY HA3  H  -9.361   8.383  41.945 1.00 . A A . 32 GLY HA3  1 1 
        7  8253 1 1 32 GLY N    N  -9.419  10.432  42.321 1.00 . A A . 32 GLY N    1 1 
        7  8254 1 1 32 GLY O    O  -9.050   8.165  44.937 1.00 . A A . 32 GLY O    1 1 
        7  8255 1 1 33 VAL C    C  -7.080   9.662  46.142 1.00 . A A . 33 VAL C    1 1 
        7  8256 1 1 33 VAL CA   C  -6.444   9.060  44.884 1.00 . A A . 33 VAL CA   1 1 
        7  8257 1 1 33 VAL CB   C  -5.110   9.745  44.565 1.00 . A A . 33 VAL CB   1 1 
        7  8258 1 1 33 VAL CG1  C  -4.219   9.730  45.809 1.00 . A A . 33 VAL CG1  1 1 
        7  8259 1 1 33 VAL CG2  C  -4.413   8.993  43.430 1.00 . A A . 33 VAL CG2  1 1 
        7  8260 1 1 33 VAL H    H  -7.247   9.750  42.988 1.00 . A A . 33 VAL H    1 1 
        7  8261 1 1 33 VAL HA   H  -6.279   8.007  45.063 1.00 . A A . 33 VAL HA   1 1 
        7  8262 1 1 33 VAL HB   H  -5.287  10.765  44.269 1.00 . A A . 33 VAL HB   1 1 
        7  8263 1 1 33 VAL HG11 H  -3.205   9.971  45.528 1.00 . A A . 33 VAL HG11 1 1 
        7  8264 1 1 33 VAL HG12 H  -4.244   8.747  46.257 1.00 . A A . 33 VAL HG12 1 1 
        7  8265 1 1 33 VAL HG13 H  -4.580  10.459  46.520 1.00 . A A . 33 VAL HG13 1 1 
        7  8266 1 1 33 VAL HG21 H  -3.606   9.596  43.042 1.00 . A A . 33 VAL HG21 1 1 
        7  8267 1 1 33 VAL HG22 H  -5.123   8.791  42.642 1.00 . A A . 33 VAL HG22 1 1 
        7  8268 1 1 33 VAL HG23 H  -4.018   8.061  43.805 1.00 . A A . 33 VAL HG23 1 1 
        7  8269 1 1 33 VAL N    N  -7.416   9.230  43.800 1.00 . A A . 33 VAL N    1 1 
        7  8270 1 1 33 VAL O    O  -7.101   9.036  47.201 1.00 . A A . 33 VAL O    1 1 
        7  8271 1 1 34 VAL C    C  -9.362  10.614  47.653 1.00 . A A . 34 VAL C    1 1 
        7  8272 1 1 34 VAL CA   C  -8.237  11.528  47.162 1.00 . A A . 34 VAL CA   1 1 
        7  8273 1 1 34 VAL CB   C  -8.793  12.901  46.772 1.00 . A A . 34 VAL CB   1 1 
        7  8274 1 1 34 VAL CG1  C  -9.642  13.459  47.918 1.00 . A A . 34 VAL CG1  1 1 
        7  8275 1 1 34 VAL CG2  C  -7.629  13.854  46.488 1.00 . A A . 34 VAL CG2  1 1 
        7  8276 1 1 34 VAL H    H  -7.470  11.350  45.167 1.00 . A A . 34 VAL H    1 1 
        7  8277 1 1 34 VAL HA   H  -7.481  11.654  47.925 1.00 . A A . 34 VAL HA   1 1 
        7  8278 1 1 34 VAL HB   H  -9.404  12.807  45.889 1.00 . A A . 34 VAL HB   1 1 
        7  8279 1 1 34 VAL HG11 H  -9.794  14.518  47.772 1.00 . A A . 34 VAL HG11 1 1 
        7  8280 1 1 34 VAL HG12 H  -9.135  13.294  48.856 1.00 . A A . 34 VAL HG12 1 1 
        7  8281 1 1 34 VAL HG13 H -10.599  12.958  47.933 1.00 . A A . 34 VAL HG13 1 1 
        7  8282 1 1 34 VAL HG21 H  -7.106  14.069  47.409 1.00 . A A . 34 VAL HG21 1 1 
        7  8283 1 1 34 VAL HG22 H  -8.009  14.773  46.067 1.00 . A A . 34 VAL HG22 1 1 
        7  8284 1 1 34 VAL HG23 H  -6.949  13.393  45.787 1.00 . A A . 34 VAL HG23 1 1 
        7  8285 1 1 34 VAL N    N  -7.602  10.878  46.017 1.00 . A A . 34 VAL N    1 1 
        7  8286 1 1 34 VAL O    O  -9.588  10.434  48.844 1.00 . A A . 34 VAL O    1 1 
        7  8287 1 1 35 GLY C    C -10.525   7.954  47.858 1.00 . A A . 35 GLY C    1 1 
        7  8288 1 1 35 GLY CA   C -11.114   9.085  47.007 1.00 . A A . 35 GLY CA   1 1 
        7  8289 1 1 35 GLY H    H  -9.758  10.223  45.773 1.00 . A A . 35 GLY H    1 1 
        7  8290 1 1 35 GLY HA2  H -11.890   9.598  47.560 1.00 . A A . 35 GLY HA2  1 1 
        7  8291 1 1 35 GLY HA3  H -11.523   8.673  46.099 1.00 . A A . 35 GLY HA3  1 1 
        7  8292 1 1 35 GLY N    N -10.040  10.018  46.689 1.00 . A A . 35 GLY N    1 1 
        7  8293 1 1 35 GLY O    O -11.097   7.542  48.865 1.00 . A A . 35 GLY O    1 1 
        7  8294 1 1 36 LEU C    C  -8.074   6.950  49.474 1.00 . A A . 36 LEU C    1 1 
        7  8295 1 1 36 LEU CA   C  -8.626   6.431  48.135 1.00 . A A . 36 LEU CA   1 1 
        7  8296 1 1 36 LEU CB   C  -7.462   5.913  47.280 1.00 . A A . 36 LEU CB   1 1 
        7  8297 1 1 36 LEU CD1  C  -6.805   4.840  45.117 1.00 . A A . 36 LEU CD1  1 1 
        7  8298 1 1 36 LEU CD2  C  -8.804   3.967  46.369 1.00 . A A . 36 LEU CD2  1 1 
        7  8299 1 1 36 LEU CG   C  -7.991   5.229  46.007 1.00 . A A . 36 LEU CG   1 1 
        7  8300 1 1 36 LEU H    H  -8.979   7.897  46.624 1.00 . A A . 36 LEU H    1 1 
        7  8301 1 1 36 LEU HA   H  -9.307   5.616  48.315 1.00 . A A . 36 LEU HA   1 1 
        7  8302 1 1 36 LEU HB2  H  -6.825   6.737  47.003 1.00 . A A . 36 LEU HB2  1 1 
        7  8303 1 1 36 LEU HB3  H  -6.890   5.199  47.853 1.00 . A A . 36 LEU HB3  1 1 
        7  8304 1 1 36 LEU HD11 H  -6.293   3.994  45.552 1.00 . A A . 36 LEU HD11 1 1 
        7  8305 1 1 36 LEU HD12 H  -6.123   5.672  45.039 1.00 . A A . 36 LEU HD12 1 1 
        7  8306 1 1 36 LEU HD13 H  -7.165   4.575  44.134 1.00 . A A . 36 LEU HD13 1 1 
        7  8307 1 1 36 LEU HD21 H  -9.834   4.242  46.540 1.00 . A A . 36 LEU HD21 1 1 
        7  8308 1 1 36 LEU HD22 H  -8.400   3.514  47.263 1.00 . A A . 36 LEU HD22 1 1 
        7  8309 1 1 36 LEU HD23 H  -8.758   3.256  45.556 1.00 . A A . 36 LEU HD23 1 1 
        7  8310 1 1 36 LEU HG   H  -8.623   5.922  45.471 1.00 . A A . 36 LEU HG   1 1 
        7  8311 1 1 36 LEU N    N  -9.355   7.491  47.432 1.00 . A A . 36 LEU N    1 1 
        7  8312 1 1 36 LEU O    O  -7.976   6.211  50.450 1.00 . A A . 36 LEU O    1 1 
        7  8313 1 1 37 SER C    C  -8.388   8.719  51.800 1.00 . A A . 37 SER C    1 1 
        7  8314 1 1 37 SER CA   C  -7.303   8.900  50.732 1.00 . A A . 37 SER CA   1 1 
        7  8315 1 1 37 SER CB   C  -7.022  10.392  50.499 1.00 . A A . 37 SER CB   1 1 
        7  8316 1 1 37 SER H    H  -8.021   8.772  48.708 1.00 . A A . 37 SER H    1 1 
        7  8317 1 1 37 SER HA   H  -6.407   8.412  51.089 1.00 . A A . 37 SER HA   1 1 
        7  8318 1 1 37 SER HB2  H  -6.332  10.510  49.683 1.00 . A A . 37 SER HB2  1 1 
        7  8319 1 1 37 SER HB3  H  -7.941  10.898  50.263 1.00 . A A . 37 SER HB3  1 1 
        7  8320 1 1 37 SER HG   H  -7.163  11.066  52.319 1.00 . A A . 37 SER HG   1 1 
        7  8321 1 1 37 SER N    N  -7.779   8.251  49.502 1.00 . A A . 37 SER N    1 1 
        7  8322 1 1 37 SER O    O  -8.118   8.434  52.961 1.00 . A A . 37 SER O    1 1 
        7  8323 1 1 37 SER OG   O  -6.460  10.959  51.673 1.00 . A A . 37 SER OG   1 1 
        7  8324 1 1 38 ALA C    C -10.619   7.226  52.906 1.00 . A A . 38 ALA C    1 1 
        7  8325 1 1 38 ALA CA   C -10.723   8.636  52.315 1.00 . A A . 38 ALA CA   1 1 
        7  8326 1 1 38 ALA CB   C -12.070   8.814  51.612 1.00 . A A . 38 ALA CB   1 1 
        7  8327 1 1 38 ALA H    H  -9.766   9.043  50.438 1.00 . A A . 38 ALA H    1 1 
        7  8328 1 1 38 ALA HA   H -10.653   9.328  53.141 1.00 . A A . 38 ALA HA   1 1 
        7  8329 1 1 38 ALA HB1  H -12.195   8.038  50.873 1.00 . A A . 38 ALA HB1  1 1 
        7  8330 1 1 38 ALA HB2  H -12.100   9.780  51.129 1.00 . A A . 38 ALA HB2  1 1 
        7  8331 1 1 38 ALA HB3  H -12.866   8.750  52.339 1.00 . A A . 38 ALA HB3  1 1 
        7  8332 1 1 38 ALA N    N  -9.623   8.838  51.385 1.00 . A A . 38 ALA N    1 1 
        7  8333 1 1 38 ALA O    O -10.883   7.022  54.091 1.00 . A A . 38 ALA O    1 1 
        7  8334 1 1 39 LEU C    C  -8.774   4.690  53.385 1.00 . A A . 39 LEU C    1 1 
        7  8335 1 1 39 LEU CA   C -10.076   4.889  52.574 1.00 . A A . 39 LEU CA   1 1 
        7  8336 1 1 39 LEU CB   C -10.067   3.940  51.365 1.00 . A A . 39 LEU CB   1 1 
        7  8337 1 1 39 LEU CD1  C -11.036   2.054  52.734 1.00 . A A . 39 LEU CD1  1 1 
        7  8338 1 1 39 LEU CD2  C  -9.869   1.580  50.567 1.00 . A A . 39 LEU CD2  1 1 
        7  8339 1 1 39 LEU CG   C  -9.884   2.478  51.810 1.00 . A A . 39 LEU CG   1 1 
        7  8340 1 1 39 LEU H    H -10.002   6.517  51.161 1.00 . A A . 39 LEU H    1 1 
        7  8341 1 1 39 LEU HA   H -10.937   4.651  53.179 1.00 . A A . 39 LEU HA   1 1 
        7  8342 1 1 39 LEU HB2  H -11.003   4.034  50.835 1.00 . A A . 39 LEU HB2  1 1 
        7  8343 1 1 39 LEU HB3  H  -9.257   4.214  50.706 1.00 . A A . 39 LEU HB3  1 1 
        7  8344 1 1 39 LEU HD11 H -11.114   0.977  52.744 1.00 . A A . 39 LEU HD11 1 1 
        7  8345 1 1 39 LEU HD12 H -11.963   2.477  52.375 1.00 . A A . 39 LEU HD12 1 1 
        7  8346 1 1 39 LEU HD13 H -10.843   2.408  53.736 1.00 . A A . 39 LEU HD13 1 1 
        7  8347 1 1 39 LEU HD21 H  -9.484   0.606  50.833 1.00 . A A . 39 LEU HD21 1 1 
        7  8348 1 1 39 LEU HD22 H  -9.241   2.021  49.809 1.00 . A A . 39 LEU HD22 1 1 
        7  8349 1 1 39 LEU HD23 H -10.875   1.476  50.186 1.00 . A A . 39 LEU HD23 1 1 
        7  8350 1 1 39 LEU HG   H  -8.946   2.371  52.335 1.00 . A A . 39 LEU HG   1 1 
        7  8351 1 1 39 LEU N    N -10.219   6.264  52.083 1.00 . A A . 39 LEU N    1 1 
        7  8352 1 1 39 LEU O    O  -8.794   4.163  54.496 1.00 . A A . 39 LEU O    1 1 
        7  8353 1 1 40 THR C    C  -5.610   6.121  53.833 1.00 . A A . 40 THR C    1 1 
        7  8354 1 1 40 THR CA   C  -6.305   4.836  53.357 1.00 . A A . 40 THR CA   1 1 
        7  8355 1 1 40 THR CB   C  -5.416   4.258  52.253 1.00 . A A . 40 THR CB   1 1 
        7  8356 1 1 40 THR CG2  C  -5.989   2.922  51.774 1.00 . A A . 40 THR CG2  1 1 
        7  8357 1 1 40 THR H    H  -7.714   5.350  51.836 1.00 . A A . 40 THR H    1 1 
        7  8358 1 1 40 THR HA   H  -6.355   4.076  54.123 1.00 . A A . 40 THR HA   1 1 
        7  8359 1 1 40 THR HB   H  -4.421   4.099  52.639 1.00 . A A . 40 THR HB   1 1 
        7  8360 1 1 40 THR HG1  H  -4.717   5.849  51.381 1.00 . A A . 40 THR HG1  1 1 
        7  8361 1 1 40 THR HG21 H  -6.178   2.285  52.625 1.00 . A A . 40 THR HG21 1 1 
        7  8362 1 1 40 THR HG22 H  -5.279   2.443  51.117 1.00 . A A . 40 THR HG22 1 1 
        7  8363 1 1 40 THR HG23 H  -6.912   3.095  51.241 1.00 . A A . 40 THR HG23 1 1 
        7  8364 1 1 40 THR N    N  -7.643   5.045  52.763 1.00 . A A . 40 THR N    1 1 
        7  8365 1 1 40 THR O    O  -4.644   6.079  54.593 1.00 . A A . 40 THR O    1 1 
        7  8366 1 1 40 THR OG1  O  -5.361   5.170  51.166 1.00 . A A . 40 THR OG1  1 1 
        7  8367 1 1 41 GLY C    C  -4.143   8.698  53.635 1.00 . A A . 41 GLY C    1 1 
        7  8368 1 1 41 GLY CA   C  -5.648   8.557  53.822 1.00 . A A . 41 GLY CA   1 1 
        7  8369 1 1 41 GLY H    H  -7.020   7.158  52.948 1.00 . A A . 41 GLY H    1 1 
        7  8370 1 1 41 GLY HA2  H  -6.128   9.323  53.246 1.00 . A A . 41 GLY HA2  1 1 
        7  8371 1 1 41 GLY HA3  H  -5.882   8.709  54.865 1.00 . A A . 41 GLY HA3  1 1 
        7  8372 1 1 41 GLY N    N  -6.160   7.243  53.411 1.00 . A A . 41 GLY N    1 1 
        7  8373 1 1 41 GLY O    O  -3.352   8.008  54.276 1.00 . A A . 41 GLY O    1 1 
        7  8374 1 1 42 TYR C    C  -2.064  11.336  52.379 1.00 . A A . 42 TYR C    1 1 
        7  8375 1 1 42 TYR CA   C  -2.359   9.825  52.385 1.00 . A A . 42 TYR CA   1 1 
        7  8376 1 1 42 TYR CB   C  -2.118   9.243  50.964 1.00 . A A . 42 TYR CB   1 1 
        7  8377 1 1 42 TYR CD1  C  -3.589  11.056  49.978 1.00 . A A . 42 TYR CD1  1 1 
        7  8378 1 1 42 TYR CD2  C  -1.503  10.524  48.862 1.00 . A A . 42 TYR CD2  1 1 
        7  8379 1 1 42 TYR CE1  C  -3.844  12.052  49.028 1.00 . A A . 42 TYR CE1  1 1 
        7  8380 1 1 42 TYR CE2  C  -1.757  11.519  47.912 1.00 . A A . 42 TYR CE2  1 1 
        7  8381 1 1 42 TYR CG   C  -2.419  10.291  49.896 1.00 . A A . 42 TYR CG   1 1 
        7  8382 1 1 42 TYR CZ   C  -2.928  12.284  47.994 1.00 . A A . 42 TYR CZ   1 1 
        7  8383 1 1 42 TYR H    H  -4.419  10.060  52.184 1.00 . A A . 42 TYR H    1 1 
        7  8384 1 1 42 TYR HA   H  -1.701   9.323  53.078 1.00 . A A . 42 TYR HA   1 1 
        7  8385 1 1 42 TYR HB2  H  -1.089   8.928  50.874 1.00 . A A . 42 TYR HB2  1 1 
        7  8386 1 1 42 TYR HB3  H  -2.765   8.390  50.815 1.00 . A A . 42 TYR HB3  1 1 
        7  8387 1 1 42 TYR HD1  H  -4.295  10.882  50.767 1.00 . A A . 42 TYR HD1  1 1 
        7  8388 1 1 42 TYR HD2  H  -0.608   9.930  48.801 1.00 . A A . 42 TYR HD2  1 1 
        7  8389 1 1 42 TYR HE1  H  -4.747  12.641  49.092 1.00 . A A . 42 TYR HE1  1 1 
        7  8390 1 1 42 TYR HE2  H  -1.051  11.699  47.115 1.00 . A A . 42 TYR HE2  1 1 
        7  8391 1 1 42 TYR HH   H  -3.956  13.007  46.559 1.00 . A A . 42 TYR HH   1 1 
        7  8392 1 1 42 TYR N    N  -3.761   9.585  52.721 1.00 . A A . 42 TYR N    1 1 
        7  8393 1 1 42 TYR O    O  -1.133  11.785  51.714 1.00 . A A . 42 TYR O    1 1 
        7  8394 1 1 42 TYR OH   O  -3.179  13.265  47.057 1.00 . A A . 42 TYR OH   1 1 
        7  8395 1 1 43 LEU C    C  -1.289  14.029  53.345 1.00 . A A . 43 LEU C    1 1 
        7  8396 1 1 43 LEU CA   C  -2.739  13.567  53.139 1.00 . A A . 43 LEU CA   1 1 
        7  8397 1 1 43 LEU CB   C  -3.536  14.019  54.389 1.00 . A A . 43 LEU CB   1 1 
        7  8398 1 1 43 LEU CD1  C  -5.604  12.991  53.414 1.00 . A A . 43 LEU CD1  1 1 
        7  8399 1 1 43 LEU CD2  C  -5.791  14.624  55.297 1.00 . A A . 43 LEU CD2  1 1 
        7  8400 1 1 43 LEU CG   C  -5.011  14.260  54.030 1.00 . A A . 43 LEU CG   1 1 
        7  8401 1 1 43 LEU H    H  -3.607  11.725  53.620 1.00 . A A . 43 LEU H    1 1 
        7  8402 1 1 43 LEU HA   H  -3.208  14.053  52.294 1.00 . A A . 43 LEU HA   1 1 
        7  8403 1 1 43 LEU HB2  H  -3.478  13.250  55.143 1.00 . A A . 43 LEU HB2  1 1 
        7  8404 1 1 43 LEU HB3  H  -3.120  14.937  54.786 1.00 . A A . 43 LEU HB3  1 1 
        7  8405 1 1 43 LEU HD11 H  -5.234  12.872  52.407 1.00 . A A . 43 LEU HD11 1 1 
        7  8406 1 1 43 LEU HD12 H  -6.681  13.069  53.394 1.00 . A A . 43 LEU HD12 1 1 
        7  8407 1 1 43 LEU HD13 H  -5.317  12.135  54.006 1.00 . A A . 43 LEU HD13 1 1 
        7  8408 1 1 43 LEU HD21 H  -5.957  13.735  55.886 1.00 . A A . 43 LEU HD21 1 1 
        7  8409 1 1 43 LEU HD22 H  -6.742  15.055  55.021 1.00 . A A . 43 LEU HD22 1 1 
        7  8410 1 1 43 LEU HD23 H  -5.226  15.340  55.875 1.00 . A A . 43 LEU HD23 1 1 
        7  8411 1 1 43 LEU HG   H  -5.078  15.069  53.318 1.00 . A A . 43 LEU HG   1 1 
        7  8412 1 1 43 LEU N    N  -2.879  12.110  53.088 1.00 . A A . 43 LEU N    1 1 
        7  8413 1 1 43 LEU O    O  -0.740  14.775  52.535 1.00 . A A . 43 LEU O    1 1 
        7  8414 1 1 44 ASP C    C   1.649  13.393  53.717 1.00 . A A . 44 ASP C    1 1 
        7  8415 1 1 44 ASP CA   C   0.686  13.971  54.758 1.00 . A A . 44 ASP CA   1 1 
        7  8416 1 1 44 ASP CB   C   1.074  13.494  56.160 1.00 . A A . 44 ASP CB   1 1 
        7  8417 1 1 44 ASP CG   C   0.932  11.975  56.222 1.00 . A A . 44 ASP CG   1 1 
        7  8418 1 1 44 ASP H    H  -1.197  12.983  55.029 1.00 . A A . 44 ASP H    1 1 
        7  8419 1 1 44 ASP HA   H   0.764  15.044  54.690 1.00 . A A . 44 ASP HA   1 1 
        7  8420 1 1 44 ASP HB2  H   2.098  13.771  56.366 1.00 . A A . 44 ASP HB2  1 1 
        7  8421 1 1 44 ASP HB3  H   0.420  13.945  56.891 1.00 . A A . 44 ASP HB3  1 1 
        7  8422 1 1 44 ASP N    N  -0.692  13.588  54.445 1.00 . A A . 44 ASP N    1 1 
        7  8423 1 1 44 ASP O    O   2.619  14.045  53.332 1.00 . A A . 44 ASP O    1 1 
        7  8424 1 1 44 ASP OD1  O   0.328  11.435  55.310 1.00 . A A . 44 ASP OD1  1 1 
        7  8425 1 1 44 ASP OD2  O   1.469  11.372  57.136 1.00 . A A . 44 ASP OD2  1 1 
        7  8426 1 1 45 TYR C    C   2.389  12.315  51.018 1.00 . A A . 45 TYR C    1 1 
        7  8427 1 1 45 TYR CA   C   2.271  11.512  52.321 1.00 . A A . 45 TYR CA   1 1 
        7  8428 1 1 45 TYR CB   C   1.749  10.096  52.013 1.00 . A A . 45 TYR CB   1 1 
        7  8429 1 1 45 TYR CD1  C   3.509   8.593  53.003 1.00 . A A . 45 TYR CD1  1 1 
        7  8430 1 1 45 TYR CD2  C   1.356   8.734  54.109 1.00 . A A . 45 TYR CD2  1 1 
        7  8431 1 1 45 TYR CE1  C   3.946   7.679  53.970 1.00 . A A . 45 TYR CE1  1 1 
        7  8432 1 1 45 TYR CE2  C   1.792   7.820  55.076 1.00 . A A . 45 TYR CE2  1 1 
        7  8433 1 1 45 TYR CG   C   2.214   9.120  53.072 1.00 . A A . 45 TYR CG   1 1 
        7  8434 1 1 45 TYR CZ   C   3.087   7.293  55.007 1.00 . A A . 45 TYR CZ   1 1 
        7  8435 1 1 45 TYR H    H   0.638  11.677  53.677 1.00 . A A . 45 TYR H    1 1 
        7  8436 1 1 45 TYR HA   H   3.260  11.429  52.747 1.00 . A A . 45 TYR HA   1 1 
        7  8437 1 1 45 TYR HB2  H   0.669  10.112  51.994 1.00 . A A . 45 TYR HB2  1 1 
        7  8438 1 1 45 TYR HB3  H   2.116   9.773  51.047 1.00 . A A . 45 TYR HB3  1 1 
        7  8439 1 1 45 TYR HD1  H   4.172   8.891  52.204 1.00 . A A . 45 TYR HD1  1 1 
        7  8440 1 1 45 TYR HD2  H   0.359   9.141  54.163 1.00 . A A . 45 TYR HD2  1 1 
        7  8441 1 1 45 TYR HE1  H   4.945   7.272  53.917 1.00 . A A . 45 TYR HE1  1 1 
        7  8442 1 1 45 TYR HE2  H   1.130   7.522  55.874 1.00 . A A . 45 TYR HE2  1 1 
        7  8443 1 1 45 TYR HH   H   3.627   5.539  55.534 1.00 . A A . 45 TYR HH   1 1 
        7  8444 1 1 45 TYR N    N   1.395  12.165  53.290 1.00 . A A . 45 TYR N    1 1 
        7  8445 1 1 45 TYR O    O   3.481  12.392  50.466 1.00 . A A . 45 TYR O    1 1 
        7  8446 1 1 45 TYR OH   O   3.518   6.392  55.959 1.00 . A A . 45 TYR OH   1 1 
        7  8447 1 1 46 VAL C    C   2.584  13.949  48.658 1.00 . A A . 46 VAL C    1 1 
        7  8448 1 1 46 VAL CA   C   1.210  13.616  49.253 1.00 . A A . 46 VAL CA   1 1 
        7  8449 1 1 46 VAL CB   C   0.435  14.923  49.456 1.00 . A A . 46 VAL CB   1 1 
        7  8450 1 1 46 VAL CG1  C  -1.031  14.611  49.786 1.00 . A A . 46 VAL CG1  1 1 
        7  8451 1 1 46 VAL CG2  C   1.067  15.729  50.600 1.00 . A A . 46 VAL CG2  1 1 
        7  8452 1 1 46 VAL H    H   0.420  12.701  51.002 1.00 . A A . 46 VAL H    1 1 
        7  8453 1 1 46 VAL HA   H   0.670  13.021  48.533 1.00 . A A . 46 VAL HA   1 1 
        7  8454 1 1 46 VAL HB   H   0.475  15.502  48.545 1.00 . A A . 46 VAL HB   1 1 
        7  8455 1 1 46 VAL HG11 H  -1.563  14.384  48.873 1.00 . A A . 46 VAL HG11 1 1 
        7  8456 1 1 46 VAL HG12 H  -1.487  15.468  50.261 1.00 . A A . 46 VAL HG12 1 1 
        7  8457 1 1 46 VAL HG13 H  -1.082  13.762  50.451 1.00 . A A . 46 VAL HG13 1 1 
        7  8458 1 1 46 VAL HG21 H   1.972  16.201  50.248 1.00 . A A . 46 VAL HG21 1 1 
        7  8459 1 1 46 VAL HG22 H   1.302  15.072  51.423 1.00 . A A . 46 VAL HG22 1 1 
        7  8460 1 1 46 VAL HG23 H   0.374  16.487  50.932 1.00 . A A . 46 VAL HG23 1 1 
        7  8461 1 1 46 VAL N    N   1.264  12.861  50.530 1.00 . A A . 46 VAL N    1 1 
        7  8462 1 1 46 VAL O    O   2.807  13.727  47.467 1.00 . A A . 46 VAL O    1 1 
        7  8463 1 1 47 LEU C    C   5.528  13.693  48.278 1.00 . A A . 47 LEU C    1 1 
        7  8464 1 1 47 LEU CA   C   4.799  14.882  48.934 1.00 . A A . 47 LEU CA   1 1 
        7  8465 1 1 47 LEU CB   C   5.648  15.404  50.104 1.00 . A A . 47 LEU CB   1 1 
        7  8466 1 1 47 LEU CD1  C   6.958  16.908  48.561 1.00 . A A . 47 LEU CD1  1 1 
        7  8467 1 1 47 LEU CD2  C   7.856  16.318  50.826 1.00 . A A . 47 LEU CD2  1 1 
        7  8468 1 1 47 LEU CG   C   7.055  15.803  49.625 1.00 . A A . 47 LEU CG   1 1 
        7  8469 1 1 47 LEU H    H   3.237  14.724  50.372 1.00 . A A . 47 LEU H    1 1 
        7  8470 1 1 47 LEU HA   H   4.667  15.693  48.235 1.00 . A A . 47 LEU HA   1 1 
        7  8471 1 1 47 LEU HB2  H   5.163  16.266  50.538 1.00 . A A . 47 LEU HB2  1 1 
        7  8472 1 1 47 LEU HB3  H   5.735  14.631  50.853 1.00 . A A . 47 LEU HB3  1 1 
        7  8473 1 1 47 LEU HD11 H   7.893  17.450  48.514 1.00 . A A . 47 LEU HD11 1 1 
        7  8474 1 1 47 LEU HD12 H   6.162  17.591  48.816 1.00 . A A . 47 LEU HD12 1 1 
        7  8475 1 1 47 LEU HD13 H   6.756  16.463  47.598 1.00 . A A . 47 LEU HD13 1 1 
        7  8476 1 1 47 LEU HD21 H   7.739  15.638  51.656 1.00 . A A . 47 LEU HD21 1 1 
        7  8477 1 1 47 LEU HD22 H   7.494  17.296  51.107 1.00 . A A . 47 LEU HD22 1 1 
        7  8478 1 1 47 LEU HD23 H   8.901  16.385  50.558 1.00 . A A . 47 LEU HD23 1 1 
        7  8479 1 1 47 LEU HG   H   7.557  14.943  49.206 1.00 . A A . 47 LEU HG   1 1 
        7  8480 1 1 47 LEU N    N   3.484  14.504  49.450 1.00 . A A . 47 LEU N    1 1 
        7  8481 1 1 47 LEU O    O   6.073  13.814  47.180 1.00 . A A . 47 LEU O    1 1 
        7  8482 1 1 48 LEU C    C   5.666  10.877  47.113 1.00 . A A . 48 LEU C    1 1 
        7  8483 1 1 48 LEU CA   C   6.235  11.358  48.476 1.00 . A A . 48 LEU CA   1 1 
        7  8484 1 1 48 LEU CB   C   6.228  10.238  49.542 1.00 . A A . 48 LEU CB   1 1 
        7  8485 1 1 48 LEU CD1  C   8.758  10.015  49.636 1.00 . A A . 48 LEU CD1  1 1 
        7  8486 1 1 48 LEU CD2  C   7.564  11.743  51.050 1.00 . A A . 48 LEU CD2  1 1 
        7  8487 1 1 48 LEU CG   C   7.475  10.332  50.441 1.00 . A A . 48 LEU CG   1 1 
        7  8488 1 1 48 LEU H    H   5.088  12.567  49.845 1.00 . A A . 48 LEU H    1 1 
        7  8489 1 1 48 LEU HA   H   7.255  11.633  48.257 1.00 . A A . 48 LEU HA   1 1 
        7  8490 1 1 48 LEU HB2  H   5.357  10.352  50.167 1.00 . A A . 48 LEU HB2  1 1 
        7  8491 1 1 48 LEU HB3  H   6.203   9.271  49.061 1.00 . A A . 48 LEU HB3  1 1 
        7  8492 1 1 48 LEU HD11 H   9.402   9.385  50.234 1.00 . A A . 48 LEU HD11 1 1 
        7  8493 1 1 48 LEU HD12 H   9.281  10.928  49.394 1.00 . A A . 48 LEU HD12 1 1 
        7  8494 1 1 48 LEU HD13 H   8.506   9.495  48.722 1.00 . A A . 48 LEU HD13 1 1 
        7  8495 1 1 48 LEU HD21 H   6.575  12.091  51.312 1.00 . A A . 48 LEU HD21 1 1 
        7  8496 1 1 48 LEU HD22 H   8.005  12.418  50.332 1.00 . A A . 48 LEU HD22 1 1 
        7  8497 1 1 48 LEU HD23 H   8.179  11.712  51.936 1.00 . A A . 48 LEU HD23 1 1 
        7  8498 1 1 48 LEU HG   H   7.380   9.610  51.240 1.00 . A A . 48 LEU HG   1 1 
        7  8499 1 1 48 LEU N    N   5.547  12.560  48.979 1.00 . A A . 48 LEU N    1 1 
        7  8500 1 1 48 LEU O    O   6.420  10.817  46.141 1.00 . A A . 48 LEU O    1 1 
        7  8501 1 1 49 PRO C    C   4.219  11.074  44.509 1.00 . A A . 49 PRO C    1 1 
        7  8502 1 1 49 PRO CA   C   3.809  10.154  45.665 1.00 . A A . 49 PRO CA   1 1 
        7  8503 1 1 49 PRO CB   C   2.297  10.252  45.895 1.00 . A A . 49 PRO CB   1 1 
        7  8504 1 1 49 PRO CD   C   3.380  10.566  48.041 1.00 . A A . 49 PRO CD   1 1 
        7  8505 1 1 49 PRO CG   C   2.115  10.034  47.357 1.00 . A A . 49 PRO CG   1 1 
        7  8506 1 1 49 PRO HA   H   4.076   9.134  45.446 1.00 . A A . 49 PRO HA   1 1 
        7  8507 1 1 49 PRO HB2  H   1.932  11.234  45.611 1.00 . A A . 49 PRO HB2  1 1 
        7  8508 1 1 49 PRO HB3  H   1.778   9.485  45.336 1.00 . A A . 49 PRO HB3  1 1 
        7  8509 1 1 49 PRO HD2  H   3.220  11.551  48.412 1.00 . A A . 49 PRO HD2  1 1 
        7  8510 1 1 49 PRO HD3  H   3.677   9.902  48.831 1.00 . A A . 49 PRO HD3  1 1 
        7  8511 1 1 49 PRO HG2  H   1.250  10.581  47.702 1.00 . A A . 49 PRO HG2  1 1 
        7  8512 1 1 49 PRO HG3  H   1.997   8.981  47.570 1.00 . A A . 49 PRO HG3  1 1 
        7  8513 1 1 49 PRO N    N   4.394  10.577  46.980 1.00 . A A . 49 PRO N    1 1 
        7  8514 1 1 49 PRO O    O   4.259  10.647  43.356 1.00 . A A . 49 PRO O    1 1 
        7  8515 1 1 50 ALA C    C   6.328  12.862  43.223 1.00 . A A . 50 ALA C    1 1 
        7  8516 1 1 50 ALA CA   C   4.990  13.282  43.814 1.00 . A A . 50 ALA CA   1 1 
        7  8517 1 1 50 ALA CB   C   5.111  14.677  44.427 1.00 . A A . 50 ALA CB   1 1 
        7  8518 1 1 50 ALA H    H   4.574  12.616  45.759 1.00 . A A . 50 ALA H    1 1 
        7  8519 1 1 50 ALA HA   H   4.292  13.319  42.990 1.00 . A A . 50 ALA HA   1 1 
        7  8520 1 1 50 ALA HB1  H   4.259  14.866  45.064 1.00 . A A . 50 ALA HB1  1 1 
        7  8521 1 1 50 ALA HB2  H   5.140  15.416  43.640 1.00 . A A . 50 ALA HB2  1 1 
        7  8522 1 1 50 ALA HB3  H   6.017  14.737  45.011 1.00 . A A . 50 ALA HB3  1 1 
        7  8523 1 1 50 ALA N    N   4.550  12.324  44.824 1.00 . A A . 50 ALA N    1 1 
        7  8524 1 1 50 ALA O    O   6.599  13.115  42.049 1.00 . A A . 50 ALA O    1 1 
        7  8525 1 1 51 LEU C    C   8.215  10.691  42.433 1.00 . A A . 51 LEU C    1 1 
        7  8526 1 1 51 LEU CA   C   8.440  11.734  43.520 1.00 . A A . 51 LEU CA   1 1 
        7  8527 1 1 51 LEU CB   C   9.253  11.117  44.665 1.00 . A A . 51 LEU CB   1 1 
        7  8528 1 1 51 LEU CD1  C   8.784  13.204  45.973 1.00 . A A . 51 LEU CD1  1 1 
        7  8529 1 1 51 LEU CD2  C  10.571  11.616  46.735 1.00 . A A . 51 LEU CD2  1 1 
        7  8530 1 1 51 LEU CG   C   9.877  12.231  45.515 1.00 . A A . 51 LEU CG   1 1 
        7  8531 1 1 51 LEU H    H   6.881  11.976  44.933 1.00 . A A . 51 LEU H    1 1 
        7  8532 1 1 51 LEU HA   H   8.986  12.580  43.124 1.00 . A A . 51 LEU HA   1 1 
        7  8533 1 1 51 LEU HB2  H   8.602  10.514  45.281 1.00 . A A . 51 LEU HB2  1 1 
        7  8534 1 1 51 LEU HB3  H  10.040  10.496  44.260 1.00 . A A . 51 LEU HB3  1 1 
        7  8535 1 1 51 LEU HD11 H   8.526  13.864  45.157 1.00 . A A . 51 LEU HD11 1 1 
        7  8536 1 1 51 LEU HD12 H   9.146  13.789  46.806 1.00 . A A . 51 LEU HD12 1 1 
        7  8537 1 1 51 LEU HD13 H   7.910  12.650  46.276 1.00 . A A . 51 LEU HD13 1 1 
        7  8538 1 1 51 LEU HD21 H   9.942  10.852  47.164 1.00 . A A . 51 LEU HD21 1 1 
        7  8539 1 1 51 LEU HD22 H  10.756  12.386  47.471 1.00 . A A . 51 LEU HD22 1 1 
        7  8540 1 1 51 LEU HD23 H  11.510  11.179  46.430 1.00 . A A . 51 LEU HD23 1 1 
        7  8541 1 1 51 LEU HG   H  10.602  12.768  44.920 1.00 . A A . 51 LEU HG   1 1 
        7  8542 1 1 51 LEU N    N   7.155  12.197  44.018 1.00 . A A . 51 LEU N    1 1 
        7  8543 1 1 51 LEU O    O   8.885  10.681  41.404 1.00 . A A . 51 LEU O    1 1 
        7  8544 1 1 52 ALA C    C   6.443   9.459  40.405 1.00 . A A . 52 ALA C    1 1 
        7  8545 1 1 52 ALA CA   C   6.873   8.804  41.711 1.00 . A A . 52 ALA CA   1 1 
        7  8546 1 1 52 ALA CB   C   5.744   7.926  42.255 1.00 . A A . 52 ALA CB   1 1 
        7  8547 1 1 52 ALA H    H   6.707   9.956  43.497 1.00 . A A . 52 ALA H    1 1 
        7  8548 1 1 52 ALA HA   H   7.739   8.189  41.508 1.00 . A A . 52 ALA HA   1 1 
        7  8549 1 1 52 ALA HB1  H   4.885   8.541  42.479 1.00 . A A . 52 ALA HB1  1 1 
        7  8550 1 1 52 ALA HB2  H   6.075   7.430  43.156 1.00 . A A . 52 ALA HB2  1 1 
        7  8551 1 1 52 ALA HB3  H   5.474   7.186  41.516 1.00 . A A . 52 ALA HB3  1 1 
        7  8552 1 1 52 ALA N    N   7.226   9.836  42.675 1.00 . A A . 52 ALA N    1 1 
        7  8553 1 1 52 ALA O    O   6.864   9.041  39.326 1.00 . A A . 52 ALA O    1 1 
        7  8554 1 1 53 ILE C    C   6.381  11.837  38.600 1.00 . A A . 53 ILE C    1 1 
        7  8555 1 1 53 ILE CA   C   5.183  11.217  39.313 1.00 . A A . 53 ILE CA   1 1 
        7  8556 1 1 53 ILE CB   C   4.176  12.313  39.700 1.00 . A A . 53 ILE CB   1 1 
        7  8557 1 1 53 ILE CD1  C   1.963  11.207  39.061 1.00 . A A . 53 ILE CD1  1 1 
        7  8558 1 1 53 ILE CG1  C   2.865  11.681  40.218 1.00 . A A . 53 ILE CG1  1 1 
        7  8559 1 1 53 ILE CG2  C   3.880  13.201  38.484 1.00 . A A . 53 ILE CG2  1 1 
        7  8560 1 1 53 ILE H    H   5.324  10.804  41.386 1.00 . A A . 53 ILE H    1 1 
        7  8561 1 1 53 ILE HA   H   4.734  10.547  38.602 1.00 . A A . 53 ILE HA   1 1 
        7  8562 1 1 53 ILE HB   H   4.607  12.923  40.481 1.00 . A A . 53 ILE HB   1 1 
        7  8563 1 1 53 ILE HD11 H   1.398  10.343  39.380 1.00 . A A . 53 ILE HD11 1 1 
        7  8564 1 1 53 ILE HD12 H   2.560  10.945  38.203 1.00 . A A . 53 ILE HD12 1 1 
        7  8565 1 1 53 ILE HD13 H   1.282  11.999  38.793 1.00 . A A . 53 ILE HD13 1 1 
        7  8566 1 1 53 ILE HG12 H   3.104  10.836  40.846 1.00 . A A . 53 ILE HG12 1 1 
        7  8567 1 1 53 ILE HG13 H   2.329  12.414  40.804 1.00 . A A . 53 ILE HG13 1 1 
        7  8568 1 1 53 ILE HG21 H   3.746  12.581  37.609 1.00 . A A . 53 ILE HG21 1 1 
        7  8569 1 1 53 ILE HG22 H   4.707  13.877  38.322 1.00 . A A . 53 ILE HG22 1 1 
        7  8570 1 1 53 ILE HG23 H   2.980  13.771  38.663 1.00 . A A . 53 ILE HG23 1 1 
        7  8571 1 1 53 ILE N    N   5.627  10.504  40.504 1.00 . A A . 53 ILE N    1 1 
        7  8572 1 1 53 ILE O    O   6.538  11.646  37.397 1.00 . A A . 53 ILE O    1 1 
        7  8573 1 1 54 PHE C    C   9.290  12.112  38.067 1.00 . A A . 54 PHE C    1 1 
        7  8574 1 1 54 PHE CA   C   8.389  13.185  38.672 1.00 . A A . 54 PHE CA   1 1 
        7  8575 1 1 54 PHE CB   C   9.176  14.006  39.694 1.00 . A A . 54 PHE CB   1 1 
        7  8576 1 1 54 PHE CD1  C  10.075  15.893  38.289 1.00 . A A . 54 PHE CD1  1 1 
        7  8577 1 1 54 PHE CD2  C  11.619  14.206  39.095 1.00 . A A . 54 PHE CD2  1 1 
        7  8578 1 1 54 PHE CE1  C  11.131  16.558  37.656 1.00 . A A . 54 PHE CE1  1 1 
        7  8579 1 1 54 PHE CE2  C  12.676  14.872  38.462 1.00 . A A . 54 PHE CE2  1 1 
        7  8580 1 1 54 PHE CG   C  10.318  14.717  39.008 1.00 . A A . 54 PHE CG   1 1 
        7  8581 1 1 54 PHE CZ   C  12.432  16.047  37.743 1.00 . A A . 54 PHE CZ   1 1 
        7  8582 1 1 54 PHE H    H   7.092  12.747  40.266 1.00 . A A . 54 PHE H    1 1 
        7  8583 1 1 54 PHE HA   H   8.057  13.837  37.878 1.00 . A A . 54 PHE HA   1 1 
        7  8584 1 1 54 PHE HB2  H   8.520  14.735  40.148 1.00 . A A . 54 PHE HB2  1 1 
        7  8585 1 1 54 PHE HB3  H   9.567  13.351  40.459 1.00 . A A . 54 PHE HB3  1 1 
        7  8586 1 1 54 PHE HD1  H   9.071  16.287  38.221 1.00 . A A . 54 PHE HD1  1 1 
        7  8587 1 1 54 PHE HD2  H  11.807  13.299  39.650 1.00 . A A . 54 PHE HD2  1 1 
        7  8588 1 1 54 PHE HE1  H  10.943  17.465  37.100 1.00 . A A . 54 PHE HE1  1 1 
        7  8589 1 1 54 PHE HE2  H  13.679  14.477  38.529 1.00 . A A . 54 PHE HE2  1 1 
        7  8590 1 1 54 PHE HZ   H  13.248  16.560  37.254 1.00 . A A . 54 PHE HZ   1 1 
        7  8591 1 1 54 PHE N    N   7.229  12.575  39.310 1.00 . A A . 54 PHE N    1 1 
        7  8592 1 1 54 PHE O    O   9.814  12.280  36.966 1.00 . A A . 54 PHE O    1 1 
        7  8593 1 1 55 ILE C    C   9.613   9.278  37.074 1.00 . A A . 55 ILE C    1 1 
        7  8594 1 1 55 ILE CA   C  10.293   9.913  38.292 1.00 . A A . 55 ILE CA   1 1 
        7  8595 1 1 55 ILE CB   C  10.485   8.857  39.426 1.00 . A A . 55 ILE CB   1 1 
        7  8596 1 1 55 ILE CD1  C  11.589  10.409  41.101 1.00 . A A . 55 ILE CD1  1 1 
        7  8597 1 1 55 ILE CG1  C  11.765   9.151  40.243 1.00 . A A . 55 ILE CG1  1 1 
        7  8598 1 1 55 ILE CG2  C  10.604   7.436  38.847 1.00 . A A . 55 ILE CG2  1 1 
        7  8599 1 1 55 ILE H    H   9.011  10.914  39.650 1.00 . A A . 55 ILE H    1 1 
        7  8600 1 1 55 ILE HA   H  11.261  10.315  38.030 1.00 . A A . 55 ILE HA   1 1 
        7  8601 1 1 55 ILE HB   H   9.630   8.892  40.085 1.00 . A A . 55 ILE HB   1 1 
        7  8602 1 1 55 ILE HD11 H  11.069  10.152  42.012 1.00 . A A . 55 ILE HD11 1 1 
        7  8603 1 1 55 ILE HD12 H  11.024  11.147  40.556 1.00 . A A . 55 ILE HD12 1 1 
        7  8604 1 1 55 ILE HD13 H  12.560  10.812  41.345 1.00 . A A . 55 ILE HD13 1 1 
        7  8605 1 1 55 ILE HG12 H  11.969   8.311  40.891 1.00 . A A . 55 ILE HG12 1 1 
        7  8606 1 1 55 ILE HG13 H  12.600   9.289  39.573 1.00 . A A . 55 ILE HG13 1 1 
        7  8607 1 1 55 ILE HG21 H  11.291   7.445  38.014 1.00 . A A . 55 ILE HG21 1 1 
        7  8608 1 1 55 ILE HG22 H   9.634   7.102  38.510 1.00 . A A . 55 ILE HG22 1 1 
        7  8609 1 1 55 ILE HG23 H  10.970   6.764  39.609 1.00 . A A . 55 ILE HG23 1 1 
        7  8610 1 1 55 ILE N    N   9.461  11.005  38.784 1.00 . A A . 55 ILE N    1 1 
        7  8611 1 1 55 ILE O    O  10.248   8.977  36.066 1.00 . A A . 55 ILE O    1 1 
        7  8612 1 1 56 GLY C    C   7.484   9.431  34.906 1.00 . A A . 56 GLY C    1 1 
        7  8613 1 1 56 GLY CA   C   7.490   8.526  36.134 1.00 . A A . 56 GLY CA   1 1 
        7  8614 1 1 56 GLY H    H   7.877   9.416  38.030 1.00 . A A . 56 GLY H    1 1 
        7  8615 1 1 56 GLY HA2  H   7.898   7.562  35.865 1.00 . A A . 56 GLY HA2  1 1 
        7  8616 1 1 56 GLY HA3  H   6.478   8.399  36.484 1.00 . A A . 56 GLY HA3  1 1 
        7  8617 1 1 56 GLY N    N   8.300   9.105  37.203 1.00 . A A . 56 GLY N    1 1 
        7  8618 1 1 56 GLY O    O   7.593   8.963  33.773 1.00 . A A . 56 GLY O    1 1 
        7  8619 1 1 57 LEU C    C   8.687  11.685  33.354 1.00 . A A . 57 LEU C    1 1 
        7  8620 1 1 57 LEU CA   C   7.333  11.698  34.056 1.00 . A A . 57 LEU CA   1 1 
        7  8621 1 1 57 LEU CB   C   7.020  13.102  34.610 1.00 . A A . 57 LEU CB   1 1 
        7  8622 1 1 57 LEU CD1  C   7.205  14.028  32.275 1.00 . A A . 57 LEU CD1  1 1 
        7  8623 1 1 57 LEU CD2  C   4.935  13.435  33.197 1.00 . A A . 57 LEU CD2  1 1 
        7  8624 1 1 57 LEU CG   C   6.340  13.983  33.541 1.00 . A A . 57 LEU CG   1 1 
        7  8625 1 1 57 LEU H    H   7.271  11.031  36.075 1.00 . A A . 57 LEU H    1 1 
        7  8626 1 1 57 LEU HA   H   6.574  11.411  33.347 1.00 . A A . 57 LEU HA   1 1 
        7  8627 1 1 57 LEU HB2  H   6.363  13.007  35.462 1.00 . A A . 57 LEU HB2  1 1 
        7  8628 1 1 57 LEU HB3  H   7.938  13.578  34.928 1.00 . A A . 57 LEU HB3  1 1 
        7  8629 1 1 57 LEU HD11 H   7.061  13.121  31.709 1.00 . A A . 57 LEU HD11 1 1 
        7  8630 1 1 57 LEU HD12 H   8.244  14.123  32.549 1.00 . A A . 57 LEU HD12 1 1 
        7  8631 1 1 57 LEU HD13 H   6.914  14.876  31.673 1.00 . A A . 57 LEU HD13 1 1 
        7  8632 1 1 57 LEU HD21 H   4.526  12.903  34.045 1.00 . A A . 57 LEU HD21 1 1 
        7  8633 1 1 57 LEU HD22 H   4.991  12.764  32.350 1.00 . A A . 57 LEU HD22 1 1 
        7  8634 1 1 57 LEU HD23 H   4.284  14.261  32.951 1.00 . A A . 57 LEU HD23 1 1 
        7  8635 1 1 57 LEU HG   H   6.241  14.987  33.930 1.00 . A A . 57 LEU HG   1 1 
        7  8636 1 1 57 LEU N    N   7.354  10.732  35.147 1.00 . A A . 57 LEU N    1 1 
        7  8637 1 1 57 LEU O    O   8.763  11.577  32.129 1.00 . A A . 57 LEU O    1 1 
        7  8638 1 1 58 THR C    C  11.312  10.646  32.657 1.00 . A A . 58 THR C    1 1 
        7  8639 1 1 58 THR CA   C  11.095  11.843  33.572 1.00 . A A . 58 THR CA   1 1 
        7  8640 1 1 58 THR CB   C  12.119  11.794  34.708 1.00 . A A . 58 THR CB   1 1 
        7  8641 1 1 58 THR CG2  C  13.534  11.829  34.127 1.00 . A A . 58 THR CG2  1 1 
        7  8642 1 1 58 THR H    H   9.640  11.962  35.096 1.00 . A A . 58 THR H    1 1 
        7  8643 1 1 58 THR HA   H  11.228  12.772  33.037 1.00 . A A . 58 THR HA   1 1 
        7  8644 1 1 58 THR HB   H  11.988  10.885  35.274 1.00 . A A . 58 THR HB   1 1 
        7  8645 1 1 58 THR HG1  H  10.993  13.128  35.566 1.00 . A A . 58 THR HG1  1 1 
        7  8646 1 1 58 THR HG21 H  13.589  12.586  33.359 1.00 . A A . 58 THR HG21 1 1 
        7  8647 1 1 58 THR HG22 H  13.771  10.865  33.700 1.00 . A A . 58 THR HG22 1 1 
        7  8648 1 1 58 THR HG23 H  14.240  12.059  34.911 1.00 . A A . 58 THR HG23 1 1 
        7  8649 1 1 58 THR N    N   9.754  11.815  34.133 1.00 . A A . 58 THR N    1 1 
        7  8650 1 1 58 THR O    O  11.861  10.776  31.564 1.00 . A A . 58 THR O    1 1 
        7  8651 1 1 58 THR OG1  O  11.929  12.917  35.559 1.00 . A A . 58 THR OG1  1 1 
        7  8652 1 1 59 ILE C    C  10.097   8.439  31.032 1.00 . A A . 59 ILE C    1 1 
        7  8653 1 1 59 ILE CA   C  10.938   8.279  32.295 1.00 . A A . 59 ILE CA   1 1 
        7  8654 1 1 59 ILE CB   C  10.487   7.052  33.093 1.00 . A A . 59 ILE CB   1 1 
        7  8655 1 1 59 ILE CD1  C  10.922   5.745  35.181 1.00 . A A . 59 ILE CD1  1 1 
        7  8656 1 1 59 ILE CG1  C  11.496   6.781  34.212 1.00 . A A . 59 ILE CG1  1 1 
        7  8657 1 1 59 ILE CG2  C  10.416   5.832  32.169 1.00 . A A . 59 ILE CG2  1 1 
        7  8658 1 1 59 ILE H    H  10.349   9.467  33.952 1.00 . A A . 59 ILE H    1 1 
        7  8659 1 1 59 ILE HA   H  11.963   8.147  31.987 1.00 . A A . 59 ILE HA   1 1 
        7  8660 1 1 59 ILE HB   H   9.512   7.237  33.521 1.00 . A A . 59 ILE HB   1 1 
        7  8661 1 1 59 ILE HD11 H  10.014   6.129  35.621 1.00 . A A . 59 ILE HD11 1 1 
        7  8662 1 1 59 ILE HD12 H  11.642   5.542  35.960 1.00 . A A . 59 ILE HD12 1 1 
        7  8663 1 1 59 ILE HD13 H  10.706   4.833  34.645 1.00 . A A . 59 ILE HD13 1 1 
        7  8664 1 1 59 ILE HG12 H  12.414   6.403  33.784 1.00 . A A . 59 ILE HG12 1 1 
        7  8665 1 1 59 ILE HG13 H  11.698   7.696  34.744 1.00 . A A . 59 ILE HG13 1 1 
        7  8666 1 1 59 ILE HG21 H  11.298   5.801  31.546 1.00 . A A . 59 ILE HG21 1 1 
        7  8667 1 1 59 ILE HG22 H   9.537   5.904  31.545 1.00 . A A . 59 ILE HG22 1 1 
        7  8668 1 1 59 ILE HG23 H  10.363   4.931  32.763 1.00 . A A . 59 ILE HG23 1 1 
        7  8669 1 1 59 ILE N    N  10.834   9.487  33.100 1.00 . A A . 59 ILE N    1 1 
        7  8670 1 1 59 ILE O    O  10.534   8.073  29.940 1.00 . A A . 59 ILE O    1 1 
        7  8671 1 1 60 TYR C    C   8.624   9.961  28.933 1.00 . A A . 60 TYR C    1 1 
        7  8672 1 1 60 TYR CA   C   7.981   9.136  30.048 1.00 . A A . 60 TYR CA   1 1 
        7  8673 1 1 60 TYR CB   C   6.688   9.807  30.507 1.00 . A A . 60 TYR CB   1 1 
        7  8674 1 1 60 TYR CD1  C   4.931   8.707  29.078 1.00 . A A . 60 TYR CD1  1 1 
        7  8675 1 1 60 TYR CD2  C   5.617  10.973  28.553 1.00 . A A . 60 TYR CD2  1 1 
        7  8676 1 1 60 TYR CE1  C   4.039   8.727  28.000 1.00 . A A . 60 TYR CE1  1 1 
        7  8677 1 1 60 TYR CE2  C   4.725  10.993  27.474 1.00 . A A . 60 TYR CE2  1 1 
        7  8678 1 1 60 TYR CG   C   5.720   9.830  29.355 1.00 . A A . 60 TYR CG   1 1 
        7  8679 1 1 60 TYR CZ   C   3.936   9.870  27.197 1.00 . A A . 60 TYR CZ   1 1 
        7  8680 1 1 60 TYR H    H   8.541   9.195  32.072 1.00 . A A . 60 TYR H    1 1 
        7  8681 1 1 60 TYR HA   H   7.735   8.168  29.644 1.00 . A A . 60 TYR HA   1 1 
        7  8682 1 1 60 TYR HB2  H   6.262   9.249  31.329 1.00 . A A . 60 TYR HB2  1 1 
        7  8683 1 1 60 TYR HB3  H   6.897  10.818  30.824 1.00 . A A . 60 TYR HB3  1 1 
        7  8684 1 1 60 TYR HD1  H   5.011   7.825  29.696 1.00 . A A . 60 TYR HD1  1 1 
        7  8685 1 1 60 TYR HD2  H   6.225  11.839  28.767 1.00 . A A . 60 TYR HD2  1 1 
        7  8686 1 1 60 TYR HE1  H   3.431   7.860  27.786 1.00 . A A . 60 TYR HE1  1 1 
        7  8687 1 1 60 TYR HE2  H   4.649  11.874  26.858 1.00 . A A . 60 TYR HE2  1 1 
        7  8688 1 1 60 TYR HH   H   3.274   9.143  25.563 1.00 . A A . 60 TYR HH   1 1 
        7  8689 1 1 60 TYR N    N   8.881   8.963  31.182 1.00 . A A . 60 TYR N    1 1 
        7  8690 1 1 60 TYR O    O   8.392   9.701  27.754 1.00 . A A . 60 TYR O    1 1 
        7  8691 1 1 60 TYR OH   O   3.057   9.882  26.135 1.00 . A A . 60 TYR OH   1 1 
        7  8692 1 1 61 ALA C    C  11.228  10.983  27.573 1.00 . A A . 61 ALA C    1 1 
        7  8693 1 1 61 ALA CA   C  10.124  11.767  28.295 1.00 . A A . 61 ALA CA   1 1 
        7  8694 1 1 61 ALA CB   C  10.729  12.999  28.972 1.00 . A A . 61 ALA CB   1 1 
        7  8695 1 1 61 ALA H    H   9.643  11.148  30.221 1.00 . A A . 61 ALA H    1 1 
        7  8696 1 1 61 ALA HA   H   9.469  12.092  27.511 1.00 . A A . 61 ALA HA   1 1 
        7  8697 1 1 61 ALA HB1  H   9.960  13.522  29.522 1.00 . A A . 61 ALA HB1  1 1 
        7  8698 1 1 61 ALA HB2  H  11.144  13.654  28.221 1.00 . A A . 61 ALA HB2  1 1 
        7  8699 1 1 61 ALA HB3  H  11.510  12.689  29.651 1.00 . A A . 61 ALA HB3  1 1 
        7  8700 1 1 61 ALA N    N   9.439  10.944  29.284 1.00 . A A . 61 ALA N    1 1 
        7  8701 1 1 61 ALA O    O  11.553  11.296  26.431 1.00 . A A . 61 ALA O    1 1 
        7  8702 1 1 62 ILE C    C  12.303   8.238  26.468 1.00 . A A . 62 ILE C    1 1 
        7  8703 1 1 62 ILE CA   C  12.843   9.165  27.573 1.00 . A A . 62 ILE CA   1 1 
        7  8704 1 1 62 ILE CB   C  13.565   8.327  28.635 1.00 . A A . 62 ILE CB   1 1 
        7  8705 1 1 62 ILE CD1  C  14.833   8.475  30.803 1.00 . A A . 62 ILE CD1  1 1 
        7  8706 1 1 62 ILE CG1  C  14.296   9.266  29.604 1.00 . A A . 62 ILE CG1  1 1 
        7  8707 1 1 62 ILE CG2  C  14.584   7.401  27.962 1.00 . A A . 62 ILE CG2  1 1 
        7  8708 1 1 62 ILE H    H  11.460   9.706  29.095 1.00 . A A . 62 ILE H    1 1 
        7  8709 1 1 62 ILE HA   H  13.562   9.837  27.134 1.00 . A A . 62 ILE HA   1 1 
        7  8710 1 1 62 ILE HB   H  12.842   7.736  29.177 1.00 . A A . 62 ILE HB   1 1 
        7  8711 1 1 62 ILE HD11 H  15.739   7.963  30.519 1.00 . A A . 62 ILE HD11 1 1 
        7  8712 1 1 62 ILE HD12 H  14.097   7.753  31.124 1.00 . A A . 62 ILE HD12 1 1 
        7  8713 1 1 62 ILE HD13 H  15.045   9.155  31.615 1.00 . A A . 62 ILE HD13 1 1 
        7  8714 1 1 62 ILE HG12 H  15.120   9.740  29.090 1.00 . A A . 62 ILE HG12 1 1 
        7  8715 1 1 62 ILE HG13 H  13.611  10.023  29.954 1.00 . A A . 62 ILE HG13 1 1 
        7  8716 1 1 62 ILE HG21 H  15.253   6.996  28.706 1.00 . A A . 62 ILE HG21 1 1 
        7  8717 1 1 62 ILE HG22 H  15.152   7.960  27.233 1.00 . A A . 62 ILE HG22 1 1 
        7  8718 1 1 62 ILE HG23 H  14.064   6.592  27.468 1.00 . A A . 62 ILE HG23 1 1 
        7  8719 1 1 62 ILE N    N  11.791   9.967  28.211 1.00 . A A . 62 ILE N    1 1 
        7  8720 1 1 62 ILE O    O  12.915   8.088  25.410 1.00 . A A . 62 ILE O    1 1 
        7  8721 1 1 63 GLN C    C   9.987   7.422  24.539 1.00 . A A . 63 GLN C    1 1 
        7  8722 1 1 63 GLN CA   C  10.533   6.699  25.780 1.00 . A A . 63 GLN CA   1 1 
        7  8723 1 1 63 GLN CB   C   9.391   5.923  26.452 1.00 . A A . 63 GLN CB   1 1 
        7  8724 1 1 63 GLN CD   C   7.273   6.185  27.785 1.00 . A A . 63 GLN CD   1 1 
        7  8725 1 1 63 GLN CG   C   8.408   6.915  27.073 1.00 . A A . 63 GLN CG   1 1 
        7  8726 1 1 63 GLN H    H  10.726   7.851  27.589 1.00 . A A . 63 GLN H    1 1 
        7  8727 1 1 63 GLN HA   H  11.277   5.991  25.446 1.00 . A A . 63 GLN HA   1 1 
        7  8728 1 1 63 GLN HB2  H   8.881   5.321  25.715 1.00 . A A . 63 GLN HB2  1 1 
        7  8729 1 1 63 GLN HB3  H   9.794   5.286  27.224 1.00 . A A . 63 GLN HB3  1 1 
        7  8730 1 1 63 GLN HE21 H   8.231   6.085  29.522 1.00 . A A . 63 GLN HE21 1 1 
        7  8731 1 1 63 GLN HE22 H   6.683   5.391  29.506 1.00 . A A . 63 GLN HE22 1 1 
        7  8732 1 1 63 GLN HG2  H   8.940   7.516  27.786 1.00 . A A . 63 GLN HG2  1 1 
        7  8733 1 1 63 GLN HG3  H   7.997   7.549  26.303 1.00 . A A . 63 GLN HG3  1 1 
        7  8734 1 1 63 GLN N    N  11.159   7.621  26.740 1.00 . A A . 63 GLN N    1 1 
        7  8735 1 1 63 GLN NE2  N   7.407   5.860  29.042 1.00 . A A . 63 GLN NE2  1 1 
        7  8736 1 1 63 GLN O    O  10.083   6.906  23.426 1.00 . A A . 63 GLN O    1 1 
        7  8737 1 1 63 GLN OE1  O   6.220   5.948  27.195 1.00 . A A . 63 GLN OE1  1 1 
        7  8738 1 1 64 ARG C    C   9.972  10.160  22.856 1.00 . A A . 64 ARG C    1 1 
        7  8739 1 1 64 ARG CA   C   8.880   9.423  23.641 1.00 . A A . 64 ARG CA   1 1 
        7  8740 1 1 64 ARG CB   C   7.872  10.437  24.200 1.00 . A A . 64 ARG CB   1 1 
        7  8741 1 1 64 ARG CD   C   7.633  12.435  25.684 1.00 . A A . 64 ARG CD   1 1 
        7  8742 1 1 64 ARG CG   C   8.612  11.601  24.855 1.00 . A A . 64 ARG CG   1 1 
        7  8743 1 1 64 ARG CZ   C   7.623  14.558  26.868 1.00 . A A . 64 ARG CZ   1 1 
        7  8744 1 1 64 ARG H    H   9.412   9.015  25.623 1.00 . A A . 64 ARG H    1 1 
        7  8745 1 1 64 ARG HA   H   8.351   8.759  22.975 1.00 . A A . 64 ARG HA   1 1 
        7  8746 1 1 64 ARG HB2  H   7.256  10.809  23.395 1.00 . A A . 64 ARG HB2  1 1 
        7  8747 1 1 64 ARG HB3  H   7.247   9.952  24.935 1.00 . A A . 64 ARG HB3  1 1 
        7  8748 1 1 64 ARG HD2  H   6.772  12.681  25.082 1.00 . A A . 64 ARG HD2  1 1 
        7  8749 1 1 64 ARG HD3  H   7.315  11.864  26.544 1.00 . A A . 64 ARG HD3  1 1 
        7  8750 1 1 64 ARG HE   H   9.204  13.845  25.872 1.00 . A A . 64 ARG HE   1 1 
        7  8751 1 1 64 ARG HG2  H   9.395  11.212  25.482 1.00 . A A . 64 ARG HG2  1 1 
        7  8752 1 1 64 ARG HG3  H   9.046  12.228  24.090 1.00 . A A . 64 ARG HG3  1 1 
        7  8753 1 1 64 ARG HH11 H   5.939  13.478  26.957 1.00 . A A . 64 ARG HH11 1 1 
        7  8754 1 1 64 ARG HH12 H   5.900  14.997  27.788 1.00 . A A . 64 ARG HH12 1 1 
        7  8755 1 1 64 ARG HH21 H   9.157  15.842  26.949 1.00 . A A . 64 ARG HH21 1 1 
        7  8756 1 1 64 ARG HH22 H   7.722  16.336  27.784 1.00 . A A . 64 ARG HH22 1 1 
        7  8757 1 1 64 ARG N    N   9.431   8.610  24.731 1.00 . A A . 64 ARG N    1 1 
        7  8758 1 1 64 ARG NE   N   8.276  13.666  26.131 1.00 . A A . 64 ARG NE   1 1 
        7  8759 1 1 64 ARG NH1  N   6.391  14.326  27.233 1.00 . A A . 64 ARG NH1  1 1 
        7  8760 1 1 64 ARG NH2  N   8.213  15.665  27.228 1.00 . A A . 64 ARG NH2  1 1 
        7  8761 1 1 64 ARG O    O   9.749  10.621  21.738 1.00 . A A . 64 ARG O    1 1 
        7  8762 1 1 65 LYS C    C  12.916  10.234  21.744 1.00 . A A . 65 LYS C    1 1 
        7  8763 1 1 65 LYS CA   C  12.267  11.017  22.891 1.00 . A A . 65 LYS CA   1 1 
        7  8764 1 1 65 LYS CB   C  13.338  11.265  23.994 1.00 . A A . 65 LYS CB   1 1 
        7  8765 1 1 65 LYS CD   C  14.024  12.844  25.859 1.00 . A A . 65 LYS CD   1 1 
        7  8766 1 1 65 LYS CE   C  15.518  12.722  25.538 1.00 . A A . 65 LYS CE   1 1 
        7  8767 1 1 65 LYS CG   C  13.184  12.684  24.581 1.00 . A A . 65 LYS CG   1 1 
        7  8768 1 1 65 LYS H    H  11.261   9.831  24.338 1.00 . A A . 65 LYS H    1 1 
        7  8769 1 1 65 LYS HA   H  11.890  11.985  22.592 1.00 . A A . 65 LYS HA   1 1 
        7  8770 1 1 65 LYS HB2  H  13.210  10.540  24.782 1.00 . A A . 65 LYS HB2  1 1 
        7  8771 1 1 65 LYS HB3  H  14.328  11.163  23.572 1.00 . A A . 65 LYS HB3  1 1 
        7  8772 1 1 65 LYS HD2  H  13.832  13.817  26.289 1.00 . A A . 65 LYS HD2  1 1 
        7  8773 1 1 65 LYS HD3  H  13.748  12.082  26.568 1.00 . A A . 65 LYS HD3  1 1 
        7  8774 1 1 65 LYS HE2  H  15.747  11.702  25.275 1.00 . A A . 65 LYS HE2  1 1 
        7  8775 1 1 65 LYS HE3  H  15.769  13.375  24.716 1.00 . A A . 65 LYS HE3  1 1 
        7  8776 1 1 65 LYS HG2  H  13.517  13.406  23.849 1.00 . A A . 65 LYS HG2  1 1 
        7  8777 1 1 65 LYS HG3  H  12.146  12.867  24.811 1.00 . A A . 65 LYS HG3  1 1 
        7  8778 1 1 65 LYS HZ1  H  15.743  13.720  27.353 1.00 . A A . 65 LYS HZ1  1 1 
        7  8779 1 1 65 LYS HZ2  H  17.172  13.606  26.441 1.00 . A A . 65 LYS HZ2  1 1 
        7  8780 1 1 65 LYS HZ3  H  16.577  12.245  27.267 1.00 . A A . 65 LYS HZ3  1 1 
        7  8781 1 1 65 LYS N    N  11.137  10.298  23.485 1.00 . A A . 65 LYS N    1 1 
        7  8782 1 1 65 LYS NZ   N  16.312  13.102  26.741 1.00 . A A . 65 LYS NZ   1 1 
        7  8783 1 1 65 LYS O    O  13.393  10.804  20.763 1.00 . A A . 65 LYS O    1 1 
        7  8784 1 1 66 ARG C    C  12.162   8.181  19.665 1.00 . A A . 66 ARG C    1 1 
        7  8785 1 1 66 ARG CA   C  13.250   8.085  20.731 1.00 . A A . 66 ARG CA   1 1 
        7  8786 1 1 66 ARG CB   C  13.448   6.634  21.179 1.00 . A A . 66 ARG CB   1 1 
        7  8787 1 1 66 ARG CD   C  14.669   5.161  22.796 1.00 . A A . 66 ARG CD   1 1 
        7  8788 1 1 66 ARG CG   C  14.484   6.597  22.304 1.00 . A A . 66 ARG CG   1 1 
        7  8789 1 1 66 ARG CZ   C  15.658   3.086  22.017 1.00 . A A . 66 ARG CZ   1 1 
        7  8790 1 1 66 ARG H    H  12.143   8.613  22.512 1.00 . A A . 66 ARG H    1 1 
        7  8791 1 1 66 ARG HA   H  14.167   8.473  20.307 1.00 . A A . 66 ARG HA   1 1 
        7  8792 1 1 66 ARG HB2  H  12.509   6.236  21.538 1.00 . A A . 66 ARG HB2  1 1 
        7  8793 1 1 66 ARG HB3  H  13.799   6.043  20.347 1.00 . A A . 66 ARG HB3  1 1 
        7  8794 1 1 66 ARG HD2  H  15.250   5.168  23.705 1.00 . A A . 66 ARG HD2  1 1 
        7  8795 1 1 66 ARG HD3  H  13.701   4.726  22.996 1.00 . A A . 66 ARG HD3  1 1 
        7  8796 1 1 66 ARG HE   H  15.624   4.776  20.942 1.00 . A A . 66 ARG HE   1 1 
        7  8797 1 1 66 ARG HG2  H  15.427   6.975  21.935 1.00 . A A . 66 ARG HG2  1 1 
        7  8798 1 1 66 ARG HG3  H  14.146   7.213  23.122 1.00 . A A . 66 ARG HG3  1 1 
        7  8799 1 1 66 ARG HH11 H  14.797   3.048  23.825 1.00 . A A . 66 ARG HH11 1 1 
        7  8800 1 1 66 ARG HH12 H  15.519   1.561  23.307 1.00 . A A . 66 ARG HH12 1 1 
        7  8801 1 1 66 ARG HH21 H  16.586   2.831  20.262 1.00 . A A . 66 ARG HH21 1 1 
        7  8802 1 1 66 ARG HH22 H  16.532   1.438  21.290 1.00 . A A . 66 ARG HH22 1 1 
        7  8803 1 1 66 ARG N    N  12.795   8.913  21.845 1.00 . A A . 66 ARG N    1 1 
        7  8804 1 1 66 ARG NE   N  15.362   4.362  21.791 1.00 . A A . 66 ARG NE   1 1 
        7  8805 1 1 66 ARG NH1  N  15.296   2.522  23.137 1.00 . A A . 66 ARG NH1  1 1 
        7  8806 1 1 66 ARG NH2  N  16.309   2.398  21.120 1.00 . A A . 66 ARG NH2  1 1 
        7  8807 1 1 66 ARG O    O  12.405   8.619  18.540 1.00 . A A . 66 ARG O    1 1 
        7  8808 1 1 67 GLN C    C   9.438   9.161  18.705 1.00 . A A . 67 GLN C    1 1 
        7  8809 1 1 67 GLN CA   C   9.801   7.750  19.160 1.00 . A A . 67 GLN CA   1 1 
        7  8810 1 1 67 GLN CB   C   8.610   7.139  19.906 1.00 . A A . 67 GLN CB   1 1 
        7  8811 1 1 67 GLN CD   C   7.719   4.996  20.875 1.00 . A A . 67 GLN CD   1 1 
        7  8812 1 1 67 GLN CG   C   8.892   5.656  20.156 1.00 . A A . 67 GLN CG   1 1 
        7  8813 1 1 67 GLN H    H  10.880   7.301  20.910 1.00 . A A . 67 GLN H    1 1 
        7  8814 1 1 67 GLN HA   H  10.024   7.109  18.319 1.00 . A A . 67 GLN HA   1 1 
        7  8815 1 1 67 GLN HB2  H   8.474   7.650  20.848 1.00 . A A . 67 GLN HB2  1 1 
        7  8816 1 1 67 GLN HB3  H   7.718   7.240  19.305 1.00 . A A . 67 GLN HB3  1 1 
        7  8817 1 1 67 GLN HE21 H   8.535   3.187  20.812 1.00 . A A . 67 GLN HE21 1 1 
        7  8818 1 1 67 GLN HE22 H   7.016   3.271  21.563 1.00 . A A . 67 GLN HE22 1 1 
        7  8819 1 1 67 GLN HG2  H   9.053   5.161  19.211 1.00 . A A . 67 GLN HG2  1 1 
        7  8820 1 1 67 GLN HG3  H   9.779   5.561  20.764 1.00 . A A . 67 GLN HG3  1 1 
        7  8821 1 1 67 GLN N    N  10.964   7.751  20.043 1.00 . A A . 67 GLN N    1 1 
        7  8822 1 1 67 GLN NE2  N   7.760   3.711  21.102 1.00 . A A . 67 GLN NE2  1 1 
        7  8823 1 1 67 GLN O    O   8.621   9.347  17.807 1.00 . A A . 67 GLN O    1 1 
        7  8824 1 1 67 GLN OE1  O   6.742   5.656  21.230 1.00 . A A . 67 GLN OE1  1 1 
        7  8825 1 1 68 ALA C    C   9.654  11.752  17.593 1.00 . A A . 68 ALA C    1 1 
        7  8826 1 1 68 ALA CA   C   9.687  11.547  19.114 1.00 . A A . 68 ALA CA   1 1 
        7  8827 1 1 68 ALA CB   C  10.772  12.451  19.714 1.00 . A A . 68 ALA CB   1 1 
        7  8828 1 1 68 ALA H    H  10.611   9.871  20.116 1.00 . A A . 68 ALA H    1 1 
        7  8829 1 1 68 ALA HA   H   8.745  11.777  19.590 1.00 . A A . 68 ALA HA   1 1 
        7  8830 1 1 68 ALA HB1  H  10.589  12.583  20.769 1.00 . A A . 68 ALA HB1  1 1 
        7  8831 1 1 68 ALA HB2  H  10.756  13.415  19.226 1.00 . A A . 68 ALA HB2  1 1 
        7  8832 1 1 68 ALA HB3  H  11.740  11.992  19.574 1.00 . A A . 68 ALA HB3  1 1 
        7  8833 1 1 68 ALA N    N  10.009  10.144  19.394 1.00 . A A . 68 ALA N    1 1 
        7  8834 1 1 68 ALA O    O   8.765  12.418  17.061 1.00 . A A . 68 ALA O    1 1 
        7  8835 1 1 69 ASP C    C   9.248  10.671  14.917 1.00 . A A . 69 ASP C    1 1 
        7  8836 1 1 69 ASP CA   C  10.605  11.139  15.440 1.00 . A A . 69 ASP CA   1 1 
        7  8837 1 1 69 ASP CB   C  11.692  10.177  14.930 1.00 . A A . 69 ASP CB   1 1 
        7  8838 1 1 69 ASP CG   C  11.551   8.811  15.597 1.00 . A A . 69 ASP CG   1 1 
        7  8839 1 1 69 ASP H    H  11.229  10.549  17.399 1.00 . A A . 69 ASP H    1 1 
        7  8840 1 1 69 ASP HA   H  10.807  12.113  15.015 1.00 . A A . 69 ASP HA   1 1 
        7  8841 1 1 69 ASP HB2  H  11.594  10.063  13.860 1.00 . A A . 69 ASP HB2  1 1 
        7  8842 1 1 69 ASP HB3  H  12.666  10.585  15.157 1.00 . A A . 69 ASP HB3  1 1 
        7  8843 1 1 69 ASP N    N  10.587  11.098  16.902 1.00 . A A . 69 ASP N    1 1 
        7  8844 1 1 69 ASP O    O   8.574  11.400  14.190 1.00 . A A . 69 ASP O    1 1 
        7  8845 1 1 69 ASP OD1  O  10.840   8.735  16.585 1.00 . A A . 69 ASP OD1  1 1 
        7  8846 1 1 69 ASP OD2  O  12.158   7.867  15.120 1.00 . A A . 69 ASP OD2  1 1 
        7  8847 1 1 70 ALA C    C   6.410   9.780  15.335 1.00 . A A . 70 ALA C    1 1 
        7  8848 1 1 70 ALA CA   C   7.567   8.918  14.837 1.00 . A A . 70 ALA CA   1 1 
        7  8849 1 1 70 ALA CB   C   7.397   7.487  15.351 1.00 . A A . 70 ALA CB   1 1 
        7  8850 1 1 70 ALA H    H   9.446   8.894  15.811 1.00 . A A . 70 ALA H    1 1 
        7  8851 1 1 70 ALA HA   H   7.552   8.902  13.757 1.00 . A A . 70 ALA HA   1 1 
        7  8852 1 1 70 ALA HB1  H   7.221   7.506  16.416 1.00 . A A . 70 ALA HB1  1 1 
        7  8853 1 1 70 ALA HB2  H   8.294   6.921  15.144 1.00 . A A . 70 ALA HB2  1 1 
        7  8854 1 1 70 ALA HB3  H   6.557   7.024  14.854 1.00 . A A . 70 ALA HB3  1 1 
        7  8855 1 1 70 ALA N    N   8.848   9.458  15.283 1.00 . A A . 70 ALA N    1 1 
        7  8856 1 1 70 ALA O    O   5.438  10.006  14.616 1.00 . A A . 70 ALA O    1 1 
        7  8857 1 1 71 SER C    C   4.189  10.282  17.329 1.00 . A A . 71 SER C    1 1 
        7  8858 1 1 71 SER CA   C   5.478  11.081  17.166 1.00 . A A . 71 SER CA   1 1 
        7  8859 1 1 71 SER CB   C   5.220  12.309  16.288 1.00 . A A . 71 SER CB   1 1 
        7  8860 1 1 71 SER H    H   7.316  10.033  17.099 1.00 . A A . 71 SER H    1 1 
        7  8861 1 1 71 SER HA   H   5.808  11.414  18.139 1.00 . A A . 71 SER HA   1 1 
        7  8862 1 1 71 SER HB2  H   6.157  12.691  15.916 1.00 . A A . 71 SER HB2  1 1 
        7  8863 1 1 71 SER HB3  H   4.591  12.032  15.452 1.00 . A A . 71 SER HB3  1 1 
        7  8864 1 1 71 SER HG   H   3.648  13.100  17.119 1.00 . A A . 71 SER HG   1 1 
        7  8865 1 1 71 SER N    N   6.520  10.252  16.573 1.00 . A A . 71 SER N    1 1 
        7  8866 1 1 71 SER O    O   3.109  10.744  16.961 1.00 . A A . 71 SER O    1 1 
        7  8867 1 1 71 SER OG   O   4.583  13.315  17.065 1.00 . A A . 71 SER OG   1 1 
        7  8868 1 1 72 SER C    C   2.476   7.901  16.764 1.00 . A A . 72 SER C    1 1 
        7  8869 1 1 72 SER CA   C   3.155   8.216  18.093 1.00 . A A . 72 SER CA   1 1 
        7  8870 1 1 72 SER CB   C   2.159   8.895  19.033 1.00 . A A . 72 SER CB   1 1 
        7  8871 1 1 72 SER H    H   5.201   8.766  18.155 1.00 . A A . 72 SER H    1 1 
        7  8872 1 1 72 SER HA   H   3.485   7.292  18.544 1.00 . A A . 72 SER HA   1 1 
        7  8873 1 1 72 SER HB2  H   1.687   9.721  18.528 1.00 . A A . 72 SER HB2  1 1 
        7  8874 1 1 72 SER HB3  H   1.404   8.180  19.334 1.00 . A A . 72 SER HB3  1 1 
        7  8875 1 1 72 SER HG   H   3.723   8.980  20.187 1.00 . A A . 72 SER HG   1 1 
        7  8876 1 1 72 SER N    N   4.313   9.079  17.884 1.00 . A A . 72 SER N    1 1 
        7  8877 1 1 72 SER O    O   2.320   8.776  15.913 1.00 . A A . 72 SER O    1 1 
        7  8878 1 1 72 SER OG   O   2.851   9.380  20.176 1.00 . A A . 72 SER OG   1 1 
        7  8879 1 1 73 THR C    C   0.472   5.034  15.625 1.00 . A A . 73 THR C    1 1 
        7  8880 1 1 73 THR CA   C   1.408   6.224  15.359 1.00 . A A . 73 THR CA   1 1 
        7  8881 1 1 73 THR CB   C   2.468   5.873  14.286 1.00 . A A . 73 THR CB   1 1 
        7  8882 1 1 73 THR CG2  C   2.649   7.040  13.304 1.00 . A A . 73 THR CG2  1 1 
        7  8883 1 1 73 THR H    H   2.221   5.991  17.305 1.00 . A A . 73 THR H    1 1 
        7  8884 1 1 73 THR HA   H   0.800   7.045  15.001 1.00 . A A . 73 THR HA   1 1 
        7  8885 1 1 73 THR HB   H   2.162   4.995  13.733 1.00 . A A . 73 THR HB   1 1 
        7  8886 1 1 73 THR HG1  H   4.283   6.377  14.773 1.00 . A A . 73 THR HG1  1 1 
        7  8887 1 1 73 THR HG21 H   3.023   7.903  13.835 1.00 . A A . 73 THR HG21 1 1 
        7  8888 1 1 73 THR HG22 H   1.697   7.281  12.852 1.00 . A A . 73 THR HG22 1 1 
        7  8889 1 1 73 THR HG23 H   3.352   6.758  12.534 1.00 . A A . 73 THR HG23 1 1 
        7  8890 1 1 73 THR N    N   2.071   6.644  16.592 1.00 . A A . 73 THR N    1 1 
        7  8891 1 1 73 THR O    O  -0.742   5.156  15.459 1.00 . A A . 73 THR O    1 1 
        7  8892 1 1 73 THR OG1  O   3.712   5.620  14.924 1.00 . A A . 73 THR OG1  1 1 
        7  8893 1 1 74 PRO C    C  -0.756   2.916  17.538 1.00 . A A . 74 PRO C    1 1 
        7  8894 1 1 74 PRO CA   C   0.146   2.701  16.322 1.00 . A A . 74 PRO CA   1 1 
        7  8895 1 1 74 PRO CB   C   1.177   1.588  16.581 1.00 . A A . 74 PRO CB   1 1 
        7  8896 1 1 74 PRO CD   C   2.421   3.622  16.269 1.00 . A A . 74 PRO CD   1 1 
        7  8897 1 1 74 PRO CG   C   2.395   2.312  17.052 1.00 . A A . 74 PRO CG   1 1 
        7  8898 1 1 74 PRO HA   H  -0.450   2.450  15.459 1.00 . A A . 74 PRO HA   1 1 
        7  8899 1 1 74 PRO HB2  H   0.821   0.903  17.341 1.00 . A A . 74 PRO HB2  1 1 
        7  8900 1 1 74 PRO HB3  H   1.394   1.056  15.667 1.00 . A A . 74 PRO HB3  1 1 
        7  8901 1 1 74 PRO HD2  H   2.884   4.404  16.853 1.00 . A A . 74 PRO HD2  1 1 
        7  8902 1 1 74 PRO HD3  H   2.932   3.486  15.330 1.00 . A A . 74 PRO HD3  1 1 
        7  8903 1 1 74 PRO HG2  H   2.325   2.508  18.115 1.00 . A A . 74 PRO HG2  1 1 
        7  8904 1 1 74 PRO HG3  H   3.284   1.737  16.836 1.00 . A A . 74 PRO HG3  1 1 
        7  8905 1 1 74 PRO N    N   0.991   3.901  16.036 1.00 . A A . 74 PRO N    1 1 
        7  8906 1 1 74 PRO O    O  -0.391   3.620  18.480 1.00 . A A . 74 PRO O    1 1 
        7  8907 1 1 75 LYS C    C  -2.296   1.891  19.896 1.00 . A A . 75 LYS C    1 1 
        7  8908 1 1 75 LYS CA   C  -2.890   2.439  18.601 1.00 . A A . 75 LYS CA   1 1 
        7  8909 1 1 75 LYS CB   C  -4.179   1.684  18.258 1.00 . A A . 75 LYS CB   1 1 
        7  8910 1 1 75 LYS CD   C  -6.493   1.118  19.013 1.00 . A A . 75 LYS CD   1 1 
        7  8911 1 1 75 LYS CE   C  -7.515   1.272  20.141 1.00 . A A . 75 LYS CE   1 1 
        7  8912 1 1 75 LYS CG   C  -5.201   1.846  19.388 1.00 . A A . 75 LYS CG   1 1 
        7  8913 1 1 75 LYS H    H  -2.174   1.761  16.725 1.00 . A A . 75 LYS H    1 1 
        7  8914 1 1 75 LYS HA   H  -3.124   3.483  18.738 1.00 . A A . 75 LYS HA   1 1 
        7  8915 1 1 75 LYS HB2  H  -4.592   2.079  17.341 1.00 . A A . 75 LYS HB2  1 1 
        7  8916 1 1 75 LYS HB3  H  -3.956   0.635  18.128 1.00 . A A . 75 LYS HB3  1 1 
        7  8917 1 1 75 LYS HD2  H  -6.893   1.543  18.103 1.00 . A A . 75 LYS HD2  1 1 
        7  8918 1 1 75 LYS HD3  H  -6.285   0.071  18.859 1.00 . A A . 75 LYS HD3  1 1 
        7  8919 1 1 75 LYS HE2  H  -7.116   0.841  21.048 1.00 . A A . 75 LYS HE2  1 1 
        7  8920 1 1 75 LYS HE3  H  -7.719   2.321  20.300 1.00 . A A . 75 LYS HE3  1 1 
        7  8921 1 1 75 LYS HG2  H  -4.804   1.424  20.300 1.00 . A A . 75 LYS HG2  1 1 
        7  8922 1 1 75 LYS HG3  H  -5.411   2.894  19.537 1.00 . A A . 75 LYS HG3  1 1 
        7  8923 1 1 75 LYS HZ1  H  -9.210   1.049  18.953 1.00 . A A . 75 LYS HZ1  1 1 
        7  8924 1 1 75 LYS HZ2  H  -9.434   0.591  20.574 1.00 . A A . 75 LYS HZ2  1 1 
        7  8925 1 1 75 LYS HZ3  H  -8.563  -0.415  19.516 1.00 . A A . 75 LYS HZ3  1 1 
        7  8926 1 1 75 LYS N    N  -1.937   2.308  17.504 1.00 . A A . 75 LYS N    1 1 
        7  8927 1 1 75 LYS NZ   N  -8.775   0.572  19.768 1.00 . A A . 75 LYS NZ   1 1 
        7  8928 1 1 75 LYS O    O  -2.416   2.508  20.954 1.00 . A A . 75 LYS O    1 1 
        7  8929 1 1 76 PHE C    C   0.045  -0.867  20.567 1.00 . A A . 76 PHE C    1 1 
        7  8930 1 1 76 PHE CA   C  -1.061   0.100  20.980 1.00 . A A . 76 PHE CA   1 1 
        7  8931 1 1 76 PHE CB   C  -2.133  -0.653  21.771 1.00 . A A . 76 PHE CB   1 1 
        7  8932 1 1 76 PHE CD1  C  -1.448  -0.177  24.149 1.00 . A A . 76 PHE CD1  1 1 
        7  8933 1 1 76 PHE CD2  C  -1.174  -2.427  23.287 1.00 . A A . 76 PHE CD2  1 1 
        7  8934 1 1 76 PHE CE1  C  -0.931  -0.587  25.384 1.00 . A A . 76 PHE CE1  1 1 
        7  8935 1 1 76 PHE CE2  C  -0.659  -2.837  24.522 1.00 . A A . 76 PHE CE2  1 1 
        7  8936 1 1 76 PHE CG   C  -1.569  -1.097  23.100 1.00 . A A . 76 PHE CG   1 1 
        7  8937 1 1 76 PHE CZ   C  -0.536  -1.917  25.571 1.00 . A A . 76 PHE CZ   1 1 
        7  8938 1 1 76 PHE H    H  -1.602   0.275  18.938 1.00 . A A . 76 PHE H    1 1 
        7  8939 1 1 76 PHE HA   H  -0.637   0.867  21.611 1.00 . A A . 76 PHE HA   1 1 
        7  8940 1 1 76 PHE HB2  H  -2.979  -0.001  21.939 1.00 . A A . 76 PHE HB2  1 1 
        7  8941 1 1 76 PHE HB3  H  -2.453  -1.518  21.209 1.00 . A A . 76 PHE HB3  1 1 
        7  8942 1 1 76 PHE HD1  H  -1.751   0.849  24.004 1.00 . A A . 76 PHE HD1  1 1 
        7  8943 1 1 76 PHE HD2  H  -1.269  -3.138  22.479 1.00 . A A . 76 PHE HD2  1 1 
        7  8944 1 1 76 PHE HE1  H  -0.837   0.123  26.192 1.00 . A A . 76 PHE HE1  1 1 
        7  8945 1 1 76 PHE HE2  H  -0.354  -3.864  24.666 1.00 . A A . 76 PHE HE2  1 1 
        7  8946 1 1 76 PHE HZ   H  -0.139  -2.233  26.523 1.00 . A A . 76 PHE HZ   1 1 
        7  8947 1 1 76 PHE N    N  -1.663   0.724  19.806 1.00 . A A . 76 PHE N    1 1 
        7  8948 1 1 76 PHE O    O   0.852  -1.292  21.393 1.00 . A A . 76 PHE O    1 1 
        7  8949 1 1 77 ASN C    C   1.066  -3.439  19.557 1.00 . A A . 77 ASN C    1 1 
        7  8950 1 1 77 ASN CA   C   1.080  -2.132  18.771 1.00 . A A . 77 ASN CA   1 1 
        7  8951 1 1 77 ASN CB   C   2.469  -1.494  18.865 1.00 . A A . 77 ASN CB   1 1 
        7  8952 1 1 77 ASN CG   C   3.455  -2.261  17.990 1.00 . A A . 77 ASN CG   1 1 
        7  8953 1 1 77 ASN H    H  -0.600  -0.843  18.672 1.00 . A A . 77 ASN H    1 1 
        7  8954 1 1 77 ASN HA   H   0.864  -2.345  17.734 1.00 . A A . 77 ASN HA   1 1 
        7  8955 1 1 77 ASN HB2  H   2.415  -0.469  18.531 1.00 . A A . 77 ASN HB2  1 1 
        7  8956 1 1 77 ASN HB3  H   2.806  -1.520  19.891 1.00 . A A . 77 ASN HB3  1 1 
        7  8957 1 1 77 ASN HD21 H   4.967  -2.058  19.263 1.00 . A A . 77 ASN HD21 1 1 
        7  8958 1 1 77 ASN HD22 H   5.324  -2.917  17.843 1.00 . A A . 77 ASN HD22 1 1 
        7  8959 1 1 77 ASN N    N   0.072  -1.212  19.283 1.00 . A A . 77 ASN N    1 1 
        7  8960 1 1 77 ASN ND2  N   4.683  -2.426  18.399 1.00 . A A . 77 ASN ND2  1 1 
        7  8961 1 1 77 ASN O    O   2.117  -3.979  19.902 1.00 . A A . 77 ASN O    1 1 
        7  8962 1 1 77 ASN OD1  O   3.094  -2.734  16.913 1.00 . A A . 77 ASN OD1  1 1 
        7  8963 1 1 78 GLY C    C  -0.394  -6.383  19.627 1.00 . A A . 78 GLY C    1 1 
        7  8964 1 1 78 GLY CA   C  -0.279  -5.198  20.580 1.00 . A A . 78 GLY CA   1 1 
        7  8965 1 1 78 GLY H    H  -0.937  -3.475  19.532 1.00 . A A . 78 GLY H    1 1 
        7  8966 1 1 78 GLY HA2  H   0.580  -5.340  21.223 1.00 . A A . 78 GLY HA2  1 1 
        7  8967 1 1 78 GLY HA3  H  -1.171  -5.147  21.186 1.00 . A A . 78 GLY HA3  1 1 
        7  8968 1 1 78 GLY N    N  -0.133  -3.948  19.835 1.00 . A A . 78 GLY N    1 1 
        7  8969 1 1 78 GLY O    O  -1.104  -6.317  18.623 1.00 . A A . 78 GLY O    1 1 
        7  8970 1 1 79 VAL C    C  -1.143  -9.225  19.048 1.00 . A A . 79 VAL C    1 1 
        7  8971 1 1 79 VAL CA   C   0.275  -8.659  19.109 1.00 . A A . 79 VAL CA   1 1 
        7  8972 1 1 79 VAL CB   C   1.236  -9.713  19.670 1.00 . A A . 79 VAL CB   1 1 
        7  8973 1 1 79 VAL CG1  C   1.050 -11.039  18.923 1.00 . A A . 79 VAL CG1  1 1 
        7  8974 1 1 79 VAL CG2  C   2.676  -9.230  19.494 1.00 . A A . 79 VAL CG2  1 1 
        7  8975 1 1 79 VAL H    H   0.857  -7.462  20.758 1.00 . A A . 79 VAL H    1 1 
        7  8976 1 1 79 VAL HA   H   0.590  -8.394  18.110 1.00 . A A . 79 VAL HA   1 1 
        7  8977 1 1 79 VAL HB   H   1.031  -9.862  20.720 1.00 . A A . 79 VAL HB   1 1 
        7  8978 1 1 79 VAL HG11 H   1.882 -11.693  19.139 1.00 . A A . 79 VAL HG11 1 1 
        7  8979 1 1 79 VAL HG12 H   1.006 -10.851  17.861 1.00 . A A . 79 VAL HG12 1 1 
        7  8980 1 1 79 VAL HG13 H   0.131 -11.507  19.244 1.00 . A A . 79 VAL HG13 1 1 
        7  8981 1 1 79 VAL HG21 H   2.761  -8.213  19.847 1.00 . A A . 79 VAL HG21 1 1 
        7  8982 1 1 79 VAL HG22 H   2.944  -9.270  18.447 1.00 . A A . 79 VAL HG22 1 1 
        7  8983 1 1 79 VAL HG23 H   3.341  -9.866  20.060 1.00 . A A . 79 VAL HG23 1 1 
        7  8984 1 1 79 VAL N    N   0.308  -7.465  19.947 1.00 . A A . 79 VAL N    1 1 
        7  8985 1 1 79 VAL O    O  -1.636  -9.574  17.975 1.00 . A A . 79 VAL O    1 1 
        7  8986 1 1 80 LYS C    C  -4.162  -8.717  20.024 1.00 . A A . 80 LYS C    1 1 
        7  8987 1 1 80 LYS CA   C  -3.154  -9.833  20.277 1.00 . A A . 80 LYS CA   1 1 
        7  8988 1 1 80 LYS CB   C  -3.409 -10.440  21.663 1.00 . A A . 80 LYS CB   1 1 
        7  8989 1 1 80 LYS CD   C  -2.555 -12.750  21.102 1.00 . A A . 80 LYS CD   1 1 
        7  8990 1 1 80 LYS CE   C  -1.687 -13.893  21.632 1.00 . A A . 80 LYS CE   1 1 
        7  8991 1 1 80 LYS CG   C  -2.358 -11.513  21.987 1.00 . A A . 80 LYS CG   1 1 
        7  8992 1 1 80 LYS H    H  -1.348  -9.014  21.028 1.00 . A A . 80 LYS H    1 1 
        7  8993 1 1 80 LYS HA   H  -3.287 -10.595  19.527 1.00 . A A . 80 LYS HA   1 1 
        7  8994 1 1 80 LYS HB2  H  -3.361  -9.657  22.407 1.00 . A A . 80 LYS HB2  1 1 
        7  8995 1 1 80 LYS HB3  H  -4.391 -10.887  21.679 1.00 . A A . 80 LYS HB3  1 1 
        7  8996 1 1 80 LYS HD2  H  -3.593 -13.046  21.118 1.00 . A A . 80 LYS HD2  1 1 
        7  8997 1 1 80 LYS HD3  H  -2.257 -12.526  20.091 1.00 . A A . 80 LYS HD3  1 1 
        7  8998 1 1 80 LYS HE2  H  -1.781 -14.749  20.981 1.00 . A A . 80 LYS HE2  1 1 
        7  8999 1 1 80 LYS HE3  H  -0.654 -13.576  21.663 1.00 . A A . 80 LYS HE3  1 1 
        7  9000 1 1 80 LYS HG2  H  -1.371 -11.107  21.818 1.00 . A A . 80 LYS HG2  1 1 
        7  9001 1 1 80 LYS HG3  H  -2.452 -11.800  23.025 1.00 . A A . 80 LYS HG3  1 1 
        7  9002 1 1 80 LYS HZ1  H  -1.411 -13.975  23.695 1.00 . A A . 80 LYS HZ1  1 1 
        7  9003 1 1 80 LYS HZ2  H  -2.275 -15.292  23.058 1.00 . A A . 80 LYS HZ2  1 1 
        7  9004 1 1 80 LYS HZ3  H  -3.027 -13.777  23.221 1.00 . A A . 80 LYS HZ3  1 1 
        7  9005 1 1 80 LYS N    N  -1.792  -9.309  20.206 1.00 . A A . 80 LYS N    1 1 
        7  9006 1 1 80 LYS NZ   N  -2.134 -14.262  23.005 1.00 . A A . 80 LYS NZ   1 1 
        7  9007 1 1 80 LYS O    O  -3.922  -7.560  20.367 1.00 . A A . 80 LYS O    1 1 
        7  9008 1 1 81 LYS C    C  -5.742  -6.884  18.411 1.00 . A A . 81 LYS C    1 1 
        7  9009 1 1 81 LYS CA   C  -6.333  -8.094  19.130 1.00 . A A . 81 LYS CA   1 1 
        7  9010 1 1 81 LYS CB   C  -7.003  -7.642  20.427 1.00 . A A . 81 LYS CB   1 1 
        7  9011 1 1 81 LYS CD   C  -8.430  -8.367  22.348 1.00 . A A . 81 LYS CD   1 1 
        7  9012 1 1 81 LYS CE   C  -9.157  -9.552  22.985 1.00 . A A . 81 LYS CE   1 1 
        7  9013 1 1 81 LYS CG   C  -7.759  -8.818  21.049 1.00 . A A . 81 LYS CG   1 1 
        7  9014 1 1 81 LYS H    H  -5.431 -10.011  19.173 1.00 . A A . 81 LYS H    1 1 
        7  9015 1 1 81 LYS HA   H  -7.076  -8.551  18.493 1.00 . A A . 81 LYS HA   1 1 
        7  9016 1 1 81 LYS HB2  H  -6.250  -7.291  21.119 1.00 . A A . 81 LYS HB2  1 1 
        7  9017 1 1 81 LYS HB3  H  -7.698  -6.843  20.216 1.00 . A A . 81 LYS HB3  1 1 
        7  9018 1 1 81 LYS HD2  H  -7.679  -7.994  23.029 1.00 . A A . 81 LYS HD2  1 1 
        7  9019 1 1 81 LYS HD3  H  -9.141  -7.585  22.132 1.00 . A A . 81 LYS HD3  1 1 
        7  9020 1 1 81 LYS HE2  H  -8.455 -10.356  23.156 1.00 . A A . 81 LYS HE2  1 1 
        7  9021 1 1 81 LYS HE3  H  -9.588  -9.246  23.927 1.00 . A A . 81 LYS HE3  1 1 
        7  9022 1 1 81 LYS HG2  H  -8.511  -9.168  20.356 1.00 . A A . 81 LYS HG2  1 1 
        7  9023 1 1 81 LYS HG3  H  -7.066  -9.618  21.263 1.00 . A A . 81 LYS HG3  1 1 
        7  9024 1 1 81 LYS HZ1  H -11.115 -10.153  22.614 1.00 . A A . 81 LYS HZ1  1 1 
        7  9025 1 1 81 LYS HZ2  H  -9.957 -10.927  21.642 1.00 . A A . 81 LYS HZ2  1 1 
        7  9026 1 1 81 LYS HZ3  H -10.394  -9.315  21.328 1.00 . A A . 81 LYS HZ3  1 1 
        7  9027 1 1 81 LYS N    N  -5.293  -9.074  19.423 1.00 . A A . 81 LYS N    1 1 
        7  9028 1 1 81 LYS NZ   N -10.237 -10.023  22.074 1.00 . A A . 81 LYS NZ   1 1 
        7  9029 1 1 81 LYS O    O  -5.003  -7.086  17.462 1.00 . A A . 81 LYS O    1 1 
        7  9030 1 1 81 LYS OXT  O  -6.038  -5.774  18.822 1.00 . A A . 81 LYS OXT  1 1 
        8  9031 1 1  1 MET C    C  -4.458   5.944  -7.380 1.00 . A A .  1 MET C    1 1 
        8  9032 1 1  1 MET CA   C  -3.498   6.208  -8.536 1.00 . A A .  1 MET CA   1 1 
        8  9033 1 1  1 MET CB   C  -4.199   5.953  -9.873 1.00 . A A .  1 MET CB   1 1 
        8  9034 1 1  1 MET CE   C  -5.805   2.436 -11.294 1.00 . A A .  1 MET CE   1 1 
        8  9035 1 1  1 MET CG   C  -4.647   4.491  -9.950 1.00 . A A .  1 MET CG   1 1 
        8  9036 1 1  1 MET H1   H  -1.716   5.624  -7.630 1.00 . A A .  1 MET H1   1 1 
        8  9037 1 1  1 MET H2   H  -1.775   5.327  -9.302 1.00 . A A .  1 MET H2   1 1 
        8  9038 1 1  1 MET H3   H  -2.641   4.335  -8.230 1.00 . A A .  1 MET H3   1 1 
        8  9039 1 1  1 MET HA   H  -3.167   7.236  -8.496 1.00 . A A .  1 MET HA   1 1 
        8  9040 1 1  1 MET HB2  H  -5.060   6.599  -9.957 1.00 . A A .  1 MET HB2  1 1 
        8  9041 1 1  1 MET HB3  H  -3.514   6.159 -10.681 1.00 . A A .  1 MET HB3  1 1 
        8  9042 1 1  1 MET HE1  H  -6.538   2.121 -12.025 1.00 . A A .  1 MET HE1  1 1 
        8  9043 1 1  1 MET HE2  H  -6.214   2.314 -10.304 1.00 . A A .  1 MET HE2  1 1 
        8  9044 1 1  1 MET HE3  H  -4.912   1.832 -11.388 1.00 . A A .  1 MET HE3  1 1 
        8  9045 1 1  1 MET HG2  H  -3.794   3.845  -9.811 1.00 . A A .  1 MET HG2  1 1 
        8  9046 1 1  1 MET HG3  H  -5.377   4.297  -9.177 1.00 . A A .  1 MET HG3  1 1 
        8  9047 1 1  1 MET N    N  -2.319   5.306  -8.415 1.00 . A A .  1 MET N    1 1 
        8  9048 1 1  1 MET O    O  -4.356   4.925  -6.696 1.00 . A A .  1 MET O    1 1 
        8  9049 1 1  1 MET SD   S  -5.388   4.175 -11.571 1.00 . A A .  1 MET SD   1 1 
        8  9050 1 1  2 LYS C    C  -5.638   6.357  -4.789 1.00 . A A .  2 LYS C    1 1 
        8  9051 1 1  2 LYS CA   C  -6.358   6.726  -6.085 1.00 . A A .  2 LYS CA   1 1 
        8  9052 1 1  2 LYS CB   C  -7.379   5.642  -6.447 1.00 . A A .  2 LYS CB   1 1 
        8  9053 1 1  2 LYS CD   C  -9.612   4.660  -5.906 1.00 . A A .  2 LYS CD   1 1 
        8  9054 1 1  2 LYS CE   C -10.820   4.737  -4.972 1.00 . A A .  2 LYS CE   1 1 
        8  9055 1 1  2 LYS CG   C  -8.578   5.711  -5.494 1.00 . A A .  2 LYS CG   1 1 
        8  9056 1 1  2 LYS H    H  -5.420   7.662  -7.739 1.00 . A A .  2 LYS H    1 1 
        8  9057 1 1  2 LYS HA   H  -6.875   7.665  -5.948 1.00 . A A .  2 LYS HA   1 1 
        8  9058 1 1  2 LYS HB2  H  -7.717   5.794  -7.461 1.00 . A A .  2 LYS HB2  1 1 
        8  9059 1 1  2 LYS HB3  H  -6.914   4.671  -6.365 1.00 . A A .  2 LYS HB3  1 1 
        8  9060 1 1  2 LYS HD2  H  -9.929   4.848  -6.922 1.00 . A A .  2 LYS HD2  1 1 
        8  9061 1 1  2 LYS HD3  H  -9.171   3.677  -5.842 1.00 . A A .  2 LYS HD3  1 1 
        8  9062 1 1  2 LYS HE2  H -10.505   4.539  -3.958 1.00 . A A .  2 LYS HE2  1 1 
        8  9063 1 1  2 LYS HE3  H -11.258   5.722  -5.027 1.00 . A A .  2 LYS HE3  1 1 
        8  9064 1 1  2 LYS HG2  H  -8.252   5.517  -4.483 1.00 . A A .  2 LYS HG2  1 1 
        8  9065 1 1  2 LYS HG3  H  -9.024   6.692  -5.548 1.00 . A A .  2 LYS HG3  1 1 
        8  9066 1 1  2 LYS HZ1  H -12.428   3.476  -4.570 1.00 . A A .  2 LYS HZ1  1 1 
        8  9067 1 1  2 LYS HZ2  H -11.343   2.868  -5.727 1.00 . A A .  2 LYS HZ2  1 1 
        8  9068 1 1  2 LYS HZ3  H -12.424   4.110  -6.143 1.00 . A A .  2 LYS HZ3  1 1 
        8  9069 1 1  2 LYS N    N  -5.387   6.869  -7.165 1.00 . A A .  2 LYS N    1 1 
        8  9070 1 1  2 LYS NZ   N -11.830   3.722  -5.383 1.00 . A A .  2 LYS NZ   1 1 
        8  9071 1 1  2 LYS O    O  -5.968   5.366  -4.139 1.00 . A A .  2 LYS O    1 1 
        8  9072 1 1  3 ASP C    C  -4.702   7.228  -1.970 1.00 . A A .  3 ASP C    1 1 
        8  9073 1 1  3 ASP CA   C  -3.869   6.911  -3.217 1.00 . A A .  3 ASP CA   1 1 
        8  9074 1 1  3 ASP CB   C  -2.620   7.796  -3.229 1.00 . A A .  3 ASP CB   1 1 
        8  9075 1 1  3 ASP CG   C  -3.039   9.262  -3.267 1.00 . A A .  3 ASP CG   1 1 
        8  9076 1 1  3 ASP H    H  -4.418   7.930  -4.992 1.00 . A A .  3 ASP H    1 1 
        8  9077 1 1  3 ASP HA   H  -3.568   5.878  -3.206 1.00 . A A .  3 ASP HA   1 1 
        8  9078 1 1  3 ASP HB2  H  -2.037   7.611  -2.340 1.00 . A A .  3 ASP HB2  1 1 
        8  9079 1 1  3 ASP HB3  H  -2.028   7.570  -4.102 1.00 . A A .  3 ASP HB3  1 1 
        8  9080 1 1  3 ASP N    N  -4.642   7.159  -4.429 1.00 . A A .  3 ASP N    1 1 
        8  9081 1 1  3 ASP O    O  -5.555   8.115  -2.004 1.00 . A A .  3 ASP O    1 1 
        8  9082 1 1  3 ASP OD1  O  -4.199   9.512  -3.553 1.00 . A A .  3 ASP OD1  1 1 
        8  9083 1 1  3 ASP OD2  O  -2.199  10.110  -3.021 1.00 . A A .  3 ASP OD2  1 1 
        8  9084 1 1  4 PRO C    C  -4.705   8.075   1.097 1.00 . A A .  4 PRO C    1 1 
        8  9085 1 1  4 PRO CA   C  -5.209   6.810   0.406 1.00 . A A .  4 PRO CA   1 1 
        8  9086 1 1  4 PRO CB   C  -4.910   5.561   1.244 1.00 . A A .  4 PRO CB   1 1 
        8  9087 1 1  4 PRO CD   C  -3.477   5.463  -0.695 1.00 . A A .  4 PRO CD   1 1 
        8  9088 1 1  4 PRO CG   C  -3.551   5.134   0.800 1.00 . A A .  4 PRO CG   1 1 
        8  9089 1 1  4 PRO HA   H  -6.266   6.881   0.216 1.00 . A A .  4 PRO HA   1 1 
        8  9090 1 1  4 PRO HB2  H  -4.911   5.800   2.300 1.00 . A A .  4 PRO HB2  1 1 
        8  9091 1 1  4 PRO HB3  H  -5.630   4.785   1.032 1.00 . A A .  4 PRO HB3  1 1 
        8  9092 1 1  4 PRO HD2  H  -2.485   5.797  -0.963 1.00 . A A .  4 PRO HD2  1 1 
        8  9093 1 1  4 PRO HD3  H  -3.763   4.604  -1.286 1.00 . A A .  4 PRO HD3  1 1 
        8  9094 1 1  4 PRO HG2  H  -2.793   5.685   1.344 1.00 . A A .  4 PRO HG2  1 1 
        8  9095 1 1  4 PRO HG3  H  -3.421   4.073   0.950 1.00 . A A .  4 PRO HG3  1 1 
        8  9096 1 1  4 PRO N    N  -4.467   6.551  -0.866 1.00 . A A .  4 PRO N    1 1 
        8  9097 1 1  4 PRO O    O  -4.108   8.008   2.170 1.00 . A A .  4 PRO O    1 1 
        8  9098 1 1  5 LYS C    C  -5.440  10.960   2.182 1.00 . A A .  5 LYS C    1 1 
        8  9099 1 1  5 LYS CA   C  -4.519  10.495   1.053 1.00 . A A .  5 LYS CA   1 1 
        8  9100 1 1  5 LYS CB   C  -4.511  11.555  -0.055 1.00 . A A .  5 LYS CB   1 1 
        8  9101 1 1  5 LYS CD   C  -3.971  13.925  -0.634 1.00 . A A .  5 LYS CD   1 1 
        8  9102 1 1  5 LYS CE   C  -3.485  15.268  -0.087 1.00 . A A .  5 LYS CE   1 1 
        8  9103 1 1  5 LYS CG   C  -4.016  12.897   0.497 1.00 . A A .  5 LYS CG   1 1 
        8  9104 1 1  5 LYS H    H  -5.450   9.243  -0.360 1.00 . A A .  5 LYS H    1 1 
        8  9105 1 1  5 LYS HA   H  -3.508  10.387   1.414 1.00 . A A .  5 LYS HA   1 1 
        8  9106 1 1  5 LYS HB2  H  -3.857  11.232  -0.852 1.00 . A A .  5 LYS HB2  1 1 
        8  9107 1 1  5 LYS HB3  H  -5.512  11.676  -0.441 1.00 . A A .  5 LYS HB3  1 1 
        8  9108 1 1  5 LYS HD2  H  -3.294  13.582  -1.404 1.00 . A A .  5 LYS HD2  1 1 
        8  9109 1 1  5 LYS HD3  H  -4.960  14.045  -1.051 1.00 . A A .  5 LYS HD3  1 1 
        8  9110 1 1  5 LYS HE2  H  -4.167  15.615   0.675 1.00 . A A .  5 LYS HE2  1 1 
        8  9111 1 1  5 LYS HE3  H  -2.500  15.149   0.338 1.00 . A A .  5 LYS HE3  1 1 
        8  9112 1 1  5 LYS HG2  H  -4.689  13.245   1.268 1.00 . A A .  5 LYS HG2  1 1 
        8  9113 1 1  5 LYS HG3  H  -3.026  12.775   0.909 1.00 . A A .  5 LYS HG3  1 1 
        8  9114 1 1  5 LYS HZ1  H  -2.469  16.293  -1.588 1.00 . A A .  5 LYS HZ1  1 1 
        8  9115 1 1  5 LYS HZ2  H  -3.684  17.205  -0.826 1.00 . A A .  5 LYS HZ2  1 1 
        8  9116 1 1  5 LYS HZ3  H  -4.100  15.992  -1.940 1.00 . A A .  5 LYS HZ3  1 1 
        8  9117 1 1  5 LYS N    N  -4.950   9.226   0.483 1.00 . A A .  5 LYS N    1 1 
        8  9118 1 1  5 LYS NZ   N  -3.430  16.264  -1.194 1.00 . A A .  5 LYS NZ   1 1 
        8  9119 1 1  5 LYS O    O  -5.002  11.239   3.293 1.00 . A A .  5 LYS O    1 1 
        8  9120 1 1  6 THR C    C  -8.163  10.142   3.693 1.00 . A A .  6 THR C    1 1 
        8  9121 1 1  6 THR CA   C  -7.806  11.329   2.795 1.00 . A A .  6 THR CA   1 1 
        8  9122 1 1  6 THR CB   C  -9.047  11.774   2.018 1.00 . A A .  6 THR CB   1 1 
        8  9123 1 1  6 THR CG2  C  -9.578  10.606   1.187 1.00 . A A .  6 THR CG2  1 1 
        8  9124 1 1  6 THR H    H  -6.985  10.595   0.991 1.00 . A A .  6 THR H    1 1 
        8  9125 1 1  6 THR HA   H  -7.479  12.139   3.417 1.00 . A A .  6 THR HA   1 1 
        8  9126 1 1  6 THR HB   H  -8.787  12.589   1.360 1.00 . A A .  6 THR HB   1 1 
        8  9127 1 1  6 THR HG1  H -10.625  11.459   3.109 1.00 . A A .  6 THR HG1  1 1 
        8  9128 1 1  6 THR HG21 H -10.339  10.964   0.509 1.00 . A A .  6 THR HG21 1 1 
        8  9129 1 1  6 THR HG22 H -10.003   9.860   1.843 1.00 . A A .  6 THR HG22 1 1 
        8  9130 1 1  6 THR HG23 H  -8.768  10.169   0.621 1.00 . A A .  6 THR HG23 1 1 
        8  9131 1 1  6 THR N    N  -6.733  10.972   1.860 1.00 . A A .  6 THR N    1 1 
        8  9132 1 1  6 THR O    O  -8.550  10.291   4.852 1.00 . A A .  6 THR O    1 1 
        8  9133 1 1  6 THR OG1  O -10.046  12.204   2.932 1.00 . A A .  6 THR OG1  1 1 
        8  9134 1 1  7 LEU C    C  -7.265   7.625   5.029 1.00 . A A .  7 LEU C    1 1 
        8  9135 1 1  7 LEU CA   C  -8.235   7.727   3.841 1.00 . A A .  7 LEU CA   1 1 
        8  9136 1 1  7 LEU CB   C  -8.074   6.510   2.919 1.00 . A A .  7 LEU CB   1 1 
        8  9137 1 1  7 LEU CD1  C  -8.938   5.346   0.863 1.00 . A A .  7 LEU CD1  1 1 
        8  9138 1 1  7 LEU CD2  C -10.569   6.312   2.522 1.00 . A A .  7 LEU CD2  1 1 
        8  9139 1 1  7 LEU CG   C  -9.188   6.495   1.855 1.00 . A A .  7 LEU CG   1 1 
        8  9140 1 1  7 LEU H    H  -7.541   9.028   2.241 1.00 . A A .  7 LEU H    1 1 
        8  9141 1 1  7 LEU HA   H  -9.242   7.750   4.224 1.00 . A A .  7 LEU HA   1 1 
        8  9142 1 1  7 LEU HB2  H  -7.113   6.561   2.431 1.00 . A A .  7 LEU HB2  1 1 
        8  9143 1 1  7 LEU HB3  H  -8.129   5.606   3.508 1.00 . A A .  7 LEU HB3  1 1 
        8  9144 1 1  7 LEU HD11 H  -9.483   5.538  -0.049 1.00 . A A .  7 LEU HD11 1 1 
        8  9145 1 1  7 LEU HD12 H  -9.278   4.417   1.295 1.00 . A A .  7 LEU HD12 1 1 
        8  9146 1 1  7 LEU HD13 H  -7.885   5.275   0.645 1.00 . A A .  7 LEU HD13 1 1 
        8  9147 1 1  7 LEU HD21 H -10.470   5.712   3.416 1.00 . A A .  7 LEU HD21 1 1 
        8  9148 1 1  7 LEU HD22 H -11.247   5.820   1.836 1.00 . A A .  7 LEU HD22 1 1 
        8  9149 1 1  7 LEU HD23 H -10.974   7.279   2.781 1.00 . A A .  7 LEU HD23 1 1 
        8  9150 1 1  7 LEU HG   H  -9.173   7.433   1.317 1.00 . A A .  7 LEU HG   1 1 
        8  9151 1 1  7 LEU N    N  -7.980   8.971   3.115 1.00 . A A .  7 LEU N    1 1 
        8  9152 1 1  7 LEU O    O  -7.659   7.293   6.147 1.00 . A A .  7 LEU O    1 1 
        8  9153 1 1  8 LEU C    C  -4.952   9.234   6.645 1.00 . A A .  8 LEU C    1 1 
        8  9154 1 1  8 LEU CA   C  -4.910   7.986   5.744 1.00 . A A .  8 LEU CA   1 1 
        8  9155 1 1  8 LEU CB   C  -3.573   7.967   4.992 1.00 . A A .  8 LEU CB   1 1 
        8  9156 1 1  8 LEU CD1  C  -2.478   6.413   6.661 1.00 . A A .  8 LEU CD1  1 1 
        8  9157 1 1  8 LEU CD2  C  -1.085   7.908   5.194 1.00 . A A .  8 LEU CD2  1 1 
        8  9158 1 1  8 LEU CG   C  -2.401   7.789   5.971 1.00 . A A .  8 LEU CG   1 1 
        8  9159 1 1  8 LEU H    H  -5.757   8.264   3.868 1.00 . A A .  8 LEU H    1 1 
        8  9160 1 1  8 LEU HA   H  -4.977   7.087   6.334 1.00 . A A .  8 LEU HA   1 1 
        8  9161 1 1  8 LEU HB2  H  -3.574   7.149   4.286 1.00 . A A .  8 LEU HB2  1 1 
        8  9162 1 1  8 LEU HB3  H  -3.452   8.897   4.457 1.00 . A A .  8 LEU HB3  1 1 
        8  9163 1 1  8 LEU HD11 H  -3.102   6.485   7.540 1.00 . A A .  8 LEU HD11 1 1 
        8  9164 1 1  8 LEU HD12 H  -1.487   6.097   6.957 1.00 . A A .  8 LEU HD12 1 1 
        8  9165 1 1  8 LEU HD13 H  -2.897   5.685   5.982 1.00 . A A .  8 LEU HD13 1 1 
        8  9166 1 1  8 LEU HD21 H  -0.254   7.781   5.871 1.00 . A A .  8 LEU HD21 1 1 
        8  9167 1 1  8 LEU HD22 H  -1.027   8.883   4.732 1.00 . A A .  8 LEU HD22 1 1 
        8  9168 1 1  8 LEU HD23 H  -1.047   7.146   4.430 1.00 . A A .  8 LEU HD23 1 1 
        8  9169 1 1  8 LEU HG   H  -2.441   8.564   6.722 1.00 . A A .  8 LEU HG   1 1 
        8  9170 1 1  8 LEU N    N  -6.007   7.961   4.765 1.00 . A A .  8 LEU N    1 1 
        8  9171 1 1  8 LEU O    O  -4.427   9.252   7.759 1.00 . A A .  8 LEU O    1 1 
        8  9172 1 1  9 ARG C    C  -6.657  11.417   8.039 1.00 . A A .  9 ARG C    1 1 
        8  9173 1 1  9 ARG CA   C  -5.760  11.544   6.809 1.00 . A A .  9 ARG CA   1 1 
        8  9174 1 1  9 ARG CB   C  -6.363  12.592   5.874 1.00 . A A .  9 ARG CB   1 1 
        8  9175 1 1  9 ARG CD   C  -4.807  14.510   6.467 1.00 . A A .  9 ARG CD   1 1 
        8  9176 1 1  9 ARG CG   C  -6.260  13.994   6.502 1.00 . A A .  9 ARG CG   1 1 
        8  9177 1 1  9 ARG CZ   C  -2.778  14.270   7.771 1.00 . A A .  9 ARG CZ   1 1 
        8  9178 1 1  9 ARG H    H  -6.135  10.039   5.320 1.00 . A A .  9 ARG H    1 1 
        8  9179 1 1  9 ARG HA   H  -4.783  11.886   7.111 1.00 . A A .  9 ARG HA   1 1 
        8  9180 1 1  9 ARG HB2  H  -5.836  12.581   4.939 1.00 . A A .  9 ARG HB2  1 1 
        8  9181 1 1  9 ARG HB3  H  -7.403  12.358   5.707 1.00 . A A .  9 ARG HB3  1 1 
        8  9182 1 1  9 ARG HD2  H  -4.292  14.115   5.605 1.00 . A A .  9 ARG HD2  1 1 
        8  9183 1 1  9 ARG HD3  H  -4.817  15.590   6.402 1.00 . A A .  9 ARG HD3  1 1 
        8  9184 1 1  9 ARG HE   H  -4.592  13.737   8.430 1.00 . A A .  9 ARG HE   1 1 
        8  9185 1 1  9 ARG HG2  H  -6.894  14.673   5.949 1.00 . A A .  9 ARG HG2  1 1 
        8  9186 1 1  9 ARG HG3  H  -6.596  13.953   7.525 1.00 . A A .  9 ARG HG3  1 1 
        8  9187 1 1  9 ARG HH11 H  -2.574  14.995   5.916 1.00 . A A .  9 ARG HH11 1 1 
        8  9188 1 1  9 ARG HH12 H  -1.111  14.868   6.836 1.00 . A A .  9 ARG HH12 1 1 
        8  9189 1 1  9 ARG HH21 H  -2.678  13.582   9.648 1.00 . A A .  9 ARG HH21 1 1 
        8  9190 1 1  9 ARG HH22 H  -1.170  14.067   8.948 1.00 . A A .  9 ARG HH22 1 1 
        8  9191 1 1  9 ARG N    N  -5.602  10.260   6.112 1.00 . A A .  9 ARG N    1 1 
        8  9192 1 1  9 ARG NE   N  -4.093  14.112   7.674 1.00 . A A .  9 ARG NE   1 1 
        8  9193 1 1  9 ARG NH1  N  -2.102  14.748   6.762 1.00 . A A .  9 ARG NH1  1 1 
        8  9194 1 1  9 ARG NH2  N  -2.161  13.948   8.875 1.00 . A A .  9 ARG NH2  1 1 
        8  9195 1 1  9 ARG O    O  -6.473  12.128   9.027 1.00 . A A .  9 ARG O    1 1 
        8  9196 1 1 10 VAL C    C  -7.899   9.650  10.288 1.00 . A A . 10 VAL C    1 1 
        8  9197 1 1 10 VAL CA   C  -8.564  10.294   9.072 1.00 . A A . 10 VAL CA   1 1 
        8  9198 1 1 10 VAL CB   C  -9.737   9.431   8.591 1.00 . A A . 10 VAL CB   1 1 
        8  9199 1 1 10 VAL CG1  C -10.626   9.044   9.777 1.00 . A A . 10 VAL CG1  1 1 
        8  9200 1 1 10 VAL CG2  C -10.564  10.223   7.576 1.00 . A A . 10 VAL CG2  1 1 
        8  9201 1 1 10 VAL H    H  -7.714   9.939   7.181 1.00 . A A . 10 VAL H    1 1 
        8  9202 1 1 10 VAL HA   H  -8.955  11.232   9.434 1.00 . A A . 10 VAL HA   1 1 
        8  9203 1 1 10 VAL HB   H  -9.354   8.535   8.123 1.00 . A A . 10 VAL HB   1 1 
        8  9204 1 1 10 VAL HG11 H -10.132   8.285  10.365 1.00 . A A . 10 VAL HG11 1 1 
        8  9205 1 1 10 VAL HG12 H -11.568   8.660   9.412 1.00 . A A . 10 VAL HG12 1 1 
        8  9206 1 1 10 VAL HG13 H -10.807   9.914  10.391 1.00 . A A . 10 VAL HG13 1 1 
        8  9207 1 1 10 VAL HG21 H  -9.935  10.513   6.747 1.00 . A A . 10 VAL HG21 1 1 
        8  9208 1 1 10 VAL HG22 H -10.964  11.106   8.050 1.00 . A A . 10 VAL HG22 1 1 
        8  9209 1 1 10 VAL HG23 H -11.375   9.608   7.215 1.00 . A A . 10 VAL HG23 1 1 
        8  9210 1 1 10 VAL N    N  -7.630  10.515   7.970 1.00 . A A . 10 VAL N    1 1 
        8  9211 1 1 10 VAL O    O  -8.198  10.047  11.415 1.00 . A A . 10 VAL O    1 1 
        8  9212 1 1 11 SER C    C  -5.528   9.097  12.032 1.00 . A A . 11 SER C    1 1 
        8  9213 1 1 11 SER CA   C  -6.374   8.074  11.274 1.00 . A A . 11 SER CA   1 1 
        8  9214 1 1 11 SER CB   C  -5.499   6.901  10.829 1.00 . A A . 11 SER CB   1 1 
        8  9215 1 1 11 SER H    H  -6.744   8.377   9.216 1.00 . A A . 11 SER H    1 1 
        8  9216 1 1 11 SER HA   H  -7.107   7.714  11.980 1.00 . A A . 11 SER HA   1 1 
        8  9217 1 1 11 SER HB2  H  -6.106   6.164  10.331 1.00 . A A . 11 SER HB2  1 1 
        8  9218 1 1 11 SER HB3  H  -4.741   7.259  10.144 1.00 . A A . 11 SER HB3  1 1 
        8  9219 1 1 11 SER HG   H  -4.914   5.354  11.853 1.00 . A A . 11 SER HG   1 1 
        8  9220 1 1 11 SER N    N  -7.010   8.680  10.109 1.00 . A A . 11 SER N    1 1 
        8  9221 1 1 11 SER O    O  -5.681   9.237  13.215 1.00 . A A . 11 SER O    1 1 
        8  9222 1 1 11 SER OG   O  -4.884   6.307  11.964 1.00 . A A . 11 SER OG   1 1 
        8  9223 1 1 12 ILE C    C  -4.604  11.774  12.849 1.00 . A A . 12 ILE C    1 1 
        8  9224 1 1 12 ILE CA   C  -3.765  10.742  12.070 1.00 . A A . 12 ILE CA   1 1 
        8  9225 1 1 12 ILE CB   C  -2.895  11.475  11.043 1.00 . A A . 12 ILE CB   1 1 
        8  9226 1 1 12 ILE CD1  C  -1.220  11.123   9.217 1.00 . A A . 12 ILE CD1  1 1 
        8  9227 1 1 12 ILE CG1  C  -1.905  10.482  10.426 1.00 . A A . 12 ILE CG1  1 1 
        8  9228 1 1 12 ILE CG2  C  -2.119  12.604  11.730 1.00 . A A . 12 ILE CG2  1 1 
        8  9229 1 1 12 ILE H    H  -4.514   9.554  10.418 1.00 . A A . 12 ILE H    1 1 
        8  9230 1 1 12 ILE HA   H  -3.111  10.195  12.732 1.00 . A A . 12 ILE HA   1 1 
        8  9231 1 1 12 ILE HB   H  -3.523  11.889  10.267 1.00 . A A . 12 ILE HB   1 1 
        8  9232 1 1 12 ILE HD11 H  -0.541  10.412   8.770 1.00 . A A . 12 ILE HD11 1 1 
        8  9233 1 1 12 ILE HD12 H  -0.669  11.995   9.536 1.00 . A A . 12 ILE HD12 1 1 
        8  9234 1 1 12 ILE HD13 H  -1.966  11.414   8.492 1.00 . A A . 12 ILE HD13 1 1 
        8  9235 1 1 12 ILE HG12 H  -1.161  10.213  11.161 1.00 . A A . 12 ILE HG12 1 1 
        8  9236 1 1 12 ILE HG13 H  -2.435   9.597  10.108 1.00 . A A . 12 ILE HG13 1 1 
        8  9237 1 1 12 ILE HG21 H  -1.706  12.240  12.660 1.00 . A A . 12 ILE HG21 1 1 
        8  9238 1 1 12 ILE HG22 H  -2.785  13.429  11.930 1.00 . A A . 12 ILE HG22 1 1 
        8  9239 1 1 12 ILE HG23 H  -1.317  12.936  11.087 1.00 . A A . 12 ILE HG23 1 1 
        8  9240 1 1 12 ILE N    N  -4.635   9.784  11.363 1.00 . A A . 12 ILE N    1 1 
        8  9241 1 1 12 ILE O    O  -4.377  12.068  14.020 1.00 . A A . 12 ILE O    1 1 
        8  9242 1 1 13 ILE C    C  -7.262  12.683  13.920 1.00 . A A . 13 ILE C    1 1 
        8  9243 1 1 13 ILE CA   C  -6.521  13.253  12.678 1.00 . A A . 13 ILE CA   1 1 
        8  9244 1 1 13 ILE CB   C  -7.537  13.685  11.604 1.00 . A A . 13 ILE CB   1 1 
        8  9245 1 1 13 ILE CD1  C  -6.598  15.967  10.925 1.00 . A A . 13 ILE CD1  1 1 
        8  9246 1 1 13 ILE CG1  C  -6.841  14.507  10.495 1.00 . A A . 13 ILE CG1  1 1 
        8  9247 1 1 13 ILE CG2  C  -8.647  14.523  12.249 1.00 . A A . 13 ILE CG2  1 1 
        8  9248 1 1 13 ILE H    H  -5.615  11.848  11.250 1.00 . A A . 13 ILE H    1 1 
        8  9249 1 1 13 ILE HA   H  -5.965  14.106  13.019 1.00 . A A . 13 ILE HA   1 1 
        8  9250 1 1 13 ILE HB   H  -7.978  12.801  11.167 1.00 . A A . 13 ILE HB   1 1 
        8  9251 1 1 13 ILE HD11 H  -7.542  16.493  10.962 1.00 . A A . 13 ILE HD11 1 1 
        8  9252 1 1 13 ILE HD12 H  -5.954  16.447  10.205 1.00 . A A . 13 ILE HD12 1 1 
        8  9253 1 1 13 ILE HD13 H  -6.132  16.000  11.893 1.00 . A A . 13 ILE HD13 1 1 
        8  9254 1 1 13 ILE HG12 H  -5.894  14.048  10.258 1.00 . A A . 13 ILE HG12 1 1 
        8  9255 1 1 13 ILE HG13 H  -7.466  14.501   9.614 1.00 . A A . 13 ILE HG13 1 1 
        8  9256 1 1 13 ILE HG21 H  -9.206  15.035  11.479 1.00 . A A . 13 ILE HG21 1 1 
        8  9257 1 1 13 ILE HG22 H  -8.208  15.250  12.918 1.00 . A A . 13 ILE HG22 1 1 
        8  9258 1 1 13 ILE HG23 H  -9.311  13.877  12.805 1.00 . A A . 13 ILE HG23 1 1 
        8  9259 1 1 13 ILE N    N  -5.579  12.267  12.134 1.00 . A A . 13 ILE N    1 1 
        8  9260 1 1 13 ILE O    O  -7.378  13.358  14.943 1.00 . A A . 13 ILE O    1 1 
        8  9261 1 1 14 GLY C    C  -7.242  10.193  15.972 1.00 . A A . 14 GLY C    1 1 
        8  9262 1 1 14 GLY CA   C  -8.318  10.751  15.004 1.00 . A A . 14 GLY CA   1 1 
        8  9263 1 1 14 GLY H    H  -7.404  10.931  13.041 1.00 . A A . 14 GLY H    1 1 
        8  9264 1 1 14 GLY HA2  H  -8.937  11.464  15.531 1.00 . A A . 14 GLY HA2  1 1 
        8  9265 1 1 14 GLY HA3  H  -8.933   9.937  14.652 1.00 . A A . 14 GLY HA3  1 1 
        8  9266 1 1 14 GLY N    N  -7.679  11.423  13.842 1.00 . A A . 14 GLY N    1 1 
        8  9267 1 1 14 GLY O    O  -7.274  10.381  17.188 1.00 . A A . 14 GLY O    1 1 
        8  9268 1 1 15 THR C    C  -4.335   9.711  16.812 1.00 . A A . 15 THR C    1 1 
        8  9269 1 1 15 THR CA   C  -5.221   8.766  16.002 1.00 . A A . 15 THR CA   1 1 
        8  9270 1 1 15 THR CB   C  -4.341   8.010  15.002 1.00 . A A . 15 THR CB   1 1 
        8  9271 1 1 15 THR CG2  C  -3.313   7.168  15.761 1.00 . A A . 15 THR CG2  1 1 
        8  9272 1 1 15 THR H    H  -6.545   9.389  14.392 1.00 . A A . 15 THR H    1 1 
        8  9273 1 1 15 THR HA   H  -5.644   8.046  16.687 1.00 . A A . 15 THR HA   1 1 
        8  9274 1 1 15 THR HB   H  -3.817   8.711  14.375 1.00 . A A . 15 THR HB   1 1 
        8  9275 1 1 15 THR HG1  H  -4.871   7.252  13.297 1.00 . A A . 15 THR HG1  1 1 
        8  9276 1 1 15 THR HG21 H  -3.800   6.642  16.569 1.00 . A A . 15 THR HG21 1 1 
        8  9277 1 1 15 THR HG22 H  -2.547   7.814  16.162 1.00 . A A . 15 THR HG22 1 1 
        8  9278 1 1 15 THR HG23 H  -2.865   6.454  15.086 1.00 . A A . 15 THR HG23 1 1 
        8  9279 1 1 15 THR N    N  -6.341   9.468  15.343 1.00 . A A . 15 THR N    1 1 
        8  9280 1 1 15 THR O    O  -3.728   9.294  17.799 1.00 . A A . 15 THR O    1 1 
        8  9281 1 1 15 THR OG1  O  -5.151   7.157  14.209 1.00 . A A . 15 THR OG1  1 1 
        8  9282 1 1 16 THR C    C  -4.148  12.417  18.432 1.00 . A A . 16 THR C    1 1 
        8  9283 1 1 16 THR CA   C  -3.464  11.961  17.147 1.00 . A A . 16 THR CA   1 1 
        8  9284 1 1 16 THR CB   C  -3.171  13.174  16.259 1.00 . A A . 16 THR CB   1 1 
        8  9285 1 1 16 THR CG2  C  -2.365  14.204  17.051 1.00 . A A . 16 THR CG2  1 1 
        8  9286 1 1 16 THR H    H  -4.809  11.308  15.673 1.00 . A A . 16 THR H    1 1 
        8  9287 1 1 16 THR HA   H  -2.526  11.501  17.419 1.00 . A A . 16 THR HA   1 1 
        8  9288 1 1 16 THR HB   H  -4.100  13.618  15.938 1.00 . A A . 16 THR HB   1 1 
        8  9289 1 1 16 THR HG1  H  -2.855  11.983  14.754 1.00 . A A . 16 THR HG1  1 1 
        8  9290 1 1 16 THR HG21 H  -1.958  14.940  16.374 1.00 . A A . 16 THR HG21 1 1 
        8  9291 1 1 16 THR HG22 H  -1.559  13.708  17.571 1.00 . A A . 16 THR HG22 1 1 
        8  9292 1 1 16 THR HG23 H  -3.009  14.692  17.768 1.00 . A A . 16 THR HG23 1 1 
        8  9293 1 1 16 THR N    N  -4.268  10.979  16.421 1.00 . A A . 16 THR N    1 1 
        8  9294 1 1 16 THR O    O  -3.487  12.769  19.409 1.00 . A A . 16 THR O    1 1 
        8  9295 1 1 16 THR OG1  O  -2.425  12.758  15.124 1.00 . A A . 16 THR OG1  1 1 
        8  9296 1 1 17 LEU C    C  -6.392  11.955  20.700 1.00 . A A . 17 LEU C    1 1 
        8  9297 1 1 17 LEU CA   C  -6.293  12.918  19.519 1.00 . A A . 17 LEU CA   1 1 
        8  9298 1 1 17 LEU CB   C  -7.705  13.236  19.018 1.00 . A A . 17 LEU CB   1 1 
        8  9299 1 1 17 LEU CD1  C  -9.070  14.578  17.408 1.00 . A A . 17 LEU CD1  1 1 
        8  9300 1 1 17 LEU CD2  C  -7.143  15.665  18.599 1.00 . A A . 17 LEU CD2  1 1 
        8  9301 1 1 17 LEU CG   C  -7.659  14.357  17.967 1.00 . A A . 17 LEU CG   1 1 
        8  9302 1 1 17 LEU H    H  -5.977  12.181  17.607 1.00 . A A . 17 LEU H    1 1 
        8  9303 1 1 17 LEU HA   H  -5.868  13.825  19.912 1.00 . A A . 17 LEU HA   1 1 
        8  9304 1 1 17 LEU HB2  H  -8.135  12.349  18.576 1.00 . A A . 17 LEU HB2  1 1 
        8  9305 1 1 17 LEU HB3  H  -8.316  13.553  19.850 1.00 . A A . 17 LEU HB3  1 1 
        8  9306 1 1 17 LEU HD11 H  -9.669  15.098  18.141 1.00 . A A . 17 LEU HD11 1 1 
        8  9307 1 1 17 LEU HD12 H  -9.523  13.624  17.182 1.00 . A A . 17 LEU HD12 1 1 
        8  9308 1 1 17 LEU HD13 H  -9.011  15.170  16.506 1.00 . A A . 17 LEU HD13 1 1 
        8  9309 1 1 17 LEU HD21 H  -7.465  15.728  19.628 1.00 . A A . 17 LEU HD21 1 1 
        8  9310 1 1 17 LEU HD22 H  -7.530  16.514  18.052 1.00 . A A . 17 LEU HD22 1 1 
        8  9311 1 1 17 LEU HD23 H  -6.064  15.682  18.558 1.00 . A A . 17 LEU HD23 1 1 
        8  9312 1 1 17 LEU HG   H  -7.001  14.061  17.161 1.00 . A A . 17 LEU HG   1 1 
        8  9313 1 1 17 LEU N    N  -5.474  12.455  18.403 1.00 . A A . 17 LEU N    1 1 
        8  9314 1 1 17 LEU O    O  -6.680  12.406  21.809 1.00 . A A . 17 LEU O    1 1 
        8  9315 1 1 18 VAL C    C  -5.341  10.122  22.743 1.00 . A A . 18 VAL C    1 1 
        8  9316 1 1 18 VAL CA   C  -6.370   9.768  21.670 1.00 . A A . 18 VAL CA   1 1 
        8  9317 1 1 18 VAL CB   C  -6.210   8.302  21.240 1.00 . A A . 18 VAL CB   1 1 
        8  9318 1 1 18 VAL CG1  C  -7.322   7.938  20.247 1.00 . A A . 18 VAL CG1  1 1 
        8  9319 1 1 18 VAL CG2  C  -4.839   8.090  20.573 1.00 . A A . 18 VAL CG2  1 1 
        8  9320 1 1 18 VAL H    H  -5.968  10.273  19.647 1.00 . A A . 18 VAL H    1 1 
        8  9321 1 1 18 VAL HA   H  -7.382   9.917  22.015 1.00 . A A . 18 VAL HA   1 1 
        8  9322 1 1 18 VAL HB   H  -6.289   7.666  22.110 1.00 . A A . 18 VAL HB   1 1 
        8  9323 1 1 18 VAL HG11 H  -7.119   8.402  19.294 1.00 . A A . 18 VAL HG11 1 1 
        8  9324 1 1 18 VAL HG12 H  -8.272   8.289  20.623 1.00 . A A . 18 VAL HG12 1 1 
        8  9325 1 1 18 VAL HG13 H  -7.358   6.866  20.125 1.00 . A A . 18 VAL HG13 1 1 
        8  9326 1 1 18 VAL HG21 H  -4.582   8.957  19.981 1.00 . A A . 18 VAL HG21 1 1 
        8  9327 1 1 18 VAL HG22 H  -4.875   7.218  19.934 1.00 . A A . 18 VAL HG22 1 1 
        8  9328 1 1 18 VAL HG23 H  -4.089   7.939  21.334 1.00 . A A . 18 VAL HG23 1 1 
        8  9329 1 1 18 VAL N    N  -6.212  10.649  20.518 1.00 . A A . 18 VAL N    1 1 
        8  9330 1 1 18 VAL O    O  -5.674  10.364  23.903 1.00 . A A . 18 VAL O    1 1 
        8  9331 1 1 19 ALA C    C  -3.050  11.753  23.860 1.00 . A A . 19 ALA C    1 1 
        8  9332 1 1 19 ALA CA   C  -2.946  10.381  23.200 1.00 . A A . 19 ALA CA   1 1 
        8  9333 1 1 19 ALA CB   C  -1.647  10.308  22.398 1.00 . A A . 19 ALA CB   1 1 
        8  9334 1 1 19 ALA H    H  -3.905   9.831  21.399 1.00 . A A . 19 ALA H    1 1 
        8  9335 1 1 19 ALA HA   H  -2.916   9.620  23.964 1.00 . A A . 19 ALA HA   1 1 
        8  9336 1 1 19 ALA HB1  H  -1.506   9.300  22.033 1.00 . A A . 19 ALA HB1  1 1 
        8  9337 1 1 19 ALA HB2  H  -0.816  10.579  23.031 1.00 . A A . 19 ALA HB2  1 1 
        8  9338 1 1 19 ALA HB3  H  -1.701  10.988  21.561 1.00 . A A . 19 ALA HB3  1 1 
        8  9339 1 1 19 ALA N    N  -4.080  10.107  22.323 1.00 . A A . 19 ALA N    1 1 
        8  9340 1 1 19 ALA O    O  -2.611  11.940  24.994 1.00 . A A . 19 ALA O    1 1 
        8  9341 1 1 20 LEU C    C  -4.760  13.950  24.942 1.00 . A A . 20 LEU C    1 1 
        8  9342 1 1 20 LEU CA   C  -3.821  14.032  23.738 1.00 . A A . 20 LEU CA   1 1 
        8  9343 1 1 20 LEU CB   C  -4.345  15.025  22.691 1.00 . A A . 20 LEU CB   1 1 
        8  9344 1 1 20 LEU CD1  C  -3.171  16.937  23.849 1.00 . A A . 20 LEU CD1  1 1 
        8  9345 1 1 20 LEU CD2  C  -5.046  17.379  22.239 1.00 . A A . 20 LEU CD2  1 1 
        8  9346 1 1 20 LEU CG   C  -4.518  16.419  23.313 1.00 . A A . 20 LEU CG   1 1 
        8  9347 1 1 20 LEU H    H  -4.042  12.479  22.293 1.00 . A A . 20 LEU H    1 1 
        8  9348 1 1 20 LEU HA   H  -2.870  14.368  24.120 1.00 . A A . 20 LEU HA   1 1 
        8  9349 1 1 20 LEU HB2  H  -3.643  15.083  21.872 1.00 . A A . 20 LEU HB2  1 1 
        8  9350 1 1 20 LEU HB3  H  -5.298  14.680  22.320 1.00 . A A . 20 LEU HB3  1 1 
        8  9351 1 1 20 LEU HD11 H  -3.012  16.558  24.847 1.00 . A A . 20 LEU HD11 1 1 
        8  9352 1 1 20 LEU HD12 H  -3.179  18.018  23.878 1.00 . A A . 20 LEU HD12 1 1 
        8  9353 1 1 20 LEU HD13 H  -2.369  16.603  23.206 1.00 . A A . 20 LEU HD13 1 1 
        8  9354 1 1 20 LEU HD21 H  -5.132  18.372  22.656 1.00 . A A . 20 LEU HD21 1 1 
        8  9355 1 1 20 LEU HD22 H  -6.015  17.045  21.901 1.00 . A A . 20 LEU HD22 1 1 
        8  9356 1 1 20 LEU HD23 H  -4.359  17.397  21.405 1.00 . A A . 20 LEU HD23 1 1 
        8  9357 1 1 20 LEU HG   H  -5.229  16.367  24.125 1.00 . A A . 20 LEU HG   1 1 
        8  9358 1 1 20 LEU N    N  -3.653  12.704  23.164 1.00 . A A . 20 LEU N    1 1 
        8  9359 1 1 20 LEU O    O  -4.492  14.550  25.983 1.00 . A A . 20 LEU O    1 1 
        8  9360 1 1 21 SER C    C  -6.221  12.090  26.974 1.00 . A A . 21 SER C    1 1 
        8  9361 1 1 21 SER CA   C  -6.787  13.040  25.916 1.00 . A A . 21 SER CA   1 1 
        8  9362 1 1 21 SER CB   C  -8.118  12.494  25.397 1.00 . A A . 21 SER CB   1 1 
        8  9363 1 1 21 SER H    H  -6.012  12.728  23.964 1.00 . A A . 21 SER H    1 1 
        8  9364 1 1 21 SER HA   H  -6.959  14.010  26.360 1.00 . A A . 21 SER HA   1 1 
        8  9365 1 1 21 SER HB2  H  -8.852  12.521  26.185 1.00 . A A . 21 SER HB2  1 1 
        8  9366 1 1 21 SER HB3  H  -8.458  13.104  24.571 1.00 . A A . 21 SER HB3  1 1 
        8  9367 1 1 21 SER HG   H  -8.703  10.904  24.441 1.00 . A A . 21 SER HG   1 1 
        8  9368 1 1 21 SER N    N  -5.846  13.195  24.809 1.00 . A A . 21 SER N    1 1 
        8  9369 1 1 21 SER O    O  -6.712  12.023  28.089 1.00 . A A . 21 SER O    1 1 
        8  9370 1 1 21 SER OG   O  -7.940  11.150  24.969 1.00 . A A . 21 SER OG   1 1 
        8  9371 1 1 22 SER C    C  -3.674  10.992  28.497 1.00 . A A . 22 SER C    1 1 
        8  9372 1 1 22 SER CA   C  -4.614  10.331  27.475 1.00 . A A . 22 SER CA   1 1 
        8  9373 1 1 22 SER CB   C  -3.789   9.339  26.656 1.00 . A A . 22 SER CB   1 1 
        8  9374 1 1 22 SER H    H  -4.943  11.412  25.640 1.00 . A A . 22 SER H    1 1 
        8  9375 1 1 22 SER HA   H  -5.421   9.782  27.938 1.00 . A A . 22 SER HA   1 1 
        8  9376 1 1 22 SER HB2  H  -3.559   8.476  27.258 1.00 . A A . 22 SER HB2  1 1 
        8  9377 1 1 22 SER HB3  H  -4.358   9.028  25.788 1.00 . A A . 22 SER HB3  1 1 
        8  9378 1 1 22 SER HG   H  -1.946   9.875  26.964 1.00 . A A . 22 SER HG   1 1 
        8  9379 1 1 22 SER N    N  -5.222  11.318  26.575 1.00 . A A . 22 SER N    1 1 
        8  9380 1 1 22 SER O    O  -3.292  10.391  29.501 1.00 . A A . 22 SER O    1 1 
        8  9381 1 1 22 SER OG   O  -2.580   9.958  26.246 1.00 . A A . 22 SER OG   1 1 
        8  9382 1 1 23 PHE C    C  -3.154  13.684  30.278 1.00 . A A . 23 PHE C    1 1 
        8  9383 1 1 23 PHE CA   C  -2.415  12.996  29.103 1.00 . A A . 23 PHE CA   1 1 
        8  9384 1 1 23 PHE CB   C  -1.575  14.014  28.293 1.00 . A A . 23 PHE CB   1 1 
        8  9385 1 1 23 PHE CD1  C   0.005  12.260  27.379 1.00 . A A . 23 PHE CD1  1 1 
        8  9386 1 1 23 PHE CD2  C   0.942  14.173  28.537 1.00 . A A . 23 PHE CD2  1 1 
        8  9387 1 1 23 PHE CE1  C   1.293  11.752  27.174 1.00 . A A . 23 PHE CE1  1 1 
        8  9388 1 1 23 PHE CE2  C   2.231  13.665  28.332 1.00 . A A . 23 PHE CE2  1 1 
        8  9389 1 1 23 PHE CG   C  -0.171  13.470  28.060 1.00 . A A . 23 PHE CG   1 1 
        8  9390 1 1 23 PHE CZ   C   2.407  12.455  27.650 1.00 . A A . 23 PHE CZ   1 1 
        8  9391 1 1 23 PHE H    H  -3.771  12.620  27.420 1.00 . A A . 23 PHE H    1 1 
        8  9392 1 1 23 PHE HA   H  -1.746  12.291  29.581 1.00 . A A . 23 PHE HA   1 1 
        8  9393 1 1 23 PHE HB2  H  -2.050  14.183  27.337 1.00 . A A . 23 PHE HB2  1 1 
        8  9394 1 1 23 PHE HB3  H  -1.511  14.952  28.828 1.00 . A A . 23 PHE HB3  1 1 
        8  9395 1 1 23 PHE HD1  H  -0.854  11.717  27.012 1.00 . A A . 23 PHE HD1  1 1 
        8  9396 1 1 23 PHE HD2  H   0.808  15.106  29.062 1.00 . A A . 23 PHE HD2  1 1 
        8  9397 1 1 23 PHE HE1  H   1.428  10.817  26.649 1.00 . A A . 23 PHE HE1  1 1 
        8  9398 1 1 23 PHE HE2  H   3.090  14.208  28.699 1.00 . A A . 23 PHE HE2  1 1 
        8  9399 1 1 23 PHE HZ   H   3.399  12.064  27.494 1.00 . A A . 23 PHE HZ   1 1 
        8  9400 1 1 23 PHE N    N  -3.318  12.246  28.204 1.00 . A A . 23 PHE N    1 1 
        8  9401 1 1 23 PHE O    O  -2.613  13.698  31.384 1.00 . A A . 23 PHE O    1 1 
        8  9402 1 1 24 THR C    C  -5.503  14.068  32.322 1.00 . A A . 24 THR C    1 1 
        8  9403 1 1 24 THR CA   C  -4.989  15.000  31.204 1.00 . A A . 24 THR CA   1 1 
        8  9404 1 1 24 THR CB   C  -6.160  15.846  30.656 1.00 . A A . 24 THR CB   1 1 
        8  9405 1 1 24 THR CG2  C  -6.327  17.126  31.486 1.00 . A A . 24 THR CG2  1 1 
        8  9406 1 1 24 THR H    H  -4.711  14.432  29.194 1.00 . A A . 24 THR H    1 1 
        8  9407 1 1 24 THR HA   H  -4.260  15.673  31.632 1.00 . A A . 24 THR HA   1 1 
        8  9408 1 1 24 THR HB   H  -7.079  15.281  30.698 1.00 . A A . 24 THR HB   1 1 
        8  9409 1 1 24 THR HG1  H  -5.672  15.400  28.829 1.00 . A A . 24 THR HG1  1 1 
        8  9410 1 1 24 THR HG21 H  -7.298  17.557  31.290 1.00 . A A . 24 THR HG21 1 1 
        8  9411 1 1 24 THR HG22 H  -5.557  17.833  31.212 1.00 . A A . 24 THR HG22 1 1 
        8  9412 1 1 24 THR HG23 H  -6.241  16.891  32.536 1.00 . A A . 24 THR HG23 1 1 
        8  9413 1 1 24 THR N    N  -4.328  14.297  30.086 1.00 . A A . 24 THR N    1 1 
        8  9414 1 1 24 THR O    O  -5.457  14.424  33.500 1.00 . A A . 24 THR O    1 1 
        8  9415 1 1 24 THR OG1  O  -5.885  16.203  29.310 1.00 . A A . 24 THR OG1  1 1 
        8  9416 1 1 25 PRO C    C  -5.773  11.680  34.184 1.00 . A A . 25 PRO C    1 1 
        8  9417 1 1 25 PRO CA   C  -6.624  11.949  32.948 1.00 . A A . 25 PRO CA   1 1 
        8  9418 1 1 25 PRO CB   C  -6.799  10.685  32.108 1.00 . A A . 25 PRO CB   1 1 
        8  9419 1 1 25 PRO CD   C  -6.148  12.420  30.602 1.00 . A A . 25 PRO CD   1 1 
        8  9420 1 1 25 PRO CG   C  -7.065  11.207  30.742 1.00 . A A . 25 PRO CG   1 1 
        8  9421 1 1 25 PRO HA   H  -7.597  12.295  33.254 1.00 . A A . 25 PRO HA   1 1 
        8  9422 1 1 25 PRO HB2  H  -5.891  10.095  32.120 1.00 . A A . 25 PRO HB2  1 1 
        8  9423 1 1 25 PRO HB3  H  -7.638  10.103  32.457 1.00 . A A . 25 PRO HB3  1 1 
        8  9424 1 1 25 PRO HD2  H  -5.191  12.114  30.226 1.00 . A A . 25 PRO HD2  1 1 
        8  9425 1 1 25 PRO HD3  H  -6.592  13.171  29.974 1.00 . A A . 25 PRO HD3  1 1 
        8  9426 1 1 25 PRO HG2  H  -6.824  10.457  30.000 1.00 . A A . 25 PRO HG2  1 1 
        8  9427 1 1 25 PRO HG3  H  -8.095  11.514  30.650 1.00 . A A . 25 PRO HG3  1 1 
        8  9428 1 1 25 PRO N    N  -6.032  12.923  31.976 1.00 . A A . 25 PRO N    1 1 
        8  9429 1 1 25 PRO O    O  -6.314  11.300  35.215 1.00 . A A . 25 PRO O    1 1 
        8  9430 1 1 26 VAL C    C  -4.147  12.571  36.453 1.00 . A A . 26 VAL C    1 1 
        8  9431 1 1 26 VAL CA   C  -3.651  11.674  35.315 1.00 . A A . 26 VAL CA   1 1 
        8  9432 1 1 26 VAL CB   C  -2.184  11.984  35.010 1.00 . A A . 26 VAL CB   1 1 
        8  9433 1 1 26 VAL CG1  C  -2.020  13.484  34.754 1.00 . A A . 26 VAL CG1  1 1 
        8  9434 1 1 26 VAL CG2  C  -1.316  11.572  36.202 1.00 . A A . 26 VAL CG2  1 1 
        8  9435 1 1 26 VAL H    H  -4.043  12.244  33.315 1.00 . A A . 26 VAL H    1 1 
        8  9436 1 1 26 VAL HA   H  -3.737  10.649  35.648 1.00 . A A . 26 VAL HA   1 1 
        8  9437 1 1 26 VAL HB   H  -1.876  11.434  34.131 1.00 . A A . 26 VAL HB   1 1 
        8  9438 1 1 26 VAL HG11 H  -2.811  13.827  34.102 1.00 . A A . 26 VAL HG11 1 1 
        8  9439 1 1 26 VAL HG12 H  -1.064  13.669  34.288 1.00 . A A . 26 VAL HG12 1 1 
        8  9440 1 1 26 VAL HG13 H  -2.071  14.018  35.692 1.00 . A A . 26 VAL HG13 1 1 
        8  9441 1 1 26 VAL HG21 H  -0.277  11.746  35.966 1.00 . A A . 26 VAL HG21 1 1 
        8  9442 1 1 26 VAL HG22 H  -1.467  10.524  36.412 1.00 . A A . 26 VAL HG22 1 1 
        8  9443 1 1 26 VAL HG23 H  -1.592  12.157  37.066 1.00 . A A . 26 VAL HG23 1 1 
        8  9444 1 1 26 VAL N    N  -4.467  11.894  34.126 1.00 . A A . 26 VAL N    1 1 
        8  9445 1 1 26 VAL O    O  -4.202  12.146  37.608 1.00 . A A . 26 VAL O    1 1 
        8  9446 1 1 27 LEU C    C  -6.025  14.286  38.025 1.00 . A A . 27 LEU C    1 1 
        8  9447 1 1 27 LEU CA   C  -4.902  14.805  37.120 1.00 . A A . 27 LEU CA   1 1 
        8  9448 1 1 27 LEU CB   C  -5.401  16.051  36.375 1.00 . A A . 27 LEU CB   1 1 
        8  9449 1 1 27 LEU CD1  C  -4.664  17.566  38.253 1.00 . A A . 27 LEU CD1  1 1 
        8  9450 1 1 27 LEU CD2  C  -6.346  18.354  36.567 1.00 . A A . 27 LEU CD2  1 1 
        8  9451 1 1 27 LEU CG   C  -5.844  17.143  37.363 1.00 . A A . 27 LEU CG   1 1 
        8  9452 1 1 27 LEU H    H  -4.327  14.145  35.215 1.00 . A A . 27 LEU H    1 1 
        8  9453 1 1 27 LEU HA   H  -4.037  15.092  37.697 1.00 . A A . 27 LEU HA   1 1 
        8  9454 1 1 27 LEU HB2  H  -4.606  16.435  35.754 1.00 . A A . 27 LEU HB2  1 1 
        8  9455 1 1 27 LEU HB3  H  -6.239  15.778  35.749 1.00 . A A . 27 LEU HB3  1 1 
        8  9456 1 1 27 LEU HD11 H  -3.751  17.562  37.674 1.00 . A A . 27 LEU HD11 1 1 
        8  9457 1 1 27 LEU HD12 H  -4.569  16.875  39.078 1.00 . A A . 27 LEU HD12 1 1 
        8  9458 1 1 27 LEU HD13 H  -4.838  18.559  38.642 1.00 . A A . 27 LEU HD13 1 1 
        8  9459 1 1 27 LEU HD21 H  -7.193  18.062  35.965 1.00 . A A . 27 LEU HD21 1 1 
        8  9460 1 1 27 LEU HD22 H  -5.555  18.715  35.926 1.00 . A A . 27 LEU HD22 1 1 
        8  9461 1 1 27 LEU HD23 H  -6.641  19.136  37.251 1.00 . A A . 27 LEU HD23 1 1 
        8  9462 1 1 27 LEU HG   H  -6.645  16.770  37.984 1.00 . A A . 27 LEU HG   1 1 
        8  9463 1 1 27 LEU N    N  -4.462  13.820  36.130 1.00 . A A . 27 LEU N    1 1 
        8  9464 1 1 27 LEU O    O  -6.172  14.740  39.159 1.00 . A A . 27 LEU O    1 1 
        8  9465 1 1 28 VAL C    C  -7.453  11.910  39.419 1.00 . A A . 28 VAL C    1 1 
        8  9466 1 1 28 VAL CA   C  -7.947  12.807  38.285 1.00 . A A . 28 VAL CA   1 1 
        8  9467 1 1 28 VAL CB   C  -8.894  12.014  37.361 1.00 . A A . 28 VAL CB   1 1 
        8  9468 1 1 28 VAL CG1  C  -9.051  12.772  36.039 1.00 . A A . 28 VAL CG1  1 1 
        8  9469 1 1 28 VAL CG2  C  -8.354  10.588  37.099 1.00 . A A . 28 VAL CG2  1 1 
        8  9470 1 1 28 VAL H    H  -6.668  13.004  36.616 1.00 . A A . 28 VAL H    1 1 
        8  9471 1 1 28 VAL HA   H  -8.502  13.635  38.702 1.00 . A A . 28 VAL HA   1 1 
        8  9472 1 1 28 VAL HB   H  -9.865  11.946  37.835 1.00 . A A . 28 VAL HB   1 1 
        8  9473 1 1 28 VAL HG11 H  -8.101  12.802  35.526 1.00 . A A . 28 VAL HG11 1 1 
        8  9474 1 1 28 VAL HG12 H  -9.383  13.780  36.238 1.00 . A A . 28 VAL HG12 1 1 
        8  9475 1 1 28 VAL HG13 H  -9.779  12.269  35.420 1.00 . A A . 28 VAL HG13 1 1 
        8  9476 1 1 28 VAL HG21 H  -8.663  10.250  36.118 1.00 . A A . 28 VAL HG21 1 1 
        8  9477 1 1 28 VAL HG22 H  -8.746   9.913  37.845 1.00 . A A . 28 VAL HG22 1 1 
        8  9478 1 1 28 VAL HG23 H  -7.278  10.587  37.155 1.00 . A A . 28 VAL HG23 1 1 
        8  9479 1 1 28 VAL N    N  -6.829  13.356  37.517 1.00 . A A . 28 VAL N    1 1 
        8  9480 1 1 28 VAL O    O  -8.099  11.783  40.459 1.00 . A A . 28 VAL O    1 1 
        8  9481 1 1 29 ILE C    C  -5.396  11.154  41.478 1.00 . A A . 29 ILE C    1 1 
        8  9482 1 1 29 ILE CA   C  -5.699  10.405  40.184 1.00 . A A . 29 ILE CA   1 1 
        8  9483 1 1 29 ILE CB   C  -4.408   9.796  39.624 1.00 . A A . 29 ILE CB   1 1 
        8  9484 1 1 29 ILE CD1  C  -5.718   7.806  38.732 1.00 . A A . 29 ILE CD1  1 1 
        8  9485 1 1 29 ILE CG1  C  -4.722   8.927  38.391 1.00 . A A . 29 ILE CG1  1 1 
        8  9486 1 1 29 ILE CG2  C  -3.720   8.945  40.697 1.00 . A A . 29 ILE CG2  1 1 
        8  9487 1 1 29 ILE H    H  -5.810  11.485  38.369 1.00 . A A . 29 ILE H    1 1 
        8  9488 1 1 29 ILE HA   H  -6.387   9.617  40.438 1.00 . A A . 29 ILE HA   1 1 
        8  9489 1 1 29 ILE HB   H  -3.742  10.596  39.334 1.00 . A A . 29 ILE HB   1 1 
        8  9490 1 1 29 ILE HD11 H  -5.570   6.979  38.053 1.00 . A A . 29 ILE HD11 1 1 
        8  9491 1 1 29 ILE HD12 H  -6.726   8.177  38.627 1.00 . A A . 29 ILE HD12 1 1 
        8  9492 1 1 29 ILE HD13 H  -5.565   7.467  39.745 1.00 . A A . 29 ILE HD13 1 1 
        8  9493 1 1 29 ILE HG12 H  -5.147   9.553  37.619 1.00 . A A . 29 ILE HG12 1 1 
        8  9494 1 1 29 ILE HG13 H  -3.806   8.488  38.025 1.00 . A A . 29 ILE HG13 1 1 
        8  9495 1 1 29 ILE HG21 H  -2.911   8.386  40.249 1.00 . A A . 29 ILE HG21 1 1 
        8  9496 1 1 29 ILE HG22 H  -4.435   8.260  41.128 1.00 . A A . 29 ILE HG22 1 1 
        8  9497 1 1 29 ILE HG23 H  -3.325   9.587  41.472 1.00 . A A . 29 ILE HG23 1 1 
        8  9498 1 1 29 ILE N    N  -6.298  11.293  39.197 1.00 . A A . 29 ILE N    1 1 
        8  9499 1 1 29 ILE O    O  -5.649  10.628  42.560 1.00 . A A . 29 ILE O    1 1 
        8  9500 1 1 30 LEU C    C  -5.782  13.238  43.496 1.00 . A A . 30 LEU C    1 1 
        8  9501 1 1 30 LEU CA   C  -4.540  13.102  42.616 1.00 . A A . 30 LEU CA   1 1 
        8  9502 1 1 30 LEU CB   C  -3.997  14.497  42.264 1.00 . A A . 30 LEU CB   1 1 
        8  9503 1 1 30 LEU CD1  C  -1.657  14.072  43.152 1.00 . A A . 30 LEU CD1  1 1 
        8  9504 1 1 30 LEU CD2  C  -2.293  13.355  40.822 1.00 . A A . 30 LEU CD2  1 1 
        8  9505 1 1 30 LEU CG   C  -2.502  14.418  41.908 1.00 . A A . 30 LEU CG   1 1 
        8  9506 1 1 30 LEU H    H  -4.648  12.772  40.528 1.00 . A A . 30 LEU H    1 1 
        8  9507 1 1 30 LEU HA   H  -3.806  12.570  43.197 1.00 . A A . 30 LEU HA   1 1 
        8  9508 1 1 30 LEU HB2  H  -4.543  14.884  41.416 1.00 . A A . 30 LEU HB2  1 1 
        8  9509 1 1 30 LEU HB3  H  -4.129  15.164  43.105 1.00 . A A . 30 LEU HB3  1 1 
        8  9510 1 1 30 LEU HD11 H  -1.541  13.000  43.238 1.00 . A A . 30 LEU HD11 1 1 
        8  9511 1 1 30 LEU HD12 H  -2.136  14.451  44.043 1.00 . A A . 30 LEU HD12 1 1 
        8  9512 1 1 30 LEU HD13 H  -0.682  14.527  43.055 1.00 . A A . 30 LEU HD13 1 1 
        8  9513 1 1 30 LEU HD21 H  -3.053  13.461  40.062 1.00 . A A . 30 LEU HD21 1 1 
        8  9514 1 1 30 LEU HD22 H  -2.358  12.371  41.263 1.00 . A A . 30 LEU HD22 1 1 
        8  9515 1 1 30 LEU HD23 H  -1.318  13.486  40.376 1.00 . A A . 30 LEU HD23 1 1 
        8  9516 1 1 30 LEU HG   H  -2.185  15.378  41.527 1.00 . A A . 30 LEU HG   1 1 
        8  9517 1 1 30 LEU N    N  -4.855  12.366  41.395 1.00 . A A . 30 LEU N    1 1 
        8  9518 1 1 30 LEU O    O  -5.721  12.929  44.685 1.00 . A A . 30 LEU O    1 1 
        8  9519 1 1 31 LEU C    C  -8.444  12.573  44.458 1.00 . A A . 31 LEU C    1 1 
        8  9520 1 1 31 LEU CA   C  -8.082  13.896  43.787 1.00 . A A . 31 LEU CA   1 1 
        8  9521 1 1 31 LEU CB   C  -9.259  14.343  42.897 1.00 . A A . 31 LEU CB   1 1 
        8  9522 1 1 31 LEU CD1  C  -9.458  16.678  43.881 1.00 . A A . 31 LEU CD1  1 1 
        8  9523 1 1 31 LEU CD2  C  -7.796  16.201  42.049 1.00 . A A . 31 LEU CD2  1 1 
        8  9524 1 1 31 LEU CG   C  -9.184  15.854  42.605 1.00 . A A . 31 LEU CG   1 1 
        8  9525 1 1 31 LEU H    H  -6.924  14.039  42.031 1.00 . A A . 31 LEU H    1 1 
        8  9526 1 1 31 LEU HA   H  -7.878  14.678  44.501 1.00 . A A . 31 LEU HA   1 1 
        8  9527 1 1 31 LEU HB2  H  -9.220  13.799  41.964 1.00 . A A . 31 LEU HB2  1 1 
        8  9528 1 1 31 LEU HB3  H -10.194  14.123  43.395 1.00 . A A . 31 LEU HB3  1 1 
        8  9529 1 1 31 LEU HD11 H -10.118  16.131  44.540 1.00 . A A . 31 LEU HD11 1 1 
        8  9530 1 1 31 LEU HD12 H  -9.927  17.610  43.608 1.00 . A A . 31 LEU HD12 1 1 
        8  9531 1 1 31 LEU HD13 H  -8.530  16.886  44.397 1.00 . A A . 31 LEU HD13 1 1 
        8  9532 1 1 31 LEU HD21 H  -7.060  16.111  42.834 1.00 . A A . 31 LEU HD21 1 1 
        8  9533 1 1 31 LEU HD22 H  -7.803  17.215  41.676 1.00 . A A . 31 LEU HD22 1 1 
        8  9534 1 1 31 LEU HD23 H  -7.551  15.525  41.244 1.00 . A A . 31 LEU HD23 1 1 
        8  9535 1 1 31 LEU HG   H  -9.932  16.102  41.864 1.00 . A A . 31 LEU HG   1 1 
        8  9536 1 1 31 LEU N    N  -6.896  13.723  42.958 1.00 . A A . 31 LEU N    1 1 
        8  9537 1 1 31 LEU O    O  -8.787  12.520  45.639 1.00 . A A . 31 LEU O    1 1 
        8  9538 1 1 32 GLY C    C  -7.614   9.795  45.264 1.00 . A A . 32 GLY C    1 1 
        8  9539 1 1 32 GLY CA   C  -8.604  10.162  44.162 1.00 . A A . 32 GLY CA   1 1 
        8  9540 1 1 32 GLY H    H  -7.998  11.659  42.762 1.00 . A A . 32 GLY H    1 1 
        8  9541 1 1 32 GLY HA2  H  -9.610  10.123  44.554 1.00 . A A . 32 GLY HA2  1 1 
        8  9542 1 1 32 GLY HA3  H  -8.507   9.457  43.350 1.00 . A A . 32 GLY HA3  1 1 
        8  9543 1 1 32 GLY N    N  -8.328  11.508  43.672 1.00 . A A . 32 GLY N    1 1 
        8  9544 1 1 32 GLY O    O  -7.993   9.288  46.316 1.00 . A A . 32 GLY O    1 1 
        8  9545 1 1 33 VAL C    C  -5.764  10.598  47.297 1.00 . A A . 33 VAL C    1 1 
        8  9546 1 1 33 VAL CA   C  -5.321   9.861  46.032 1.00 . A A . 33 VAL CA   1 1 
        8  9547 1 1 33 VAL CB   C  -3.948  10.359  45.567 1.00 . A A . 33 VAL CB   1 1 
        8  9548 1 1 33 VAL CG1  C  -2.965  10.322  46.742 1.00 . A A . 33 VAL CG1  1 1 
        8  9549 1 1 33 VAL CG2  C  -3.427   9.450  44.446 1.00 . A A . 33 VAL CG2  1 1 
        8  9550 1 1 33 VAL H    H  -6.174  10.577  44.173 1.00 . A A . 33 VAL H    1 1 
        8  9551 1 1 33 VAL HA   H  -5.274   8.803  46.250 1.00 . A A . 33 VAL HA   1 1 
        8  9552 1 1 33 VAL HB   H  -4.035  11.372  45.202 1.00 . A A . 33 VAL HB   1 1 
        8  9553 1 1 33 VAL HG11 H  -1.955  10.426  46.371 1.00 . A A . 33 VAL HG11 1 1 
        8  9554 1 1 33 VAL HG12 H  -3.062   9.383  47.264 1.00 . A A . 33 VAL HG12 1 1 
        8  9555 1 1 33 VAL HG13 H  -3.183  11.135  47.418 1.00 . A A . 33 VAL HG13 1 1 
        8  9556 1 1 33 VAL HG21 H  -2.636   9.956  43.912 1.00 . A A . 33 VAL HG21 1 1 
        8  9557 1 1 33 VAL HG22 H  -4.230   9.220  43.763 1.00 . A A . 33 VAL HG22 1 1 
        8  9558 1 1 33 VAL HG23 H  -3.044   8.533  44.870 1.00 . A A . 33 VAL HG23 1 1 
        8  9559 1 1 33 VAL N    N  -6.347  10.114  45.019 1.00 . A A . 33 VAL N    1 1 
        8  9560 1 1 33 VAL O    O  -5.801  10.022  48.385 1.00 . A A . 33 VAL O    1 1 
        8  9561 1 1 34 VAL C    C  -7.768  12.043  48.898 1.00 . A A . 34 VAL C    1 1 
        8  9562 1 1 34 VAL CA   C  -6.525  12.684  48.281 1.00 . A A . 34 VAL CA   1 1 
        8  9563 1 1 34 VAL CB   C  -6.848  14.108  47.818 1.00 . A A . 34 VAL CB   1 1 
        8  9564 1 1 34 VAL CG1  C  -7.509  14.889  48.959 1.00 . A A . 34 VAL CG1  1 1 
        8  9565 1 1 34 VAL CG2  C  -5.552  14.811  47.404 1.00 . A A . 34 VAL CG2  1 1 
        8  9566 1 1 34 VAL H    H  -5.945  12.292  46.266 1.00 . A A . 34 VAL H    1 1 
        8  9567 1 1 34 VAL HA   H  -5.706  12.718  48.983 1.00 . A A . 34 VAL HA   1 1 
        8  9568 1 1 34 VAL HB   H  -7.521  14.067  46.974 1.00 . A A . 34 VAL HB   1 1 
        8  9569 1 1 34 VAL HG11 H  -6.980  14.697  49.881 1.00 . A A . 34 VAL HG11 1 1 
        8  9570 1 1 34 VAL HG12 H  -8.537  14.574  49.061 1.00 . A A . 34 VAL HG12 1 1 
        8  9571 1 1 34 VAL HG13 H  -7.477  15.946  48.739 1.00 . A A . 34 VAL HG13 1 1 
        8  9572 1 1 34 VAL HG21 H  -5.028  14.203  46.681 1.00 . A A . 34 VAL HG21 1 1 
        8  9573 1 1 34 VAL HG22 H  -4.927  14.955  48.272 1.00 . A A . 34 VAL HG22 1 1 
        8  9574 1 1 34 VAL HG23 H  -5.786  15.770  46.965 1.00 . A A . 34 VAL HG23 1 1 
        8  9575 1 1 34 VAL N    N  -6.093  11.877  47.142 1.00 . A A . 34 VAL N    1 1 
        8  9576 1 1 34 VAL O    O  -7.920  11.942  50.112 1.00 . A A . 34 VAL O    1 1 
        8  9577 1 1 35 GLY C    C  -9.538   9.715  49.250 1.00 . A A . 35 GLY C    1 1 
        8  9578 1 1 35 GLY CA   C  -9.880  10.953  48.424 1.00 . A A . 35 GLY CA   1 1 
        8  9579 1 1 35 GLY H    H  -8.403  11.739  47.069 1.00 . A A . 35 GLY H    1 1 
        8  9580 1 1 35 GLY HA2  H -10.467  11.639  49.021 1.00 . A A . 35 GLY HA2  1 1 
        8  9581 1 1 35 GLY HA3  H -10.444  10.657  47.553 1.00 . A A . 35 GLY HA3  1 1 
        8  9582 1 1 35 GLY N    N  -8.644  11.606  48.009 1.00 . A A . 35 GLY N    1 1 
        8  9583 1 1 35 GLY O    O -10.117   9.472  50.309 1.00 . A A . 35 GLY O    1 1 
        8  9584 1 1 36 LEU C    C  -7.315   8.092  50.674 1.00 . A A . 36 LEU C    1 1 
        8  9585 1 1 36 LEU CA   C  -8.115   7.735  49.415 1.00 . A A . 36 LEU CA   1 1 
        8  9586 1 1 36 LEU CB   C  -7.227   6.914  48.446 1.00 . A A . 36 LEU CB   1 1 
        8  9587 1 1 36 LEU CD1  C  -8.983   6.624  46.663 1.00 . A A . 36 LEU CD1  1 1 
        8  9588 1 1 36 LEU CD2  C  -7.130   4.969  46.875 1.00 . A A . 36 LEU CD2  1 1 
        8  9589 1 1 36 LEU CG   C  -8.067   5.897  47.651 1.00 . A A . 36 LEU CG   1 1 
        8  9590 1 1 36 LEU H    H  -8.169   9.209  47.900 1.00 . A A . 36 LEU H    1 1 
        8  9591 1 1 36 LEU HA   H  -8.979   7.146  49.683 1.00 . A A . 36 LEU HA   1 1 
        8  9592 1 1 36 LEU HB2  H  -6.744   7.587  47.755 1.00 . A A . 36 LEU HB2  1 1 
        8  9593 1 1 36 LEU HB3  H  -6.471   6.379  49.006 1.00 . A A . 36 LEU HB3  1 1 
        8  9594 1 1 36 LEU HD11 H  -8.393   7.022  45.851 1.00 . A A . 36 LEU HD11 1 1 
        8  9595 1 1 36 LEU HD12 H  -9.495   7.429  47.166 1.00 . A A . 36 LEU HD12 1 1 
        8  9596 1 1 36 LEU HD13 H  -9.710   5.929  46.268 1.00 . A A . 36 LEU HD13 1 1 
        8  9597 1 1 36 LEU HD21 H  -6.572   4.359  47.569 1.00 . A A . 36 LEU HD21 1 1 
        8  9598 1 1 36 LEU HD22 H  -6.445   5.561  46.285 1.00 . A A . 36 LEU HD22 1 1 
        8  9599 1 1 36 LEU HD23 H  -7.710   4.334  46.222 1.00 . A A . 36 LEU HD23 1 1 
        8  9600 1 1 36 LEU HG   H  -8.667   5.310  48.331 1.00 . A A . 36 LEU HG   1 1 
        8  9601 1 1 36 LEU N    N  -8.578   8.948  48.748 1.00 . A A . 36 LEU N    1 1 
        8  9602 1 1 36 LEU O    O  -7.335   7.366  51.668 1.00 . A A . 36 LEU O    1 1 
        8  9603 1 1 37 SER C    C  -6.860   9.890  52.937 1.00 . A A . 37 SER C    1 1 
        8  9604 1 1 37 SER CA   C  -5.886   9.712  51.779 1.00 . A A . 37 SER CA   1 1 
        8  9605 1 1 37 SER CB   C  -5.164  11.030  51.488 1.00 . A A . 37 SER CB   1 1 
        8  9606 1 1 37 SER H    H  -6.774   9.799  49.825 1.00 . A A . 37 SER H    1 1 
        8  9607 1 1 37 SER HA   H  -5.165   8.964  52.076 1.00 . A A . 37 SER HA   1 1 
        8  9608 1 1 37 SER HB2  H  -4.405  11.199  52.235 1.00 . A A . 37 SER HB2  1 1 
        8  9609 1 1 37 SER HB3  H  -4.696  10.975  50.513 1.00 . A A . 37 SER HB3  1 1 
        8  9610 1 1 37 SER HG   H  -5.927  12.663  50.761 1.00 . A A . 37 SER HG   1 1 
        8  9611 1 1 37 SER N    N  -6.648   9.244  50.622 1.00 . A A . 37 SER N    1 1 
        8  9612 1 1 37 SER O    O  -6.542   9.616  54.065 1.00 . A A . 37 SER O    1 1 
        8  9613 1 1 37 SER OG   O  -6.095  12.100  51.519 1.00 . A A . 37 SER OG   1 1 
        8  9614 1 1 38 ALA C    C  -9.361   9.151  54.361 1.00 . A A . 38 ALA C    1 1 
        8  9615 1 1 38 ALA CA   C  -9.085  10.492  53.660 1.00 . A A . 38 ALA CA   1 1 
        8  9616 1 1 38 ALA CB   C -10.374  11.046  53.051 1.00 . A A . 38 ALA CB   1 1 
        8  9617 1 1 38 ALA H    H  -8.230  10.527  51.685 1.00 . A A . 38 ALA H    1 1 
        8  9618 1 1 38 ALA HA   H  -8.744  11.152  54.443 1.00 . A A . 38 ALA HA   1 1 
        8  9619 1 1 38 ALA HB1  H -11.014  11.416  53.838 1.00 . A A . 38 ALA HB1  1 1 
        8  9620 1 1 38 ALA HB2  H -10.883  10.262  52.511 1.00 . A A . 38 ALA HB2  1 1 
        8  9621 1 1 38 ALA HB3  H -10.134  11.852  52.374 1.00 . A A . 38 ALA HB3  1 1 
        8  9622 1 1 38 ALA N    N  -8.059  10.320  52.628 1.00 . A A . 38 ALA N    1 1 
        8  9623 1 1 38 ALA O    O  -9.585   9.114  55.571 1.00 . A A . 38 ALA O    1 1 
        8  9624 1 1 39 LEU C    C  -8.321   6.277  55.029 1.00 . A A . 39 LEU C    1 1 
        8  9625 1 1 39 LEU CA   C  -9.554   6.746  54.213 1.00 . A A . 39 LEU CA   1 1 
        8  9626 1 1 39 LEU CB   C  -9.868   5.720  53.109 1.00 . A A . 39 LEU CB   1 1 
        8  9627 1 1 39 LEU CD1  C -12.253   5.256  53.852 1.00 . A A . 39 LEU CD1  1 1 
        8  9628 1 1 39 LEU CD2  C -11.726   7.241  52.390 1.00 . A A . 39 LEU CD2  1 1 
        8  9629 1 1 39 LEU CG   C -11.354   5.787  52.714 1.00 . A A . 39 LEU CG   1 1 
        8  9630 1 1 39 LEU H    H  -9.097   8.202  52.665 1.00 . A A . 39 LEU H    1 1 
        8  9631 1 1 39 LEU HA   H -10.394   6.813  54.884 1.00 . A A . 39 LEU HA   1 1 
        8  9632 1 1 39 LEU HB2  H  -9.261   5.938  52.242 1.00 . A A . 39 LEU HB2  1 1 
        8  9633 1 1 39 LEU HB3  H  -9.637   4.723  53.460 1.00 . A A . 39 LEU HB3  1 1 
        8  9634 1 1 39 LEU HD11 H -13.144   4.820  53.424 1.00 . A A . 39 LEU HD11 1 1 
        8  9635 1 1 39 LEU HD12 H -12.537   6.064  54.511 1.00 . A A . 39 LEU HD12 1 1 
        8  9636 1 1 39 LEU HD13 H -11.727   4.502  54.418 1.00 . A A . 39 LEU HD13 1 1 
        8  9637 1 1 39 LEU HD21 H -12.667   7.261  51.860 1.00 . A A . 39 LEU HD21 1 1 
        8  9638 1 1 39 LEU HD22 H -10.956   7.680  51.773 1.00 . A A . 39 LEU HD22 1 1 
        8  9639 1 1 39 LEU HD23 H -11.817   7.803  53.307 1.00 . A A . 39 LEU HD23 1 1 
        8  9640 1 1 39 LEU HG   H -11.510   5.179  51.835 1.00 . A A . 39 LEU HG   1 1 
        8  9641 1 1 39 LEU N    N  -9.323   8.067  53.608 1.00 . A A . 39 LEU N    1 1 
        8  9642 1 1 39 LEU O    O  -8.444   5.866  56.183 1.00 . A A . 39 LEU O    1 1 
        8  9643 1 1 40 THR C    C  -5.085   7.030  55.622 1.00 . A A . 40 THR C    1 1 
        8  9644 1 1 40 THR CA   C  -5.892   5.869  55.023 1.00 . A A . 40 THR CA   1 1 
        8  9645 1 1 40 THR CB   C  -5.028   5.167  53.971 1.00 . A A . 40 THR CB   1 1 
        8  9646 1 1 40 THR CG2  C  -5.781   3.958  53.413 1.00 . A A . 40 THR CG2  1 1 
        8  9647 1 1 40 THR H    H  -7.193   6.618  53.458 1.00 . A A . 40 THR H    1 1 
        8  9648 1 1 40 THR HA   H  -6.123   5.150  55.796 1.00 . A A . 40 THR HA   1 1 
        8  9649 1 1 40 THR HB   H  -4.107   4.836  54.424 1.00 . A A . 40 THR HB   1 1 
        8  9650 1 1 40 THR HG1  H  -3.816   6.329  52.990 1.00 . A A . 40 THR HG1  1 1 
        8  9651 1 1 40 THR HG21 H  -5.155   3.444  52.699 1.00 . A A . 40 THR HG21 1 1 
        8  9652 1 1 40 THR HG22 H  -6.685   4.290  52.926 1.00 . A A . 40 THR HG22 1 1 
        8  9653 1 1 40 THR HG23 H  -6.032   3.287  54.221 1.00 . A A . 40 THR HG23 1 1 
        8  9654 1 1 40 THR N    N  -7.155   6.318  54.391 1.00 . A A . 40 THR N    1 1 
        8  9655 1 1 40 THR O    O  -4.015   6.830  56.198 1.00 . A A . 40 THR O    1 1 
        8  9656 1 1 40 THR OG1  O  -4.738   6.075  52.917 1.00 . A A . 40 THR OG1  1 1 
        8  9657 1 1 41 GLY C    C  -3.615   9.667  55.713 1.00 . A A . 41 GLY C    1 1 
        8  9658 1 1 41 GLY CA   C  -5.041   9.396  56.178 1.00 . A A . 41 GLY CA   1 1 
        8  9659 1 1 41 GLY H    H  -6.588   8.248  55.251 1.00 . A A . 41 GLY H    1 1 
        8  9660 1 1 41 GLY HA2  H  -5.642  10.268  55.980 1.00 . A A . 41 GLY HA2  1 1 
        8  9661 1 1 41 GLY HA3  H  -5.022   9.238  57.248 1.00 . A A . 41 GLY HA3  1 1 
        8  9662 1 1 41 GLY N    N  -5.658   8.216  55.557 1.00 . A A . 41 GLY N    1 1 
        8  9663 1 1 41 GLY O    O  -2.675   9.507  56.492 1.00 . A A . 41 GLY O    1 1 
        8  9664 1 1 42 TYR C    C  -1.955  11.914  53.753 1.00 . A A . 42 TYR C    1 1 
        8  9665 1 1 42 TYR CA   C  -2.099  10.398  53.942 1.00 . A A . 42 TYR CA   1 1 
        8  9666 1 1 42 TYR CB   C  -1.910   9.670  52.580 1.00 . A A . 42 TYR CB   1 1 
        8  9667 1 1 42 TYR CD1  C  -0.889   7.651  53.710 1.00 . A A . 42 TYR CD1  1 1 
        8  9668 1 1 42 TYR CD2  C   0.231   8.587  51.774 1.00 . A A . 42 TYR CD2  1 1 
        8  9669 1 1 42 TYR CE1  C   0.112   6.679  53.820 1.00 . A A . 42 TYR CE1  1 1 
        8  9670 1 1 42 TYR CE2  C   1.232   7.615  51.883 1.00 . A A . 42 TYR CE2  1 1 
        8  9671 1 1 42 TYR CG   C  -0.829   8.606  52.688 1.00 . A A . 42 TYR CG   1 1 
        8  9672 1 1 42 TYR CZ   C   1.173   6.660  52.906 1.00 . A A . 42 TYR CZ   1 1 
        8  9673 1 1 42 TYR H    H  -4.180  10.217  53.840 1.00 . A A . 42 TYR H    1 1 
        8  9674 1 1 42 TYR HA   H  -1.335  10.059  54.628 1.00 . A A . 42 TYR HA   1 1 
        8  9675 1 1 42 TYR HB2  H  -2.840   9.197  52.303 1.00 . A A . 42 TYR HB2  1 1 
        8  9676 1 1 42 TYR HB3  H  -1.635  10.380  51.810 1.00 . A A . 42 TYR HB3  1 1 
        8  9677 1 1 42 TYR HD1  H  -1.707   7.665  54.415 1.00 . A A . 42 TYR HD1  1 1 
        8  9678 1 1 42 TYR HD2  H   0.279   9.323  50.986 1.00 . A A . 42 TYR HD2  1 1 
        8  9679 1 1 42 TYR HE1  H   0.066   5.942  54.608 1.00 . A A . 42 TYR HE1  1 1 
        8  9680 1 1 42 TYR HE2  H   2.051   7.601  51.179 1.00 . A A . 42 TYR HE2  1 1 
        8  9681 1 1 42 TYR HH   H   1.738   4.865  53.222 1.00 . A A . 42 TYR HH   1 1 
        8  9682 1 1 42 TYR N    N  -3.433  10.094  54.462 1.00 . A A . 42 TYR N    1 1 
        8  9683 1 1 42 TYR O    O  -1.101  12.376  52.996 1.00 . A A . 42 TYR O    1 1 
        8  9684 1 1 42 TYR OH   O   2.159   5.701  53.014 1.00 . A A . 42 TYR OH   1 1 
        8  9685 1 1 43 LEU C    C  -1.408  14.732  54.437 1.00 . A A . 43 LEU C    1 1 
        8  9686 1 1 43 LEU CA   C  -2.810  14.132  54.341 1.00 . A A . 43 LEU CA   1 1 
        8  9687 1 1 43 LEU CB   C  -3.552  14.639  55.585 1.00 . A A . 43 LEU CB   1 1 
        8  9688 1 1 43 LEU CD1  C  -5.661  14.548  56.920 1.00 . A A . 43 LEU CD1  1 1 
        8  9689 1 1 43 LEU CD2  C  -5.795  14.664  54.417 1.00 . A A . 43 LEU CD2  1 1 
        8  9690 1 1 43 LEU CG   C  -4.996  14.109  55.611 1.00 . A A . 43 LEU CG   1 1 
        8  9691 1 1 43 LEU H    H  -3.476  12.259  55.017 1.00 . A A . 43 LEU H    1 1 
        8  9692 1 1 43 LEU HA   H  -3.376  14.498  53.499 1.00 . A A . 43 LEU HA   1 1 
        8  9693 1 1 43 LEU HB2  H  -3.033  14.302  56.471 1.00 . A A . 43 LEU HB2  1 1 
        8  9694 1 1 43 LEU HB3  H  -3.570  15.719  55.573 1.00 . A A . 43 LEU HB3  1 1 
        8  9695 1 1 43 LEU HD11 H  -5.131  14.118  57.756 1.00 . A A . 43 LEU HD11 1 1 
        8  9696 1 1 43 LEU HD12 H  -6.688  14.211  56.932 1.00 . A A . 43 LEU HD12 1 1 
        8  9697 1 1 43 LEU HD13 H  -5.636  15.626  56.992 1.00 . A A . 43 LEU HD13 1 1 
        8  9698 1 1 43 LEU HD21 H  -6.850  14.673  54.654 1.00 . A A . 43 LEU HD21 1 1 
        8  9699 1 1 43 LEU HD22 H  -5.634  14.036  53.554 1.00 . A A . 43 LEU HD22 1 1 
        8  9700 1 1 43 LEU HD23 H  -5.470  15.670  54.195 1.00 . A A . 43 LEU HD23 1 1 
        8  9701 1 1 43 LEU HG   H  -4.982  13.029  55.567 1.00 . A A . 43 LEU HG   1 1 
        8  9702 1 1 43 LEU N    N  -2.809  12.673  54.433 1.00 . A A . 43 LEU N    1 1 
        8  9703 1 1 43 LEU O    O  -0.957  15.452  53.546 1.00 . A A . 43 LEU O    1 1 
        8  9704 1 1 44 ASP C    C   1.577  14.295  54.729 1.00 . A A . 44 ASP C    1 1 
        8  9705 1 1 44 ASP CA   C   0.628  14.903  55.758 1.00 . A A . 44 ASP CA   1 1 
        8  9706 1 1 44 ASP CB   C   1.091  14.595  57.181 1.00 . A A . 44 ASP CB   1 1 
        8  9707 1 1 44 ASP CG   C   2.458  15.219  57.446 1.00 . A A . 44 ASP CG   1 1 
        8  9708 1 1 44 ASP H    H  -1.159  13.807  56.173 1.00 . A A . 44 ASP H    1 1 
        8  9709 1 1 44 ASP HA   H   0.631  15.969  55.587 1.00 . A A . 44 ASP HA   1 1 
        8  9710 1 1 44 ASP HB2  H   0.375  14.996  57.884 1.00 . A A . 44 ASP HB2  1 1 
        8  9711 1 1 44 ASP HB3  H   1.158  13.525  57.310 1.00 . A A . 44 ASP HB3  1 1 
        8  9712 1 1 44 ASP N    N  -0.730  14.412  55.534 1.00 . A A . 44 ASP N    1 1 
        8  9713 1 1 44 ASP O    O   2.483  14.967  54.236 1.00 . A A . 44 ASP O    1 1 
        8  9714 1 1 44 ASP OD1  O   3.024  15.781  56.523 1.00 . A A . 44 ASP OD1  1 1 
        8  9715 1 1 44 ASP OD2  O   2.921  15.117  58.569 1.00 . A A . 44 ASP OD2  1 1 
        8  9716 1 1 45 TYR C    C   2.246  13.061  52.112 1.00 . A A . 45 TYR C    1 1 
        8  9717 1 1 45 TYR CA   C   2.245  12.340  53.464 1.00 . A A . 45 TYR CA   1 1 
        8  9718 1 1 45 TYR CB   C   1.781  10.888  53.271 1.00 . A A . 45 TYR CB   1 1 
        8  9719 1 1 45 TYR CD1  C   1.558   9.914  55.594 1.00 . A A . 45 TYR CD1  1 1 
        8  9720 1 1 45 TYR CD2  C   3.463   9.279  54.235 1.00 . A A . 45 TYR CD2  1 1 
        8  9721 1 1 45 TYR CE1  C   2.014   9.082  56.623 1.00 . A A . 45 TYR CE1  1 1 
        8  9722 1 1 45 TYR CE2  C   3.920   8.447  55.265 1.00 . A A . 45 TYR CE2  1 1 
        8  9723 1 1 45 TYR CG   C   2.282  10.012  54.400 1.00 . A A . 45 TYR CG   1 1 
        8  9724 1 1 45 TYR CZ   C   3.195   8.349  56.458 1.00 . A A . 45 TYR CZ   1 1 
        8  9725 1 1 45 TYR H    H   0.671  12.521  54.880 1.00 . A A . 45 TYR H    1 1 
        8  9726 1 1 45 TYR HA   H   3.257  12.336  53.841 1.00 . A A . 45 TYR HA   1 1 
        8  9727 1 1 45 TYR HB2  H   0.702  10.860  53.253 1.00 . A A . 45 TYR HB2  1 1 
        8  9728 1 1 45 TYR HB3  H   2.162  10.506  52.332 1.00 . A A . 45 TYR HB3  1 1 
        8  9729 1 1 45 TYR HD1  H   0.651  10.482  55.724 1.00 . A A . 45 TYR HD1  1 1 
        8  9730 1 1 45 TYR HD2  H   4.022   9.356  53.315 1.00 . A A . 45 TYR HD2  1 1 
        8  9731 1 1 45 TYR HE1  H   1.456   9.006  57.544 1.00 . A A . 45 TYR HE1  1 1 
        8  9732 1 1 45 TYR HE2  H   4.831   7.881  55.137 1.00 . A A . 45 TYR HE2  1 1 
        8  9733 1 1 45 TYR HH   H   4.264   8.030  58.008 1.00 . A A . 45 TYR HH   1 1 
        8  9734 1 1 45 TYR N    N   1.379  13.019  54.421 1.00 . A A . 45 TYR N    1 1 
        8  9735 1 1 45 TYR O    O   3.298  13.155  51.490 1.00 . A A . 45 TYR O    1 1 
        8  9736 1 1 45 TYR OH   O   3.645   7.528  57.473 1.00 . A A . 45 TYR OH   1 1 
        8  9737 1 1 46 VAL C    C   2.222  14.563  49.671 1.00 . A A . 46 VAL C    1 1 
        8  9738 1 1 46 VAL CA   C   0.896  14.194  50.351 1.00 . A A . 46 VAL CA   1 1 
        8  9739 1 1 46 VAL CB   C   0.041  15.459  50.540 1.00 . A A . 46 VAL CB   1 1 
        8  9740 1 1 46 VAL CG1  C   0.036  16.294  49.252 1.00 . A A . 46 VAL CG1  1 1 
        8  9741 1 1 46 VAL CG2  C  -1.398  15.054  50.885 1.00 . A A . 46 VAL CG2  1 1 
        8  9742 1 1 46 VAL H    H   0.255  13.342  52.186 1.00 . A A . 46 VAL H    1 1 
        8  9743 1 1 46 VAL HA   H   0.359  13.527  49.693 1.00 . A A . 46 VAL HA   1 1 
        8  9744 1 1 46 VAL HB   H   0.452  16.049  51.347 1.00 . A A . 46 VAL HB   1 1 
        8  9745 1 1 46 VAL HG11 H  -0.120  15.645  48.403 1.00 . A A . 46 VAL HG11 1 1 
        8  9746 1 1 46 VAL HG12 H   0.983  16.802  49.148 1.00 . A A . 46 VAL HG12 1 1 
        8  9747 1 1 46 VAL HG13 H  -0.759  17.024  49.298 1.00 . A A . 46 VAL HG13 1 1 
        8  9748 1 1 46 VAL HG21 H  -1.385  14.235  51.589 1.00 . A A . 46 VAL HG21 1 1 
        8  9749 1 1 46 VAL HG22 H  -1.913  14.747  49.987 1.00 . A A . 46 VAL HG22 1 1 
        8  9750 1 1 46 VAL HG23 H  -1.912  15.897  51.323 1.00 . A A . 46 VAL HG23 1 1 
        8  9751 1 1 46 VAL N    N   1.064  13.520  51.661 1.00 . A A . 46 VAL N    1 1 
        8  9752 1 1 46 VAL O    O   2.406  14.277  48.487 1.00 . A A . 46 VAL O    1 1 
        8  9753 1 1 47 LEU C    C   5.117  14.412  49.150 1.00 . A A . 47 LEU C    1 1 
        8  9754 1 1 47 LEU CA   C   4.391  15.612  49.789 1.00 . A A . 47 LEU CA   1 1 
        8  9755 1 1 47 LEU CB   C   5.294  16.203  50.891 1.00 . A A . 47 LEU CB   1 1 
        8  9756 1 1 47 LEU CD1  C   5.272  18.579  49.988 1.00 . A A . 47 LEU CD1  1 1 
        8  9757 1 1 47 LEU CD2  C   3.410  17.757  51.474 1.00 . A A . 47 LEU CD2  1 1 
        8  9758 1 1 47 LEU CG   C   4.913  17.667  51.183 1.00 . A A . 47 LEU CG   1 1 
        8  9759 1 1 47 LEU H    H   2.911  15.465  51.308 1.00 . A A . 47 LEU H    1 1 
        8  9760 1 1 47 LEU HA   H   4.198  16.385  49.062 1.00 . A A . 47 LEU HA   1 1 
        8  9761 1 1 47 LEU HB2  H   5.174  15.621  51.793 1.00 . A A . 47 LEU HB2  1 1 
        8  9762 1 1 47 LEU HB3  H   6.328  16.159  50.577 1.00 . A A . 47 LEU HB3  1 1 
        8  9763 1 1 47 LEU HD11 H   4.429  18.664  49.317 1.00 . A A . 47 LEU HD11 1 1 
        8  9764 1 1 47 LEU HD12 H   6.116  18.170  49.450 1.00 . A A . 47 LEU HD12 1 1 
        8  9765 1 1 47 LEU HD13 H   5.531  19.560  50.357 1.00 . A A . 47 LEU HD13 1 1 
        8  9766 1 1 47 LEU HD21 H   3.178  18.736  51.865 1.00 . A A . 47 LEU HD21 1 1 
        8  9767 1 1 47 LEU HD22 H   3.139  17.007  52.202 1.00 . A A . 47 LEU HD22 1 1 
        8  9768 1 1 47 LEU HD23 H   2.855  17.593  50.563 1.00 . A A . 47 LEU HD23 1 1 
        8  9769 1 1 47 LEU HG   H   5.462  18.003  52.051 1.00 . A A . 47 LEU HG   1 1 
        8  9770 1 1 47 LEU N    N   3.122  15.208  50.387 1.00 . A A . 47 LEU N    1 1 
        8  9771 1 1 47 LEU O    O   5.599  14.494  48.023 1.00 . A A . 47 LEU O    1 1 
        8  9772 1 1 48 LEU C    C   5.249  11.500  48.158 1.00 . A A . 48 LEU C    1 1 
        8  9773 1 1 48 LEU CA   C   5.891  12.100  49.435 1.00 . A A . 48 LEU CA   1 1 
        8  9774 1 1 48 LEU CB   C   6.002  11.063  50.578 1.00 . A A . 48 LEU CB   1 1 
        8  9775 1 1 48 LEU CD1  C   7.498  12.575  51.905 1.00 . A A . 48 LEU CD1  1 1 
        8  9776 1 1 48 LEU CD2  C   7.455  10.122  52.383 1.00 . A A . 48 LEU CD2  1 1 
        8  9777 1 1 48 LEU CG   C   7.361  11.183  51.283 1.00 . A A . 48 LEU CG   1 1 
        8  9778 1 1 48 LEU H    H   4.789  13.359  50.793 1.00 . A A . 48 LEU H    1 1 
        8  9779 1 1 48 LEU HA   H   6.884  12.394  49.129 1.00 . A A . 48 LEU HA   1 1 
        8  9780 1 1 48 LEU HB2  H   5.227  11.253  51.306 1.00 . A A . 48 LEU HB2  1 1 
        8  9781 1 1 48 LEU HB3  H   5.891  10.064  50.183 1.00 . A A . 48 LEU HB3  1 1 
        8  9782 1 1 48 LEU HD11 H   6.578  12.837  52.408 1.00 . A A . 48 LEU HD11 1 1 
        8  9783 1 1 48 LEU HD12 H   7.701  13.297  51.129 1.00 . A A . 48 LEU HD12 1 1 
        8  9784 1 1 48 LEU HD13 H   8.309  12.574  52.617 1.00 . A A . 48 LEU HD13 1 1 
        8  9785 1 1 48 LEU HD21 H   8.480  10.033  52.712 1.00 . A A . 48 LEU HD21 1 1 
        8  9786 1 1 48 LEU HD22 H   7.118   9.171  51.996 1.00 . A A . 48 LEU HD22 1 1 
        8  9787 1 1 48 LEU HD23 H   6.833  10.413  53.217 1.00 . A A . 48 LEU HD23 1 1 
        8  9788 1 1 48 LEU HG   H   8.153  11.031  50.564 1.00 . A A . 48 LEU HG   1 1 
        8  9789 1 1 48 LEU N    N   5.201  13.315  49.905 1.00 . A A . 48 LEU N    1 1 
        8  9790 1 1 48 LEU O    O   5.931  11.409  47.137 1.00 . A A . 48 LEU O    1 1 
        8  9791 1 1 49 PRO C    C   3.617  11.423  45.668 1.00 . A A . 49 PRO C    1 1 
        8  9792 1 1 49 PRO CA   C   3.343  10.565  46.909 1.00 . A A . 49 PRO CA   1 1 
        8  9793 1 1 49 PRO CB   C   1.854  10.572  47.262 1.00 . A A . 49 PRO CB   1 1 
        8  9794 1 1 49 PRO CD   C   3.043  11.126  49.274 1.00 . A A . 49 PRO CD   1 1 
        8  9795 1 1 49 PRO CG   C   1.831  10.364  48.733 1.00 . A A . 49 PRO CG   1 1 
        8  9796 1 1 49 PRO HA   H   3.668   9.552  46.740 1.00 . A A . 49 PRO HA   1 1 
        8  9797 1 1 49 PRO HB2  H   1.408  11.525  47.004 1.00 . A A . 49 PRO HB2  1 1 
        8  9798 1 1 49 PRO HB3  H   1.340   9.765  46.761 1.00 . A A . 49 PRO HB3  1 1 
        8  9799 1 1 49 PRO HD2  H   2.769  12.124  49.531 1.00 . A A . 49 PRO HD2  1 1 
        8  9800 1 1 49 PRO HD3  H   3.461  10.610  50.118 1.00 . A A . 49 PRO HD3  1 1 
        8  9801 1 1 49 PRO HG2  H   0.913  10.761  49.153 1.00 . A A . 49 PRO HG2  1 1 
        8  9802 1 1 49 PRO HG3  H   1.925   9.313  48.966 1.00 . A A . 49 PRO HG3  1 1 
        8  9803 1 1 49 PRO N    N   3.990  11.117  48.146 1.00 . A A . 49 PRO N    1 1 
        8  9804 1 1 49 PRO O    O   3.613  10.920  44.544 1.00 . A A . 49 PRO O    1 1 
        8  9805 1 1 50 ALA C    C   5.550  13.243  44.135 1.00 . A A . 50 ALA C    1 1 
        8  9806 1 1 50 ALA CA   C   4.221  13.624  44.789 1.00 . A A . 50 ALA CA   1 1 
        8  9807 1 1 50 ALA CB   C   4.295  15.061  45.310 1.00 . A A . 50 ALA CB   1 1 
        8  9808 1 1 50 ALA H    H   3.957  13.050  46.797 1.00 . A A . 50 ALA H    1 1 
        8  9809 1 1 50 ALA HA   H   3.477  13.573  44.008 1.00 . A A . 50 ALA HA   1 1 
        8  9810 1 1 50 ALA HB1  H   3.484  15.236  46.002 1.00 . A A . 50 ALA HB1  1 1 
        8  9811 1 1 50 ALA HB2  H   4.216  15.748  44.481 1.00 . A A . 50 ALA HB2  1 1 
        8  9812 1 1 50 ALA HB3  H   5.238  15.214  45.814 1.00 . A A . 50 ALA HB3  1 1 
        8  9813 1 1 50 ALA N    N   3.896  12.706  45.882 1.00 . A A . 50 ALA N    1 1 
        8  9814 1 1 50 ALA O    O   5.737  13.459  42.938 1.00 . A A . 50 ALA O    1 1 
        8  9815 1 1 51 LEU C    C   7.519  11.143  43.314 1.00 . A A . 51 LEU C    1 1 
        8  9816 1 1 51 LEU CA   C   7.743  12.238  44.354 1.00 . A A . 51 LEU CA   1 1 
        8  9817 1 1 51 LEU CB   C   8.652  11.700  45.472 1.00 . A A . 51 LEU CB   1 1 
        8  9818 1 1 51 LEU CD1  C  10.351  13.587  45.421 1.00 . A A . 51 LEU CD1  1 1 
        8  9819 1 1 51 LEU CD2  C   8.192  13.851  46.680 1.00 . A A . 51 LEU CD2  1 1 
        8  9820 1 1 51 LEU CG   C   9.284  12.859  46.265 1.00 . A A . 51 LEU CG   1 1 
        8  9821 1 1 51 LEU H    H   6.244  12.464  45.843 1.00 . A A . 51 LEU H    1 1 
        8  9822 1 1 51 LEU HA   H   8.221  13.087  43.893 1.00 . A A . 51 LEU HA   1 1 
        8  9823 1 1 51 LEU HB2  H   8.062  11.093  46.143 1.00 . A A . 51 LEU HB2  1 1 
        8  9824 1 1 51 LEU HB3  H   9.435  11.091  45.043 1.00 . A A . 51 LEU HB3  1 1 
        8  9825 1 1 51 LEU HD11 H  11.086  14.024  46.080 1.00 . A A . 51 LEU HD11 1 1 
        8  9826 1 1 51 LEU HD12 H   9.892  14.369  44.833 1.00 . A A . 51 LEU HD12 1 1 
        8  9827 1 1 51 LEU HD13 H  10.841  12.886  44.760 1.00 . A A . 51 LEU HD13 1 1 
        8  9828 1 1 51 LEU HD21 H   7.332  13.306  47.036 1.00 . A A . 51 LEU HD21 1 1 
        8  9829 1 1 51 LEU HD22 H   7.910  14.455  45.831 1.00 . A A . 51 LEU HD22 1 1 
        8  9830 1 1 51 LEU HD23 H   8.566  14.488  47.469 1.00 . A A . 51 LEU HD23 1 1 
        8  9831 1 1 51 LEU HG   H   9.754  12.460  47.152 1.00 . A A . 51 LEU HG   1 1 
        8  9832 1 1 51 LEU N    N   6.458  12.658  44.906 1.00 . A A . 51 LEU N    1 1 
        8  9833 1 1 51 LEU O    O   8.150  11.122  42.259 1.00 . A A . 51 LEU O    1 1 
        8  9834 1 1 52 ALA C    C   5.737   9.745  41.399 1.00 . A A . 52 ALA C    1 1 
        8  9835 1 1 52 ALA CA   C   6.242   9.169  42.719 1.00 . A A . 52 ALA CA   1 1 
        8  9836 1 1 52 ALA CB   C   5.172   8.270  43.342 1.00 . A A . 52 ALA CB   1 1 
        8  9837 1 1 52 ALA H    H   6.101  10.391  44.469 1.00 . A A . 52 ALA H    1 1 
        8  9838 1 1 52 ALA HA   H   7.123   8.582  42.507 1.00 . A A . 52 ALA HA   1 1 
        8  9839 1 1 52 ALA HB1  H   5.435   8.054  44.368 1.00 . A A . 52 ALA HB1  1 1 
        8  9840 1 1 52 ALA HB2  H   5.107   7.347  42.784 1.00 . A A . 52 ALA HB2  1 1 
        8  9841 1 1 52 ALA HB3  H   4.217   8.775  43.315 1.00 . A A . 52 ALA HB3  1 1 
        8  9842 1 1 52 ALA N    N   6.584  10.256  43.628 1.00 . A A . 52 ALA N    1 1 
        8  9843 1 1 52 ALA O    O   6.119   9.279  40.325 1.00 . A A . 52 ALA O    1 1 
        8  9844 1 1 53 ILE C    C   5.512  12.028  39.455 1.00 . A A . 53 ILE C    1 1 
        8  9845 1 1 53 ILE CA   C   4.375  11.407  40.270 1.00 . A A . 53 ILE CA   1 1 
        8  9846 1 1 53 ILE CB   C   3.348  12.488  40.649 1.00 . A A . 53 ILE CB   1 1 
        8  9847 1 1 53 ILE CD1  C   1.153  11.272  40.167 1.00 . A A . 53 ILE CD1  1 1 
        8  9848 1 1 53 ILE CG1  C   2.084  11.840  41.256 1.00 . A A . 53 ILE CG1  1 1 
        8  9849 1 1 53 ILE CG2  C   2.966  13.302  39.404 1.00 . A A . 53 ILE CG2  1 1 
        8  9850 1 1 53 ILE H    H   4.628  11.107  42.360 1.00 . A A . 53 ILE H    1 1 
        8  9851 1 1 53 ILE HA   H   3.915  10.685  39.620 1.00 . A A . 53 ILE HA   1 1 
        8  9852 1 1 53 ILE HB   H   3.791  13.151  41.377 1.00 . A A . 53 ILE HB   1 1 
        8  9853 1 1 53 ILE HD11 H   0.619  10.420  40.562 1.00 . A A . 53 ILE HD11 1 1 
        8  9854 1 1 53 ILE HD12 H   1.723  10.969  39.306 1.00 . A A . 53 ILE HD12 1 1 
        8  9855 1 1 53 ILE HD13 H   0.444  12.030  39.873 1.00 . A A . 53 ILE HD13 1 1 
        8  9856 1 1 53 ILE HG12 H   2.382  11.039  41.916 1.00 . A A . 53 ILE HG12 1 1 
        8  9857 1 1 53 ILE HG13 H   1.547  12.585  41.825 1.00 . A A . 53 ILE HG13 1 1 
        8  9858 1 1 53 ILE HG21 H   2.063  13.861  39.602 1.00 . A A . 53 ILE HG21 1 1 
        8  9859 1 1 53 ILE HG22 H   2.799  12.632  38.573 1.00 . A A . 53 ILE HG22 1 1 
        8  9860 1 1 53 ILE HG23 H   3.766  13.984  39.162 1.00 . A A . 53 ILE HG23 1 1 
        8  9861 1 1 53 ILE N    N   4.896  10.772  41.479 1.00 . A A . 53 ILE N    1 1 
        8  9862 1 1 53 ILE O    O   5.611  11.769  38.256 1.00 . A A . 53 ILE O    1 1 
        8  9863 1 1 54 PHE C    C   8.355  12.378  38.703 1.00 . A A . 54 PHE C    1 1 
        8  9864 1 1 54 PHE CA   C   7.466  13.451  39.324 1.00 . A A . 54 PHE CA   1 1 
        8  9865 1 1 54 PHE CB   C   8.294  14.343  40.253 1.00 . A A . 54 PHE CB   1 1 
        8  9866 1 1 54 PHE CD1  C   9.094  16.128  38.665 1.00 . A A . 54 PHE CD1  1 1 
        8  9867 1 1 54 PHE CD2  C  10.706  14.540  39.535 1.00 . A A . 54 PHE CD2  1 1 
        8  9868 1 1 54 PHE CE1  C  10.109  16.760  37.937 1.00 . A A . 54 PHE CE1  1 1 
        8  9869 1 1 54 PHE CE2  C  11.722  15.171  38.807 1.00 . A A . 54 PHE CE2  1 1 
        8  9870 1 1 54 PHE CG   C   9.392  15.017  39.464 1.00 . A A . 54 PHE CG   1 1 
        8  9871 1 1 54 PHE CZ   C  11.423  16.281  38.007 1.00 . A A . 54 PHE CZ   1 1 
        8  9872 1 1 54 PHE H    H   6.276  13.058  41.020 1.00 . A A . 54 PHE H    1 1 
        8  9873 1 1 54 PHE HA   H   7.062  14.053  38.525 1.00 . A A . 54 PHE HA   1 1 
        8  9874 1 1 54 PHE HB2  H   7.655  15.094  40.693 1.00 . A A . 54 PHE HB2  1 1 
        8  9875 1 1 54 PHE HB3  H   8.732  13.739  41.034 1.00 . A A . 54 PHE HB3  1 1 
        8  9876 1 1 54 PHE HD1  H   8.080  16.496  38.609 1.00 . A A . 54 PHE HD1  1 1 
        8  9877 1 1 54 PHE HD2  H  10.936  13.683  40.152 1.00 . A A . 54 PHE HD2  1 1 
        8  9878 1 1 54 PHE HE1  H   9.879  17.616  37.320 1.00 . A A . 54 PHE HE1  1 1 
        8  9879 1 1 54 PHE HE2  H  12.735  14.802  38.862 1.00 . A A . 54 PHE HE2  1 1 
        8  9880 1 1 54 PHE HZ   H  12.206  16.768  37.446 1.00 . A A . 54 PHE HZ   1 1 
        8  9881 1 1 54 PHE N    N   6.369  12.838  40.070 1.00 . A A . 54 PHE N    1 1 
        8  9882 1 1 54 PHE O    O   8.775  12.499  37.553 1.00 . A A . 54 PHE O    1 1 
        8  9883 1 1 55 ILE C    C   8.687   9.530  37.791 1.00 . A A . 55 ILE C    1 1 
        8  9884 1 1 55 ILE CA   C   9.413  10.213  38.950 1.00 . A A . 55 ILE CA   1 1 
        8  9885 1 1 55 ILE CB   C   9.663   9.200  40.073 1.00 . A A . 55 ILE CB   1 1 
        8  9886 1 1 55 ILE CD1  C  10.614   8.958  42.374 1.00 . A A . 55 ILE CD1  1 1 
        8  9887 1 1 55 ILE CG1  C  10.604   9.820  41.110 1.00 . A A . 55 ILE CG1  1 1 
        8  9888 1 1 55 ILE CG2  C  10.308   7.933  39.502 1.00 . A A . 55 ILE CG2  1 1 
        8  9889 1 1 55 ILE H    H   8.209  11.255  40.347 1.00 . A A . 55 ILE H    1 1 
        8  9890 1 1 55 ILE HA   H  10.369  10.599  38.625 1.00 . A A . 55 ILE HA   1 1 
        8  9891 1 1 55 ILE HB   H   8.724   8.945  40.544 1.00 . A A . 55 ILE HB   1 1 
        8  9892 1 1 55 ILE HD11 H   9.692   9.105  42.918 1.00 . A A . 55 ILE HD11 1 1 
        8  9893 1 1 55 ILE HD12 H  11.449   9.244  42.997 1.00 . A A . 55 ILE HD12 1 1 
        8  9894 1 1 55 ILE HD13 H  10.708   7.919  42.100 1.00 . A A . 55 ILE HD13 1 1 
        8  9895 1 1 55 ILE HG12 H  11.604   9.869  40.701 1.00 . A A . 55 ILE HG12 1 1 
        8  9896 1 1 55 ILE HG13 H  10.270  10.815  41.355 1.00 . A A . 55 ILE HG13 1 1 
        8  9897 1 1 55 ILE HG21 H   9.562   7.357  38.972 1.00 . A A . 55 ILE HG21 1 1 
        8  9898 1 1 55 ILE HG22 H  10.714   7.339  40.308 1.00 . A A . 55 ILE HG22 1 1 
        8  9899 1 1 55 ILE HG23 H  11.100   8.208  38.822 1.00 . A A . 55 ILE HG23 1 1 
        8  9900 1 1 55 ILE N    N   8.607  11.316  39.455 1.00 . A A . 55 ILE N    1 1 
        8  9901 1 1 55 ILE O    O   9.278   9.191  36.766 1.00 . A A . 55 ILE O    1 1 
        8  9902 1 1 56 GLY C    C   6.455   9.577  35.713 1.00 . A A . 56 GLY C    1 1 
        8  9903 1 1 56 GLY CA   C   6.525   8.731  36.984 1.00 . A A . 56 GLY CA   1 1 
        8  9904 1 1 56 GLY H    H   7.002   9.704  38.821 1.00 . A A . 56 GLY H    1 1 
        8  9905 1 1 56 GLY HA2  H   6.918   7.755  36.740 1.00 . A A . 56 GLY HA2  1 1 
        8  9906 1 1 56 GLY HA3  H   5.529   8.622  37.389 1.00 . A A . 56 GLY HA3  1 1 
        8  9907 1 1 56 GLY N    N   7.383   9.355  37.988 1.00 . A A . 56 GLY N    1 1 
        8  9908 1 1 56 GLY O    O   6.535   9.052  34.602 1.00 . A A . 56 GLY O    1 1 
        8  9909 1 1 57 LEU C    C   7.540  11.723  33.948 1.00 . A A . 57 LEU C    1 1 
        8  9910 1 1 57 LEU CA   C   6.237  11.788  34.736 1.00 . A A . 57 LEU CA   1 1 
        8  9911 1 1 57 LEU CB   C   5.982  13.228  35.198 1.00 . A A . 57 LEU CB   1 1 
        8  9912 1 1 57 LEU CD1  C   4.408  14.733  36.423 1.00 . A A . 57 LEU CD1  1 1 
        8  9913 1 1 57 LEU CD2  C   3.522  13.263  34.590 1.00 . A A . 57 LEU CD2  1 1 
        8  9914 1 1 57 LEU CG   C   4.548  13.370  35.738 1.00 . A A . 57 LEU CG   1 1 
        8  9915 1 1 57 LEU H    H   6.261  11.235  36.802 1.00 . A A . 57 LEU H    1 1 
        8  9916 1 1 57 LEU HA   H   5.435  11.476  34.089 1.00 . A A . 57 LEU HA   1 1 
        8  9917 1 1 57 LEU HB2  H   6.683  13.478  35.981 1.00 . A A . 57 LEU HB2  1 1 
        8  9918 1 1 57 LEU HB3  H   6.123  13.902  34.367 1.00 . A A . 57 LEU HB3  1 1 
        8  9919 1 1 57 LEU HD11 H   5.181  14.842  37.170 1.00 . A A . 57 LEU HD11 1 1 
        8  9920 1 1 57 LEU HD12 H   3.439  14.800  36.895 1.00 . A A . 57 LEU HD12 1 1 
        8  9921 1 1 57 LEU HD13 H   4.504  15.517  35.687 1.00 . A A . 57 LEU HD13 1 1 
        8  9922 1 1 57 LEU HD21 H   3.924  13.707  33.691 1.00 . A A . 57 LEU HD21 1 1 
        8  9923 1 1 57 LEU HD22 H   2.612  13.780  34.866 1.00 . A A . 57 LEU HD22 1 1 
        8  9924 1 1 57 LEU HD23 H   3.292  12.224  34.406 1.00 . A A . 57 LEU HD23 1 1 
        8  9925 1 1 57 LEU HG   H   4.362  12.589  36.460 1.00 . A A . 57 LEU HG   1 1 
        8  9926 1 1 57 LEU N    N   6.310  10.890  35.887 1.00 . A A . 57 LEU N    1 1 
        8  9927 1 1 57 LEU O    O   7.531  11.585  32.724 1.00 . A A . 57 LEU O    1 1 
        8  9928 1 1 58 THR C    C  10.134  10.618  33.129 1.00 . A A . 58 THR C    1 1 
        8  9929 1 1 58 THR CA   C   9.964  11.854  34.006 1.00 . A A . 58 THR CA   1 1 
        8  9930 1 1 58 THR CB   C  11.054  11.854  35.082 1.00 . A A . 58 THR CB   1 1 
        8  9931 1 1 58 THR CG2  C  12.432  11.845  34.418 1.00 . A A . 58 THR CG2  1 1 
        8  9932 1 1 58 THR H    H   8.603  12.053  35.610 1.00 . A A . 58 THR H    1 1 
        8  9933 1 1 58 THR HA   H  10.066  12.757  33.423 1.00 . A A . 58 THR HA   1 1 
        8  9934 1 1 58 THR HB   H  10.951  10.976  35.700 1.00 . A A . 58 THR HB   1 1 
        8  9935 1 1 58 THR HG1  H  11.108  13.782  35.334 1.00 . A A . 58 THR HG1  1 1 
        8  9936 1 1 58 THR HG21 H  13.183  12.115  35.144 1.00 . A A . 58 THR HG21 1 1 
        8  9937 1 1 58 THR HG22 H  12.445  12.556  33.605 1.00 . A A . 58 THR HG22 1 1 
        8  9938 1 1 58 THR HG23 H  12.639  10.858  34.036 1.00 . A A . 58 THR HG23 1 1 
        8  9939 1 1 58 THR N    N   8.657  11.860  34.651 1.00 . A A . 58 THR N    1 1 
        8  9940 1 1 58 THR O    O  10.626  10.701  32.004 1.00 . A A . 58 THR O    1 1 
        8  9941 1 1 58 THR OG1  O  10.923  13.018  35.884 1.00 . A A . 58 THR OG1  1 1 
        8  9942 1 1 59 ILE C    C   8.851   8.325  31.660 1.00 . A A . 59 ILE C    1 1 
        8  9943 1 1 59 ILE CA   C   9.755   8.234  32.890 1.00 . A A . 59 ILE CA   1 1 
        8  9944 1 1 59 ILE CB   C   9.347   7.048  33.769 1.00 . A A . 59 ILE CB   1 1 
        8  9945 1 1 59 ILE CD1  C   9.877   5.847  35.897 1.00 . A A . 59 ILE CD1  1 1 
        8  9946 1 1 59 ILE CG1  C  10.404   6.838  34.857 1.00 . A A . 59 ILE CG1  1 1 
        8  9947 1 1 59 ILE CG2  C   9.243   5.783  32.912 1.00 . A A . 59 ILE CG2  1 1 
        8  9948 1 1 59 ILE H    H   9.249   9.499  34.522 1.00 . A A . 59 ILE H    1 1 
        8  9949 1 1 59 ILE HA   H  10.763   8.087  32.531 1.00 . A A . 59 ILE HA   1 1 
        8  9950 1 1 59 ILE HB   H   8.390   7.253  34.228 1.00 . A A . 59 ILE HB   1 1 
        8  9951 1 1 59 ILE HD11 H  10.683   5.552  36.553 1.00 . A A . 59 ILE HD11 1 1 
        8  9952 1 1 59 ILE HD12 H   9.482   4.976  35.396 1.00 . A A . 59 ILE HD12 1 1 
        8  9953 1 1 59 ILE HD13 H   9.095   6.316  36.476 1.00 . A A . 59 ILE HD13 1 1 
        8  9954 1 1 59 ILE HG12 H  11.306   6.446  34.411 1.00 . A A . 59 ILE HG12 1 1 
        8  9955 1 1 59 ILE HG13 H  10.619   7.781  35.337 1.00 . A A . 59 ILE HG13 1 1 
        8  9956 1 1 59 ILE HG21 H  10.101   5.718  32.260 1.00 . A A . 59 ILE HG21 1 1 
        8  9957 1 1 59 ILE HG22 H   8.342   5.824  32.319 1.00 . A A . 59 ILE HG22 1 1 
        8  9958 1 1 59 ILE HG23 H   9.211   4.914  33.553 1.00 . A A . 59 ILE HG23 1 1 
        8  9959 1 1 59 ILE N    N   9.687   9.479  33.645 1.00 . A A . 59 ILE N    1 1 
        8  9960 1 1 59 ILE O    O   9.233   7.896  30.571 1.00 . A A . 59 ILE O    1 1 
        8  9961 1 1 60 TYR C    C   7.244   9.719  29.542 1.00 . A A . 60 TYR C    1 1 
        8  9962 1 1 60 TYR CA   C   6.681   8.949  30.742 1.00 . A A . 60 TYR CA   1 1 
        8  9963 1 1 60 TYR CB   C   5.396   9.642  31.246 1.00 . A A . 60 TYR CB   1 1 
        8  9964 1 1 60 TYR CD1  C   4.882   7.591  32.640 1.00 . A A . 60 TYR CD1  1 1 
        8  9965 1 1 60 TYR CD2  C   3.059   8.739  31.528 1.00 . A A . 60 TYR CD2  1 1 
        8  9966 1 1 60 TYR CE1  C   3.976   6.664  33.169 1.00 . A A . 60 TYR CE1  1 1 
        8  9967 1 1 60 TYR CE2  C   2.153   7.813  32.057 1.00 . A A . 60 TYR CE2  1 1 
        8  9968 1 1 60 TYR CG   C   4.424   8.628  31.819 1.00 . A A . 60 TYR CG   1 1 
        8  9969 1 1 60 TYR CZ   C   2.612   6.775  32.878 1.00 . A A . 60 TYR CZ   1 1 
        8  9970 1 1 60 TYR H    H   7.347   9.124  32.734 1.00 . A A . 60 TYR H    1 1 
        8  9971 1 1 60 TYR HA   H   6.431   7.957  30.398 1.00 . A A . 60 TYR HA   1 1 
        8  9972 1 1 60 TYR HB2  H   5.657  10.353  32.015 1.00 . A A . 60 TYR HB2  1 1 
        8  9973 1 1 60 TYR HB3  H   4.918  10.168  30.428 1.00 . A A . 60 TYR HB3  1 1 
        8  9974 1 1 60 TYR HD1  H   5.934   7.505  32.866 1.00 . A A . 60 TYR HD1  1 1 
        8  9975 1 1 60 TYR HD2  H   2.705   9.539  30.895 1.00 . A A . 60 TYR HD2  1 1 
        8  9976 1 1 60 TYR HE1  H   4.330   5.864  33.802 1.00 . A A . 60 TYR HE1  1 1 
        8  9977 1 1 60 TYR HE2  H   1.100   7.897  31.832 1.00 . A A . 60 TYR HE2  1 1 
        8  9978 1 1 60 TYR HH   H   1.208   5.497  32.672 1.00 . A A . 60 TYR HH   1 1 
        8  9979 1 1 60 TYR N    N   7.641   8.850  31.840 1.00 . A A . 60 TYR N    1 1 
        8  9980 1 1 60 TYR O    O   7.007   9.324  28.404 1.00 . A A . 60 TYR O    1 1 
        8  9981 1 1 60 TYR OH   O   1.718   5.861  33.399 1.00 . A A . 60 TYR OH   1 1 
        8  9982 1 1 61 ALA C    C   9.690  10.748  27.981 1.00 . A A . 61 ALA C    1 1 
        8  9983 1 1 61 ALA CA   C   8.544  11.527  28.627 1.00 . A A . 61 ALA CA   1 1 
        8  9984 1 1 61 ALA CB   C   9.048  12.897  29.083 1.00 . A A . 61 ALA CB   1 1 
        8  9985 1 1 61 ALA H    H   8.199  11.092  30.672 1.00 . A A . 61 ALA H    1 1 
        8  9986 1 1 61 ALA HA   H   7.811  11.668  27.846 1.00 . A A . 61 ALA HA   1 1 
        8  9987 1 1 61 ALA HB1  H   9.976  12.778  29.622 1.00 . A A . 61 ALA HB1  1 1 
        8  9988 1 1 61 ALA HB2  H   8.312  13.354  29.729 1.00 . A A . 61 ALA HB2  1 1 
        8  9989 1 1 61 ALA HB3  H   9.210  13.526  28.221 1.00 . A A . 61 ALA HB3  1 1 
        8  9990 1 1 61 ALA N    N   7.987  10.797  29.762 1.00 . A A . 61 ALA N    1 1 
        8  9991 1 1 61 ALA O    O   9.694  10.562  26.766 1.00 . A A . 61 ALA O    1 1 
        8  9992 1 1 62 ILE C    C  11.483   8.507  27.288 1.00 . A A . 62 ILE C    1 1 
        8  9993 1 1 62 ILE CA   C  11.859   9.676  28.201 1.00 . A A . 62 ILE CA   1 1 
        8  9994 1 1 62 ILE CB   C  12.708   9.138  29.362 1.00 . A A . 62 ILE CB   1 1 
        8  9995 1 1 62 ILE CD1  C  13.904   9.814  31.452 1.00 . A A . 62 ILE CD1  1 1 
        8  9996 1 1 62 ILE CG1  C  13.298  10.318  30.141 1.00 . A A . 62 ILE CG1  1 1 
        8  9997 1 1 62 ILE CG2  C  13.853   8.273  28.818 1.00 . A A . 62 ILE CG2  1 1 
        8  9998 1 1 62 ILE H    H  10.724  10.620  29.703 1.00 . A A . 62 ILE H    1 1 
        8  9999 1 1 62 ILE HA   H  12.457  10.403  27.672 1.00 . A A . 62 ILE HA   1 1 
        8 10000 1 1 62 ILE HB   H  12.088   8.545  30.018 1.00 . A A . 62 ILE HB   1 1 
        8 10001 1 1 62 ILE HD11 H  14.503   8.936  31.258 1.00 . A A . 62 ILE HD11 1 1 
        8 10002 1 1 62 ILE HD12 H  13.112   9.564  32.141 1.00 . A A . 62 ILE HD12 1 1 
        8 10003 1 1 62 ILE HD13 H  14.525  10.586  31.881 1.00 . A A . 62 ILE HD13 1 1 
        8 10004 1 1 62 ILE HG12 H  14.066  10.792  29.547 1.00 . A A . 62 ILE HG12 1 1 
        8 10005 1 1 62 ILE HG13 H  12.518  11.032  30.358 1.00 . A A . 62 ILE HG13 1 1 
        8 10006 1 1 62 ILE HG21 H  14.311   8.771  27.976 1.00 . A A . 62 ILE HG21 1 1 
        8 10007 1 1 62 ILE HG22 H  13.463   7.316  28.503 1.00 . A A . 62 ILE HG22 1 1 
        8 10008 1 1 62 ILE HG23 H  14.592   8.121  29.592 1.00 . A A . 62 ILE HG23 1 1 
        8 10009 1 1 62 ILE N    N  10.689  10.353  28.760 1.00 . A A . 62 ILE N    1 1 
        8 10010 1 1 62 ILE O    O  12.035   8.369  26.196 1.00 . A A . 62 ILE O    1 1 
        8 10011 1 1 63 GLN C    C   9.380   7.051  25.660 1.00 . A A . 63 GLN C    1 1 
        8 10012 1 1 63 GLN CA   C  10.123   6.550  26.899 1.00 . A A . 63 GLN CA   1 1 
        8 10013 1 1 63 GLN CB   C   9.233   5.594  27.707 1.00 . A A . 63 GLN CB   1 1 
        8 10014 1 1 63 GLN CD   C   6.936   6.290  26.958 1.00 . A A . 63 GLN CD   1 1 
        8 10015 1 1 63 GLN CG   C   7.928   6.295  28.117 1.00 . A A . 63 GLN CG   1 1 
        8 10016 1 1 63 GLN H    H  10.107   7.858  28.582 1.00 . A A . 63 GLN H    1 1 
        8 10017 1 1 63 GLN HA   H  11.000   6.014  26.567 1.00 . A A . 63 GLN HA   1 1 
        8 10018 1 1 63 GLN HB2  H   9.005   4.725  27.108 1.00 . A A . 63 GLN HB2  1 1 
        8 10019 1 1 63 GLN HB3  H   9.762   5.284  28.596 1.00 . A A . 63 GLN HB3  1 1 
        8 10020 1 1 63 GLN HE21 H   5.718   7.611  27.804 1.00 . A A . 63 GLN HE21 1 1 
        8 10021 1 1 63 GLN HE22 H   5.232   7.049  26.277 1.00 . A A . 63 GLN HE22 1 1 
        8 10022 1 1 63 GLN HG2  H   7.495   5.775  28.958 1.00 . A A . 63 GLN HG2  1 1 
        8 10023 1 1 63 GLN HG3  H   8.144   7.311  28.401 1.00 . A A . 63 GLN HG3  1 1 
        8 10024 1 1 63 GLN N    N  10.543   7.679  27.722 1.00 . A A . 63 GLN N    1 1 
        8 10025 1 1 63 GLN NE2  N   5.874   7.046  27.018 1.00 . A A . 63 GLN NE2  1 1 
        8 10026 1 1 63 GLN O    O   9.499   6.475  24.582 1.00 . A A . 63 GLN O    1 1 
        8 10027 1 1 63 GLN OE1  O   7.133   5.580  25.973 1.00 . A A . 63 GLN OE1  1 1 
        8 10028 1 1 64 ARG C    C   8.822   9.643  23.845 1.00 . A A . 64 ARG C    1 1 
        8 10029 1 1 64 ARG CA   C   7.900   8.807  24.754 1.00 . A A . 64 ARG CA   1 1 
        8 10030 1 1 64 ARG CB   C   6.842   9.740  25.359 1.00 . A A . 64 ARG CB   1 1 
        8 10031 1 1 64 ARG CD   C   5.012  11.343  24.750 1.00 . A A . 64 ARG CD   1 1 
        8 10032 1 1 64 ARG CG   C   5.816  10.129  24.286 1.00 . A A . 64 ARG CG   1 1 
        8 10033 1 1 64 ARG CZ   C   5.356  13.737  25.000 1.00 . A A . 64 ARG CZ   1 1 
        8 10034 1 1 64 ARG H    H   8.626   8.596  26.698 1.00 . A A . 64 ARG H    1 1 
        8 10035 1 1 64 ARG HA   H   7.397   8.064  24.165 1.00 . A A . 64 ARG HA   1 1 
        8 10036 1 1 64 ARG HB2  H   6.338   9.233  26.166 1.00 . A A . 64 ARG HB2  1 1 
        8 10037 1 1 64 ARG HB3  H   7.321  10.631  25.737 1.00 . A A . 64 ARG HB3  1 1 
        8 10038 1 1 64 ARG HD2  H   4.160  11.479  24.101 1.00 . A A . 64 ARG HD2  1 1 
        8 10039 1 1 64 ARG HD3  H   4.669  11.177  25.760 1.00 . A A . 64 ARG HD3  1 1 
        8 10040 1 1 64 ARG HE   H   6.790  12.455  24.453 1.00 . A A . 64 ARG HE   1 1 
        8 10041 1 1 64 ARG HG2  H   6.324  10.370  23.368 1.00 . A A . 64 ARG HG2  1 1 
        8 10042 1 1 64 ARG HG3  H   5.145   9.302  24.117 1.00 . A A . 64 ARG HG3  1 1 
        8 10043 1 1 64 ARG HH11 H   3.518  13.054  25.405 1.00 . A A . 64 ARG HH11 1 1 
        8 10044 1 1 64 ARG HH12 H   3.736  14.765  25.573 1.00 . A A . 64 ARG HH12 1 1 
        8 10045 1 1 64 ARG HH21 H   7.080  14.694  24.661 1.00 . A A . 64 ARG HH21 1 1 
        8 10046 1 1 64 ARG HH22 H   5.753  15.694  25.151 1.00 . A A . 64 ARG HH22 1 1 
        8 10047 1 1 64 ARG N    N   8.652   8.149  25.826 1.00 . A A . 64 ARG N    1 1 
        8 10048 1 1 64 ARG NE   N   5.847  12.537  24.709 1.00 . A A . 64 ARG NE   1 1 
        8 10049 1 1 64 ARG NH1  N   4.106  13.862  25.354 1.00 . A A . 64 ARG NH1  1 1 
        8 10050 1 1 64 ARG NH2  N   6.123  14.790  24.932 1.00 . A A . 64 ARG NH2  1 1 
        8 10051 1 1 64 ARG O    O   8.482   9.970  22.711 1.00 . A A . 64 ARG O    1 1 
        8 10052 1 1 65 LYS C    C  11.817  10.138  22.636 1.00 . A A . 65 LYS C    1 1 
        8 10053 1 1 65 LYS CA   C  10.970  10.848  23.715 1.00 . A A . 65 LYS CA   1 1 
        8 10054 1 1 65 LYS CB   C  11.960  11.325  24.794 1.00 . A A . 65 LYS CB   1 1 
        8 10055 1 1 65 LYS CD   C  12.173  13.819  24.420 1.00 . A A . 65 LYS CD   1 1 
        8 10056 1 1 65 LYS CE   C  13.085  14.921  23.877 1.00 . A A . 65 LYS CE   1 1 
        8 10057 1 1 65 LYS CG   C  12.863  12.457  24.254 1.00 . A A . 65 LYS CG   1 1 
        8 10058 1 1 65 LYS H    H  10.206   9.611  25.261 1.00 . A A . 65 LYS H    1 1 
        8 10059 1 1 65 LYS HA   H  10.457  11.733  23.377 1.00 . A A . 65 LYS HA   1 1 
        8 10060 1 1 65 LYS HB2  H  11.407  11.686  25.648 1.00 . A A . 65 LYS HB2  1 1 
        8 10061 1 1 65 LYS HB3  H  12.578  10.494  25.100 1.00 . A A . 65 LYS HB3  1 1 
        8 10062 1 1 65 LYS HD2  H  11.241  13.826  23.876 1.00 . A A . 65 LYS HD2  1 1 
        8 10063 1 1 65 LYS HD3  H  11.980  14.000  25.467 1.00 . A A . 65 LYS HD3  1 1 
        8 10064 1 1 65 LYS HE2  H  13.301  14.728  22.838 1.00 . A A . 65 LYS HE2  1 1 
        8 10065 1 1 65 LYS HE3  H  12.591  15.876  23.971 1.00 . A A . 65 LYS HE3  1 1 
        8 10066 1 1 65 LYS HG2  H  13.792  12.463  24.805 1.00 . A A . 65 LYS HG2  1 1 
        8 10067 1 1 65 LYS HG3  H  13.074  12.293  23.209 1.00 . A A . 65 LYS HG3  1 1 
        8 10068 1 1 65 LYS HZ1  H  14.235  14.401  25.534 1.00 . A A . 65 LYS HZ1  1 1 
        8 10069 1 1 65 LYS HZ2  H  14.607  15.925  24.882 1.00 . A A . 65 LYS HZ2  1 1 
        8 10070 1 1 65 LYS HZ3  H  15.116  14.511  24.088 1.00 . A A . 65 LYS HZ3  1 1 
        8 10071 1 1 65 LYS N    N   9.975  10.004  24.394 1.00 . A A . 65 LYS N    1 1 
        8 10072 1 1 65 LYS NZ   N  14.357  14.941  24.655 1.00 . A A . 65 LYS NZ   1 1 
        8 10073 1 1 65 LYS O    O  12.186  10.711  21.612 1.00 . A A . 65 LYS O    1 1 
        8 10074 1 1 66 ARG C    C  11.956   7.382  20.894 1.00 . A A . 66 ARG C    1 1 
        8 10075 1 1 66 ARG CA   C  12.834   7.987  22.003 1.00 . A A . 66 ARG CA   1 1 
        8 10076 1 1 66 ARG CB   C  13.493   6.857  22.804 1.00 . A A . 66 ARG CB   1 1 
        8 10077 1 1 66 ARG CD   C  15.665   8.033  23.378 1.00 . A A . 66 ARG CD   1 1 
        8 10078 1 1 66 ARG CG   C  14.370   7.424  23.935 1.00 . A A . 66 ARG CG   1 1 
        8 10079 1 1 66 ARG CZ   C  17.238   6.183  23.283 1.00 . A A . 66 ARG CZ   1 1 
        8 10080 1 1 66 ARG H    H  11.540   8.484  23.640 1.00 . A A . 66 ARG H    1 1 
        8 10081 1 1 66 ARG HA   H  13.596   8.563  21.511 1.00 . A A . 66 ARG HA   1 1 
        8 10082 1 1 66 ARG HB2  H  12.724   6.230  23.232 1.00 . A A . 66 ARG HB2  1 1 
        8 10083 1 1 66 ARG HB3  H  14.107   6.263  22.143 1.00 . A A . 66 ARG HB3  1 1 
        8 10084 1 1 66 ARG HD2  H  15.437   8.855  22.723 1.00 . A A . 66 ARG HD2  1 1 
        8 10085 1 1 66 ARG HD3  H  16.260   8.402  24.202 1.00 . A A . 66 ARG HD3  1 1 
        8 10086 1 1 66 ARG HE   H  16.345   6.969  21.673 1.00 . A A . 66 ARG HE   1 1 
        8 10087 1 1 66 ARG HG2  H  13.818   8.188  24.462 1.00 . A A . 66 ARG HG2  1 1 
        8 10088 1 1 66 ARG HG3  H  14.620   6.629  24.623 1.00 . A A . 66 ARG HG3  1 1 
        8 10089 1 1 66 ARG HH11 H  16.834   6.922  25.099 1.00 . A A . 66 ARG HH11 1 1 
        8 10090 1 1 66 ARG HH12 H  17.964   5.610  25.058 1.00 . A A . 66 ARG HH12 1 1 
        8 10091 1 1 66 ARG HH21 H  17.830   5.252  21.612 1.00 . A A . 66 ARG HH21 1 1 
        8 10092 1 1 66 ARG HH22 H  18.528   4.665  23.084 1.00 . A A . 66 ARG HH22 1 1 
        8 10093 1 1 66 ARG N    N  12.074   8.864  22.912 1.00 . A A . 66 ARG N    1 1 
        8 10094 1 1 66 ARG NE   N  16.428   7.025  22.648 1.00 . A A . 66 ARG NE   1 1 
        8 10095 1 1 66 ARG NH1  N  17.355   6.244  24.581 1.00 . A A . 66 ARG NH1  1 1 
        8 10096 1 1 66 ARG NH2  N  17.918   5.298  22.607 1.00 . A A . 66 ARG NH2  1 1 
        8 10097 1 1 66 ARG O    O  12.341   7.325  19.726 1.00 . A A . 66 ARG O    1 1 
        8 10098 1 1 67 GLN C    C   8.920   7.618  19.755 1.00 . A A . 67 GLN C    1 1 
        8 10099 1 1 67 GLN CA   C   9.722   6.478  20.386 1.00 . A A . 67 GLN CA   1 1 
        8 10100 1 1 67 GLN CB   C   8.801   5.509  21.128 1.00 . A A . 67 GLN CB   1 1 
        8 10101 1 1 67 GLN CD   C   7.264   5.319  23.078 1.00 . A A . 67 GLN CD   1 1 
        8 10102 1 1 67 GLN CG   C   7.889   6.281  22.071 1.00 . A A . 67 GLN CG   1 1 
        8 10103 1 1 67 GLN H    H  10.494   7.270  22.199 1.00 . A A . 67 GLN H    1 1 
        8 10104 1 1 67 GLN HA   H  10.220   5.932  19.596 1.00 . A A . 67 GLN HA   1 1 
        8 10105 1 1 67 GLN HB2  H   8.202   4.964  20.415 1.00 . A A . 67 GLN HB2  1 1 
        8 10106 1 1 67 GLN HB3  H   9.403   4.815  21.696 1.00 . A A . 67 GLN HB3  1 1 
        8 10107 1 1 67 GLN HE21 H   5.802   6.554  23.605 1.00 . A A . 67 GLN HE21 1 1 
        8 10108 1 1 67 GLN HE22 H   5.802   5.051  24.394 1.00 . A A . 67 GLN HE22 1 1 
        8 10109 1 1 67 GLN HG2  H   8.473   7.023  22.582 1.00 . A A . 67 GLN HG2  1 1 
        8 10110 1 1 67 GLN HG3  H   7.109   6.765  21.502 1.00 . A A . 67 GLN HG3  1 1 
        8 10111 1 1 67 GLN N    N  10.751   7.008  21.290 1.00 . A A . 67 GLN N    1 1 
        8 10112 1 1 67 GLN NE2  N   6.200   5.671  23.748 1.00 . A A . 67 GLN NE2  1 1 
        8 10113 1 1 67 GLN O    O   8.086   7.408  18.882 1.00 . A A . 67 GLN O    1 1 
        8 10114 1 1 67 GLN OE1  O   7.769   4.210  23.256 1.00 . A A . 67 GLN OE1  1 1 
        8 10115 1 1 68 ALA C    C   8.208   9.982  18.366 1.00 . A A . 68 ALA C    1 1 
        8 10116 1 1 68 ALA CA   C   8.353   9.990  19.900 1.00 . A A . 68 ALA CA   1 1 
        8 10117 1 1 68 ALA CB   C   9.099  11.274  20.340 1.00 . A A . 68 ALA CB   1 1 
        8 10118 1 1 68 ALA H    H   9.809   8.815  21.012 1.00 . A A . 68 ALA H    1 1 
        8 10119 1 1 68 ALA HA   H   7.398   9.950  20.406 1.00 . A A . 68 ALA HA   1 1 
        8 10120 1 1 68 ALA HB1  H   9.120  11.994  19.531 1.00 . A A . 68 ALA HB1  1 1 
        8 10121 1 1 68 ALA HB2  H  10.108  11.021  20.612 1.00 . A A . 68 ALA HB2  1 1 
        8 10122 1 1 68 ALA HB3  H   8.601  11.717  21.192 1.00 . A A . 68 ALA HB3  1 1 
        8 10123 1 1 68 ALA N    N   9.128   8.808  20.309 1.00 . A A . 68 ALA N    1 1 
        8 10124 1 1 68 ALA O    O   7.126  10.232  17.835 1.00 . A A . 68 ALA O    1 1 
        8 10125 1 1 69 ASP C    C   8.198   8.386  15.874 1.00 . A A . 69 ASP C    1 1 
        8 10126 1 1 69 ASP CA   C   9.237   9.450  16.224 1.00 . A A . 69 ASP CA   1 1 
        8 10127 1 1 69 ASP CB   C  10.607   8.986  15.720 1.00 . A A . 69 ASP CB   1 1 
        8 10128 1 1 69 ASP CG   C  10.575   8.841  14.201 1.00 . A A . 69 ASP CG   1 1 
        8 10129 1 1 69 ASP H    H  10.089   9.346  18.175 1.00 . A A . 69 ASP H    1 1 
        8 10130 1 1 69 ASP HA   H   8.980  10.365  15.708 1.00 . A A . 69 ASP HA   1 1 
        8 10131 1 1 69 ASP HB2  H  11.356   9.714  15.997 1.00 . A A . 69 ASP HB2  1 1 
        8 10132 1 1 69 ASP HB3  H  10.850   8.033  16.165 1.00 . A A . 69 ASP HB3  1 1 
        8 10133 1 1 69 ASP N    N   9.281   9.599  17.679 1.00 . A A . 69 ASP N    1 1 
        8 10134 1 1 69 ASP O    O   7.315   8.601  15.045 1.00 . A A . 69 ASP O    1 1 
        8 10135 1 1 69 ASP OD1  O   9.487   8.865  13.651 1.00 . A A . 69 ASP OD1  1 1 
        8 10136 1 1 69 ASP OD2  O  11.634   8.694  13.614 1.00 . A A . 69 ASP OD2  1 1 
        8 10137 1 1 70 ALA C    C   5.996   6.453  16.664 1.00 . A A . 70 ALA C    1 1 
        8 10138 1 1 70 ALA CA   C   7.434   6.107  16.280 1.00 . A A . 70 ALA CA   1 1 
        8 10139 1 1 70 ALA CB   C   7.898   4.890  17.082 1.00 . A A . 70 ALA CB   1 1 
        8 10140 1 1 70 ALA H    H   9.106   7.132  17.112 1.00 . A A . 70 ALA H    1 1 
        8 10141 1 1 70 ALA HA   H   7.460   5.855  15.230 1.00 . A A . 70 ALA HA   1 1 
        8 10142 1 1 70 ALA HB1  H   8.805   4.498  16.646 1.00 . A A . 70 ALA HB1  1 1 
        8 10143 1 1 70 ALA HB2  H   7.131   4.130  17.061 1.00 . A A . 70 ALA HB2  1 1 
        8 10144 1 1 70 ALA HB3  H   8.087   5.183  18.102 1.00 . A A . 70 ALA HB3  1 1 
        8 10145 1 1 70 ALA N    N   8.336   7.232  16.515 1.00 . A A . 70 ALA N    1 1 
        8 10146 1 1 70 ALA O    O   5.053   6.075  15.968 1.00 . A A . 70 ALA O    1 1 
        8 10147 1 1 71 SER C    C   3.833   6.363  18.943 1.00 . A A . 71 SER C    1 1 
        8 10148 1 1 71 SER CA   C   4.508   7.545  18.251 1.00 . A A . 71 SER CA   1 1 
        8 10149 1 1 71 SER CB   C   3.639   8.024  17.082 1.00 . A A . 71 SER CB   1 1 
        8 10150 1 1 71 SER H    H   6.619   7.430  18.290 1.00 . A A . 71 SER H    1 1 
        8 10151 1 1 71 SER HA   H   4.614   8.351  18.964 1.00 . A A . 71 SER HA   1 1 
        8 10152 1 1 71 SER HB2  H   2.935   8.764  17.428 1.00 . A A . 71 SER HB2  1 1 
        8 10153 1 1 71 SER HB3  H   4.271   8.460  16.321 1.00 . A A . 71 SER HB3  1 1 
        8 10154 1 1 71 SER HG   H   3.337   6.113  16.864 1.00 . A A . 71 SER HG   1 1 
        8 10155 1 1 71 SER N    N   5.834   7.163  17.776 1.00 . A A . 71 SER N    1 1 
        8 10156 1 1 71 SER O    O   4.246   5.216  18.778 1.00 . A A . 71 SER O    1 1 
        8 10157 1 1 71 SER OG   O   2.923   6.919  16.545 1.00 . A A . 71 SER OG   1 1 
        8 10158 1 1 72 SER C    C   1.455   4.610  19.462 1.00 . A A . 72 SER C    1 1 
        8 10159 1 1 72 SER CA   C   2.066   5.612  20.437 1.00 . A A . 72 SER CA   1 1 
        8 10160 1 1 72 SER CB   C   0.960   6.239  21.286 1.00 . A A . 72 SER CB   1 1 
        8 10161 1 1 72 SER H    H   2.512   7.588  19.813 1.00 . A A . 72 SER H    1 1 
        8 10162 1 1 72 SER HA   H   2.752   5.092  21.089 1.00 . A A . 72 SER HA   1 1 
        8 10163 1 1 72 SER HB2  H   1.394   6.913  22.005 1.00 . A A . 72 SER HB2  1 1 
        8 10164 1 1 72 SER HB3  H   0.284   6.788  20.645 1.00 . A A . 72 SER HB3  1 1 
        8 10165 1 1 72 SER HG   H   0.674   5.088  22.829 1.00 . A A . 72 SER HG   1 1 
        8 10166 1 1 72 SER N    N   2.794   6.654  19.720 1.00 . A A . 72 SER N    1 1 
        8 10167 1 1 72 SER O    O   1.474   3.403  19.702 1.00 . A A . 72 SER O    1 1 
        8 10168 1 1 72 SER OG   O   0.257   5.212  21.972 1.00 . A A . 72 SER OG   1 1 
        8 10169 1 1 73 THR C    C   0.888   4.550  15.971 1.00 . A A . 73 THR C    1 1 
        8 10170 1 1 73 THR CA   C   0.272   4.283  17.343 1.00 . A A . 73 THR CA   1 1 
        8 10171 1 1 73 THR CB   C  -1.226   4.587  17.292 1.00 . A A . 73 THR CB   1 1 
        8 10172 1 1 73 THR CG2  C  -1.887   4.132  18.595 1.00 . A A . 73 THR CG2  1 1 
        8 10173 1 1 73 THR H    H   0.919   6.096  18.236 1.00 . A A . 73 THR H    1 1 
        8 10174 1 1 73 THR HA   H   0.403   3.239  17.595 1.00 . A A . 73 THR HA   1 1 
        8 10175 1 1 73 THR HB   H  -1.672   4.062  16.464 1.00 . A A . 73 THR HB   1 1 
        8 10176 1 1 73 THR HG1  H  -1.429   6.172  16.185 1.00 . A A . 73 THR HG1  1 1 
        8 10177 1 1 73 THR HG21 H  -2.938   4.381  18.570 1.00 . A A . 73 THR HG21 1 1 
        8 10178 1 1 73 THR HG22 H  -1.418   4.631  19.431 1.00 . A A . 73 THR HG22 1 1 
        8 10179 1 1 73 THR HG23 H  -1.772   3.064  18.703 1.00 . A A . 73 THR HG23 1 1 
        8 10180 1 1 73 THR N    N   0.905   5.124  18.363 1.00 . A A . 73 THR N    1 1 
        8 10181 1 1 73 THR O    O   0.328   5.296  15.166 1.00 . A A . 73 THR O    1 1 
        8 10182 1 1 73 THR OG1  O  -1.414   5.984  17.126 1.00 . A A . 73 THR OG1  1 1 
        8 10183 1 1 74 PRO C    C   1.839   3.893  13.185 1.00 . A A . 74 PRO C    1 1 
        8 10184 1 1 74 PRO CA   C   2.741   4.159  14.391 1.00 . A A . 74 PRO CA   1 1 
        8 10185 1 1 74 PRO CB   C   3.882   3.132  14.464 1.00 . A A . 74 PRO CB   1 1 
        8 10186 1 1 74 PRO CD   C   2.775   3.065  16.591 1.00 . A A . 74 PRO CD   1 1 
        8 10187 1 1 74 PRO CG   C   4.143   2.971  15.923 1.00 . A A . 74 PRO CG   1 1 
        8 10188 1 1 74 PRO HA   H   3.154   5.154  14.335 1.00 . A A . 74 PRO HA   1 1 
        8 10189 1 1 74 PRO HB2  H   3.574   2.189  14.027 1.00 . A A . 74 PRO HB2  1 1 
        8 10190 1 1 74 PRO HB3  H   4.764   3.508  13.968 1.00 . A A . 74 PRO HB3  1 1 
        8 10191 1 1 74 PRO HD2  H   2.305   2.092  16.634 1.00 . A A . 74 PRO HD2  1 1 
        8 10192 1 1 74 PRO HD3  H   2.856   3.497  17.575 1.00 . A A . 74 PRO HD3  1 1 
        8 10193 1 1 74 PRO HG2  H   4.593   2.005  16.117 1.00 . A A . 74 PRO HG2  1 1 
        8 10194 1 1 74 PRO HG3  H   4.781   3.762  16.283 1.00 . A A . 74 PRO HG3  1 1 
        8 10195 1 1 74 PRO N    N   2.029   3.969  15.695 1.00 . A A . 74 PRO N    1 1 
        8 10196 1 1 74 PRO O    O   1.915   4.599  12.178 1.00 . A A . 74 PRO O    1 1 
        8 10197 1 1 75 LYS C    C   0.868   2.388  10.886 1.00 . A A . 75 LYS C    1 1 
        8 10198 1 1 75 LYS CA   C   0.089   2.537  12.190 1.00 . A A . 75 LYS CA   1 1 
        8 10199 1 1 75 LYS CB   C  -0.979   3.626  12.029 1.00 . A A . 75 LYS CB   1 1 
        8 10200 1 1 75 LYS CD   C  -2.947   2.667  13.281 1.00 . A A . 75 LYS CD   1 1 
        8 10201 1 1 75 LYS CE   C  -3.854   2.848  14.500 1.00 . A A . 75 LYS CE   1 1 
        8 10202 1 1 75 LYS CG   C  -1.837   3.728  13.304 1.00 . A A . 75 LYS CG   1 1 
        8 10203 1 1 75 LYS H    H   0.971   2.342  14.110 1.00 . A A . 75 LYS H    1 1 
        8 10204 1 1 75 LYS HA   H  -0.394   1.601  12.411 1.00 . A A . 75 LYS HA   1 1 
        8 10205 1 1 75 LYS HB2  H  -0.492   4.575  11.851 1.00 . A A . 75 LYS HB2  1 1 
        8 10206 1 1 75 LYS HB3  H  -1.611   3.386  11.187 1.00 . A A . 75 LYS HB3  1 1 
        8 10207 1 1 75 LYS HD2  H  -3.532   2.778  12.379 1.00 . A A . 75 LYS HD2  1 1 
        8 10208 1 1 75 LYS HD3  H  -2.510   1.682  13.308 1.00 . A A . 75 LYS HD3  1 1 
        8 10209 1 1 75 LYS HE2  H  -4.635   2.102  14.481 1.00 . A A . 75 LYS HE2  1 1 
        8 10210 1 1 75 LYS HE3  H  -3.272   2.735  15.402 1.00 . A A . 75 LYS HE3  1 1 
        8 10211 1 1 75 LYS HG2  H  -1.213   3.576  14.174 1.00 . A A . 75 LYS HG2  1 1 
        8 10212 1 1 75 LYS HG3  H  -2.285   4.710  13.354 1.00 . A A . 75 LYS HG3  1 1 
        8 10213 1 1 75 LYS HZ1  H  -5.055   4.302  13.616 1.00 . A A . 75 LYS HZ1  1 1 
        8 10214 1 1 75 LYS HZ2  H  -3.713   4.925  14.453 1.00 . A A . 75 LYS HZ2  1 1 
        8 10215 1 1 75 LYS HZ3  H  -5.057   4.340  15.312 1.00 . A A . 75 LYS HZ3  1 1 
        8 10216 1 1 75 LYS N    N   0.990   2.874  13.288 1.00 . A A . 75 LYS N    1 1 
        8 10217 1 1 75 LYS NZ   N  -4.465   4.206  14.468 1.00 . A A . 75 LYS NZ   1 1 
        8 10218 1 1 75 LYS O    O   0.448   2.886   9.841 1.00 . A A . 75 LYS O    1 1 
        8 10219 1 1 76 PHE C    C   3.159  -0.004   9.611 1.00 . A A . 76 PHE C    1 1 
        8 10220 1 1 76 PHE CA   C   2.849   1.481   9.776 1.00 . A A . 76 PHE CA   1 1 
        8 10221 1 1 76 PHE CB   C   4.158   2.260   9.920 1.00 . A A . 76 PHE CB   1 1 
        8 10222 1 1 76 PHE CD1  C   4.790   2.647   7.512 1.00 . A A . 76 PHE CD1  1 1 
        8 10223 1 1 76 PHE CD2  C   6.099   1.082   8.821 1.00 . A A . 76 PHE CD2  1 1 
        8 10224 1 1 76 PHE CE1  C   5.603   2.397   6.399 1.00 . A A . 76 PHE CE1  1 1 
        8 10225 1 1 76 PHE CE2  C   6.911   0.831   7.708 1.00 . A A . 76 PHE CE2  1 1 
        8 10226 1 1 76 PHE CG   C   5.038   1.989   8.722 1.00 . A A . 76 PHE CG   1 1 
        8 10227 1 1 76 PHE CZ   C   6.663   1.489   6.498 1.00 . A A . 76 PHE CZ   1 1 
        8 10228 1 1 76 PHE H    H   2.287   1.327  11.817 1.00 . A A . 76 PHE H    1 1 
        8 10229 1 1 76 PHE HA   H   2.334   1.828   8.890 1.00 . A A . 76 PHE HA   1 1 
        8 10230 1 1 76 PHE HB2  H   3.943   3.317   9.979 1.00 . A A . 76 PHE HB2  1 1 
        8 10231 1 1 76 PHE HB3  H   4.667   1.945  10.819 1.00 . A A . 76 PHE HB3  1 1 
        8 10232 1 1 76 PHE HD1  H   3.972   3.348   7.436 1.00 . A A . 76 PHE HD1  1 1 
        8 10233 1 1 76 PHE HD2  H   6.290   0.573   9.754 1.00 . A A . 76 PHE HD2  1 1 
        8 10234 1 1 76 PHE HE1  H   5.412   2.905   5.466 1.00 . A A . 76 PHE HE1  1 1 
        8 10235 1 1 76 PHE HE2  H   7.729   0.130   7.784 1.00 . A A . 76 PHE HE2  1 1 
        8 10236 1 1 76 PHE HZ   H   7.290   1.295   5.639 1.00 . A A . 76 PHE HZ   1 1 
        8 10237 1 1 76 PHE N    N   2.007   1.698  10.956 1.00 . A A . 76 PHE N    1 1 
        8 10238 1 1 76 PHE O    O   3.618  -0.660  10.546 1.00 . A A . 76 PHE O    1 1 
        8 10239 1 1 77 ASN C    C   2.291  -2.822   9.028 1.00 . A A . 77 ASN C    1 1 
        8 10240 1 1 77 ASN CA   C   3.158  -1.936   8.139 1.00 . A A . 77 ASN CA   1 1 
        8 10241 1 1 77 ASN CB   C   4.638  -2.257   8.373 1.00 . A A . 77 ASN CB   1 1 
        8 10242 1 1 77 ASN CG   C   5.011  -3.559   7.670 1.00 . A A . 77 ASN CG   1 1 
        8 10243 1 1 77 ASN H    H   2.538   0.045   7.709 1.00 . A A . 77 ASN H    1 1 
        8 10244 1 1 77 ASN HA   H   2.916  -2.135   7.106 1.00 . A A . 77 ASN HA   1 1 
        8 10245 1 1 77 ASN HB2  H   5.244  -1.453   7.980 1.00 . A A . 77 ASN HB2  1 1 
        8 10246 1 1 77 ASN HB3  H   4.823  -2.358   9.432 1.00 . A A . 77 ASN HB3  1 1 
        8 10247 1 1 77 ASN HD21 H   6.319  -4.107   9.059 1.00 . A A . 77 ASN HD21 1 1 
        8 10248 1 1 77 ASN HD22 H   6.142  -5.189   7.763 1.00 . A A . 77 ASN HD22 1 1 
        8 10249 1 1 77 ASN N    N   2.904  -0.526   8.416 1.00 . A A . 77 ASN N    1 1 
        8 10250 1 1 77 ASN ND2  N   5.898  -4.351   8.209 1.00 . A A . 77 ASN ND2  1 1 
        8 10251 1 1 77 ASN O    O   1.868  -2.410  10.109 1.00 . A A . 77 ASN O    1 1 
        8 10252 1 1 77 ASN OD1  O   4.477  -3.864   6.603 1.00 . A A . 77 ASN OD1  1 1 
        8 10253 1 1 78 GLY C    C   1.015  -6.277   8.555 1.00 . A A . 78 GLY C    1 1 
        8 10254 1 1 78 GLY CA   C   1.211  -4.977   9.325 1.00 . A A . 78 GLY CA   1 1 
        8 10255 1 1 78 GLY H    H   2.394  -4.313   7.697 1.00 . A A . 78 GLY H    1 1 
        8 10256 1 1 78 GLY HA2  H   1.697  -5.190  10.267 1.00 . A A . 78 GLY HA2  1 1 
        8 10257 1 1 78 GLY HA3  H   0.246  -4.532   9.516 1.00 . A A . 78 GLY HA3  1 1 
        8 10258 1 1 78 GLY N    N   2.030  -4.040   8.565 1.00 . A A . 78 GLY N    1 1 
        8 10259 1 1 78 GLY O    O   1.610  -6.477   7.494 1.00 . A A . 78 GLY O    1 1 
        8 10260 1 1 79 VAL C    C  -1.577  -8.797   8.567 1.00 . A A . 79 VAL C    1 1 
        8 10261 1 1 79 VAL CA   C  -0.097  -8.450   8.451 1.00 . A A . 79 VAL CA   1 1 
        8 10262 1 1 79 VAL CB   C   0.738  -9.548   9.111 1.00 . A A . 79 VAL CB   1 1 
        8 10263 1 1 79 VAL CG1  C   0.371  -9.648  10.593 1.00 . A A . 79 VAL CG1  1 1 
        8 10264 1 1 79 VAL CG2  C   0.452 -10.886   8.426 1.00 . A A . 79 VAL CG2  1 1 
        8 10265 1 1 79 VAL H    H  -0.266  -6.946   9.940 1.00 . A A . 79 VAL H    1 1 
        8 10266 1 1 79 VAL HA   H   0.167  -8.394   7.403 1.00 . A A . 79 VAL HA   1 1 
        8 10267 1 1 79 VAL HB   H   1.787  -9.309   9.017 1.00 . A A . 79 VAL HB   1 1 
        8 10268 1 1 79 VAL HG11 H  -0.644 -10.003  10.690 1.00 . A A . 79 VAL HG11 1 1 
        8 10269 1 1 79 VAL HG12 H   0.457  -8.673  11.052 1.00 . A A . 79 VAL HG12 1 1 
        8 10270 1 1 79 VAL HG13 H   1.042 -10.336  11.085 1.00 . A A . 79 VAL HG13 1 1 
        8 10271 1 1 79 VAL HG21 H   0.474 -10.754   7.354 1.00 . A A . 79 VAL HG21 1 1 
        8 10272 1 1 79 VAL HG22 H  -0.523 -11.242   8.725 1.00 . A A . 79 VAL HG22 1 1 
        8 10273 1 1 79 VAL HG23 H   1.203 -11.607   8.715 1.00 . A A . 79 VAL HG23 1 1 
        8 10274 1 1 79 VAL N    N   0.178  -7.163   9.093 1.00 . A A . 79 VAL N    1 1 
        8 10275 1 1 79 VAL O    O  -2.195  -8.589   9.611 1.00 . A A . 79 VAL O    1 1 
        8 10276 1 1 80 LYS C    C  -3.779 -10.964   8.298 1.00 . A A . 80 LYS C    1 1 
        8 10277 1 1 80 LYS CA   C  -3.550  -9.700   7.475 1.00 . A A . 80 LYS CA   1 1 
        8 10278 1 1 80 LYS CB   C  -4.017  -9.934   6.036 1.00 . A A . 80 LYS CB   1 1 
        8 10279 1 1 80 LYS CD   C  -4.438  -8.844   3.827 1.00 . A A . 80 LYS CD   1 1 
        8 10280 1 1 80 LYS CE   C  -4.396  -7.522   3.058 1.00 . A A . 80 LYS CE   1 1 
        8 10281 1 1 80 LYS CG   C  -3.972  -8.612   5.266 1.00 . A A . 80 LYS CG   1 1 
        8 10282 1 1 80 LYS H    H  -1.598  -9.469   6.682 1.00 . A A . 80 LYS H    1 1 
        8 10283 1 1 80 LYS HA   H  -4.128  -8.895   7.901 1.00 . A A . 80 LYS HA   1 1 
        8 10284 1 1 80 LYS HB2  H  -3.366 -10.653   5.559 1.00 . A A . 80 LYS HB2  1 1 
        8 10285 1 1 80 LYS HB3  H  -5.028 -10.311   6.042 1.00 . A A . 80 LYS HB3  1 1 
        8 10286 1 1 80 LYS HD2  H  -3.788  -9.561   3.348 1.00 . A A . 80 LYS HD2  1 1 
        8 10287 1 1 80 LYS HD3  H  -5.450  -9.222   3.832 1.00 . A A . 80 LYS HD3  1 1 
        8 10288 1 1 80 LYS HE2  H  -5.051  -6.808   3.533 1.00 . A A . 80 LYS HE2  1 1 
        8 10289 1 1 80 LYS HE3  H  -3.386  -7.139   3.057 1.00 . A A . 80 LYS HE3  1 1 
        8 10290 1 1 80 LYS HG2  H  -4.621  -7.895   5.744 1.00 . A A . 80 LYS HG2  1 1 
        8 10291 1 1 80 LYS HG3  H  -2.961  -8.235   5.258 1.00 . A A . 80 LYS HG3  1 1 
        8 10292 1 1 80 LYS HZ1  H  -4.550  -6.946   1.062 1.00 . A A . 80 LYS HZ1  1 1 
        8 10293 1 1 80 LYS HZ2  H  -5.879  -7.839   1.632 1.00 . A A . 80 LYS HZ2  1 1 
        8 10294 1 1 80 LYS HZ3  H  -4.410  -8.621   1.288 1.00 . A A . 80 LYS HZ3  1 1 
        8 10295 1 1 80 LYS N    N  -2.140  -9.327   7.485 1.00 . A A . 80 LYS N    1 1 
        8 10296 1 1 80 LYS NZ   N  -4.843  -7.749   1.654 1.00 . A A . 80 LYS NZ   1 1 
        8 10297 1 1 80 LYS O    O  -2.935 -11.859   8.327 1.00 . A A . 80 LYS O    1 1 
        8 10298 1 1 81 LYS C    C  -6.765 -12.244  10.046 1.00 . A A . 81 LYS C    1 1 
        8 10299 1 1 81 LYS CA   C  -5.262 -12.190   9.783 1.00 . A A . 81 LYS CA   1 1 
        8 10300 1 1 81 LYS CB   C  -4.499 -12.124  11.118 1.00 . A A . 81 LYS CB   1 1 
        8 10301 1 1 81 LYS CD   C  -3.165 -14.268  11.181 1.00 . A A . 81 LYS CD   1 1 
        8 10302 1 1 81 LYS CE   C  -3.070 -15.653  11.821 1.00 . A A . 81 LYS CE   1 1 
        8 10303 1 1 81 LYS CG   C  -4.387 -13.528  11.744 1.00 . A A . 81 LYS CG   1 1 
        8 10304 1 1 81 LYS H    H  -5.564 -10.286   8.901 1.00 . A A . 81 LYS H    1 1 
        8 10305 1 1 81 LYS HA   H  -4.970 -13.082   9.254 1.00 . A A . 81 LYS HA   1 1 
        8 10306 1 1 81 LYS HB2  H  -3.509 -11.725  10.942 1.00 . A A . 81 LYS HB2  1 1 
        8 10307 1 1 81 LYS HB3  H  -5.025 -11.470  11.799 1.00 . A A . 81 LYS HB3  1 1 
        8 10308 1 1 81 LYS HD2  H  -3.263 -14.373  10.112 1.00 . A A . 81 LYS HD2  1 1 
        8 10309 1 1 81 LYS HD3  H  -2.270 -13.708  11.407 1.00 . A A . 81 LYS HD3  1 1 
        8 10310 1 1 81 LYS HE2  H  -2.122 -16.104  11.566 1.00 . A A . 81 LYS HE2  1 1 
        8 10311 1 1 81 LYS HE3  H  -3.147 -15.560  12.895 1.00 . A A . 81 LYS HE3  1 1 
        8 10312 1 1 81 LYS HG2  H  -4.281 -13.433  12.816 1.00 . A A . 81 LYS HG2  1 1 
        8 10313 1 1 81 LYS HG3  H  -5.279 -14.096  11.525 1.00 . A A . 81 LYS HG3  1 1 
        8 10314 1 1 81 LYS HZ1  H  -4.506 -16.150  10.398 1.00 . A A . 81 LYS HZ1  1 1 
        8 10315 1 1 81 LYS HZ2  H  -4.967 -16.494  11.997 1.00 . A A . 81 LYS HZ2  1 1 
        8 10316 1 1 81 LYS HZ3  H  -3.840 -17.487  11.203 1.00 . A A . 81 LYS HZ3  1 1 
        8 10317 1 1 81 LYS N    N  -4.929 -11.030   8.963 1.00 . A A . 81 LYS N    1 1 
        8 10318 1 1 81 LYS NZ   N  -4.179 -16.511  11.316 1.00 . A A . 81 LYS NZ   1 1 
        8 10319 1 1 81 LYS O    O  -7.217 -11.548  10.940 1.00 . A A . 81 LYS O    1 1 
        8 10320 1 1 81 LYS OXT  O  -7.442 -12.980   9.347 1.00 . A A . 81 LYS OXT  1 1 
        9 10321 1 1  1 MET C    C  -9.443   5.412  -5.156 1.00 . A A .  1 MET C    1 1 
        9 10322 1 1  1 MET CA   C  -9.993   5.736  -6.547 1.00 . A A .  1 MET CA   1 1 
        9 10323 1 1  1 MET CB   C -10.718   4.508  -7.144 1.00 . A A .  1 MET CB   1 1 
        9 10324 1 1  1 MET CE   C -11.169   4.497 -10.535 1.00 . A A .  1 MET CE   1 1 
        9 10325 1 1  1 MET CG   C -11.937   4.951  -7.966 1.00 . A A .  1 MET CG   1 1 
        9 10326 1 1  1 MET H1   H  -8.380   6.951  -7.055 1.00 . A A .  1 MET H1   1 1 
        9 10327 1 1  1 MET H2   H  -9.211   6.308  -8.390 1.00 . A A .  1 MET H2   1 1 
        9 10328 1 1  1 MET H3   H  -8.175   5.320  -7.474 1.00 . A A .  1 MET H3   1 1 
        9 10329 1 1  1 MET HA   H -10.675   6.571  -6.470 1.00 . A A .  1 MET HA   1 1 
        9 10330 1 1  1 MET HB2  H -10.035   3.970  -7.784 1.00 . A A .  1 MET HB2  1 1 
        9 10331 1 1  1 MET HB3  H -11.050   3.853  -6.350 1.00 . A A .  1 MET HB3  1 1 
        9 10332 1 1  1 MET HE1  H -10.661   3.695 -10.019 1.00 . A A .  1 MET HE1  1 1 
        9 10333 1 1  1 MET HE2  H -10.581   4.804 -11.384 1.00 . A A .  1 MET HE2  1 1 
        9 10334 1 1  1 MET HE3  H -12.139   4.156 -10.874 1.00 . A A .  1 MET HE3  1 1 
        9 10335 1 1  1 MET HG2  H -12.483   4.080  -8.296 1.00 . A A .  1 MET HG2  1 1 
        9 10336 1 1  1 MET HG3  H -12.582   5.568  -7.355 1.00 . A A .  1 MET HG3  1 1 
        9 10337 1 1  1 MET N    N  -8.853   6.107  -7.434 1.00 . A A .  1 MET N    1 1 
        9 10338 1 1  1 MET O    O -10.177   5.423  -4.169 1.00 . A A .  1 MET O    1 1 
        9 10339 1 1  1 MET SD   S -11.386   5.897  -9.408 1.00 . A A .  1 MET SD   1 1 
        9 10340 1 1  2 LYS C    C  -7.585   5.969  -2.854 1.00 . A A .  2 LYS C    1 1 
        9 10341 1 1  2 LYS CA   C  -7.507   4.792  -3.825 1.00 . A A .  2 LYS CA   1 1 
        9 10342 1 1  2 LYS CB   C  -6.043   4.414  -4.065 1.00 . A A .  2 LYS CB   1 1 
        9 10343 1 1  2 LYS CD   C  -4.514   2.557  -4.820 1.00 . A A .  2 LYS CD   1 1 
        9 10344 1 1  2 LYS CE   C  -3.709   3.375  -5.837 1.00 . A A .  2 LYS CE   1 1 
        9 10345 1 1  2 LYS CG   C  -5.968   3.048  -4.764 1.00 . A A .  2 LYS CG   1 1 
        9 10346 1 1  2 LYS H    H  -7.612   5.126  -5.915 1.00 . A A .  2 LYS H    1 1 
        9 10347 1 1  2 LYS HA   H  -8.017   3.947  -3.387 1.00 . A A .  2 LYS HA   1 1 
        9 10348 1 1  2 LYS HB2  H  -5.588   5.164  -4.692 1.00 . A A .  2 LYS HB2  1 1 
        9 10349 1 1  2 LYS HB3  H  -5.520   4.365  -3.121 1.00 . A A .  2 LYS HB3  1 1 
        9 10350 1 1  2 LYS HD2  H  -4.064   2.662  -3.843 1.00 . A A .  2 LYS HD2  1 1 
        9 10351 1 1  2 LYS HD3  H  -4.500   1.517  -5.110 1.00 . A A .  2 LYS HD3  1 1 
        9 10352 1 1  2 LYS HE2  H  -4.217   3.369  -6.789 1.00 . A A .  2 LYS HE2  1 1 
        9 10353 1 1  2 LYS HE3  H  -3.604   4.389  -5.489 1.00 . A A .  2 LYS HE3  1 1 
        9 10354 1 1  2 LYS HG2  H  -6.563   2.332  -4.217 1.00 . A A .  2 LYS HG2  1 1 
        9 10355 1 1  2 LYS HG3  H  -6.351   3.141  -5.769 1.00 . A A .  2 LYS HG3  1 1 
        9 10356 1 1  2 LYS HZ1  H  -2.331   1.846  -5.517 1.00 . A A .  2 LYS HZ1  1 1 
        9 10357 1 1  2 LYS HZ2  H  -1.644   3.399  -5.566 1.00 . A A .  2 LYS HZ2  1 1 
        9 10358 1 1  2 LYS HZ3  H  -2.145   2.644  -7.003 1.00 . A A .  2 LYS HZ3  1 1 
        9 10359 1 1  2 LYS N    N  -8.147   5.121  -5.094 1.00 . A A .  2 LYS N    1 1 
        9 10360 1 1  2 LYS NZ   N  -2.355   2.770  -5.993 1.00 . A A .  2 LYS NZ   1 1 
        9 10361 1 1  2 LYS O    O  -7.815   5.782  -1.659 1.00 . A A .  2 LYS O    1 1 
        9 10362 1 1  3 ASP C    C  -6.601   8.189  -1.281 1.00 . A A .  3 ASP C    1 1 
        9 10363 1 1  3 ASP CA   C  -7.459   8.374  -2.533 1.00 . A A .  3 ASP CA   1 1 
        9 10364 1 1  3 ASP CB   C  -8.909   8.638  -2.123 1.00 . A A .  3 ASP CB   1 1 
        9 10365 1 1  3 ASP CG   C  -9.779   8.770  -3.368 1.00 . A A .  3 ASP CG   1 1 
        9 10366 1 1  3 ASP H    H  -7.223   7.273  -4.332 1.00 . A A .  3 ASP H    1 1 
        9 10367 1 1  3 ASP HA   H  -7.095   9.222  -3.093 1.00 . A A .  3 ASP HA   1 1 
        9 10368 1 1  3 ASP HB2  H  -9.267   7.815  -1.520 1.00 . A A .  3 ASP HB2  1 1 
        9 10369 1 1  3 ASP HB3  H  -8.961   9.552  -1.551 1.00 . A A .  3 ASP HB3  1 1 
        9 10370 1 1  3 ASP N    N  -7.399   7.180  -3.372 1.00 . A A .  3 ASP N    1 1 
        9 10371 1 1  3 ASP O    O  -7.094   8.293  -0.161 1.00 . A A .  3 ASP O    1 1 
        9 10372 1 1  3 ASP OD1  O  -9.221   8.951  -4.438 1.00 . A A .  3 ASP OD1  1 1 
        9 10373 1 1  3 ASP OD2  O -10.987   8.657  -3.240 1.00 . A A .  3 ASP OD2  1 1 
        9 10374 1 1  4 PRO C    C  -4.092   8.965   0.465 1.00 . A A .  4 PRO C    1 1 
        9 10375 1 1  4 PRO CA   C  -4.384   7.684  -0.322 1.00 . A A .  4 PRO CA   1 1 
        9 10376 1 1  4 PRO CB   C  -3.117   7.162  -1.021 1.00 . A A .  4 PRO CB   1 1 
        9 10377 1 1  4 PRO CD   C  -4.663   7.774  -2.763 1.00 . A A .  4 PRO CD   1 1 
        9 10378 1 1  4 PRO CG   C  -3.179   7.738  -2.396 1.00 . A A .  4 PRO CG   1 1 
        9 10379 1 1  4 PRO HA   H  -4.762   6.923   0.335 1.00 . A A .  4 PRO HA   1 1 
        9 10380 1 1  4 PRO HB2  H  -2.226   7.501  -0.504 1.00 . A A .  4 PRO HB2  1 1 
        9 10381 1 1  4 PRO HB3  H  -3.130   6.083  -1.072 1.00 . A A .  4 PRO HB3  1 1 
        9 10382 1 1  4 PRO HD2  H  -4.876   8.624  -3.395 1.00 . A A .  4 PRO HD2  1 1 
        9 10383 1 1  4 PRO HD3  H  -4.960   6.856  -3.241 1.00 . A A .  4 PRO HD3  1 1 
        9 10384 1 1  4 PRO HG2  H  -2.767   8.740  -2.400 1.00 . A A .  4 PRO HG2  1 1 
        9 10385 1 1  4 PRO HG3  H  -2.646   7.111  -3.094 1.00 . A A .  4 PRO HG3  1 1 
        9 10386 1 1  4 PRO N    N  -5.336   7.907  -1.457 1.00 . A A .  4 PRO N    1 1 
        9 10387 1 1  4 PRO O    O  -3.551   8.916   1.567 1.00 . A A .  4 PRO O    1 1 
        9 10388 1 1  5 LYS C    C  -5.244  11.690   1.652 1.00 . A A .  5 LYS C    1 1 
        9 10389 1 1  5 LYS CA   C  -4.225  11.388   0.543 1.00 . A A .  5 LYS CA   1 1 
        9 10390 1 1  5 LYS CB   C  -4.298  12.491  -0.529 1.00 . A A .  5 LYS CB   1 1 
        9 10391 1 1  5 LYS CD   C  -2.781  14.087   0.723 1.00 . A A .  5 LYS CD   1 1 
        9 10392 1 1  5 LYS CE   C  -2.594  15.556   1.103 1.00 . A A .  5 LYS CE   1 1 
        9 10393 1 1  5 LYS CG   C  -4.159  13.903   0.077 1.00 . A A .  5 LYS CG   1 1 
        9 10394 1 1  5 LYS H    H  -4.914  10.083  -0.973 1.00 . A A .  5 LYS H    1 1 
        9 10395 1 1  5 LYS HA   H  -3.227  11.384   0.947 1.00 . A A .  5 LYS HA   1 1 
        9 10396 1 1  5 LYS HB2  H  -3.505  12.339  -1.245 1.00 . A A .  5 LYS HB2  1 1 
        9 10397 1 1  5 LYS HB3  H  -5.248  12.420  -1.040 1.00 . A A .  5 LYS HB3  1 1 
        9 10398 1 1  5 LYS HD2  H  -2.712  13.483   1.615 1.00 . A A .  5 LYS HD2  1 1 
        9 10399 1 1  5 LYS HD3  H  -2.010  13.795   0.026 1.00 . A A .  5 LYS HD3  1 1 
        9 10400 1 1  5 LYS HE2  H  -2.662  16.169   0.216 1.00 . A A .  5 LYS HE2  1 1 
        9 10401 1 1  5 LYS HE3  H  -3.364  15.848   1.801 1.00 . A A .  5 LYS HE3  1 1 
        9 10402 1 1  5 LYS HG2  H  -4.277  14.634  -0.708 1.00 . A A .  5 LYS HG2  1 1 
        9 10403 1 1  5 LYS HG3  H  -4.925  14.062   0.820 1.00 . A A .  5 LYS HG3  1 1 
        9 10404 1 1  5 LYS HZ1  H  -0.742  16.499   1.239 1.00 . A A .  5 LYS HZ1  1 1 
        9 10405 1 1  5 LYS HZ2  H  -0.715  14.856   1.666 1.00 . A A .  5 LYS HZ2  1 1 
        9 10406 1 1  5 LYS HZ3  H  -1.376  16.002   2.732 1.00 . A A .  5 LYS HZ3  1 1 
        9 10407 1 1  5 LYS N    N  -4.453  10.103  -0.108 1.00 . A A .  5 LYS N    1 1 
        9 10408 1 1  5 LYS NZ   N  -1.255  15.742   1.732 1.00 . A A .  5 LYS NZ   1 1 
        9 10409 1 1  5 LYS O    O  -4.885  11.993   2.785 1.00 . A A .  5 LYS O    1 1 
        9 10410 1 1  6 THR C    C  -7.911  10.515   3.079 1.00 . A A .  6 THR C    1 1 
        9 10411 1 1  6 THR CA   C  -7.652  11.750   2.199 1.00 . A A .  6 THR CA   1 1 
        9 10412 1 1  6 THR CB   C  -8.914  12.069   1.393 1.00 . A A .  6 THR CB   1 1 
        9 10413 1 1  6 THR CG2  C  -8.690  13.340   0.572 1.00 . A A .  6 THR CG2  1 1 
        9 10414 1 1  6 THR H    H  -6.689  11.167   0.400 1.00 . A A .  6 THR H    1 1 
        9 10415 1 1  6 THR HA   H  -7.440  12.582   2.843 1.00 . A A .  6 THR HA   1 1 
        9 10416 1 1  6 THR HB   H  -9.743  12.221   2.065 1.00 . A A .  6 THR HB   1 1 
        9 10417 1 1  6 THR HG1  H -10.130  10.760   0.624 1.00 . A A .  6 THR HG1  1 1 
        9 10418 1 1  6 THR HG21 H  -8.665  14.194   1.232 1.00 . A A .  6 THR HG21 1 1 
        9 10419 1 1  6 THR HG22 H  -9.496  13.456  -0.138 1.00 . A A .  6 THR HG22 1 1 
        9 10420 1 1  6 THR HG23 H  -7.752  13.266   0.042 1.00 . A A .  6 THR HG23 1 1 
        9 10421 1 1  6 THR N    N  -6.517  11.551   1.285 1.00 . A A .  6 THR N    1 1 
        9 10422 1 1  6 THR O    O  -8.361  10.608   4.221 1.00 . A A .  6 THR O    1 1 
        9 10423 1 1  6 THR OG1  O  -9.202  10.984   0.521 1.00 . A A .  6 THR OG1  1 1 
        9 10424 1 1  7 LEU C    C  -6.813   8.069   4.454 1.00 . A A .  7 LEU C    1 1 
        9 10425 1 1  7 LEU CA   C  -7.715   8.095   3.210 1.00 . A A .  7 LEU CA   1 1 
        9 10426 1 1  7 LEU CB   C  -7.379   6.925   2.281 1.00 . A A .  7 LEU CB   1 1 
        9 10427 1 1  7 LEU CD1  C  -8.914   5.390   3.565 1.00 . A A .  7 LEU CD1  1 1 
        9 10428 1 1  7 LEU CD2  C  -7.142   4.450   2.060 1.00 . A A .  7 LEU CD2  1 1 
        9 10429 1 1  7 LEU CG   C  -7.487   5.586   3.029 1.00 . A A .  7 LEU CG   1 1 
        9 10430 1 1  7 LEU H    H  -7.102   9.500   1.657 1.00 . A A .  7 LEU H    1 1 
        9 10431 1 1  7 LEU HA   H  -8.740   7.997   3.537 1.00 . A A .  7 LEU HA   1 1 
        9 10432 1 1  7 LEU HB2  H  -8.067   6.921   1.449 1.00 . A A .  7 LEU HB2  1 1 
        9 10433 1 1  7 LEU HB3  H  -6.376   7.045   1.915 1.00 . A A .  7 LEU HB3  1 1 
        9 10434 1 1  7 LEU HD11 H  -9.627   5.778   2.853 1.00 . A A .  7 LEU HD11 1 1 
        9 10435 1 1  7 LEU HD12 H  -9.021   5.913   4.503 1.00 . A A .  7 LEU HD12 1 1 
        9 10436 1 1  7 LEU HD13 H  -9.102   4.336   3.724 1.00 . A A .  7 LEU HD13 1 1 
        9 10437 1 1  7 LEU HD21 H  -6.099   4.514   1.788 1.00 . A A .  7 LEU HD21 1 1 
        9 10438 1 1  7 LEU HD22 H  -7.753   4.536   1.174 1.00 . A A .  7 LEU HD22 1 1 
        9 10439 1 1  7 LEU HD23 H  -7.333   3.499   2.537 1.00 . A A .  7 LEU HD23 1 1 
        9 10440 1 1  7 LEU HG   H  -6.789   5.574   3.855 1.00 . A A .  7 LEU HG   1 1 
        9 10441 1 1  7 LEU N    N  -7.574   9.377   2.507 1.00 . A A .  7 LEU N    1 1 
        9 10442 1 1  7 LEU O    O  -7.244   7.703   5.546 1.00 . A A .  7 LEU O    1 1 
        9 10443 1 1  8 LEU C    C  -4.760   9.812   6.234 1.00 . A A .  8 LEU C    1 1 
        9 10444 1 1  8 LEU CA   C  -4.557   8.581   5.336 1.00 . A A .  8 LEU CA   1 1 
        9 10445 1 1  8 LEU CB   C  -3.155   8.647   4.718 1.00 . A A .  8 LEU CB   1 1 
        9 10446 1 1  8 LEU CD1  C  -1.480   7.510   3.247 1.00 . A A .  8 LEU CD1  1 1 
        9 10447 1 1  8 LEU CD2  C  -2.816   6.142   4.876 1.00 . A A .  8 LEU CD2  1 1 
        9 10448 1 1  8 LEU CG   C  -2.846   7.362   3.930 1.00 . A A .  8 LEU CG   1 1 
        9 10449 1 1  8 LEU H    H  -5.287   8.819   3.395 1.00 . A A .  8 LEU H    1 1 
        9 10450 1 1  8 LEU HA   H  -4.624   7.674   5.914 1.00 . A A .  8 LEU HA   1 1 
        9 10451 1 1  8 LEU HB2  H  -3.100   9.496   4.052 1.00 . A A .  8 LEU HB2  1 1 
        9 10452 1 1  8 LEU HB3  H  -2.425   8.765   5.504 1.00 . A A .  8 LEU HB3  1 1 
        9 10453 1 1  8 LEU HD11 H  -0.726   7.709   3.994 1.00 . A A .  8 LEU HD11 1 1 
        9 10454 1 1  8 LEU HD12 H  -1.513   8.329   2.545 1.00 . A A .  8 LEU HD12 1 1 
        9 10455 1 1  8 LEU HD13 H  -1.239   6.597   2.726 1.00 . A A .  8 LEU HD13 1 1 
        9 10456 1 1  8 LEU HD21 H  -2.456   6.443   5.850 1.00 . A A .  8 LEU HD21 1 1 
        9 10457 1 1  8 LEU HD22 H  -2.163   5.380   4.474 1.00 . A A .  8 LEU HD22 1 1 
        9 10458 1 1  8 LEU HD23 H  -3.812   5.737   4.971 1.00 . A A .  8 LEU HD23 1 1 
        9 10459 1 1  8 LEU HG   H  -3.608   7.214   3.178 1.00 . A A .  8 LEU HG   1 1 
        9 10460 1 1  8 LEU N    N  -5.568   8.490   4.274 1.00 . A A .  8 LEU N    1 1 
        9 10461 1 1  8 LEU O    O  -4.274   9.879   7.363 1.00 . A A .  8 LEU O    1 1 
        9 10462 1 1  9 ARG C    C  -6.716  11.891   7.550 1.00 . A A .  9 ARG C    1 1 
        9 10463 1 1  9 ARG CA   C  -5.775  12.049   6.357 1.00 . A A .  9 ARG CA   1 1 
        9 10464 1 1  9 ARG CB   C  -6.411  13.045   5.392 1.00 . A A .  9 ARG CB   1 1 
        9 10465 1 1  9 ARG CD   C  -6.998  15.457   5.087 1.00 . A A .  9 ARG CD   1 1 
        9 10466 1 1  9 ARG CG   C  -6.631  14.380   6.109 1.00 . A A .  9 ARG CG   1 1 
        9 10467 1 1  9 ARG CZ   C  -7.409  17.851   5.109 1.00 . A A .  9 ARG CZ   1 1 
        9 10468 1 1  9 ARG H    H  -5.949  10.525   4.853 1.00 . A A .  9 ARG H    1 1 
        9 10469 1 1  9 ARG HA   H  -4.843  12.471   6.700 1.00 . A A .  9 ARG HA   1 1 
        9 10470 1 1  9 ARG HB2  H  -5.767  13.194   4.542 1.00 . A A .  9 ARG HB2  1 1 
        9 10471 1 1  9 ARG HB3  H  -7.363  12.660   5.070 1.00 . A A .  9 ARG HB3  1 1 
        9 10472 1 1  9 ARG HD2  H  -6.156  15.634   4.436 1.00 . A A .  9 ARG HD2  1 1 
        9 10473 1 1  9 ARG HD3  H  -7.839  15.120   4.498 1.00 . A A .  9 ARG HD3  1 1 
        9 10474 1 1  9 ARG HE   H  -7.560  16.679   6.725 1.00 . A A .  9 ARG HE   1 1 
        9 10475 1 1  9 ARG HG2  H  -7.435  14.277   6.824 1.00 . A A .  9 ARG HG2  1 1 
        9 10476 1 1  9 ARG HG3  H  -5.727  14.667   6.623 1.00 . A A .  9 ARG HG3  1 1 
        9 10477 1 1  9 ARG HH11 H  -6.828  17.060   3.365 1.00 . A A .  9 ARG HH11 1 1 
        9 10478 1 1  9 ARG HH12 H  -7.152  18.762   3.344 1.00 . A A .  9 ARG HH12 1 1 
        9 10479 1 1  9 ARG HH21 H  -8.004  18.906   6.702 1.00 . A A .  9 ARG HH21 1 1 
        9 10480 1 1  9 ARG HH22 H  -7.817  19.807   5.235 1.00 . A A .  9 ARG HH22 1 1 
        9 10481 1 1  9 ARG N    N  -5.479  10.780   5.675 1.00 . A A .  9 ARG N    1 1 
        9 10482 1 1  9 ARG NE   N  -7.349  16.699   5.768 1.00 . A A .  9 ARG NE   1 1 
        9 10483 1 1  9 ARG NH1  N  -7.107  17.894   3.840 1.00 . A A .  9 ARG NH1  1 1 
        9 10484 1 1  9 ARG NH2  N  -7.772  18.940   5.730 1.00 . A A .  9 ARG NH2  1 1 
        9 10485 1 1  9 ARG O    O  -6.579  12.597   8.548 1.00 . A A .  9 ARG O    1 1 
        9 10486 1 1 10 VAL C    C  -8.081  10.060   9.722 1.00 . A A . 10 VAL C    1 1 
        9 10487 1 1 10 VAL CA   C  -8.660  10.791   8.513 1.00 . A A . 10 VAL CA   1 1 
        9 10488 1 1 10 VAL CB   C  -9.886  10.039   7.990 1.00 . A A . 10 VAL CB   1 1 
        9 10489 1 1 10 VAL CG1  C -10.615  10.909   6.962 1.00 . A A . 10 VAL CG1  1 1 
        9 10490 1 1 10 VAL CG2  C  -9.448   8.730   7.329 1.00 . A A . 10 VAL CG2  1 1 
        9 10491 1 1 10 VAL H    H  -7.752  10.429   6.638 1.00 . A A . 10 VAL H    1 1 
        9 10492 1 1 10 VAL HA   H  -8.990  11.743   8.894 1.00 . A A . 10 VAL HA   1 1 
        9 10493 1 1 10 VAL HB   H -10.553   9.824   8.813 1.00 . A A . 10 VAL HB   1 1 
        9 10494 1 1 10 VAL HG11 H  -9.909  11.263   6.227 1.00 . A A . 10 VAL HG11 1 1 
        9 10495 1 1 10 VAL HG12 H -11.068  11.752   7.462 1.00 . A A . 10 VAL HG12 1 1 
        9 10496 1 1 10 VAL HG13 H -11.381  10.324   6.474 1.00 . A A . 10 VAL HG13 1 1 
        9 10497 1 1 10 VAL HG21 H  -9.033   8.942   6.355 1.00 . A A . 10 VAL HG21 1 1 
        9 10498 1 1 10 VAL HG22 H -10.301   8.078   7.221 1.00 . A A . 10 VAL HG22 1 1 
        9 10499 1 1 10 VAL HG23 H  -8.702   8.248   7.943 1.00 . A A . 10 VAL HG23 1 1 
        9 10500 1 1 10 VAL N    N  -7.689  10.990   7.439 1.00 . A A . 10 VAL N    1 1 
        9 10501 1 1 10 VAL O    O  -8.505  10.333  10.845 1.00 . A A . 10 VAL O    1 1 
        9 10502 1 1 11 SER C    C  -5.659   9.382  11.528 1.00 . A A . 11 SER C    1 1 
        9 10503 1 1 11 SER CA   C  -6.595   8.472  10.729 1.00 . A A . 11 SER CA   1 1 
        9 10504 1 1 11 SER CB   C  -5.842   7.212  10.302 1.00 . A A . 11 SER CB   1 1 
        9 10505 1 1 11 SER H    H  -6.780   8.907   8.672 1.00 . A A . 11 SER H    1 1 
        9 10506 1 1 11 SER HA   H  -7.386   8.187  11.405 1.00 . A A . 11 SER HA   1 1 
        9 10507 1 1 11 SER HB2  H  -5.067   7.471   9.600 1.00 . A A . 11 SER HB2  1 1 
        9 10508 1 1 11 SER HB3  H  -5.396   6.749  11.173 1.00 . A A . 11 SER HB3  1 1 
        9 10509 1 1 11 SER HG   H  -6.288   5.485   9.525 1.00 . A A . 11 SER HG   1 1 
        9 10510 1 1 11 SER N    N  -7.135   9.146   9.553 1.00 . A A . 11 SER N    1 1 
        9 10511 1 1 11 SER O    O  -5.837   9.533  12.707 1.00 . A A . 11 SER O    1 1 
        9 10512 1 1 11 SER OG   O  -6.751   6.311   9.685 1.00 . A A . 11 SER OG   1 1 
        9 10513 1 1 12 ILE C    C  -4.383  11.926  12.443 1.00 . A A . 12 ILE C    1 1 
        9 10514 1 1 12 ILE CA   C  -3.694  10.792  11.645 1.00 . A A . 12 ILE CA   1 1 
        9 10515 1 1 12 ILE CB   C  -2.662  11.379  10.657 1.00 . A A . 12 ILE CB   1 1 
        9 10516 1 1 12 ILE CD1  C  -2.291  12.720   8.575 1.00 . A A . 12 ILE CD1  1 1 
        9 10517 1 1 12 ILE CG1  C  -3.349  12.185   9.544 1.00 . A A . 12 ILE CG1  1 1 
        9 10518 1 1 12 ILE CG2  C  -1.867  10.233  10.019 1.00 . A A . 12 ILE CG2  1 1 
        9 10519 1 1 12 ILE H    H  -4.527   9.732   9.954 1.00 . A A . 12 ILE H    1 1 
        9 10520 1 1 12 ILE HA   H  -3.149  10.144  12.315 1.00 . A A . 12 ILE HA   1 1 
        9 10521 1 1 12 ILE HB   H  -1.981  12.021  11.199 1.00 . A A . 12 ILE HB   1 1 
        9 10522 1 1 12 ILE HD11 H  -1.458  13.122   9.134 1.00 . A A . 12 ILE HD11 1 1 
        9 10523 1 1 12 ILE HD12 H  -2.723  13.499   7.965 1.00 . A A . 12 ILE HD12 1 1 
        9 10524 1 1 12 ILE HD13 H  -1.945  11.917   7.941 1.00 . A A . 12 ILE HD13 1 1 
        9 10525 1 1 12 ILE HG12 H  -4.042  11.553   9.010 1.00 . A A . 12 ILE HG12 1 1 
        9 10526 1 1 12 ILE HG13 H  -3.877  13.021   9.969 1.00 . A A . 12 ILE HG13 1 1 
        9 10527 1 1 12 ILE HG21 H  -1.026  10.637   9.475 1.00 . A A . 12 ILE HG21 1 1 
        9 10528 1 1 12 ILE HG22 H  -2.505   9.687   9.342 1.00 . A A . 12 ILE HG22 1 1 
        9 10529 1 1 12 ILE HG23 H  -1.507   9.568  10.791 1.00 . A A . 12 ILE HG23 1 1 
        9 10530 1 1 12 ILE N    N  -4.655   9.955  10.900 1.00 . A A . 12 ILE N    1 1 
        9 10531 1 1 12 ILE O    O  -4.146  12.136  13.631 1.00 . A A . 12 ILE O    1 1 
        9 10532 1 1 13 ILE C    C  -6.893  13.236  13.477 1.00 . A A . 13 ILE C    1 1 
        9 10533 1 1 13 ILE CA   C  -6.020  13.717  12.289 1.00 . A A . 13 ILE CA   1 1 
        9 10534 1 1 13 ILE CB   C  -6.888  14.377  11.214 1.00 . A A . 13 ILE CB   1 1 
        9 10535 1 1 13 ILE CD1  C  -8.117  16.473  10.608 1.00 . A A . 13 ILE CD1  1 1 
        9 10536 1 1 13 ILE CG1  C  -7.467  15.690  11.753 1.00 . A A . 13 ILE CG1  1 1 
        9 10537 1 1 13 ILE CG2  C  -8.027  13.438  10.834 1.00 . A A . 13 ILE CG2  1 1 
        9 10538 1 1 13 ILE H    H  -5.315  12.216  10.829 1.00 . A A . 13 ILE H    1 1 
        9 10539 1 1 13 ILE HA   H  -5.330  14.449  12.682 1.00 . A A . 13 ILE HA   1 1 
        9 10540 1 1 13 ILE HB   H  -6.284  14.578  10.341 1.00 . A A . 13 ILE HB   1 1 
        9 10541 1 1 13 ILE HD11 H  -7.433  16.529   9.774 1.00 . A A . 13 ILE HD11 1 1 
        9 10542 1 1 13 ILE HD12 H  -8.354  17.471  10.946 1.00 . A A . 13 ILE HD12 1 1 
        9 10543 1 1 13 ILE HD13 H  -9.022  15.973  10.299 1.00 . A A . 13 ILE HD13 1 1 
        9 10544 1 1 13 ILE HG12 H  -8.210  15.472  12.506 1.00 . A A . 13 ILE HG12 1 1 
        9 10545 1 1 13 ILE HG13 H  -6.677  16.283  12.187 1.00 . A A . 13 ILE HG13 1 1 
        9 10546 1 1 13 ILE HG21 H  -8.511  13.802   9.940 1.00 . A A . 13 ILE HG21 1 1 
        9 10547 1 1 13 ILE HG22 H  -8.744  13.394  11.640 1.00 . A A . 13 ILE HG22 1 1 
        9 10548 1 1 13 ILE HG23 H  -7.627  12.457  10.652 1.00 . A A . 13 ILE HG23 1 1 
        9 10549 1 1 13 ILE N    N  -5.239  12.603  11.726 1.00 . A A . 13 ILE N    1 1 
        9 10550 1 1 13 ILE O    O  -6.983  13.908  14.504 1.00 . A A . 13 ILE O    1 1 
        9 10551 1 1 14 GLY C    C  -7.298  10.698  15.444 1.00 . A A . 14 GLY C    1 1 
        9 10552 1 1 14 GLY CA   C  -8.239  11.424  14.451 1.00 . A A . 14 GLY CA   1 1 
        9 10553 1 1 14 GLY H    H  -7.206  11.535  12.546 1.00 . A A . 14 GLY H    1 1 
        9 10554 1 1 14 GLY HA2  H  -8.783  12.198  14.973 1.00 . A A . 14 GLY HA2  1 1 
        9 10555 1 1 14 GLY HA3  H  -8.936  10.711  14.040 1.00 . A A . 14 GLY HA3  1 1 
        9 10556 1 1 14 GLY N    N  -7.456  12.037  13.348 1.00 . A A . 14 GLY N    1 1 
        9 10557 1 1 14 GLY O    O  -7.349  10.869  16.662 1.00 . A A . 14 GLY O    1 1 
        9 10558 1 1 15 THR C    C  -4.532   9.786  16.371 1.00 . A A . 15 THR C    1 1 
        9 10559 1 1 15 THR CA   C  -5.510   8.991  15.510 1.00 . A A . 15 THR CA   1 1 
        9 10560 1 1 15 THR CB   C  -4.711   8.132  14.521 1.00 . A A . 15 THR CB   1 1 
        9 10561 1 1 15 THR CG2  C  -3.836   7.144  15.297 1.00 . A A . 15 THR CG2  1 1 
        9 10562 1 1 15 THR H    H  -6.661   9.828  13.872 1.00 . A A . 15 THR H    1 1 
        9 10563 1 1 15 THR HA   H  -6.058   8.327  16.162 1.00 . A A . 15 THR HA   1 1 
        9 10564 1 1 15 THR HB   H  -4.076   8.762  13.922 1.00 . A A . 15 THR HB   1 1 
        9 10565 1 1 15 THR HG1  H  -6.177   6.883  14.252 1.00 . A A . 15 THR HG1  1 1 
        9 10566 1 1 15 THR HG21 H  -4.419   6.674  16.074 1.00 . A A . 15 THR HG21 1 1 
        9 10567 1 1 15 THR HG22 H  -3.005   7.672  15.741 1.00 . A A . 15 THR HG22 1 1 
        9 10568 1 1 15 THR HG23 H  -3.461   6.390  14.621 1.00 . A A . 15 THR HG23 1 1 
        9 10569 1 1 15 THR N    N  -6.490   9.861  14.830 1.00 . A A . 15 THR N    1 1 
        9 10570 1 1 15 THR O    O  -4.025   9.269  17.366 1.00 . A A . 15 THR O    1 1 
        9 10571 1 1 15 THR OG1  O  -5.604   7.408  13.688 1.00 . A A . 15 THR OG1  1 1 
        9 10572 1 1 16 THR C    C  -4.029  12.418  18.058 1.00 . A A . 16 THR C    1 1 
        9 10573 1 1 16 THR CA   C  -3.370  11.885  16.790 1.00 . A A . 16 THR CA   1 1 
        9 10574 1 1 16 THR CB   C  -2.877  13.058  15.937 1.00 . A A . 16 THR CB   1 1 
        9 10575 1 1 16 THR CG2  C  -1.953  13.944  16.772 1.00 . A A . 16 THR CG2  1 1 
        9 10576 1 1 16 THR H    H  -4.732  11.459  15.255 1.00 . A A . 16 THR H    1 1 
        9 10577 1 1 16 THR HA   H  -2.516  11.294  17.082 1.00 . A A . 16 THR HA   1 1 
        9 10578 1 1 16 THR HB   H  -3.721  13.640  15.601 1.00 . A A . 16 THR HB   1 1 
        9 10579 1 1 16 THR HG1  H  -2.397  13.096  14.053 1.00 . A A . 16 THR HG1  1 1 
        9 10580 1 1 16 THR HG21 H  -2.541  14.520  17.473 1.00 . A A . 16 THR HG21 1 1 
        9 10581 1 1 16 THR HG22 H  -1.412  14.614  16.121 1.00 . A A . 16 THR HG22 1 1 
        9 10582 1 1 16 THR HG23 H  -1.253  13.326  17.314 1.00 . A A . 16 THR HG23 1 1 
        9 10583 1 1 16 THR N    N  -4.276  11.041  16.014 1.00 . A A . 16 THR N    1 1 
        9 10584 1 1 16 THR O    O  -3.361  12.662  19.063 1.00 . A A . 16 THR O    1 1 
        9 10585 1 1 16 THR OG1  O  -2.166  12.557  14.813 1.00 . A A . 16 THR OG1  1 1 
        9 10586 1 1 17 LEU C    C  -6.408  12.280  20.231 1.00 . A A . 17 LEU C    1 1 
        9 10587 1 1 17 LEU CA   C  -6.119  13.230  19.068 1.00 . A A . 17 LEU CA   1 1 
        9 10588 1 1 17 LEU CB   C  -7.447  13.754  18.503 1.00 . A A . 17 LEU CB   1 1 
        9 10589 1 1 17 LEU CD1  C  -7.382  16.100  19.468 1.00 . A A . 17 LEU CD1  1 1 
        9 10590 1 1 17 LEU CD2  C  -9.574  14.950  19.067 1.00 . A A . 17 LEU CD2  1 1 
        9 10591 1 1 17 LEU CG   C  -8.112  14.743  19.480 1.00 . A A . 17 LEU CG   1 1 
        9 10592 1 1 17 LEU H    H  -5.840  12.479  17.158 1.00 . A A . 17 LEU H    1 1 
        9 10593 1 1 17 LEU HA   H  -5.581  14.059  19.488 1.00 . A A . 17 LEU HA   1 1 
        9 10594 1 1 17 LEU HB2  H  -7.263  14.246  17.559 1.00 . A A . 17 LEU HB2  1 1 
        9 10595 1 1 17 LEU HB3  H  -8.112  12.919  18.340 1.00 . A A . 17 LEU HB3  1 1 
        9 10596 1 1 17 LEU HD11 H  -8.037  16.866  19.861 1.00 . A A . 17 LEU HD11 1 1 
        9 10597 1 1 17 LEU HD12 H  -7.102  16.356  18.459 1.00 . A A . 17 LEU HD12 1 1 
        9 10598 1 1 17 LEU HD13 H  -6.497  16.044  20.083 1.00 . A A . 17 LEU HD13 1 1 
        9 10599 1 1 17 LEU HD21 H  -9.621  15.209  18.019 1.00 . A A . 17 LEU HD21 1 1 
        9 10600 1 1 17 LEU HD22 H -10.004  15.747  19.654 1.00 . A A . 17 LEU HD22 1 1 
        9 10601 1 1 17 LEU HD23 H -10.127  14.038  19.237 1.00 . A A . 17 LEU HD23 1 1 
        9 10602 1 1 17 LEU HG   H  -8.082  14.337  20.478 1.00 . A A . 17 LEU HG   1 1 
        9 10603 1 1 17 LEU N    N  -5.334  12.657  17.978 1.00 . A A . 17 LEU N    1 1 
        9 10604 1 1 17 LEU O    O  -6.636  12.753  21.344 1.00 . A A . 17 LEU O    1 1 
        9 10605 1 1 18 VAL C    C  -5.754  10.334  22.275 1.00 . A A . 18 VAL C    1 1 
        9 10606 1 1 18 VAL CA   C  -6.779  10.116  21.164 1.00 . A A . 18 VAL CA   1 1 
        9 10607 1 1 18 VAL CB   C  -6.780   8.646  20.733 1.00 . A A . 18 VAL CB   1 1 
        9 10608 1 1 18 VAL CG1  C  -6.918   7.743  21.964 1.00 . A A . 18 VAL CG1  1 1 
        9 10609 1 1 18 VAL CG2  C  -7.957   8.400  19.785 1.00 . A A . 18 VAL CG2  1 1 
        9 10610 1 1 18 VAL H    H  -6.244  10.571  19.154 1.00 . A A . 18 VAL H    1 1 
        9 10611 1 1 18 VAL HA   H  -7.776  10.393  21.473 1.00 . A A . 18 VAL HA   1 1 
        9 10612 1 1 18 VAL HB   H  -5.854   8.419  20.226 1.00 . A A . 18 VAL HB   1 1 
        9 10613 1 1 18 VAL HG11 H  -7.194   6.746  21.650 1.00 . A A . 18 VAL HG11 1 1 
        9 10614 1 1 18 VAL HG12 H  -7.683   8.139  22.616 1.00 . A A . 18 VAL HG12 1 1 
        9 10615 1 1 18 VAL HG13 H  -5.977   7.707  22.492 1.00 . A A . 18 VAL HG13 1 1 
        9 10616 1 1 18 VAL HG21 H  -8.879   8.411  20.347 1.00 . A A . 18 VAL HG21 1 1 
        9 10617 1 1 18 VAL HG22 H  -7.839   7.440  19.306 1.00 . A A . 18 VAL HG22 1 1 
        9 10618 1 1 18 VAL HG23 H  -7.982   9.176  19.035 1.00 . A A . 18 VAL HG23 1 1 
        9 10619 1 1 18 VAL N    N  -6.447  10.967  20.028 1.00 . A A . 18 VAL N    1 1 
        9 10620 1 1 18 VAL O    O  -6.101  10.561  23.435 1.00 . A A . 18 VAL O    1 1 
        9 10621 1 1 19 ALA C    C  -3.341  11.720  23.505 1.00 . A A . 19 ALA C    1 1 
        9 10622 1 1 19 ALA CA   C  -3.366  10.359  22.812 1.00 . A A . 19 ALA CA   1 1 
        9 10623 1 1 19 ALA CB   C  -2.055  10.162  22.049 1.00 . A A . 19 ALA CB   1 1 
        9 10624 1 1 19 ALA H    H  -4.302   9.955  20.966 1.00 . A A . 19 ALA H    1 1 
        9 10625 1 1 19 ALA HA   H  -3.441   9.583  23.554 1.00 . A A . 19 ALA HA   1 1 
        9 10626 1 1 19 ALA HB1  H  -1.950  10.940  21.308 1.00 . A A . 19 ALA HB1  1 1 
        9 10627 1 1 19 ALA HB2  H  -2.064   9.199  21.561 1.00 . A A . 19 ALA HB2  1 1 
        9 10628 1 1 19 ALA HB3  H  -1.225  10.209  22.739 1.00 . A A . 19 ALA HB3  1 1 
        9 10629 1 1 19 ALA N    N  -4.488  10.222  21.890 1.00 . A A . 19 ALA N    1 1 
        9 10630 1 1 19 ALA O    O  -2.923  11.826  24.658 1.00 . A A . 19 ALA O    1 1 
        9 10631 1 1 20 LEU C    C  -4.839  14.122  24.558 1.00 . A A . 20 LEU C    1 1 
        9 10632 1 1 20 LEU CA   C  -3.834  14.086  23.407 1.00 . A A . 20 LEU CA   1 1 
        9 10633 1 1 20 LEU CB   C  -4.174  15.145  22.351 1.00 . A A . 20 LEU CB   1 1 
        9 10634 1 1 20 LEU CD1  C  -2.822  16.890  23.578 1.00 . A A . 20 LEU CD1  1 1 
        9 10635 1 1 20 LEU CD2  C  -4.562  17.575  21.901 1.00 . A A . 20 LEU CD2  1 1 
        9 10636 1 1 20 LEU CG   C  -4.200  16.548  22.982 1.00 . A A . 20 LEU CG   1 1 
        9 10637 1 1 20 LEU H    H  -4.182  12.596  21.921 1.00 . A A . 20 LEU H    1 1 
        9 10638 1 1 20 LEU HA   H  -2.866  14.295  23.833 1.00 . A A . 20 LEU HA   1 1 
        9 10639 1 1 20 LEU HB2  H  -3.430  15.121  21.569 1.00 . A A . 20 LEU HB2  1 1 
        9 10640 1 1 20 LEU HB3  H  -5.143  14.929  21.928 1.00 . A A . 20 LEU HB3  1 1 
        9 10641 1 1 20 LEU HD11 H  -2.751  16.484  24.576 1.00 . A A . 20 LEU HD11 1 1 
        9 10642 1 1 20 LEU HD12 H  -2.699  17.963  23.622 1.00 . A A . 20 LEU HD12 1 1 
        9 10643 1 1 20 LEU HD13 H  -2.042  16.466  22.961 1.00 . A A . 20 LEU HD13 1 1 
        9 10644 1 1 20 LEU HD21 H  -4.000  17.368  21.003 1.00 . A A . 20 LEU HD21 1 1 
        9 10645 1 1 20 LEU HD22 H  -4.325  18.567  22.254 1.00 . A A . 20 LEU HD22 1 1 
        9 10646 1 1 20 LEU HD23 H  -5.619  17.514  21.687 1.00 . A A . 20 LEU HD23 1 1 
        9 10647 1 1 20 LEU HG   H  -4.944  16.577  23.764 1.00 . A A . 20 LEU HG   1 1 
        9 10648 1 1 20 LEU N    N  -3.803  12.753  22.811 1.00 . A A . 20 LEU N    1 1 
        9 10649 1 1 20 LEU O    O  -4.547  14.657  25.627 1.00 . A A . 20 LEU O    1 1 
        9 10650 1 1 21 SER C    C  -6.710  12.466  26.451 1.00 . A A . 21 SER C    1 1 
        9 10651 1 1 21 SER CA   C  -7.044  13.507  25.384 1.00 . A A . 21 SER CA   1 1 
        9 10652 1 1 21 SER CB   C  -8.400  13.180  24.760 1.00 . A A . 21 SER CB   1 1 
        9 10653 1 1 21 SER H    H  -6.211  13.124  23.482 1.00 . A A . 21 SER H    1 1 
        9 10654 1 1 21 SER HA   H  -7.101  14.481  25.846 1.00 . A A . 21 SER HA   1 1 
        9 10655 1 1 21 SER HB2  H  -8.641  13.915  24.010 1.00 . A A . 21 SER HB2  1 1 
        9 10656 1 1 21 SER HB3  H  -8.358  12.201  24.301 1.00 . A A . 21 SER HB3  1 1 
        9 10657 1 1 21 SER HG   H -10.255  13.267  25.343 1.00 . A A . 21 SER HG   1 1 
        9 10658 1 1 21 SER N    N  -6.016  13.542  24.346 1.00 . A A . 21 SER N    1 1 
        9 10659 1 1 21 SER O    O  -7.185  12.536  27.569 1.00 . A A . 21 SER O    1 1 
        9 10660 1 1 21 SER OG   O  -9.399  13.201  25.772 1.00 . A A . 21 SER OG   1 1 
        9 10661 1 1 22 SER C    C  -4.577  10.918  28.064 1.00 . A A . 22 SER C    1 1 
        9 10662 1 1 22 SER CA   C  -5.526  10.405  26.971 1.00 . A A . 22 SER CA   1 1 
        9 10663 1 1 22 SER CB   C  -4.803   9.313  26.186 1.00 . A A . 22 SER CB   1 1 
        9 10664 1 1 22 SER H    H  -5.592  11.530  25.137 1.00 . A A . 22 SER H    1 1 
        9 10665 1 1 22 SER HA   H  -6.430   9.984  27.386 1.00 . A A . 22 SER HA   1 1 
        9 10666 1 1 22 SER HB2  H  -4.734   8.420  26.785 1.00 . A A . 22 SER HB2  1 1 
        9 10667 1 1 22 SER HB3  H  -5.356   9.096  25.282 1.00 . A A . 22 SER HB3  1 1 
        9 10668 1 1 22 SER HG   H  -2.866   9.167  26.276 1.00 . A A . 22 SER HG   1 1 
        9 10669 1 1 22 SER N    N  -5.910  11.489  26.062 1.00 . A A . 22 SER N    1 1 
        9 10670 1 1 22 SER O    O  -4.344  10.259  29.077 1.00 . A A . 22 SER O    1 1 
        9 10671 1 1 22 SER OG   O  -3.495   9.763  25.864 1.00 . A A . 22 SER OG   1 1 
        9 10672 1 1 23 PHE C    C  -3.924  13.413  29.994 1.00 . A A . 23 PHE C    1 1 
        9 10673 1 1 23 PHE CA   C  -3.162  12.755  28.810 1.00 . A A . 23 PHE CA   1 1 
        9 10674 1 1 23 PHE CB   C  -2.216  13.755  28.107 1.00 . A A . 23 PHE CB   1 1 
        9 10675 1 1 23 PHE CD1  C  -0.919  11.854  27.065 1.00 . A A . 23 PHE CD1  1 1 
        9 10676 1 1 23 PHE CD2  C   0.313  13.618  28.185 1.00 . A A . 23 PHE CD2  1 1 
        9 10677 1 1 23 PHE CE1  C   0.285  11.202  26.771 1.00 . A A . 23 PHE CE1  1 1 
        9 10678 1 1 23 PHE CE2  C   1.515  12.965  27.891 1.00 . A A . 23 PHE CE2  1 1 
        9 10679 1 1 23 PHE CG   C  -0.904  13.063  27.772 1.00 . A A . 23 PHE CG   1 1 
        9 10680 1 1 23 PHE CZ   C   1.502  11.757  27.184 1.00 . A A . 23 PHE CZ   1 1 
        9 10681 1 1 23 PHE H    H  -4.437  12.570  27.041 1.00 . A A . 23 PHE H    1 1 
        9 10682 1 1 23 PHE HA   H  -2.571  11.983  29.285 1.00 . A A . 23 PHE HA   1 1 
        9 10683 1 1 23 PHE HB2  H  -2.679  14.104  27.195 1.00 . A A . 23 PHE HB2  1 1 
        9 10684 1 1 23 PHE HB3  H  -2.023  14.598  28.755 1.00 . A A . 23 PHE HB3  1 1 
        9 10685 1 1 23 PHE HD1  H  -1.857  11.426  26.746 1.00 . A A . 23 PHE HD1  1 1 
        9 10686 1 1 23 PHE HD2  H   0.325  14.550  28.731 1.00 . A A . 23 PHE HD2  1 1 
        9 10687 1 1 23 PHE HE1  H   0.274  10.269  26.225 1.00 . A A . 23 PHE HE1  1 1 
        9 10688 1 1 23 PHE HE2  H   2.454  13.393  28.210 1.00 . A A . 23 PHE HE2  1 1 
        9 10689 1 1 23 PHE HZ   H   2.428  11.253  26.957 1.00 . A A . 23 PHE HZ   1 1 
        9 10690 1 1 23 PHE N    N  -4.067  12.124  27.831 1.00 . A A . 23 PHE N    1 1 
        9 10691 1 1 23 PHE O    O  -3.435  13.339  31.120 1.00 . A A . 23 PHE O    1 1 
        9 10692 1 1 24 THR C    C  -6.308  13.798  32.005 1.00 . A A . 24 THR C    1 1 
        9 10693 1 1 24 THR CA   C  -5.759  14.752  30.909 1.00 . A A . 24 THR CA   1 1 
        9 10694 1 1 24 THR CB   C  -6.882  15.661  30.371 1.00 . A A . 24 THR CB   1 1 
        9 10695 1 1 24 THR CG2  C  -7.727  16.201  31.529 1.00 . A A . 24 THR CG2  1 1 
        9 10696 1 1 24 THR H    H  -5.399  14.267  28.881 1.00 . A A . 24 THR H    1 1 
        9 10697 1 1 24 THR HA   H  -5.031  15.399  31.378 1.00 . A A . 24 THR HA   1 1 
        9 10698 1 1 24 THR HB   H  -7.513  15.111  29.697 1.00 . A A . 24 THR HB   1 1 
        9 10699 1 1 24 THR HG1  H  -6.227  17.490  30.283 1.00 . A A . 24 THR HG1  1 1 
        9 10700 1 1 24 THR HG21 H  -8.378  15.421  31.894 1.00 . A A . 24 THR HG21 1 1 
        9 10701 1 1 24 THR HG22 H  -8.321  17.034  31.184 1.00 . A A . 24 THR HG22 1 1 
        9 10702 1 1 24 THR HG23 H  -7.077  16.528  32.327 1.00 . A A . 24 THR HG23 1 1 
        9 10703 1 1 24 THR N    N  -5.065  14.085  29.784 1.00 . A A . 24 THR N    1 1 
        9 10704 1 1 24 THR O    O  -6.264  14.137  33.187 1.00 . A A . 24 THR O    1 1 
        9 10705 1 1 24 THR OG1  O  -6.299  16.753  29.673 1.00 . A A . 24 THR OG1  1 1 
        9 10706 1 1 25 PRO C    C  -6.633  11.426  33.884 1.00 . A A . 25 PRO C    1 1 
        9 10707 1 1 25 PRO CA   C  -7.453  11.683  32.621 1.00 . A A . 25 PRO CA   1 1 
        9 10708 1 1 25 PRO CB   C  -7.571  10.400  31.799 1.00 . A A . 25 PRO CB   1 1 
        9 10709 1 1 25 PRO CD   C  -6.993  12.161  30.276 1.00 . A A . 25 PRO CD   1 1 
        9 10710 1 1 25 PRO CG   C  -7.819  10.880  30.418 1.00 . A A . 25 PRO CG   1 1 
        9 10711 1 1 25 PRO HA   H  -8.442  12.009  32.893 1.00 . A A . 25 PRO HA   1 1 
        9 10712 1 1 25 PRO HB2  H  -6.648   9.833  31.847 1.00 . A A . 25 PRO HB2  1 1 
        9 10713 1 1 25 PRO HB3  H  -8.401   9.800  32.143 1.00 . A A . 25 PRO HB3  1 1 
        9 10714 1 1 25 PRO HD2  H  -6.035  11.941  29.851 1.00 . A A . 25 PRO HD2  1 1 
        9 10715 1 1 25 PRO HD3  H  -7.521  12.880  29.688 1.00 . A A . 25 PRO HD3  1 1 
        9 10716 1 1 25 PRO HG2  H  -7.496  10.134  29.699 1.00 . A A . 25 PRO HG2  1 1 
        9 10717 1 1 25 PRO HG3  H  -8.867  11.102  30.279 1.00 . A A . 25 PRO HG3  1 1 
        9 10718 1 1 25 PRO N    N  -6.851  12.656  31.650 1.00 . A A . 25 PRO N    1 1 
        9 10719 1 1 25 PRO O    O  -7.197  11.009  34.887 1.00 . A A . 25 PRO O    1 1 
        9 10720 1 1 26 VAL C    C  -5.070  12.333  36.226 1.00 . A A . 26 VAL C    1 1 
        9 10721 1 1 26 VAL CA   C  -4.545  11.454  35.085 1.00 . A A . 26 VAL CA   1 1 
        9 10722 1 1 26 VAL CB   C  -3.069  11.773  34.814 1.00 . A A . 26 VAL CB   1 1 
        9 10723 1 1 26 VAL CG1  C  -2.279  11.752  36.126 1.00 . A A . 26 VAL CG1  1 1 
        9 10724 1 1 26 VAL CG2  C  -2.490  10.727  33.859 1.00 . A A . 26 VAL CG2  1 1 
        9 10725 1 1 26 VAL H    H  -4.885  12.056  33.090 1.00 . A A . 26 VAL H    1 1 
        9 10726 1 1 26 VAL HA   H  -4.633  10.425  35.398 1.00 . A A . 26 VAL HA   1 1 
        9 10727 1 1 26 VAL HB   H  -2.992  12.752  34.365 1.00 . A A . 26 VAL HB   1 1 
        9 10728 1 1 26 VAL HG11 H  -2.533  10.863  36.684 1.00 . A A . 26 VAL HG11 1 1 
        9 10729 1 1 26 VAL HG12 H  -2.526  12.627  36.710 1.00 . A A . 26 VAL HG12 1 1 
        9 10730 1 1 26 VAL HG13 H  -1.221  11.751  35.910 1.00 . A A . 26 VAL HG13 1 1 
        9 10731 1 1 26 VAL HG21 H  -2.976  10.808  32.897 1.00 . A A . 26 VAL HG21 1 1 
        9 10732 1 1 26 VAL HG22 H  -2.653   9.740  34.263 1.00 . A A . 26 VAL HG22 1 1 
        9 10733 1 1 26 VAL HG23 H  -1.430  10.898  33.741 1.00 . A A . 26 VAL HG23 1 1 
        9 10734 1 1 26 VAL N    N  -5.332  11.677  33.874 1.00 . A A . 26 VAL N    1 1 
        9 10735 1 1 26 VAL O    O  -5.172  11.881  37.361 1.00 . A A . 26 VAL O    1 1 
        9 10736 1 1 27 LEU C    C  -6.949  14.016  37.809 1.00 . A A . 27 LEU C    1 1 
        9 10737 1 1 27 LEU CA   C  -5.797  14.557  36.945 1.00 . A A . 27 LEU CA   1 1 
        9 10738 1 1 27 LEU CB   C  -6.271  15.842  36.229 1.00 . A A . 27 LEU CB   1 1 
        9 10739 1 1 27 LEU CD1  C  -4.469  17.341  37.214 1.00 . A A . 27 LEU CD1  1 1 
        9 10740 1 1 27 LEU CD2  C  -4.020  15.996  35.127 1.00 . A A . 27 LEU CD2  1 1 
        9 10741 1 1 27 LEU CG   C  -5.083  16.773  35.917 1.00 . A A . 27 LEU CG   1 1 
        9 10742 1 1 27 LEU H    H  -5.170  13.939  35.031 1.00 . A A . 27 LEU H    1 1 
        9 10743 1 1 27 LEU HA   H  -4.947  14.804  37.557 1.00 . A A . 27 LEU HA   1 1 
        9 10744 1 1 27 LEU HB2  H  -6.757  15.568  35.304 1.00 . A A . 27 LEU HB2  1 1 
        9 10745 1 1 27 LEU HB3  H  -6.978  16.370  36.855 1.00 . A A . 27 LEU HB3  1 1 
        9 10746 1 1 27 LEU HD11 H  -5.222  17.389  37.989 1.00 . A A . 27 LEU HD11 1 1 
        9 10747 1 1 27 LEU HD12 H  -4.096  18.336  37.023 1.00 . A A . 27 LEU HD12 1 1 
        9 10748 1 1 27 LEU HD13 H  -3.652  16.715  37.546 1.00 . A A . 27 LEU HD13 1 1 
        9 10749 1 1 27 LEU HD21 H  -4.495  15.453  34.324 1.00 . A A . 27 LEU HD21 1 1 
        9 10750 1 1 27 LEU HD22 H  -3.516  15.303  35.782 1.00 . A A . 27 LEU HD22 1 1 
        9 10751 1 1 27 LEU HD23 H  -3.301  16.689  34.715 1.00 . A A . 27 LEU HD23 1 1 
        9 10752 1 1 27 LEU HG   H  -5.438  17.595  35.312 1.00 . A A . 27 LEU HG   1 1 
        9 10753 1 1 27 LEU N    N  -5.348  13.597  35.932 1.00 . A A . 27 LEU N    1 1 
        9 10754 1 1 27 LEU O    O  -7.129  14.445  38.949 1.00 . A A . 27 LEU O    1 1 
        9 10755 1 1 28 VAL C    C  -8.406  11.629  39.153 1.00 . A A . 28 VAL C    1 1 
        9 10756 1 1 28 VAL CA   C  -8.866  12.511  37.987 1.00 . A A . 28 VAL CA   1 1 
        9 10757 1 1 28 VAL CB   C  -9.751  11.691  37.024 1.00 . A A . 28 VAL CB   1 1 
        9 10758 1 1 28 VAL CG1  C  -9.154  10.284  36.789 1.00 . A A . 28 VAL CG1  1 1 
        9 10759 1 1 28 VAL CG2  C -11.163  11.559  37.613 1.00 . A A . 28 VAL CG2  1 1 
        9 10760 1 1 28 VAL H    H  -7.529  12.756  36.364 1.00 . A A . 28 VAL H    1 1 
        9 10761 1 1 28 VAL HA   H  -9.457  13.325  38.383 1.00 . A A . 28 VAL HA   1 1 
        9 10762 1 1 28 VAL HB   H  -9.810  12.211  36.078 1.00 . A A . 28 VAL HB   1 1 
        9 10763 1 1 28 VAL HG11 H  -8.081  10.324  36.879 1.00 . A A . 28 VAL HG11 1 1 
        9 10764 1 1 28 VAL HG12 H  -9.417   9.940  35.799 1.00 . A A . 28 VAL HG12 1 1 
        9 10765 1 1 28 VAL HG13 H  -9.545   9.592  37.522 1.00 . A A . 28 VAL HG13 1 1 
        9 10766 1 1 28 VAL HG21 H -11.658  12.518  37.584 1.00 . A A . 28 VAL HG21 1 1 
        9 10767 1 1 28 VAL HG22 H -11.096  11.219  38.636 1.00 . A A . 28 VAL HG22 1 1 
        9 10768 1 1 28 VAL HG23 H -11.731  10.844  37.033 1.00 . A A . 28 VAL HG23 1 1 
        9 10769 1 1 28 VAL N    N  -7.729  13.090  37.263 1.00 . A A . 28 VAL N    1 1 
        9 10770 1 1 28 VAL O    O  -9.095  11.510  40.167 1.00 . A A . 28 VAL O    1 1 
        9 10771 1 1 29 ILE C    C  -6.545  10.930  41.358 1.00 . A A . 29 ILE C    1 1 
        9 10772 1 1 29 ILE CA   C  -6.682  10.165  40.042 1.00 . A A . 29 ILE CA   1 1 
        9 10773 1 1 29 ILE CB   C  -5.314   9.586  39.623 1.00 . A A . 29 ILE CB   1 1 
        9 10774 1 1 29 ILE CD1  C  -3.414  10.601  40.980 1.00 . A A . 29 ILE CD1  1 1 
        9 10775 1 1 29 ILE CG1  C  -4.216  10.690  39.673 1.00 . A A . 29 ILE CG1  1 1 
        9 10776 1 1 29 ILE CG2  C  -5.411   8.994  38.207 1.00 . A A . 29 ILE CG2  1 1 
        9 10777 1 1 29 ILE H    H  -6.708  11.230  38.197 1.00 . A A . 29 ILE H    1 1 
        9 10778 1 1 29 ILE HA   H  -7.358   9.348  40.242 1.00 . A A . 29 ILE HA   1 1 
        9 10779 1 1 29 ILE HB   H  -5.056   8.787  40.306 1.00 . A A . 29 ILE HB   1 1 
        9 10780 1 1 29 ILE HD11 H  -2.989  11.568  41.208 1.00 . A A . 29 ILE HD11 1 1 
        9 10781 1 1 29 ILE HD12 H  -2.619   9.879  40.865 1.00 . A A . 29 ILE HD12 1 1 
        9 10782 1 1 29 ILE HD13 H  -4.063  10.295  41.787 1.00 . A A . 29 ILE HD13 1 1 
        9 10783 1 1 29 ILE HG12 H  -3.536  10.568  38.841 1.00 . A A . 29 ILE HG12 1 1 
        9 10784 1 1 29 ILE HG13 H  -4.673  11.667  39.609 1.00 . A A . 29 ILE HG13 1 1 
        9 10785 1 1 29 ILE HG21 H  -5.937   8.052  38.247 1.00 . A A . 29 ILE HG21 1 1 
        9 10786 1 1 29 ILE HG22 H  -4.417   8.833  37.818 1.00 . A A . 29 ILE HG22 1 1 
        9 10787 1 1 29 ILE HG23 H  -5.941   9.673  37.559 1.00 . A A . 29 ILE HG23 1 1 
        9 10788 1 1 29 ILE N    N  -7.235  11.024  38.997 1.00 . A A . 29 ILE N    1 1 
        9 10789 1 1 29 ILE O    O  -6.722  10.344  42.424 1.00 . A A . 29 ILE O    1 1 
        9 10790 1 1 30 LEU C    C  -7.382  12.912  43.381 1.00 . A A . 30 LEU C    1 1 
        9 10791 1 1 30 LEU CA   C  -6.102  12.998  42.542 1.00 . A A . 30 LEU CA   1 1 
        9 10792 1 1 30 LEU CB   C  -5.792  14.465  42.185 1.00 . A A . 30 LEU CB   1 1 
        9 10793 1 1 30 LEU CD1  C  -4.753  16.612  42.937 1.00 . A A . 30 LEU CD1  1 1 
        9 10794 1 1 30 LEU CD2  C  -5.717  15.040  44.634 1.00 . A A . 30 LEU CD2  1 1 
        9 10795 1 1 30 LEU CG   C  -4.974  15.140  43.296 1.00 . A A . 30 LEU CG   1 1 
        9 10796 1 1 30 LEU H    H  -6.096  12.681  40.456 1.00 . A A . 30 LEU H    1 1 
        9 10797 1 1 30 LEU HA   H  -5.308  12.600  43.156 1.00 . A A . 30 LEU HA   1 1 
        9 10798 1 1 30 LEU HB2  H  -5.226  14.492  41.266 1.00 . A A . 30 LEU HB2  1 1 
        9 10799 1 1 30 LEU HB3  H  -6.717  15.008  42.045 1.00 . A A . 30 LEU HB3  1 1 
        9 10800 1 1 30 LEU HD11 H  -4.269  16.679  41.974 1.00 . A A . 30 LEU HD11 1 1 
        9 10801 1 1 30 LEU HD12 H  -4.130  17.076  43.686 1.00 . A A . 30 LEU HD12 1 1 
        9 10802 1 1 30 LEU HD13 H  -5.706  17.119  42.897 1.00 . A A . 30 LEU HD13 1 1 
        9 10803 1 1 30 LEU HD21 H  -5.342  15.792  45.315 1.00 . A A . 30 LEU HD21 1 1 
        9 10804 1 1 30 LEU HD22 H  -5.552  14.063  45.060 1.00 . A A . 30 LEU HD22 1 1 
        9 10805 1 1 30 LEU HD23 H  -6.775  15.193  44.477 1.00 . A A . 30 LEU HD23 1 1 
        9 10806 1 1 30 LEU HG   H  -4.015  14.648  43.380 1.00 . A A . 30 LEU HG   1 1 
        9 10807 1 1 30 LEU N    N  -6.241  12.223  41.310 1.00 . A A . 30 LEU N    1 1 
        9 10808 1 1 30 LEU O    O  -7.315  12.610  44.572 1.00 . A A . 30 LEU O    1 1 
        9 10809 1 1 31 LEU C    C  -9.973  11.823  44.236 1.00 . A A . 31 LEU C    1 1 
        9 10810 1 1 31 LEU CA   C  -9.768  13.192  43.595 1.00 . A A . 31 LEU CA   1 1 
        9 10811 1 1 31 LEU CB   C -10.958  13.473  42.670 1.00 . A A . 31 LEU CB   1 1 
        9 10812 1 1 31 LEU CD1  C -11.982  15.117  41.093 1.00 . A A . 31 LEU CD1  1 1 
        9 10813 1 1 31 LEU CD2  C -11.222  15.897  43.362 1.00 . A A . 31 LEU CD2  1 1 
        9 10814 1 1 31 LEU CG   C -10.928  14.933  42.191 1.00 . A A . 31 LEU CG   1 1 
        9 10815 1 1 31 LEU H    H  -8.575  13.537  41.881 1.00 . A A . 31 LEU H    1 1 
        9 10816 1 1 31 LEU HA   H  -9.711  13.986  44.321 1.00 . A A . 31 LEU HA   1 1 
        9 10817 1 1 31 LEU HB2  H -10.901  12.816  41.814 1.00 . A A . 31 LEU HB2  1 1 
        9 10818 1 1 31 LEU HB3  H -11.878  13.285  43.201 1.00 . A A . 31 LEU HB3  1 1 
        9 10819 1 1 31 LEU HD11 H -11.768  14.446  40.274 1.00 . A A . 31 LEU HD11 1 1 
        9 10820 1 1 31 LEU HD12 H -11.958  16.137  40.739 1.00 . A A . 31 LEU HD12 1 1 
        9 10821 1 1 31 LEU HD13 H -12.961  14.897  41.492 1.00 . A A . 31 LEU HD13 1 1 
        9 10822 1 1 31 LEU HD21 H -11.692  16.797  42.988 1.00 . A A . 31 LEU HD21 1 1 
        9 10823 1 1 31 LEU HD22 H -10.297  16.163  43.851 1.00 . A A . 31 LEU HD22 1 1 
        9 10824 1 1 31 LEU HD23 H -11.880  15.424  44.077 1.00 . A A . 31 LEU HD23 1 1 
        9 10825 1 1 31 LEU HG   H  -9.951  15.151  41.783 1.00 . A A . 31 LEU HG   1 1 
        9 10826 1 1 31 LEU N    N  -8.539  13.213  42.805 1.00 . A A . 31 LEU N    1 1 
        9 10827 1 1 31 LEU O    O -10.365  11.705  45.397 1.00 . A A . 31 LEU O    1 1 
        9 10828 1 1 32 GLY C    C  -8.814   9.190  45.091 1.00 . A A . 32 GLY C    1 1 
        9 10829 1 1 32 GLY CA   C  -9.772   9.419  43.923 1.00 . A A . 32 GLY CA   1 1 
        9 10830 1 1 32 GLY H    H  -9.312  11.010  42.564 1.00 . A A . 32 GLY H    1 1 
        9 10831 1 1 32 GLY HA2  H -10.787   9.228  44.246 1.00 . A A . 32 GLY HA2  1 1 
        9 10832 1 1 32 GLY HA3  H  -9.519   8.745  43.119 1.00 . A A . 32 GLY HA3  1 1 
        9 10833 1 1 32 GLY N    N  -9.665  10.797  43.453 1.00 . A A . 32 GLY N    1 1 
        9 10834 1 1 32 GLY O    O  -9.178   8.616  46.113 1.00 . A A . 32 GLY O    1 1 
        9 10835 1 1 33 VAL C    C  -7.250  10.246  47.250 1.00 . A A . 33 VAL C    1 1 
        9 10836 1 1 33 VAL CA   C  -6.617   9.604  46.010 1.00 . A A . 33 VAL CA   1 1 
        9 10837 1 1 33 VAL CB   C  -5.304  10.309  45.644 1.00 . A A . 33 VAL CB   1 1 
        9 10838 1 1 33 VAL CG1  C  -4.413  10.411  46.887 1.00 . A A . 33 VAL CG1  1 1 
        9 10839 1 1 33 VAL CG2  C  -4.570   9.499  44.568 1.00 . A A . 33 VAL CG2  1 1 
        9 10840 1 1 33 VAL H    H  -7.459  10.205  44.099 1.00 . A A . 33 VAL H    1 1 
        9 10841 1 1 33 VAL HA   H  -6.421   8.562  46.228 1.00 . A A . 33 VAL HA   1 1 
        9 10842 1 1 33 VAL HB   H  -5.516  11.299  45.272 1.00 . A A . 33 VAL HB   1 1 
        9 10843 1 1 33 VAL HG11 H  -3.415  10.701  46.593 1.00 . A A . 33 VAL HG11 1 1 
        9 10844 1 1 33 VAL HG12 H  -4.377   9.453  47.384 1.00 . A A . 33 VAL HG12 1 1 
        9 10845 1 1 33 VAL HG13 H  -4.819  11.150  47.561 1.00 . A A . 33 VAL HG13 1 1 
        9 10846 1 1 33 VAL HG21 H  -3.820  10.121  44.102 1.00 . A A . 33 VAL HG21 1 1 
        9 10847 1 1 33 VAL HG22 H  -5.274   9.165  43.823 1.00 . A A . 33 VAL HG22 1 1 
        9 10848 1 1 33 VAL HG23 H  -4.094   8.641  45.022 1.00 . A A . 33 VAL HG23 1 1 
        9 10849 1 1 33 VAL N    N  -7.600   9.706  44.930 1.00 . A A . 33 VAL N    1 1 
        9 10850 1 1 33 VAL O    O  -7.257   9.655  48.331 1.00 . A A . 33 VAL O    1 1 
        9 10851 1 1 34 VAL C    C  -9.548  11.324  48.751 1.00 . A A . 34 VAL C    1 1 
        9 10852 1 1 34 VAL CA   C  -8.396  12.169  48.202 1.00 . A A . 34 VAL CA   1 1 
        9 10853 1 1 34 VAL CB   C  -8.928  13.527  47.724 1.00 . A A . 34 VAL CB   1 1 
        9 10854 1 1 34 VAL CG1  C  -9.786  14.167  48.823 1.00 . A A . 34 VAL CG1  1 1 
        9 10855 1 1 34 VAL CG2  C  -7.746  14.449  47.397 1.00 . A A . 34 VAL CG2  1 1 
        9 10856 1 1 34 VAL H    H  -7.646  11.904  46.220 1.00 . A A . 34 VAL H    1 1 
        9 10857 1 1 34 VAL HA   H  -7.632  12.334  48.946 1.00 . A A . 34 VAL HA   1 1 
        9 10858 1 1 34 VAL HB   H  -9.528  13.384  46.839 1.00 . A A . 34 VAL HB   1 1 
        9 10859 1 1 34 VAL HG11 H -10.754  13.690  48.846 1.00 . A A . 34 VAL HG11 1 1 
        9 10860 1 1 34 VAL HG12 H  -9.910  15.221  48.618 1.00 . A A . 34 VAL HG12 1 1 
        9 10861 1 1 34 VAL HG13 H  -9.300  14.041  49.780 1.00 . A A . 34 VAL HG13 1 1 
        9 10862 1 1 34 VAL HG21 H  -8.085  15.259  46.768 1.00 . A A . 34 VAL HG21 1 1 
        9 10863 1 1 34 VAL HG22 H  -6.982  13.889  46.881 1.00 . A A . 34 VAL HG22 1 1 
        9 10864 1 1 34 VAL HG23 H  -7.337  14.853  48.312 1.00 . A A . 34 VAL HG23 1 1 
        9 10865 1 1 34 VAL N    N  -7.772  11.459  47.083 1.00 . A A . 34 VAL N    1 1 
        9 10866 1 1 34 VAL O    O  -9.735  11.177  49.957 1.00 . A A . 34 VAL O    1 1 
        9 10867 1 1 35 GLY C    C -10.913   8.734  48.985 1.00 . A A . 35 GLY C    1 1 
        9 10868 1 1 35 GLY CA   C -11.429   9.912  48.160 1.00 . A A . 35 GLY CA   1 1 
        9 10869 1 1 35 GLY H    H -10.034  10.956  46.889 1.00 . A A . 35 GLY H    1 1 
        9 10870 1 1 35 GLY HA2  H -12.148  10.477  48.736 1.00 . A A . 35 GLY HA2  1 1 
        9 10871 1 1 35 GLY HA3  H -11.893   9.542  47.260 1.00 . A A . 35 GLY HA3  1 1 
        9 10872 1 1 35 GLY N    N -10.298  10.768  47.814 1.00 . A A . 35 GLY N    1 1 
        9 10873 1 1 35 GLY O    O -11.480   8.375  50.019 1.00 . A A . 35 GLY O    1 1 
        9 10874 1 1 36 LEU C    C  -8.517   7.492  50.491 1.00 . A A . 36 LEU C    1 1 
        9 10875 1 1 36 LEU CA   C  -9.157   7.041  49.175 1.00 . A A . 36 LEU CA   1 1 
        9 10876 1 1 36 LEU CB   C  -8.081   6.467  48.242 1.00 . A A . 36 LEU CB   1 1 
        9 10877 1 1 36 LEU CD1  C  -8.438   4.124  49.112 1.00 . A A . 36 LEU CD1  1 1 
        9 10878 1 1 36 LEU CD2  C  -6.308   4.736  47.932 1.00 . A A . 36 LEU CD2  1 1 
        9 10879 1 1 36 LEU CG   C  -7.406   5.241  48.876 1.00 . A A . 36 LEU CG   1 1 
        9 10880 1 1 36 LEU H    H  -9.426   8.515  47.688 1.00 . A A . 36 LEU H    1 1 
        9 10881 1 1 36 LEU HA   H  -9.891   6.278  49.373 1.00 . A A . 36 LEU HA   1 1 
        9 10882 1 1 36 LEU HB2  H  -8.540   6.177  47.308 1.00 . A A . 36 LEU HB2  1 1 
        9 10883 1 1 36 LEU HB3  H  -7.334   7.223  48.051 1.00 . A A . 36 LEU HB3  1 1 
        9 10884 1 1 36 LEU HD11 H  -8.925   4.284  50.059 1.00 . A A . 36 LEU HD11 1 1 
        9 10885 1 1 36 LEU HD12 H  -7.941   3.163  49.128 1.00 . A A . 36 LEU HD12 1 1 
        9 10886 1 1 36 LEU HD13 H  -9.174   4.132  48.321 1.00 . A A . 36 LEU HD13 1 1 
        9 10887 1 1 36 LEU HD21 H  -5.854   3.850  48.350 1.00 . A A . 36 LEU HD21 1 1 
        9 10888 1 1 36 LEU HD22 H  -5.556   5.501  47.810 1.00 . A A . 36 LEU HD22 1 1 
        9 10889 1 1 36 LEU HD23 H  -6.741   4.498  46.972 1.00 . A A . 36 LEU HD23 1 1 
        9 10890 1 1 36 LEU HG   H  -6.963   5.522  49.820 1.00 . A A . 36 LEU HG   1 1 
        9 10891 1 1 36 LEU N    N  -9.814   8.164  48.514 1.00 . A A . 36 LEU N    1 1 
        9 10892 1 1 36 LEU O    O  -8.495   6.755  51.472 1.00 . A A . 36 LEU O    1 1 
        9 10893 1 1 37 SER C    C  -8.539   9.354  52.796 1.00 . A A . 37 SER C    1 1 
        9 10894 1 1 37 SER CA   C  -7.458   9.311  51.710 1.00 . A A . 37 SER CA   1 1 
        9 10895 1 1 37 SER CB   C  -6.912  10.714  51.445 1.00 . A A . 37 SER CB   1 1 
        9 10896 1 1 37 SER H    H  -8.218   9.277  49.700 1.00 . A A . 37 SER H    1 1 
        9 10897 1 1 37 SER HA   H  -6.657   8.675  52.059 1.00 . A A . 37 SER HA   1 1 
        9 10898 1 1 37 SER HB2  H  -7.685  11.336  51.037 1.00 . A A . 37 SER HB2  1 1 
        9 10899 1 1 37 SER HB3  H  -6.563  11.144  52.376 1.00 . A A . 37 SER HB3  1 1 
        9 10900 1 1 37 SER HG   H  -5.415  11.492  50.477 1.00 . A A . 37 SER HG   1 1 
        9 10901 1 1 37 SER N    N  -8.045   8.734  50.498 1.00 . A A . 37 SER N    1 1 
        9 10902 1 1 37 SER O    O  -8.308   9.043  53.957 1.00 . A A . 37 SER O    1 1 
        9 10903 1 1 37 SER OG   O  -5.836  10.630  50.519 1.00 . A A . 37 SER OG   1 1 
        9 10904 1 1 38 ALA C    C -10.970   8.324  53.967 1.00 . A A . 38 ALA C    1 1 
        9 10905 1 1 38 ALA CA   C -10.835   9.714  53.347 1.00 . A A . 38 ALA CA   1 1 
        9 10906 1 1 38 ALA CB   C -12.138  10.116  52.657 1.00 . A A . 38 ALA CB   1 1 
        9 10907 1 1 38 ALA H    H  -9.870   9.906  51.450 1.00 . A A . 38 ALA H    1 1 
        9 10908 1 1 38 ALA HA   H -10.626  10.397  54.157 1.00 . A A . 38 ALA HA   1 1 
        9 10909 1 1 38 ALA HB1  H -12.908  10.268  53.399 1.00 . A A . 38 ALA HB1  1 1 
        9 10910 1 1 38 ALA HB2  H -12.442   9.333  51.977 1.00 . A A . 38 ALA HB2  1 1 
        9 10911 1 1 38 ALA HB3  H -11.986  11.031  52.104 1.00 . A A . 38 ALA HB3  1 1 
        9 10912 1 1 38 ALA N    N  -9.739   9.691  52.397 1.00 . A A . 38 ALA N    1 1 
        9 10913 1 1 38 ALA O    O -11.237   8.194  55.161 1.00 . A A . 38 ALA O    1 1 
        9 10914 1 1 39 LEU C    C  -9.577   5.517  54.444 1.00 . A A . 39 LEU C    1 1 
        9 10915 1 1 39 LEU CA   C -10.855   5.928  53.676 1.00 . A A . 39 LEU CA   1 1 
        9 10916 1 1 39 LEU CB   C -11.047   4.962  52.505 1.00 . A A . 39 LEU CB   1 1 
        9 10917 1 1 39 LEU CD1  C -12.432   4.401  50.497 1.00 . A A . 39 LEU CD1  1 1 
        9 10918 1 1 39 LEU CD2  C -13.546   5.316  52.553 1.00 . A A . 39 LEU CD2  1 1 
        9 10919 1 1 39 LEU CG   C -12.279   5.365  51.680 1.00 . A A . 39 LEU CG   1 1 
        9 10920 1 1 39 LEU H    H -10.529   7.485  52.225 1.00 . A A . 39 LEU H    1 1 
        9 10921 1 1 39 LEU HA   H -11.720   5.855  54.317 1.00 . A A . 39 LEU HA   1 1 
        9 10922 1 1 39 LEU HB2  H -10.172   4.991  51.877 1.00 . A A . 39 LEU HB2  1 1 
        9 10923 1 1 39 LEU HB3  H -11.184   3.960  52.883 1.00 . A A . 39 LEU HB3  1 1 
        9 10924 1 1 39 LEU HD11 H -12.836   3.463  50.849 1.00 . A A . 39 LEU HD11 1 1 
        9 10925 1 1 39 LEU HD12 H -11.466   4.229  50.044 1.00 . A A . 39 LEU HD12 1 1 
        9 10926 1 1 39 LEU HD13 H -13.101   4.831  49.766 1.00 . A A . 39 LEU HD13 1 1 
        9 10927 1 1 39 LEU HD21 H -13.642   6.242  53.100 1.00 . A A . 39 LEU HD21 1 1 
        9 10928 1 1 39 LEU HD22 H -13.478   4.492  53.249 1.00 . A A . 39 LEU HD22 1 1 
        9 10929 1 1 39 LEU HD23 H -14.418   5.182  51.926 1.00 . A A . 39 LEU HD23 1 1 
        9 10930 1 1 39 LEU HG   H -12.140   6.369  51.304 1.00 . A A . 39 LEU HG   1 1 
        9 10931 1 1 39 LEU N    N -10.764   7.292  53.157 1.00 . A A . 39 LEU N    1 1 
        9 10932 1 1 39 LEU O    O  -9.650   5.016  55.566 1.00 . A A . 39 LEU O    1 1 
        9 10933 1 1 40 THR C    C  -6.194   6.395  54.760 1.00 . A A . 40 THR C    1 1 
        9 10934 1 1 40 THR CA   C  -7.115   5.237  54.328 1.00 . A A . 40 THR CA   1 1 
        9 10935 1 1 40 THR CB   C  -6.389   4.490  53.196 1.00 . A A . 40 THR CB   1 1 
        9 10936 1 1 40 THR CG2  C  -5.256   3.637  53.774 1.00 . A A . 40 THR CG2  1 1 
        9 10937 1 1 40 THR H    H  -8.456   5.960  52.850 1.00 . A A . 40 THR H    1 1 
        9 10938 1 1 40 THR HA   H  -7.276   4.505  55.108 1.00 . A A . 40 THR HA   1 1 
        9 10939 1 1 40 THR HB   H  -5.980   5.198  52.490 1.00 . A A . 40 THR HB   1 1 
        9 10940 1 1 40 THR HG1  H  -7.553   2.934  53.130 1.00 . A A . 40 THR HG1  1 1 
        9 10941 1 1 40 THR HG21 H  -4.634   4.244  54.413 1.00 . A A . 40 THR HG21 1 1 
        9 10942 1 1 40 THR HG22 H  -4.660   3.237  52.967 1.00 . A A . 40 THR HG22 1 1 
        9 10943 1 1 40 THR HG23 H  -5.676   2.824  54.346 1.00 . A A . 40 THR HG23 1 1 
        9 10944 1 1 40 THR N    N  -8.419   5.665  53.779 1.00 . A A . 40 THR N    1 1 
        9 10945 1 1 40 THR O    O  -5.259   6.212  55.538 1.00 . A A . 40 THR O    1 1 
        9 10946 1 1 40 THR OG1  O  -7.319   3.648  52.531 1.00 . A A . 40 THR OG1  1 1 
        9 10947 1 1 41 GLY C    C  -4.312   8.750  54.339 1.00 . A A . 41 GLY C    1 1 
        9 10948 1 1 41 GLY CA   C  -5.801   8.803  54.652 1.00 . A A . 41 GLY CA   1 1 
        9 10949 1 1 41 GLY H    H  -7.398   7.632  53.828 1.00 . A A . 41 GLY H    1 1 
        9 10950 1 1 41 GLY HA2  H  -6.216   9.649  54.132 1.00 . A A . 41 GLY HA2  1 1 
        9 10951 1 1 41 GLY HA3  H  -5.920   8.960  55.714 1.00 . A A . 41 GLY HA3  1 1 
        9 10952 1 1 41 GLY N    N  -6.532   7.582  54.285 1.00 . A A . 41 GLY N    1 1 
        9 10953 1 1 41 GLY O    O  -3.513   8.280  55.148 1.00 . A A . 41 GLY O    1 1 
        9 10954 1 1 42 TYR C    C  -2.159  10.798  52.584 1.00 . A A . 42 TYR C    1 1 
        9 10955 1 1 42 TYR CA   C  -2.549   9.325  52.734 1.00 . A A . 42 TYR CA   1 1 
        9 10956 1 1 42 TYR CB   C  -2.426   8.596  51.363 1.00 . A A . 42 TYR CB   1 1 
        9 10957 1 1 42 TYR CD1  C  -1.596   6.450  52.408 1.00 . A A . 42 TYR CD1  1 1 
        9 10958 1 1 42 TYR CD2  C  -0.306   7.434  50.607 1.00 . A A . 42 TYR CD2  1 1 
        9 10959 1 1 42 TYR CE1  C  -0.663   5.412  52.510 1.00 . A A . 42 TYR CE1  1 1 
        9 10960 1 1 42 TYR CE2  C   0.627   6.396  50.708 1.00 . A A . 42 TYR CE2  1 1 
        9 10961 1 1 42 TYR CG   C  -1.419   7.461  51.457 1.00 . A A . 42 TYR CG   1 1 
        9 10962 1 1 42 TYR CZ   C   0.449   5.384  51.661 1.00 . A A . 42 TYR CZ   1 1 
        9 10963 1 1 42 TYR H    H  -4.599   9.630  52.543 1.00 . A A . 42 TYR H    1 1 
        9 10964 1 1 42 TYR HA   H  -1.882   8.845  53.440 1.00 . A A . 42 TYR HA   1 1 
        9 10965 1 1 42 TYR HB2  H  -3.390   8.188  51.094 1.00 . A A . 42 TYR HB2  1 1 
        9 10966 1 1 42 TYR HB3  H  -2.113   9.291  50.594 1.00 . A A . 42 TYR HB3  1 1 
        9 10967 1 1 42 TYR HD1  H  -2.455   6.471  53.064 1.00 . A A . 42 TYR HD1  1 1 
        9 10968 1 1 42 TYR HD2  H  -0.167   8.213  49.871 1.00 . A A . 42 TYR HD2  1 1 
        9 10969 1 1 42 TYR HE1  H  -0.801   4.632  53.244 1.00 . A A . 42 TYR HE1  1 1 
        9 10970 1 1 42 TYR HE2  H   1.486   6.374  50.053 1.00 . A A . 42 TYR HE2  1 1 
        9 10971 1 1 42 TYR HH   H   2.179   4.725  52.127 1.00 . A A . 42 TYR HH   1 1 
        9 10972 1 1 42 TYR N    N  -3.940   9.266  53.170 1.00 . A A . 42 TYR N    1 1 
        9 10973 1 1 42 TYR O    O  -1.222  11.141  51.862 1.00 . A A . 42 TYR O    1 1 
        9 10974 1 1 42 TYR OH   O   1.370   4.361  51.761 1.00 . A A . 42 TYR OH   1 1 
        9 10975 1 1 43 LEU C    C  -1.269  13.532  53.374 1.00 . A A . 43 LEU C    1 1 
        9 10976 1 1 43 LEU CA   C  -2.724  13.106  53.208 1.00 . A A . 43 LEU CA   1 1 
        9 10977 1 1 43 LEU CB   C  -3.447  13.669  54.438 1.00 . A A . 43 LEU CB   1 1 
        9 10978 1 1 43 LEU CD1  C  -5.605  13.816  55.684 1.00 . A A . 43 LEU CD1  1 1 
        9 10979 1 1 43 LEU CD2  C  -5.611  14.079  53.188 1.00 . A A . 43 LEU CD2  1 1 
        9 10980 1 1 43 LEU CG   C  -4.951  13.353  54.379 1.00 . A A . 43 LEU CG   1 1 
        9 10981 1 1 43 LEU H    H  -3.661  11.330  53.804 1.00 . A A . 43 LEU H    1 1 
        9 10982 1 1 43 LEU HA   H  -3.207  13.566  52.361 1.00 . A A . 43 LEU HA   1 1 
        9 10983 1 1 43 LEU HB2  H  -3.026  13.228  55.330 1.00 . A A . 43 LEU HB2  1 1 
        9 10984 1 1 43 LEU HB3  H  -3.309  14.740  54.472 1.00 . A A . 43 LEU HB3  1 1 
        9 10985 1 1 43 LEU HD11 H  -6.677  13.697  55.613 1.00 . A A . 43 LEU HD11 1 1 
        9 10986 1 1 43 LEU HD12 H  -5.369  14.856  55.857 1.00 . A A . 43 LEU HD12 1 1 
        9 10987 1 1 43 LEU HD13 H  -5.231  13.221  56.504 1.00 . A A . 43 LEU HD13 1 1 
        9 10988 1 1 43 LEU HD21 H  -5.512  13.475  52.297 1.00 . A A . 43 LEU HD21 1 1 
        9 10989 1 1 43 LEU HD22 H  -5.130  15.034  53.029 1.00 . A A . 43 LEU HD22 1 1 
        9 10990 1 1 43 LEU HD23 H  -6.661  14.238  53.392 1.00 . A A . 43 LEU HD23 1 1 
        9 10991 1 1 43 LEU HG   H  -5.088  12.287  54.273 1.00 . A A . 43 LEU HG   1 1 
        9 10992 1 1 43 LEU N    N  -2.920  11.660  53.255 1.00 . A A . 43 LEU N    1 1 
        9 10993 1 1 43 LEU O    O  -0.708  14.222  52.528 1.00 . A A . 43 LEU O    1 1 
        9 10994 1 1 44 ASP C    C   1.636  12.825  53.730 1.00 . A A . 44 ASP C    1 1 
        9 10995 1 1 44 ASP CA   C   0.715  13.448  54.775 1.00 . A A . 44 ASP CA   1 1 
        9 10996 1 1 44 ASP CB   C   1.105  12.998  56.184 1.00 . A A . 44 ASP CB   1 1 
        9 10997 1 1 44 ASP CG   C   2.536  13.417  56.499 1.00 . A A . 44 ASP CG   1 1 
        9 10998 1 1 44 ASP H    H  -1.201  12.548  55.093 1.00 . A A . 44 ASP H    1 1 
        9 10999 1 1 44 ASP HA   H   0.826  14.516  54.679 1.00 . A A . 44 ASP HA   1 1 
        9 11000 1 1 44 ASP HB2  H   0.434  13.447  56.900 1.00 . A A . 44 ASP HB2  1 1 
        9 11001 1 1 44 ASP HB3  H   1.026  11.923  56.246 1.00 . A A . 44 ASP HB3  1 1 
        9 11002 1 1 44 ASP N    N  -0.676  13.111  54.485 1.00 . A A . 44 ASP N    1 1 
        9 11003 1 1 44 ASP O    O   2.594  13.459  53.289 1.00 . A A . 44 ASP O    1 1 
        9 11004 1 1 44 ASP OD1  O   3.118  14.133  55.702 1.00 . A A . 44 ASP OD1  1 1 
        9 11005 1 1 44 ASP OD2  O   3.030  13.013  57.540 1.00 . A A . 44 ASP OD2  1 1 
        9 11006 1 1 45 TYR C    C   2.290  11.758  51.077 1.00 . A A . 45 TYR C    1 1 
        9 11007 1 1 45 TYR CA   C   2.198  10.921  52.356 1.00 . A A . 45 TYR CA   1 1 
        9 11008 1 1 45 TYR CB   C   1.636   9.528  52.030 1.00 . A A . 45 TYR CB   1 1 
        9 11009 1 1 45 TYR CD1  C   3.292   7.875  52.961 1.00 . A A . 45 TYR CD1  1 1 
        9 11010 1 1 45 TYR CD2  C   1.236   8.268  54.186 1.00 . A A . 45 TYR CD2  1 1 
        9 11011 1 1 45 TYR CE1  C   3.693   6.950  53.933 1.00 . A A . 45 TYR CE1  1 1 
        9 11012 1 1 45 TYR CE2  C   1.638   7.342  55.156 1.00 . A A . 45 TYR CE2  1 1 
        9 11013 1 1 45 TYR CG   C   2.063   8.534  53.088 1.00 . A A . 45 TYR CG   1 1 
        9 11014 1 1 45 TYR CZ   C   2.866   6.683  55.030 1.00 . A A . 45 TYR CZ   1 1 
        9 11015 1 1 45 TYR H    H   0.603  11.117  53.752 1.00 . A A . 45 TYR H    1 1 
        9 11016 1 1 45 TYR HA   H   3.195  10.813  52.760 1.00 . A A . 45 TYR HA   1 1 
        9 11017 1 1 45 TYR HB2  H   0.557   9.577  51.999 1.00 . A A . 45 TYR HB2  1 1 
        9 11018 1 1 45 TYR HB3  H   2.006   9.202  51.068 1.00 . A A . 45 TYR HB3  1 1 
        9 11019 1 1 45 TYR HD1  H   3.930   8.080  52.115 1.00 . A A . 45 TYR HD1  1 1 
        9 11020 1 1 45 TYR HD2  H   0.290   8.776  54.284 1.00 . A A . 45 TYR HD2  1 1 
        9 11021 1 1 45 TYR HE1  H   4.642   6.441  53.834 1.00 . A A . 45 TYR HE1  1 1 
        9 11022 1 1 45 TYR HE2  H   0.999   7.136  56.003 1.00 . A A . 45 TYR HE2  1 1 
        9 11023 1 1 45 TYR HH   H   3.905   6.198  56.556 1.00 . A A . 45 TYR HH   1 1 
        9 11024 1 1 45 TYR N    N   1.358  11.588  53.343 1.00 . A A . 45 TYR N    1 1 
        9 11025 1 1 45 TYR O    O   3.356  11.823  50.489 1.00 . A A . 45 TYR O    1 1 
        9 11026 1 1 45 TYR OH   O   3.262   5.771  55.987 1.00 . A A . 45 TYR OH   1 1 
        9 11027 1 1 46 VAL C    C   2.269  13.763  48.804 1.00 . A A . 46 VAL C    1 1 
        9 11028 1 1 46 VAL CA   C   0.992  13.147  49.416 1.00 . A A . 46 VAL CA   1 1 
        9 11029 1 1 46 VAL CB   C   0.007  14.286  49.701 1.00 . A A . 46 VAL CB   1 1 
        9 11030 1 1 46 VAL CG1  C   0.677  15.328  50.605 1.00 . A A . 46 VAL CG1  1 1 
        9 11031 1 1 46 VAL CG2  C  -0.418  14.953  48.387 1.00 . A A . 46 VAL CG2  1 1 
        9 11032 1 1 46 VAL H    H   0.323  12.149  51.149 1.00 . A A . 46 VAL H    1 1 
        9 11033 1 1 46 VAL HA   H   0.539  12.509  48.675 1.00 . A A . 46 VAL HA   1 1 
        9 11034 1 1 46 VAL HB   H  -0.864  13.886  50.201 1.00 . A A . 46 VAL HB   1 1 
        9 11035 1 1 46 VAL HG11 H  -0.080  15.955  51.053 1.00 . A A . 46 VAL HG11 1 1 
        9 11036 1 1 46 VAL HG12 H   1.347  15.939  50.017 1.00 . A A . 46 VAL HG12 1 1 
        9 11037 1 1 46 VAL HG13 H   1.237  14.828  51.381 1.00 . A A . 46 VAL HG13 1 1 
        9 11038 1 1 46 VAL HG21 H   0.394  15.559  48.014 1.00 . A A . 46 VAL HG21 1 1 
        9 11039 1 1 46 VAL HG22 H  -1.280  15.580  48.566 1.00 . A A . 46 VAL HG22 1 1 
        9 11040 1 1 46 VAL HG23 H  -0.669  14.198  47.657 1.00 . A A . 46 VAL HG23 1 1 
        9 11041 1 1 46 VAL N    N   1.148  12.332  50.655 1.00 . A A . 46 VAL N    1 1 
        9 11042 1 1 46 VAL O    O   2.248  14.166  47.640 1.00 . A A . 46 VAL O    1 1 
        9 11043 1 1 47 LEU C    C   5.413  13.205  48.276 1.00 . A A . 47 LEU C    1 1 
        9 11044 1 1 47 LEU CA   C   4.622  14.332  48.973 1.00 . A A . 47 LEU CA   1 1 
        9 11045 1 1 47 LEU CB   C   5.456  14.955  50.111 1.00 . A A . 47 LEU CB   1 1 
        9 11046 1 1 47 LEU CD1  C   7.049  16.774  50.751 1.00 . A A . 47 LEU CD1  1 1 
        9 11047 1 1 47 LEU CD2  C   7.433  15.479  48.638 1.00 . A A . 47 LEU CD2  1 1 
        9 11048 1 1 47 LEU CG   C   6.368  16.070  49.574 1.00 . A A . 47 LEU CG   1 1 
        9 11049 1 1 47 LEU H    H   3.369  13.399  50.419 1.00 . A A . 47 LEU H    1 1 
        9 11050 1 1 47 LEU HA   H   4.384  15.103  48.253 1.00 . A A . 47 LEU HA   1 1 
        9 11051 1 1 47 LEU HB2  H   4.786  15.374  50.847 1.00 . A A . 47 LEU HB2  1 1 
        9 11052 1 1 47 LEU HB3  H   6.058  14.195  50.578 1.00 . A A . 47 LEU HB3  1 1 
        9 11053 1 1 47 LEU HD11 H   6.300  17.257  51.363 1.00 . A A . 47 LEU HD11 1 1 
        9 11054 1 1 47 LEU HD12 H   7.740  17.514  50.376 1.00 . A A . 47 LEU HD12 1 1 
        9 11055 1 1 47 LEU HD13 H   7.585  16.048  51.344 1.00 . A A . 47 LEU HD13 1 1 
        9 11056 1 1 47 LEU HD21 H   7.005  15.330  47.660 1.00 . A A . 47 LEU HD21 1 1 
        9 11057 1 1 47 LEU HD22 H   7.780  14.533  49.029 1.00 . A A . 47 LEU HD22 1 1 
        9 11058 1 1 47 LEU HD23 H   8.268  16.162  48.560 1.00 . A A . 47 LEU HD23 1 1 
        9 11059 1 1 47 LEU HG   H   5.770  16.790  49.032 1.00 . A A . 47 LEU HG   1 1 
        9 11060 1 1 47 LEU N    N   3.373  13.803  49.529 1.00 . A A . 47 LEU N    1 1 
        9 11061 1 1 47 LEU O    O   5.894  13.349  47.152 1.00 . A A . 47 LEU O    1 1 
        9 11062 1 1 48 LEU C    C   5.630  10.318  47.179 1.00 . A A . 48 LEU C    1 1 
        9 11063 1 1 48 LEU CA   C   6.229  10.896  48.486 1.00 . A A . 48 LEU CA   1 1 
        9 11064 1 1 48 LEU CB   C   6.296   9.805  49.568 1.00 . A A . 48 LEU CB   1 1 
        9 11065 1 1 48 LEU CD1  C   7.037  11.500  51.262 1.00 . A A . 48 LEU CD1  1 1 
        9 11066 1 1 48 LEU CD2  C   7.426   9.061  51.672 1.00 . A A . 48 LEU CD2  1 1 
        9 11067 1 1 48 LEU CG   C   7.370  10.158  50.604 1.00 . A A . 48 LEU CG   1 1 
        9 11068 1 1 48 LEU H    H   5.062  12.088  49.854 1.00 . A A . 48 LEU H    1 1 
        9 11069 1 1 48 LEU HA   H   7.232  11.195  48.231 1.00 . A A . 48 LEU HA   1 1 
        9 11070 1 1 48 LEU HB2  H   5.339   9.729  50.059 1.00 . A A . 48 LEU HB2  1 1 
        9 11071 1 1 48 LEU HB3  H   6.542   8.857  49.111 1.00 . A A . 48 LEU HB3  1 1 
        9 11072 1 1 48 LEU HD11 H   5.973  11.566  51.439 1.00 . A A . 48 LEU HD11 1 1 
        9 11073 1 1 48 LEU HD12 H   7.345  12.298  50.607 1.00 . A A . 48 LEU HD12 1 1 
        9 11074 1 1 48 LEU HD13 H   7.565  11.586  52.202 1.00 . A A . 48 LEU HD13 1 1 
        9 11075 1 1 48 LEU HD21 H   7.399   8.090  51.197 1.00 . A A . 48 LEU HD21 1 1 
        9 11076 1 1 48 LEU HD22 H   6.579   9.160  52.335 1.00 . A A . 48 LEU HD22 1 1 
        9 11077 1 1 48 LEU HD23 H   8.339   9.158  52.241 1.00 . A A . 48 LEU HD23 1 1 
        9 11078 1 1 48 LEU HG   H   8.329  10.229  50.112 1.00 . A A . 48 LEU HG   1 1 
        9 11079 1 1 48 LEU N    N   5.517  12.085  48.985 1.00 . A A . 48 LEU N    1 1 
        9 11080 1 1 48 LEU O    O   6.391   9.990  46.269 1.00 . A A . 48 LEU O    1 1 
        9 11081 1 1 49 PRO C    C   3.888  10.513  44.594 1.00 . A A . 49 PRO C    1 1 
        9 11082 1 1 49 PRO CA   C   3.735   9.584  45.799 1.00 . A A . 49 PRO CA   1 1 
        9 11083 1 1 49 PRO CB   C   2.264   9.340  46.165 1.00 . A A . 49 PRO CB   1 1 
        9 11084 1 1 49 PRO CD   C   3.289  10.519  48.016 1.00 . A A . 49 PRO CD   1 1 
        9 11085 1 1 49 PRO CG   C   1.972  10.321  47.251 1.00 . A A . 49 PRO CG   1 1 
        9 11086 1 1 49 PRO HA   H   4.207   8.638  45.582 1.00 . A A . 49 PRO HA   1 1 
        9 11087 1 1 49 PRO HB2  H   1.624   9.514  45.309 1.00 . A A . 49 PRO HB2  1 1 
        9 11088 1 1 49 PRO HB3  H   2.129   8.331  46.533 1.00 . A A . 49 PRO HB3  1 1 
        9 11089 1 1 49 PRO HD2  H   3.388  11.545  48.298 1.00 . A A . 49 PRO HD2  1 1 
        9 11090 1 1 49 PRO HD3  H   3.337   9.872  48.877 1.00 . A A . 49 PRO HD3  1 1 
        9 11091 1 1 49 PRO HG2  H   1.638  11.261  46.824 1.00 . A A . 49 PRO HG2  1 1 
        9 11092 1 1 49 PRO HG3  H   1.218   9.932  47.920 1.00 . A A . 49 PRO HG3  1 1 
        9 11093 1 1 49 PRO N    N   4.329  10.161  47.044 1.00 . A A . 49 PRO N    1 1 
        9 11094 1 1 49 PRO O    O   3.927  10.056  43.452 1.00 . A A . 49 PRO O    1 1 
        9 11095 1 1 50 ALA C    C   5.608  12.712  43.225 1.00 . A A . 50 ALA C    1 1 
        9 11096 1 1 50 ALA CA   C   4.199  12.803  43.800 1.00 . A A . 50 ALA CA   1 1 
        9 11097 1 1 50 ALA CB   C   3.952  14.208  44.350 1.00 . A A . 50 ALA CB   1 1 
        9 11098 1 1 50 ALA H    H   4.020  12.136  45.781 1.00 . A A . 50 ALA H    1 1 
        9 11099 1 1 50 ALA HA   H   3.521  12.623  42.979 1.00 . A A . 50 ALA HA   1 1 
        9 11100 1 1 50 ALA HB1  H   4.803  14.518  44.939 1.00 . A A . 50 ALA HB1  1 1 
        9 11101 1 1 50 ALA HB2  H   3.068  14.200  44.972 1.00 . A A . 50 ALA HB2  1 1 
        9 11102 1 1 50 ALA HB3  H   3.810  14.898  43.531 1.00 . A A . 50 ALA HB3  1 1 
        9 11103 1 1 50 ALA N    N   4.009  11.813  44.856 1.00 . A A . 50 ALA N    1 1 
        9 11104 1 1 50 ALA O    O   5.818  12.985  42.043 1.00 . A A . 50 ALA O    1 1 
        9 11105 1 1 51 LEU C    C   7.979  11.066  42.510 1.00 . A A . 51 LEU C    1 1 
        9 11106 1 1 51 LEU CA   C   7.937  12.160  43.569 1.00 . A A . 51 LEU CA   1 1 
        9 11107 1 1 51 LEU CB   C   8.867  11.785  44.727 1.00 . A A . 51 LEU CB   1 1 
        9 11108 1 1 51 LEU CD1  C   9.775  12.498  46.946 1.00 . A A . 51 LEU CD1  1 1 
        9 11109 1 1 51 LEU CD2  C   9.761  14.134  45.034 1.00 . A A . 51 LEU CD2  1 1 
        9 11110 1 1 51 LEU CG   C   9.006  12.965  45.703 1.00 . A A . 51 LEU CG   1 1 
        9 11111 1 1 51 LEU H    H   6.349  12.055  44.969 1.00 . A A . 51 LEU H    1 1 
        9 11112 1 1 51 LEU HA   H   8.264  13.092  43.138 1.00 . A A . 51 LEU HA   1 1 
        9 11113 1 1 51 LEU HB2  H   8.454  10.934  45.251 1.00 . A A . 51 LEU HB2  1 1 
        9 11114 1 1 51 LEU HB3  H   9.840  11.525  44.337 1.00 . A A . 51 LEU HB3  1 1 
        9 11115 1 1 51 LEU HD11 H   9.345  11.579  47.313 1.00 . A A . 51 LEU HD11 1 1 
        9 11116 1 1 51 LEU HD12 H   9.714  13.256  47.712 1.00 . A A . 51 LEU HD12 1 1 
        9 11117 1 1 51 LEU HD13 H  10.810  12.333  46.686 1.00 . A A . 51 LEU HD13 1 1 
        9 11118 1 1 51 LEU HD21 H   9.056  14.761  44.508 1.00 . A A . 51 LEU HD21 1 1 
        9 11119 1 1 51 LEU HD22 H  10.492  13.752  44.337 1.00 . A A . 51 LEU HD22 1 1 
        9 11120 1 1 51 LEU HD23 H  10.263  14.724  45.789 1.00 . A A . 51 LEU HD23 1 1 
        9 11121 1 1 51 LEU HG   H   8.021  13.295  46.000 1.00 . A A . 51 LEU HG   1 1 
        9 11122 1 1 51 LEU N    N   6.568  12.304  44.046 1.00 . A A . 51 LEU N    1 1 
        9 11123 1 1 51 LEU O    O   8.654  11.183  41.490 1.00 . A A . 51 LEU O    1 1 
        9 11124 1 1 52 ALA C    C   6.584   9.421  40.489 1.00 . A A . 52 ALA C    1 1 
        9 11125 1 1 52 ALA CA   C   7.112   8.905  41.825 1.00 . A A . 52 ALA CA   1 1 
        9 11126 1 1 52 ALA CB   C   6.184   7.819  42.373 1.00 . A A . 52 ALA CB   1 1 
        9 11127 1 1 52 ALA H    H   6.664  10.040  43.578 1.00 . A A . 52 ALA H    1 1 
        9 11128 1 1 52 ALA HA   H   8.093   8.487  41.654 1.00 . A A . 52 ALA HA   1 1 
        9 11129 1 1 52 ALA HB1  H   5.239   8.260  42.650 1.00 . A A . 52 ALA HB1  1 1 
        9 11130 1 1 52 ALA HB2  H   6.638   7.363  43.241 1.00 . A A . 52 ALA HB2  1 1 
        9 11131 1 1 52 ALA HB3  H   6.022   7.067  41.615 1.00 . A A . 52 ALA HB3  1 1 
        9 11132 1 1 52 ALA N    N   7.207  10.016  42.763 1.00 . A A . 52 ALA N    1 1 
        9 11133 1 1 52 ALA O    O   7.077   9.038  39.428 1.00 . A A . 52 ALA O    1 1 
        9 11134 1 1 53 ILE C    C   6.102  11.674  38.565 1.00 . A A . 53 ILE C    1 1 
        9 11135 1 1 53 ILE CA   C   5.036  10.885  39.324 1.00 . A A . 53 ILE CA   1 1 
        9 11136 1 1 53 ILE CB   C   3.861  11.806  39.669 1.00 . A A . 53 ILE CB   1 1 
        9 11137 1 1 53 ILE CD1  C   2.254   9.855  39.404 1.00 . A A . 53 ILE CD1  1 1 
        9 11138 1 1 53 ILE CG1  C   2.726  10.993  40.322 1.00 . A A . 53 ILE CG1  1 1 
        9 11139 1 1 53 ILE CG2  C   3.349  12.494  38.399 1.00 . A A . 53 ILE CG2  1 1 
        9 11140 1 1 53 ILE H    H   5.242  10.586  41.415 1.00 . A A . 53 ILE H    1 1 
        9 11141 1 1 53 ILE HA   H   4.702  10.118  38.645 1.00 . A A . 53 ILE HA   1 1 
        9 11142 1 1 53 ILE HB   H   4.200  12.562  40.363 1.00 . A A . 53 ILE HB   1 1 
        9 11143 1 1 53 ILE HD11 H   1.229   9.609  39.639 1.00 . A A . 53 ILE HD11 1 1 
        9 11144 1 1 53 ILE HD12 H   2.874   8.985  39.564 1.00 . A A . 53 ILE HD12 1 1 
        9 11145 1 1 53 ILE HD13 H   2.322  10.157  38.371 1.00 . A A . 53 ILE HD13 1 1 
        9 11146 1 1 53 ILE HG12 H   3.083  10.573  41.251 1.00 . A A . 53 ILE HG12 1 1 
        9 11147 1 1 53 ILE HG13 H   1.895  11.651  40.529 1.00 . A A . 53 ILE HG13 1 1 
        9 11148 1 1 53 ILE HG21 H   3.234  11.762  37.614 1.00 . A A . 53 ILE HG21 1 1 
        9 11149 1 1 53 ILE HG22 H   4.056  13.249  38.089 1.00 . A A . 53 ILE HG22 1 1 
        9 11150 1 1 53 ILE HG23 H   2.394  12.956  38.601 1.00 . A A . 53 ILE HG23 1 1 
        9 11151 1 1 53 ILE N    N   5.596  10.310  40.544 1.00 . A A . 53 ILE N    1 1 
        9 11152 1 1 53 ILE O    O   6.280  11.455  37.366 1.00 . A A . 53 ILE O    1 1 
        9 11153 1 1 54 PHE C    C   8.889  12.416  37.939 1.00 . A A . 54 PHE C    1 1 
        9 11154 1 1 54 PHE CA   C   7.837  13.353  38.521 1.00 . A A . 54 PHE CA   1 1 
        9 11155 1 1 54 PHE CB   C   8.498  14.356  39.469 1.00 . A A . 54 PHE CB   1 1 
        9 11156 1 1 54 PHE CD1  C   7.191  16.392  38.770 1.00 . A A . 54 PHE CD1  1 1 
        9 11157 1 1 54 PHE CD2  C   6.967  15.595  41.049 1.00 . A A . 54 PHE CD2  1 1 
        9 11158 1 1 54 PHE CE1  C   6.292  17.431  39.045 1.00 . A A . 54 PHE CE1  1 1 
        9 11159 1 1 54 PHE CE2  C   6.068  16.633  41.323 1.00 . A A . 54 PHE CE2  1 1 
        9 11160 1 1 54 PHE CG   C   7.528  15.474  39.772 1.00 . A A . 54 PHE CG   1 1 
        9 11161 1 1 54 PHE CZ   C   5.731  17.551  40.322 1.00 . A A . 54 PHE CZ   1 1 
        9 11162 1 1 54 PHE H    H   6.650  12.774  40.170 1.00 . A A . 54 PHE H    1 1 
        9 11163 1 1 54 PHE HA   H   7.381  13.889  37.704 1.00 . A A . 54 PHE HA   1 1 
        9 11164 1 1 54 PHE HB2  H   8.774  13.855  40.387 1.00 . A A . 54 PHE HB2  1 1 
        9 11165 1 1 54 PHE HB3  H   9.382  14.764  39.003 1.00 . A A . 54 PHE HB3  1 1 
        9 11166 1 1 54 PHE HD1  H   7.623  16.299  37.785 1.00 . A A . 54 PHE HD1  1 1 
        9 11167 1 1 54 PHE HD2  H   7.226  14.887  41.822 1.00 . A A . 54 PHE HD2  1 1 
        9 11168 1 1 54 PHE HE1  H   6.032  18.139  38.272 1.00 . A A . 54 PHE HE1  1 1 
        9 11169 1 1 54 PHE HE2  H   5.635  16.726  42.309 1.00 . A A . 54 PHE HE2  1 1 
        9 11170 1 1 54 PHE HZ   H   5.038  18.351  40.534 1.00 . A A . 54 PHE HZ   1 1 
        9 11171 1 1 54 PHE N    N   6.814  12.583  39.223 1.00 . A A . 54 PHE N    1 1 
        9 11172 1 1 54 PHE O    O   9.349  12.612  36.816 1.00 . A A . 54 PHE O    1 1 
        9 11173 1 1 55 ILE C    C   9.601   9.673  36.989 1.00 . A A . 55 ILE C    1 1 
        9 11174 1 1 55 ILE CA   C  10.191  10.394  38.198 1.00 . A A . 55 ILE CA   1 1 
        9 11175 1 1 55 ILE CB   C  10.505   9.382  39.306 1.00 . A A . 55 ILE CB   1 1 
        9 11176 1 1 55 ILE CD1  C  11.360   9.176  41.648 1.00 . A A . 55 ILE CD1  1 1 
        9 11177 1 1 55 ILE CG1  C  11.303  10.077  40.412 1.00 . A A . 55 ILE CG1  1 1 
        9 11178 1 1 55 ILE CG2  C  11.337   8.230  38.734 1.00 . A A . 55 ILE CG2  1 1 
        9 11179 1 1 55 ILE H    H   8.800  11.243  39.554 1.00 . A A . 55 ILE H    1 1 
        9 11180 1 1 55 ILE HA   H  11.106  10.902  37.929 1.00 . A A . 55 ILE HA   1 1 
        9 11181 1 1 55 ILE HB   H   9.584   8.995  39.713 1.00 . A A . 55 ILE HB   1 1 
        9 11182 1 1 55 ILE HD11 H  12.091   9.562  42.341 1.00 . A A . 55 ILE HD11 1 1 
        9 11183 1 1 55 ILE HD12 H  11.638   8.175  41.351 1.00 . A A . 55 ILE HD12 1 1 
        9 11184 1 1 55 ILE HD13 H  10.390   9.154  42.122 1.00 . A A . 55 ILE HD13 1 1 
        9 11185 1 1 55 ILE HG12 H  12.308  10.270  40.062 1.00 . A A . 55 ILE HG12 1 1 
        9 11186 1 1 55 ILE HG13 H  10.829  11.010  40.670 1.00 . A A . 55 ILE HG13 1 1 
        9 11187 1 1 55 ILE HG21 H  12.131   8.628  38.123 1.00 . A A . 55 ILE HG21 1 1 
        9 11188 1 1 55 ILE HG22 H  10.704   7.593  38.134 1.00 . A A . 55 ILE HG22 1 1 
        9 11189 1 1 55 ILE HG23 H  11.760   7.655  39.545 1.00 . A A . 55 ILE HG23 1 1 
        9 11190 1 1 55 ILE N    N   9.231  11.377  38.683 1.00 . A A . 55 ILE N    1 1 
        9 11191 1 1 55 ILE O    O  10.275   9.421  35.991 1.00 . A A . 55 ILE O    1 1 
        9 11192 1 1 56 GLY C    C   7.506   9.561  34.790 1.00 . A A . 56 GLY C    1 1 
        9 11193 1 1 56 GLY CA   C   7.573   8.695  36.047 1.00 . A A . 56 GLY CA   1 1 
        9 11194 1 1 56 GLY H    H   7.857   9.658  37.927 1.00 . A A . 56 GLY H    1 1 
        9 11195 1 1 56 GLY HA2  H   8.066   7.763  35.810 1.00 . A A . 56 GLY HA2  1 1 
        9 11196 1 1 56 GLY HA3  H   6.569   8.490  36.388 1.00 . A A . 56 GLY HA3  1 1 
        9 11197 1 1 56 GLY N    N   8.312   9.368  37.110 1.00 . A A . 56 GLY N    1 1 
        9 11198 1 1 56 GLY O    O   7.668   9.067  33.674 1.00 . A A . 56 GLY O    1 1 
        9 11199 1 1 57 LEU C    C   8.529  11.795  33.103 1.00 . A A . 57 LEU C    1 1 
        9 11200 1 1 57 LEU CA   C   7.192  11.772  33.838 1.00 . A A . 57 LEU CA   1 1 
        9 11201 1 1 57 LEU CB   C   6.826  13.188  34.301 1.00 . A A . 57 LEU CB   1 1 
        9 11202 1 1 57 LEU CD1  C   5.081  14.583  35.432 1.00 . A A . 57 LEU CD1  1 1 
        9 11203 1 1 57 LEU CD2  C   4.398  13.011  33.593 1.00 . A A . 57 LEU CD2  1 1 
        9 11204 1 1 57 LEU CG   C   5.364  13.225  34.779 1.00 . A A . 57 LEU CG   1 1 
        9 11205 1 1 57 LEU H    H   7.159  11.184  35.897 1.00 . A A . 57 LEU H    1 1 
        9 11206 1 1 57 LEU HA   H   6.439  11.420  33.153 1.00 . A A . 57 LEU HA   1 1 
        9 11207 1 1 57 LEU HB2  H   7.475  13.475  35.116 1.00 . A A . 57 LEU HB2  1 1 
        9 11208 1 1 57 LEU HB3  H   6.954  13.879  33.482 1.00 . A A . 57 LEU HB3  1 1 
        9 11209 1 1 57 LEU HD11 H   5.683  14.689  36.321 1.00 . A A . 57 LEU HD11 1 1 
        9 11210 1 1 57 LEU HD12 H   4.036  14.644  35.697 1.00 . A A . 57 LEU HD12 1 1 
        9 11211 1 1 57 LEU HD13 H   5.323  15.374  34.738 1.00 . A A . 57 LEU HD13 1 1 
        9 11212 1 1 57 LEU HD21 H   4.227  11.954  33.455 1.00 . A A . 57 LEU HD21 1 1 
        9 11213 1 1 57 LEU HD22 H   4.823  13.425  32.689 1.00 . A A . 57 LEU HD22 1 1 
        9 11214 1 1 57 LEU HD23 H   3.453  13.497  33.796 1.00 . A A . 57 LEU HD23 1 1 
        9 11215 1 1 57 LEU HG   H   5.211  12.444  35.511 1.00 . A A . 57 LEU HG   1 1 
        9 11216 1 1 57 LEU N    N   7.269  10.860  34.979 1.00 . A A . 57 LEU N    1 1 
        9 11217 1 1 57 LEU O    O   8.578  11.682  31.882 1.00 . A A . 57 LEU O    1 1 
        9 11218 1 1 58 THR C    C  11.132  10.849  32.295 1.00 . A A . 58 THR C    1 1 
        9 11219 1 1 58 THR CA   C  10.919  12.051  33.212 1.00 . A A . 58 THR CA   1 1 
        9 11220 1 1 58 THR CB   C  12.013  12.073  34.284 1.00 . A A . 58 THR CB   1 1 
        9 11221 1 1 58 THR CG2  C  11.901  13.353  35.117 1.00 . A A . 58 THR CG2  1 1 
        9 11222 1 1 58 THR H    H   9.507  12.156  34.801 1.00 . A A . 58 THR H    1 1 
        9 11223 1 1 58 THR HA   H  10.978  12.969  32.647 1.00 . A A . 58 THR HA   1 1 
        9 11224 1 1 58 THR HB   H  12.980  12.045  33.808 1.00 . A A . 58 THR HB   1 1 
        9 11225 1 1 58 THR HG1  H  12.724  10.500  35.179 1.00 . A A . 58 THR HG1  1 1 
        9 11226 1 1 58 THR HG21 H  12.357  14.172  34.579 1.00 . A A . 58 THR HG21 1 1 
        9 11227 1 1 58 THR HG22 H  12.410  13.216  36.059 1.00 . A A . 58 THR HG22 1 1 
        9 11228 1 1 58 THR HG23 H  10.861  13.579  35.301 1.00 . A A . 58 THR HG23 1 1 
        9 11229 1 1 58 THR N    N   9.608  11.979  33.843 1.00 . A A . 58 THR N    1 1 
        9 11230 1 1 58 THR O    O  11.682  10.982  31.208 1.00 . A A . 58 THR O    1 1 
        9 11231 1 1 58 THR OG1  O  11.872  10.939  35.128 1.00 . A A . 58 THR OG1  1 1 
        9 11232 1 1 59 ILE C    C   9.940   8.617  30.634 1.00 . A A . 59 ILE C    1 1 
        9 11233 1 1 59 ILE CA   C  10.745   8.466  31.933 1.00 . A A . 59 ILE CA   1 1 
        9 11234 1 1 59 ILE CB   C  10.266   7.248  32.729 1.00 . A A . 59 ILE CB   1 1 
        9 11235 1 1 59 ILE CD1  C  10.661   5.937  34.829 1.00 . A A . 59 ILE CD1  1 1 
        9 11236 1 1 59 ILE CG1  C  11.247   6.979  33.874 1.00 . A A . 59 ILE CG1  1 1 
        9 11237 1 1 59 ILE CG2  C  10.210   6.023  31.811 1.00 . A A . 59 ILE CG2  1 1 
        9 11238 1 1 59 ILE H    H  10.166   9.691  33.591 1.00 . A A . 59 ILE H    1 1 
        9 11239 1 1 59 ILE HA   H  11.769   8.319  31.631 1.00 . A A . 59 ILE HA   1 1 
        9 11240 1 1 59 ILE HB   H   9.283   7.443  33.130 1.00 . A A . 59 ILE HB   1 1 
        9 11241 1 1 59 ILE HD11 H  11.242   5.915  35.740 1.00 . A A . 59 ILE HD11 1 1 
        9 11242 1 1 59 ILE HD12 H  10.689   4.963  34.362 1.00 . A A . 59 ILE HD12 1 1 
        9 11243 1 1 59 ILE HD13 H   9.639   6.193  35.063 1.00 . A A . 59 ILE HD13 1 1 
        9 11244 1 1 59 ILE HG12 H  12.179   6.612  33.468 1.00 . A A . 59 ILE HG12 1 1 
        9 11245 1 1 59 ILE HG13 H  11.429   7.896  34.415 1.00 . A A . 59 ILE HG13 1 1 
        9 11246 1 1 59 ILE HG21 H   9.350   6.097  31.163 1.00 . A A . 59 ILE HG21 1 1 
        9 11247 1 1 59 ILE HG22 H  10.135   5.127  32.407 1.00 . A A . 59 ILE HG22 1 1 
        9 11248 1 1 59 ILE HG23 H  11.108   5.981  31.212 1.00 . A A . 59 ILE HG23 1 1 
        9 11249 1 1 59 ILE N    N  10.645   9.690  32.736 1.00 . A A . 59 ILE N    1 1 
        9 11250 1 1 59 ILE O    O  10.418   8.243  29.562 1.00 . A A . 59 ILE O    1 1 
        9 11251 1 1 60 TYR C    C   8.663   9.973  28.386 1.00 . A A . 60 TYR C    1 1 
        9 11252 1 1 60 TYR CA   C   7.882   9.316  29.538 1.00 . A A . 60 TYR CA   1 1 
        9 11253 1 1 60 TYR CB   C   6.612  10.133  29.890 1.00 . A A . 60 TYR CB   1 1 
        9 11254 1 1 60 TYR CD1  C   5.419  10.197  27.652 1.00 . A A . 60 TYR CD1  1 1 
        9 11255 1 1 60 TYR CD2  C   6.313  12.258  28.565 1.00 . A A . 60 TYR CD2  1 1 
        9 11256 1 1 60 TYR CE1  C   4.964  10.894  26.526 1.00 . A A . 60 TYR CE1  1 1 
        9 11257 1 1 60 TYR CE2  C   5.857  12.954  27.440 1.00 . A A . 60 TYR CE2  1 1 
        9 11258 1 1 60 TYR CG   C   6.094  10.879  28.671 1.00 . A A . 60 TYR CG   1 1 
        9 11259 1 1 60 TYR CZ   C   5.182  12.273  26.421 1.00 . A A . 60 TYR CZ   1 1 
        9 11260 1 1 60 TYR H    H   8.371   9.389  31.608 1.00 . A A . 60 TYR H    1 1 
        9 11261 1 1 60 TYR HA   H   7.573   8.344  29.189 1.00 . A A . 60 TYR HA   1 1 
        9 11262 1 1 60 TYR HB2  H   5.843   9.463  30.246 1.00 . A A . 60 TYR HB2  1 1 
        9 11263 1 1 60 TYR HB3  H   6.844  10.840  30.666 1.00 . A A . 60 TYR HB3  1 1 
        9 11264 1 1 60 TYR HD1  H   5.250   9.133  27.733 1.00 . A A . 60 TYR HD1  1 1 
        9 11265 1 1 60 TYR HD2  H   6.834  12.784  29.352 1.00 . A A . 60 TYR HD2  1 1 
        9 11266 1 1 60 TYR HE1  H   4.442  10.368  25.740 1.00 . A A . 60 TYR HE1  1 1 
        9 11267 1 1 60 TYR HE2  H   6.026  14.018  27.359 1.00 . A A . 60 TYR HE2  1 1 
        9 11268 1 1 60 TYR HH   H   5.208  12.628  24.545 1.00 . A A . 60 TYR HH   1 1 
        9 11269 1 1 60 TYR N    N   8.725   9.148  30.726 1.00 . A A . 60 TYR N    1 1 
        9 11270 1 1 60 TYR O    O   8.414   9.665  27.221 1.00 . A A . 60 TYR O    1 1 
        9 11271 1 1 60 TYR OH   O   4.734  12.961  25.311 1.00 . A A . 60 TYR OH   1 1 
        9 11272 1 1 61 ALA C    C  11.390  10.557  26.967 1.00 . A A . 61 ALA C    1 1 
        9 11273 1 1 61 ALA CA   C  10.394  11.512  27.645 1.00 . A A . 61 ALA CA   1 1 
        9 11274 1 1 61 ALA CB   C  11.152  12.699  28.243 1.00 . A A . 61 ALA CB   1 1 
        9 11275 1 1 61 ALA H    H   9.817  11.092  29.612 1.00 . A A . 61 ALA H    1 1 
        9 11276 1 1 61 ALA HA   H   9.755  11.879  26.856 1.00 . A A . 61 ALA HA   1 1 
        9 11277 1 1 61 ALA HB1  H  11.681  13.221  27.458 1.00 . A A . 61 ALA HB1  1 1 
        9 11278 1 1 61 ALA HB2  H  11.859  12.341  28.977 1.00 . A A . 61 ALA HB2  1 1 
        9 11279 1 1 61 ALA HB3  H  10.452  13.373  28.714 1.00 . A A . 61 ALA HB3  1 1 
        9 11280 1 1 61 ALA N    N   9.599  10.859  28.685 1.00 . A A . 61 ALA N    1 1 
        9 11281 1 1 61 ALA O    O  11.750  10.773  25.810 1.00 . A A . 61 ALA O    1 1 
        9 11282 1 1 62 ILE C    C  12.113   7.644  26.027 1.00 . A A . 62 ILE C    1 1 
        9 11283 1 1 62 ILE CA   C  12.784   8.559  27.062 1.00 . A A . 62 ILE CA   1 1 
        9 11284 1 1 62 ILE CB   C  13.434   7.702  28.169 1.00 . A A . 62 ILE CB   1 1 
        9 11285 1 1 62 ILE CD1  C  13.747   9.768  29.554 1.00 . A A . 62 ILE CD1  1 1 
        9 11286 1 1 62 ILE CG1  C  14.448   8.555  28.945 1.00 . A A . 62 ILE CG1  1 1 
        9 11287 1 1 62 ILE CG2  C  14.167   6.500  27.556 1.00 . A A . 62 ILE CG2  1 1 
        9 11288 1 1 62 ILE H    H  11.493   9.330  28.561 1.00 . A A . 62 ILE H    1 1 
        9 11289 1 1 62 ILE HA   H  13.566   9.126  26.580 1.00 . A A . 62 ILE HA   1 1 
        9 11290 1 1 62 ILE HB   H  12.669   7.349  28.845 1.00 . A A . 62 ILE HB   1 1 
        9 11291 1 1 62 ILE HD11 H  12.759   9.487  29.877 1.00 . A A . 62 ILE HD11 1 1 
        9 11292 1 1 62 ILE HD12 H  13.675  10.552  28.814 1.00 . A A . 62 ILE HD12 1 1 
        9 11293 1 1 62 ILE HD13 H  14.314  10.125  30.401 1.00 . A A . 62 ILE HD13 1 1 
        9 11294 1 1 62 ILE HG12 H  14.887   7.961  29.732 1.00 . A A . 62 ILE HG12 1 1 
        9 11295 1 1 62 ILE HG13 H  15.224   8.890  28.272 1.00 . A A . 62 ILE HG13 1 1 
        9 11296 1 1 62 ILE HG21 H  14.830   6.067  28.291 1.00 . A A . 62 ILE HG21 1 1 
        9 11297 1 1 62 ILE HG22 H  14.741   6.825  26.701 1.00 . A A . 62 ILE HG22 1 1 
        9 11298 1 1 62 ILE HG23 H  13.445   5.760  27.243 1.00 . A A . 62 ILE HG23 1 1 
        9 11299 1 1 62 ILE N    N  11.836   9.510  27.660 1.00 . A A . 62 ILE N    1 1 
        9 11300 1 1 62 ILE O    O  12.662   7.387  24.956 1.00 . A A . 62 ILE O    1 1 
        9 11301 1 1 63 GLN C    C   9.768   6.978  24.199 1.00 . A A . 63 GLN C    1 1 
        9 11302 1 1 63 GLN CA   C  10.187   6.262  25.481 1.00 . A A . 63 GLN CA   1 1 
        9 11303 1 1 63 GLN CB   C   8.960   5.659  26.182 1.00 . A A . 63 GLN CB   1 1 
        9 11304 1 1 63 GLN CD   C   6.780   6.214  27.302 1.00 . A A . 63 GLN CD   1 1 
        9 11305 1 1 63 GLN CG   C   8.039   6.781  26.654 1.00 . A A . 63 GLN CG   1 1 
        9 11306 1 1 63 GLN H    H  10.545   7.448  27.229 1.00 . A A . 63 GLN H    1 1 
        9 11307 1 1 63 GLN HA   H  10.840   5.459  25.172 1.00 . A A . 63 GLN HA   1 1 
        9 11308 1 1 63 GLN HB2  H   8.428   5.021  25.492 1.00 . A A . 63 GLN HB2  1 1 
        9 11309 1 1 63 GLN HB3  H   9.283   5.079  27.034 1.00 . A A . 63 GLN HB3  1 1 
        9 11310 1 1 63 GLN HE21 H   5.559   7.190  26.078 1.00 . A A . 63 GLN HE21 1 1 
        9 11311 1 1 63 GLN HE22 H   4.795   6.214  27.239 1.00 . A A . 63 GLN HE22 1 1 
        9 11312 1 1 63 GLN HG2  H   8.569   7.380  27.371 1.00 . A A . 63 GLN HG2  1 1 
        9 11313 1 1 63 GLN HG3  H   7.756   7.394  25.814 1.00 . A A . 63 GLN HG3  1 1 
        9 11314 1 1 63 GLN N    N  10.925   7.155  26.375 1.00 . A A . 63 GLN N    1 1 
        9 11315 1 1 63 GLN NE2  N   5.615   6.569  26.835 1.00 . A A . 63 GLN NE2  1 1 
        9 11316 1 1 63 GLN O    O   9.877   6.401  23.120 1.00 . A A . 63 GLN O    1 1 
        9 11317 1 1 63 GLN OE1  O   6.852   5.459  28.272 1.00 . A A . 63 GLN OE1  1 1 
        9 11318 1 1 64 ARG C    C  10.250   9.141  22.229 1.00 . A A . 64 ARG C    1 1 
        9 11319 1 1 64 ARG CA   C   8.984   8.944  23.059 1.00 . A A . 64 ARG CA   1 1 
        9 11320 1 1 64 ARG CB   C   8.361  10.306  23.402 1.00 . A A . 64 ARG CB   1 1 
        9 11321 1 1 64 ARG CD   C   5.957  10.106  22.654 1.00 . A A . 64 ARG CD   1 1 
        9 11322 1 1 64 ARG CG   C   6.901  10.125  23.864 1.00 . A A . 64 ARG CG   1 1 
        9 11323 1 1 64 ARG CZ   C   5.256  11.647  20.909 1.00 . A A . 64 ARG CZ   1 1 
        9 11324 1 1 64 ARG H    H   9.320   8.677  25.159 1.00 . A A . 64 ARG H    1 1 
        9 11325 1 1 64 ARG HA   H   8.300   8.373  22.456 1.00 . A A . 64 ARG HA   1 1 
        9 11326 1 1 64 ARG HB2  H   8.933  10.766  24.195 1.00 . A A . 64 ARG HB2  1 1 
        9 11327 1 1 64 ARG HB3  H   8.388  10.943  22.529 1.00 . A A . 64 ARG HB3  1 1 
        9 11328 1 1 64 ARG HD2  H   6.330   9.420  21.911 1.00 . A A . 64 ARG HD2  1 1 
        9 113