NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
561570 2lut 18540 cing 4-filtered-FRED STAR entry full 934


data_FRED_restraints_with_modified_coordinates_PDB_code_2lut

# This FRED archive file contains, for PDB entry <2lut>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2lut
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2lut
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all disulfide bound"
    _Assembly.Molecular_mass        13537.42

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Midkine_related_growth_factor A . 1 1 
    stop_

save_


save_Midkine_related_growth_factor
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Midkine related growth factor"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQTVSVTKPCTTKVKNKPKGKKGKGKGN
    _Entity.Number_of_monomers           125

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 GLY . 1 1 
         2 SER . 1 1 
         3 LYS . 1 1 
         4 ASN . 1 1 
         5 LYS . 1 1 
         6 LYS . 1 1 
         7 GLU . 1 1 
         8 LYS . 1 1 
         9 ASN . 1 1 
        10 LYS . 1 1 
        11 GLY . 1 1 
        12 GLY . 1 1 
        13 LYS . 1 1 
        14 GLY . 1 1 
        15 GLY . 1 1 
        16 ALA . 1 1 
        17 ASP . 1 1 
        18 CYS . 1 1 
        19 ALA . 1 1 
        20 GLU . 1 1 
        21 TRP . 1 1 
        22 LEU . 1 1 
        23 TYR . 1 1 
        24 GLY . 1 1 
        25 SER . 1 1 
        26 CYS . 1 1 
        27 VAL . 1 1 
        28 ALA . 1 1 
        29 ASN . 1 1 
        30 ASN . 1 1 
        31 GLY . 1 1 
        32 ASP . 1 1 
        33 CYS . 1 1 
        34 GLY . 1 1 
        35 GLN . 1 1 
        36 GLY . 1 1 
        37 MET . 1 1 
        38 ARG . 1 1 
        39 GLU . 1 1 
        40 GLY . 1 1 
        41 THR . 1 1 
        42 CYS . 1 1 
        43 ASN . 1 1 
        44 GLU . 1 1 
        45 GLN . 1 1 
        46 THR . 1 1 
        47 ARG . 1 1 
        48 LYS . 1 1 
        49 VAL . 1 1 
        50 LYS . 1 1 
        51 CYS . 1 1 
        52 ARG . 1 1 
        53 VAL . 1 1 
        54 PRO . 1 1 
        55 CYS . 1 1 
        56 ASN . 1 1 
        57 TRP . 1 1 
        58 LYS . 1 1 
        59 LYS . 1 1 
        60 GLU . 1 1 
        61 PHE . 1 1 
        62 GLY . 1 1 
        63 ALA . 1 1 
        64 ASP . 1 1 
        65 CYS . 1 1 
        66 LYS . 1 1 
        67 TYR . 1 1 
        68 LYS . 1 1 
        69 PHE . 1 1 
        70 GLY . 1 1 
        71 ASN . 1 1 
        72 TRP . 1 1 
        73 GLY . 1 1 
        74 GLU . 1 1 
        75 CYS . 1 1 
        76 ASP . 1 1 
        77 ALA . 1 1 
        78 ALA . 1 1 
        79 THR . 1 1 
        80 SER . 1 1 
        81 THR . 1 1 
        82 LYS . 1 1 
        83 SER . 1 1 
        84 ARG . 1 1 
        85 THR . 1 1 
        86 GLY . 1 1 
        87 THR . 1 1 
        88 LEU . 1 1 
        89 GLN . 1 1 
        90 LYS . 1 1 
        91 ALA . 1 1 
        92 LEU . 1 1 
        93 PHE . 1 1 
        94 ASN . 1 1 
        95 VAL . 1 1 
        96 GLU . 1 1 
        97 CYS . 1 1 
        98 GLN . 1 1 
        99 GLN . 1 1 
       100 THR . 1 1 
       101 VAL . 1 1 
       102 SER . 1 1 
       103 VAL . 1 1 
       104 THR . 1 1 
       105 LYS . 1 1 
       106 PRO . 1 1 
       107 CYS . 1 1 
       108 THR . 1 1 
       109 THR . 1 1 
       110 LYS . 1 1 
       111 VAL . 1 1 
       112 LYS . 1 1 
       113 ASN . 1 1 
       114 LYS . 1 1 
       115 PRO . 1 1 
       116 LYS . 1 1 
       117 GLY . 1 1 
       118 LYS . 1 1 
       119 LYS . 1 1 
       120 GLY . 1 1 
       121 LYS . 1 1 
       122 GLY . 1 1 
       123 LYS . 1 1 
       124 GLY . 1 1 
       125 ASN . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY   1   1 1 1 
       SER   2   2 1 1 
       LYS   3   3 1 1 
       ASN   4   4 1 1 
       LYS   5   5 1 1 
       LYS   6   6 1 1 
       GLU   7   7 1 1 
       LYS   8   8 1 1 
       ASN   9   9 1 1 
       LYS  10  10 1 1 
       GLY  11  11 1 1 
       GLY  12  12 1 1 
       LYS  13  13 1 1 
       GLY  14  14 1 1 
       GLY  15  15 1 1 
       ALA  16  16 1 1 
       ASP  17  17 1 1 
       CYS  18  18 1 1 
       ALA  19  19 1 1 
       GLU  20  20 1 1 
       TRP  21  21 1 1 
       LEU  22  22 1 1 
       TYR  23  23 1 1 
       GLY  24  24 1 1 
       SER  25  25 1 1 
       CYS  26  26 1 1 
       VAL  27  27 1 1 
       ALA  28  28 1 1 
       ASN  29  29 1 1 
       ASN  30  30 1 1 
       GLY  31  31 1 1 
       ASP  32  32 1 1 
       CYS  33  33 1 1 
       GLY  34  34 1 1 
       GLN  35  35 1 1 
       GLY  36  36 1 1 
       MET  37  37 1 1 
       ARG  38  38 1 1 
       GLU  39  39 1 1 
       GLY  40  40 1 1 
       THR  41  41 1 1 
       CYS  42  42 1 1 
       ASN  43  43 1 1 
       GLU  44  44 1 1 
       GLN  45  45 1 1 
       THR  46  46 1 1 
       ARG  47  47 1 1 
       LYS  48  48 1 1 
       VAL  49  49 1 1 
       LYS  50  50 1 1 
       CYS  51  51 1 1 
       ARG  52  52 1 1 
       VAL  53  53 1 1 
       PRO  54  54 1 1 
       CYS  55  55 1 1 
       ASN  56  56 1 1 
       TRP  57  57 1 1 
       LYS  58  58 1 1 
       LYS  59  59 1 1 
       GLU  60  60 1 1 
       PHE  61  61 1 1 
       GLY  62  62 1 1 
       ALA  63  63 1 1 
       ASP  64  64 1 1 
       CYS  65  65 1 1 
       LYS  66  66 1 1 
       TYR  67  67 1 1 
       LYS  68  68 1 1 
       PHE  69  69 1 1 
       GLY  70  70 1 1 
       ASN  71  71 1 1 
       TRP  72  72 1 1 
       GLY  73  73 1 1 
       GLU  74  74 1 1 
       CYS  75  75 1 1 
       ASP  76  76 1 1 
       ALA  77  77 1 1 
       ALA  78  78 1 1 
       THR  79  79 1 1 
       SER  80  80 1 1 
       THR  81  81 1 1 
       LYS  82  82 1 1 
       SER  83  83 1 1 
       ARG  84  84 1 1 
       THR  85  85 1 1 
       GLY  86  86 1 1 
       THR  87  87 1 1 
       LEU  88  88 1 1 
       GLN  89  89 1 1 
       LYS  90  90 1 1 
       ALA  91  91 1 1 
       LEU  92  92 1 1 
       PHE  93  93 1 1 
       ASN  94  94 1 1 
       VAL  95  95 1 1 
       GLU  96  96 1 1 
       CYS  97  97 1 1 
       GLN  98  98 1 1 
       GLN  99  99 1 1 
       THR 100 100 1 1 
       VAL 101 101 1 1 
       SER 102 102 1 1 
       VAL 103 103 1 1 
       THR 104 104 1 1 
       LYS 105 105 1 1 
       PRO 106 106 1 1 
       CYS 107 107 1 1 
       THR 108 108 1 1 
       THR 109 109 1 1 
       LYS 110 110 1 1 
       VAL 111 111 1 1 
       LYS 112 112 1 1 
       ASN 113 113 1 1 
       LYS 114 114 1 1 
       PRO 115 115 1 1 
       LYS 116 116 1 1 
       GLY 117 117 1 1 
       LYS 118 118 1 1 
       LYS 119 119 1 1 
       GLY 120 120 1 1 
       LYS 121 121 1 1 
       GLY 122 122 1 1 
       LYS 123 123 1 1 
       GLY 124 124 1 1 
       ASN 125 125 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
       491 1 . . . 1 1 
       492 1 . . . 1 1 
       493 1 . . . 1 1 
       494 1 . . . 1 1 
       495 1 . . . 1 1 
       496 1 . . . 1 1 
       497 1 . . . 1 1 
       498 1 . . . 1 1 
       499 1 . . . 1 1 
       500 1 . . . 1 1 
       501 1 . . . 1 1 
       502 1 . . . 1 1 
       503 1 . . . 1 1 
       504 1 . . . 1 1 
       505 1 . . . 1 1 
       506 1 . . . 1 1 
       507 1 . . . 1 1 
       508 1 . . . 1 1 
       509 1 . . . 1 1 
       510 1 . . . 1 1 
       511 1 . . . 1 1 
       512 1 . . . 1 1 
       513 1 . . . 1 1 
       514 1 . . . 1 1 
       515 1 . . . 1 1 
       516 1 . . . 1 1 
       517 1 . . . 1 1 
       518 1 . . . 1 1 
       519 1 . . . 1 1 
       520 1 . . . 1 1 
       521 1 . . . 1 1 
       522 1 . . . 1 1 
       523 1 . . . 1 1 
       524 1 . . . 1 1 
       525 1 . . . 1 1 
       526 1 . . . 1 1 
       527 1 . . . 1 1 
       528 1 . . . 1 1 
       529 1 . . . 1 1 
       530 1 . . . 1 1 
       531 1 . . . 1 1 
       532 1 . . . 1 1 
       533 1 . . . 1 1 
       534 1 . . . 1 1 
       535 1 . . . 1 1 
       536 1 . . . 1 1 
       537 1 . . . 1 1 
       538 1 . . . 1 1 
       539 1 . . . 1 1 
       540 1 . . . 1 1 
       541 1 . . . 1 1 
       542 1 . . . 1 1 
       543 1 . . . 1 1 
       544 1 . . . 1 1 
       545 1 . . . 1 1 
       546 1 . . . 1 1 
       547 1 . . . 1 1 
       548 1 . . . 1 1 
       549 1 . . . 1 1 
       550 1 . . . 1 1 
       551 1 . . . 1 1 
       552 1 . . . 1 1 
       553 1 . . . 1 1 
       554 1 . . . 1 1 
       555 1 . . . 1 1 
       556 1 . . . 1 1 
       557 1 . . . 1 1 
       558 1 . . . 1 1 
       559 1 . . . 1 1 
       560 1 . . . 1 1 
       561 1 . . . 1 1 
       562 1 . . . 1 1 
       563 1 . . . 1 1 
       564 1 . . . 1 1 
       565 1 . . . 1 1 
       566 1 . . . 1 1 
       567 1 . . . 1 1 
       568 1 . . . 1 1 
       569 1 . . . 1 1 
       570 1 . . . 1 1 
       571 1 . . . 1 1 
       572 1 . . . 1 1 
       573 1 . . . 1 1 
       574 1 . . . 1 1 
       575 1 . . . 1 1 
       576 1 . . . 1 1 
       577 1 . . . 1 1 
       578 1 . . . 1 1 
       579 1 . . . 1 1 
       580 1 . . . 1 1 
       581 1 . . . 1 1 
       582 1 . . . 1 1 
       583 1 . . . 1 1 
       584 1 . . . 1 1 
       585 1 . . . 1 1 
       586 1 . . . 1 1 
       587 1 . . . 1 1 
       588 1 . . . 1 1 
       589 1 . . . 1 1 
       590 1 . . . 1 1 
       591 1 . . . 1 1 
       592 1 . . . 1 1 
       593 1 . . . 1 1 
       594 1 . . . 1 1 
       595 1 . . . 1 1 
       596 1 . . . 1 1 
       597 1 . . . 1 1 
       598 1 . . . 1 1 
       599 1 . . . 1 1 
       600 1 . . . 1 1 
       601 1 . . . 1 1 
       602 1 . . . 1 1 
       603 1 . . . 1 1 
       604 1 . . . 1 1 
       605 1 . . . 1 1 
       606 1 . . . 1 1 
       607 1 . . . 1 1 
       608 1 . . . 1 1 
       609 1 . . . 1 1 
       610 1 . . . 1 1 
       611 1 . . . 1 1 
       612 1 . . . 1 1 
       613 1 . . . 1 1 
       614 1 . . . 1 1 
       615 1 . . . 1 1 
       616 1 . . . 1 1 
       617 1 . . . 1 1 
       618 1 . . . 1 1 
       619 1 . . . 1 1 
       620 1 . . . 1 1 
       621 1 . . . 1 1 
       622 1 . . . 1 1 
       623 1 . . . 1 1 
       624 1 . . . 1 1 
       625 1 . . . 1 1 
       626 1 . . . 1 1 
       627 1 . . . 1 1 
       628 1 . . . 1 1 
       629 1 . . . 1 1 
       630 1 . . . 1 1 
       631 1 . . . 1 1 
       632 1 . . . 1 1 
       633 1 . . . 1 1 
       634 1 . . . 1 1 
       635 1 . . . 1 1 
       636 1 . . . 1 1 
       637 1 . . . 1 1 
       638 1 . . . 1 1 
       639 1 . . . 1 1 
       640 1 . . . 1 1 
       641 1 . . . 1 1 
       642 1 . . . 1 1 
       643 1 . . . 1 1 
       644 1 . . . 1 1 
       645 1 . . . 1 1 
       646 1 . . . 1 1 
       647 1 . . . 1 1 
       648 1 . . . 1 1 
       649 1 . . . 1 1 
       650 1 . . . 1 1 
       651 1 . . . 1 1 
       652 1 . . . 1 1 
       653 1 . . . 1 1 
       654 1 . . . 1 1 
       655 1 . . . 1 1 
       656 1 . . . 1 1 
       657 1 . . . 1 1 
       658 1 . . . 1 1 
       659 1 . . . 1 1 
       660 1 . . . 1 1 
       661 1 . . . 1 1 
       662 1 . . . 1 1 
       663 1 . . . 1 1 
       664 1 . . . 1 1 
       665 1 . . . 1 1 
       666 1 . . . 1 1 
       667 1 . . . 1 1 
       668 1 . . . 1 1 
       669 1 . . . 1 1 
       670 1 . . . 1 1 
       671 1 . . . 1 1 
       672 1 . . . 1 1 
       673 1 . . . 1 1 
       674 1 . . . 1 1 
       675 1 . . . 1 1 
       676 1 . . . 1 1 
       677 1 . . . 1 1 
       678 1 . . . 1 1 
       679 1 . . . 1 1 
       680 1 . . . 1 1 
       681 1 . . . 1 1 
       682 1 . . . 1 1 
       683 1 . . . 1 1 
       684 1 . . . 1 1 
       685 1 . . . 1 1 
       686 1 . . . 1 1 
       687 1 . . . 1 1 
       688 1 . . . 1 1 
       689 1 . . . 1 1 
       690 1 . . . 1 1 
       691 1 . . . 1 1 
       692 1 . . . 1 1 
       693 1 . . . 1 1 
       694 1 . . . 1 1 
       695 1 . . . 1 1 
       696 1 . . . 1 1 
       697 1 . . . 1 1 
       698 1 . . . 1 1 
       699 1 . . . 1 1 
       700 1 . . . 1 1 
       701 1 . . . 1 1 
       702 1 . . . 1 1 
       703 1 . . . 1 1 
       704 1 . . . 1 1 
       705 1 . . . 1 1 
       706 1 . . . 1 1 
       707 1 . . . 1 1 
       708 1 . . . 1 1 
       709 1 . . . 1 1 
       710 1 . . . 1 1 
       711 1 . . . 1 1 
       712 1 . . . 1 1 
       713 1 . . . 1 1 
       714 1 . . . 1 1 
       715 1 . . . 1 1 
       716 1 . . . 1 1 
       717 1 . . . 1 1 
       718 1 . . . 1 1 
       719 1 . . . 1 1 
       720 1 . . . 1 1 
       721 1 . . . 1 1 
       722 1 . . . 1 1 
       723 1 . . . 1 1 
       724 1 . . . 1 1 
       725 1 . . . 1 1 
       726 1 . . . 1 1 
       727 1 . . . 1 1 
       728 1 . . . 1 1 
       729 1 . . . 1 1 
       730 1 . . . 1 1 
       731 1 . . . 1 1 
       732 1 . . . 1 1 
       733 1 . . . 1 1 
       734 1 . . . 1 1 
       735 1 . . . 1 1 
       736 1 . . . 1 1 
       737 1 . . . 1 1 
       738 1 . . . 1 1 
       739 1 . . . 1 1 
       740 1 . . . 1 1 
       741 1 . . . 1 1 
       742 1 . . . 1 1 
       743 1 . . . 1 1 
       744 1 . . . 1 1 
       745 1 . . . 1 1 
       746 1 . . . 1 1 
       747 1 . . . 1 1 
       748 1 . . . 1 1 
       749 1 . . . 1 1 
       750 1 . . . 1 1 
       751 1 . . . 1 1 
       752 1 . . . 1 1 
       753 1 . . . 1 1 
       754 1 . . . 1 1 
       755 1 . . . 1 1 
       756 1 . . . 1 1 
       757 1 . . . 1 1 
       758 1 . . . 1 1 
       759 1 . . . 1 1 
       760 1 . . . 1 1 
       761 1 . . . 1 1 
       762 1 . . . 1 1 
       763 1 . . . 1 1 
       764 1 . . . 1 1 
       765 1 . . . 1 1 
       766 1 . . . 1 1 
       767 1 . . . 1 1 
       768 1 . . . 1 1 
       769 1 . . . 1 1 
       770 1 . . . 1 1 
       771 1 . . . 1 1 
       772 1 . . . 1 1 
       773 1 . . . 1 1 
       774 1 . . . 1 1 
       775 1 . . . 1 1 
       776 1 . . . 1 1 
       777 1 . . . 1 1 
       778 1 . . . 1 1 
       779 1 . . . 1 1 
       780 1 . . . 1 1 
       781 1 . . . 1 1 
       782 1 . . . 1 1 
       783 1 . . . 1 1 
       784 1 . . . 1 1 
       785 1 . . . 1 1 
       786 1 . . . 1 1 
       787 1 . . . 1 1 
       788 1 . . . 1 1 
       789 1 . . . 1 1 
       790 1 . . . 1 1 
       791 1 . . . 1 1 
       792 1 . . . 1 1 
       793 1 . . . 1 1 
       794 1 . . . 1 1 
       795 1 . . . 1 1 
       796 1 . . . 1 1 
       797 1 . . . 1 1 
       798 1 . . . 1 1 
       799 1 . . . 1 1 
       800 1 . . . 1 1 
       801 1 . . . 1 1 
       802 1 . . . 1 1 
       803 1 . . . 1 1 
       804 1 . . . 1 1 
       805 1 . . . 1 1 
       806 1 . . . 1 1 
       807 1 . . . 1 1 
       808 1 . . . 1 1 
       809 1 . . . 1 1 
       810 1 . . . 1 1 
       811 1 . . . 1 1 
       812 1 . . . 1 1 
       813 1 . . . 1 1 
       814 1 . . . 1 1 
       815 1 . . . 1 1 
       816 1 . . . 1 1 
       817 1 . . . 1 1 
       818 1 . . . 1 1 
       819 1 . . . 1 1 
       820 1 . . . 1 1 
       821 1 . . . 1 1 
       822 1 . . . 1 1 
       823 1 . . . 1 1 
       824 1 . . . 1 1 
       825 1 . . . 1 1 
       826 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1   5 LYS QB  .   5 LYS  HB3  1 1 
         1 1 2 1 1   5 LYS QG  .   5 LYS  HG3  1 1 
         2 1 1 1 1  15 GLY QA  .  15 GLY  HA3  1 1 
         2 1 2 1 1  16 ALA H   .  16 ALA  H    1 1 
         3 1 1 1 1  15 GLY QA  .  15 GLY  HA3  1 1 
         3 1 2 1 1  16 ALA MB  .  16 ALA  QB   1 1 
         4 1 1 1 1  16 ALA H   .  16 ALA  H    1 1 
         4 1 2 1 1  16 ALA MB  .  16 ALA  QB   1 1 
         5 1 1 1 1  16 ALA HA  .  16 ALA  HA   1 1 
         5 1 2 1 1  17 ASP H   .  17 ASP  H    1 1 
         6 1 1 1 1  16 ALA MB  .  16 ALA  QB   1 1 
         6 1 2 1 1  17 ASP H   .  17 ASP  H    1 1 
         7 1 1 1 1  16 ALA MB  .  16 ALA  QB   1 1 
         7 1 2 1 1  17 ASP QB  .  17 ASP  HB3  1 1 
         8 1 1 1 1  17 ASP HA  .  17 ASP  HA   1 1 
         8 1 2 1 1  18 CYS H   .  18 CYSS H    1 1 
         9 1 1 1 1  17 ASP QB  .  17 ASP  HB3  1 1 
         9 1 2 1 1  18 CYS H   .  18 CYSS H    1 1 
        10 1 1 1 1  18 CYS HA  .  18 CYSS HA   1 1 
        10 1 2 1 1  19 ALA H   .  19 ALA  H    1 1 
        11 1 1 1 1  18 CYS HA  .  18 CYSS HA   1 1 
        11 1 2 1 1  19 ALA MB  .  19 ALA  QB   1 1 
        12 1 1 1 1  18 CYS HA  .  18 CYSS HA   1 1 
        12 1 2 1 1  21 TRP HH2 .  21 TRP  HH2  1 1 
        13 1 1 1 1  18 CYS QB  .  18 CYSS HB3  1 1 
        13 1 2 1 1  19 ALA H   .  19 ALA  H    1 1 
        14 1 1 1 1  18 CYS QB  .  18 CYSS HB2  1 1 
        14 1 2 1 1  21 TRP HD1 .  21 TRP  HD1  1 1 
        15 1 1 1 1  18 CYS QB  .  18 CYSS HB3  1 1 
        15 1 2 1 1  21 TRP HZ2 .  21 TRP  HZ2  1 1 
        16 1 1 1 1  19 ALA H   .  19 ALA  H    1 1 
        16 1 2 1 1  19 ALA MB  .  19 ALA  QB   1 1 
        17 1 1 1 1  19 ALA H   .  19 ALA  H    1 1 
        17 1 2 1 1  20 GLU H   .  20 GLU  H    1 1 
        18 1 1 1 1  19 ALA HA  .  19 ALA  HA   1 1 
        18 1 2 1 1  21 TRP HD1 .  21 TRP  HD1  1 1 
        19 1 1 1 1  19 ALA MB  .  19 ALA  QB   1 1 
        19 1 2 1 1  20 GLU H   .  20 GLU  H    1 1 
        20 1 1 1 1  19 ALA MB  .  19 ALA  QB   1 1 
        20 1 2 1 1  20 GLU QB  .  20 GLU  HB3  1 1 
        21 1 1 1 1  19 ALA MB  .  19 ALA  QB   1 1 
        21 1 2 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        22 1 1 1 1  20 GLU H   .  20 GLU  H    1 1 
        22 1 2 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        23 1 1 1 1  20 GLU H   .  20 GLU  H    1 1 
        23 1 2 1 1  21 TRP H   .  21 TRP  H    1 1 
        24 1 1 1 1  20 GLU HA  .  20 GLU  HA   1 1 
        24 1 2 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        25 1 1 1 1  20 GLU HA  .  20 GLU  HA   1 1 
        25 1 2 1 1  21 TRP H   .  21 TRP  H    1 1 
        26 1 1 1 1  20 GLU HA  .  20 GLU  HA   1 1 
        26 1 2 1 1  21 TRP HD1 .  21 TRP  HD1  1 1 
        27 1 1 1 1  20 GLU QB  .  20 GLU  HB3  1 1 
        27 1 2 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        28 1 1 1 1  20 GLU QB  .  20 GLU  HB3  1 1 
        28 1 2 1 1  21 TRP H   .  21 TRP  H    1 1 
        29 1 1 1 1  20 GLU QB  .  20 GLU  HB2  1 1 
        29 1 2 1 1  22 LEU QD  .  22 LEU  QD2  1 1 
        30 1 1 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        30 1 2 1 1  21 TRP H   .  21 TRP  H    1 1 
        31 1 1 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        31 1 2 1 1  21 TRP HA  .  21 TRP  HA   1 1 
        32 1 1 1 1  20 GLU QG  .  20 GLU  HG3  1 1 
        32 1 2 1 1  22 LEU QD  .  22 LEU  QD2  1 1 
        33 1 1 1 1  21 TRP H   .  21 TRP  H    1 1 
        33 1 2 1 1  21 TRP HD1 .  21 TRP  HD1  1 1 
        34 1 1 1 1  21 TRP HA  .  21 TRP  HA   1 1 
        34 1 2 1 1  21 TRP HD1 .  21 TRP  HD1  1 1 
        35 1 1 1 1  21 TRP HA  .  21 TRP  HA   1 1 
        35 1 2 1 1  22 LEU H   .  22 LEU  H    1 1 
        36 1 1 1 1  21 TRP HA  .  21 TRP  HA   1 1 
        36 1 2 1 1  22 LEU QB  .  22 LEU  HB3  1 1 
        37 1 1 1 1  21 TRP HA  .  21 TRP  HA   1 1 
        37 1 2 1 1  22 LEU QD  .  22 LEU  QD2  1 1 
        38 1 1 1 1  21 TRP QB  .  21 TRP  HB3  1 1 
        38 1 2 1 1  22 LEU H   .  22 LEU  H    1 1 
        39 1 1 1 1  21 TRP QB  .  21 TRP  HB3  1 1 
        39 1 2 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        40 1 1 1 1  21 TRP HE3 .  21 TRP  HE3  1 1 
        40 1 2 1 1  41 THR H   .  41 THR  H    1 1 
        41 1 1 1 1  21 TRP HE3 .  21 TRP  HE3  1 1 
        41 1 2 1 1  42 CYS H   .  42 CYSS H    1 1 
        42 1 1 1 1  21 TRP HE3 .  21 TRP  HE3  1 1 
        42 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
        43 1 1 1 1  21 TRP HH2 .  21 TRP  HH2  1 1 
        43 1 2 1 1  45 GLN HA  .  45 GLN  HA   1 1 
        44 1 1 1 1  21 TRP HH2 .  21 TRP  HH2  1 1 
        44 1 2 1 1  45 GLN QB  .  45 GLN  HB3  1 1 
        45 1 1 1 1  21 TRP HH2 .  21 TRP  HH2  1 1 
        45 1 2 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
        46 1 1 1 1  21 TRP HH2 .  21 TRP  HH2  1 1 
        46 1 2 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
        47 1 1 1 1  21 TRP HH2 .  21 TRP  HH2  1 1 
        47 1 2 1 1  47 ARG QG  .  47 ARG  HG2  1 1 
        48 1 1 1 1  21 TRP HZ2 .  21 TRP  HZ2  1 1 
        48 1 2 1 1  45 GLN QB  .  45 GLN  HB2  1 1 
        49 1 1 1 1  21 TRP HZ2 .  21 TRP  HZ2  1 1 
        49 1 2 1 1  47 ARG QD  .  47 ARG  HD3  1 1 
        50 1 1 1 1  21 TRP HZ3 .  21 TRP  HZ3  1 1 
        50 1 2 1 1  42 CYS H   .  42 CYSS H    1 1 
        51 1 1 1 1  21 TRP HZ3 .  21 TRP  HZ3  1 1 
        51 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
        52 1 1 1 1  21 TRP HZ3 .  21 TRP  HZ3  1 1 
        52 1 2 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
        53 1 1 1 1  22 LEU H   .  22 LEU  H    1 1 
        53 1 2 1 1  22 LEU QB  .  22 LEU  HB3  1 1 
        54 1 1 1 1  22 LEU H   .  22 LEU  H    1 1 
        54 1 2 1 1  22 LEU QD  .  22 LEU  QD1  1 1 
        55 1 1 1 1  22 LEU H   .  22 LEU  H    1 1 
        55 1 2 1 1  22 LEU HG  .  22 LEU  HG   1 1 
        56 1 1 1 1  22 LEU H   .  22 LEU  H    1 1 
        56 1 2 1 1  23 TYR H   .  23 TYR  H    1 1 
        57 1 1 1 1  22 LEU H   .  22 LEU  H    1 1 
        57 1 2 1 1  41 THR H   .  41 THR  H    1 1 
        58 1 1 1 1  22 LEU H   .  22 LEU  H    1 1 
        58 1 2 1 1  42 CYS HA  .  42 CYSS HA   1 1 
        59 1 1 1 1  22 LEU HA  .  22 LEU  HA   1 1 
        59 1 2 1 1  22 LEU QD  .  22 LEU  QD1  1 1 
        60 1 1 1 1  22 LEU HA  .  22 LEU  HA   1 1 
        60 1 2 1 1  23 TYR H   .  23 TYR  H    1 1 
        61 1 1 1 1  22 LEU QB  .  22 LEU  HB3  1 1 
        61 1 2 1 1  22 LEU QD  .  22 LEU  QD1  1 1 
        62 1 1 1 1  22 LEU QB  .  22 LEU  HB3  1 1 
        62 1 2 1 1  23 TYR H   .  23 TYR  H    1 1 
        63 1 1 1 1  22 LEU QB  .  22 LEU  HB2  1 1 
        63 1 2 1 1  41 THR MG  .  41 THR  QG2  1 1 
        64 1 1 1 1  22 LEU MD1 .  22 LEU  QD1  1 1 
        64 1 2 1 1  22 LEU MD2 .  22 LEU  QD2  1 1 
        65 1 1 1 1  22 LEU QD  .  22 LEU  QD1  1 1 
        65 1 2 1 1  22 LEU HG  .  22 LEU  HG   1 1 
        66 1 1 1 1  22 LEU QD  .  22 LEU  QD1  1 1 
        66 1 2 1 1  23 TYR H   .  23 TYR  H    1 1 
        67 1 1 1 1  22 LEU QD  .  22 LEU  QD2  1 1 
        67 1 2 1 1  43 ASN HA  .  43 ASN  HA   1 1 
        68 1 1 1 1  23 TYR H   .  23 TYR  H    1 1 
        68 1 2 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        69 1 1 1 1  23 TYR HA  .  23 TYR  HA   1 1 
        69 1 2 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        70 1 1 1 1  23 TYR HA  .  23 TYR  HA   1 1 
        70 1 2 1 1  24 GLY H   .  24 GLY  H    1 1 
        71 1 1 1 1  23 TYR HA  .  23 TYR  HA   1 1 
        71 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
        72 1 1 1 1  23 TYR HA  .  23 TYR  HA   1 1 
        72 1 2 1 1  40 GLY QA  .  40 GLY  HA3  1 1 
        73 1 1 1 1  23 TYR HA  .  23 TYR  HA   1 1 
        73 1 2 1 1  41 THR H   .  41 THR  H    1 1 
        74 1 1 1 1  23 TYR QB  .  23 TYR  HB2  1 1 
        74 1 2 1 1  24 GLY H   .  24 GLY  H    1 1 
        75 1 1 1 1  23 TYR QB  .  23 TYR  HB2  1 1 
        75 1 2 1 1  38 ARG QB  .  38 ARG  HB3  1 1 
        76 1 1 1 1  23 TYR QB  .  23 TYR  HB2  1 1 
        76 1 2 1 1  41 THR H   .  41 THR  H    1 1 
        77 1 1 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        77 1 2 1 1  24 GLY H   .  24 GLY  H    1 1 
        78 1 1 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        78 1 2 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
        79 1 1 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        79 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
        80 1 1 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        80 1 2 1 1  40 GLY QA  .  40 GLY  HA3  1 1 
        81 1 1 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        81 1 2 1 1  41 THR H   .  41 THR  H    1 1 
        82 1 1 1 1  23 TYR QD  .  23 TYR  HD1  1 1 
        82 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
        83 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        83 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
        84 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        84 1 2 1 1  40 GLY QA  .  40 GLY  HA3  1 1 
        85 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        85 1 2 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
        86 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        86 1 2 1 1  47 ARG QD  .  47 ARG  HD3  1 1 
        87 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        87 1 2 1 1  47 ARG QG  .  47 ARG  HG2  1 1 
        88 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        88 1 2 1 1  49 VAL HB  .  49 VAL  HB   1 1 
        89 1 1 1 1  23 TYR QE  .  23 TYR  HE1  1 1 
        89 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
        90 1 1 1 1  24 GLY H   .  24 GLY  H    1 1 
        90 1 2 1 1  25 SER H   .  25 SER  H    1 1 
        91 1 1 1 1  24 GLY H   .  24 GLY  H    1 1 
        91 1 2 1 1  40 GLY QA  .  40 GLY  HA3  1 1 
        92 1 1 1 1  24 GLY H   .  24 GLY  H    1 1 
        92 1 2 1 1  41 THR H   .  41 THR  H    1 1 
        93 1 1 1 1  24 GLY QA  .  24 GLY  HA3  1 1 
        93 1 2 1 1  25 SER H   .  25 SER  H    1 1 
        94 1 1 1 1  24 GLY QA  .  24 GLY  HA3  1 1 
        94 1 2 1 1  25 SER QB  .  25 SER  HB3  1 1 
        95 1 1 1 1  24 GLY QA  .  24 GLY  HA3  1 1 
        95 1 2 1 1  38 ARG QD  .  38 ARG  HD3  1 1 
        96 1 1 1 1  25 SER HA  .  25 SER  HA   1 1 
        96 1 2 1 1  26 CYS H   .  26 CYSS H    1 1 
        97 1 1 1 1  25 SER HA  .  25 SER  HA   1 1 
        97 1 2 1 1  27 VAL QG  .  27 VAL  QG2  1 1 
        98 1 1 1 1  25 SER QB  .  25 SER  HB3  1 1 
        98 1 2 1 1  26 CYS H   .  26 CYSS H    1 1 
        99 1 1 1 1  26 CYS HA  .  26 CYSS HA   1 1 
        99 1 2 1 1  27 VAL H   .  27 VAL  H    1 1 
       100 1 1 1 1  26 CYS HA  .  26 CYSS HA   1 1 
       100 1 2 1 1  27 VAL QG  .  27 VAL  QG2  1 1 
       101 1 1 1 1  26 CYS HA  .  26 CYSS HA   1 1 
       101 1 2 1 1  38 ARG QB  .  38 ARG  HB3  1 1 
       102 1 1 1 1  26 CYS HA  .  26 CYSS HA   1 1 
       102 1 2 1 1  39 GLU H   .  39 GLU  H    1 1 
       103 1 1 1 1  26 CYS QB  .  26 CYSS HB2  1 1 
       103 1 2 1 1  27 VAL H   .  27 VAL  H    1 1 
       104 1 1 1 1  26 CYS QB  .  26 CYSS HB2  1 1 
       104 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       105 1 1 1 1  26 CYS QB  .  26 CYSS HB2  1 1 
       105 1 2 1 1  57 TRP HE1 .  57 TRP  HE1  1 1 
       106 1 1 1 1  26 CYS QB  .  26 CYSS HB2  1 1 
       106 1 2 1 1  57 TRP HZ2 .  57 TRP  HZ2  1 1 
       107 1 1 1 1  27 VAL H   .  27 VAL  H    1 1 
       107 1 2 1 1  27 VAL QG  .  27 VAL  QG2  1 1 
       108 1 1 1 1  27 VAL H   .  27 VAL  H    1 1 
       108 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       109 1 1 1 1  27 VAL H   .  27 VAL  H    1 1 
       109 1 2 1 1  38 ARG HA  .  38 ARG  HA   1 1 
       110 1 1 1 1  27 VAL H   .  27 VAL  H    1 1 
       110 1 2 1 1  38 ARG QB  .  38 ARG  HB3  1 1 
       111 1 1 1 1  27 VAL H   .  27 VAL  H    1 1 
       111 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       112 1 1 1 1  27 VAL HA  .  27 VAL  HA   1 1 
       112 1 2 1 1  27 VAL QG  .  27 VAL  QG2  1 1 
       113 1 1 1 1  27 VAL HA  .  27 VAL  HA   1 1 
       113 1 2 1 1  28 ALA H   .  28 ALA  H    1 1 
       114 1 1 1 1  27 VAL HA  .  27 VAL  HA   1 1 
       114 1 2 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       115 1 1 1 1  27 VAL HA  .  27 VAL  HA   1 1 
       115 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       116 1 1 1 1  27 VAL HA  .  27 VAL  HA   1 1 
       116 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       117 1 1 1 1  27 VAL HB  .  27 VAL  HB   1 1 
       117 1 2 1 1  27 VAL QG  .  27 VAL  QG2  1 1 
       118 1 1 1 1  27 VAL HB  .  27 VAL  HB   1 1 
       118 1 2 1 1  28 ALA H   .  28 ALA  H    1 1 
       119 1 1 1 1  27 VAL HB  .  27 VAL  HB   1 1 
       119 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       120 1 1 1 1  27 VAL QG  .  27 VAL  QG1  1 1 
       120 1 2 1 1  28 ALA H   .  28 ALA  H    1 1 
       121 1 1 1 1  27 VAL QG  .  27 VAL  QG2  1 1 
       121 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       122 1 1 1 1  28 ALA H   .  28 ALA  H    1 1 
       122 1 2 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       123 1 1 1 1  28 ALA H   .  28 ALA  H    1 1 
       123 1 2 1 1  29 ASN H   .  29 ASN  H    1 1 
       124 1 1 1 1  28 ALA H   .  28 ALA  H    1 1 
       124 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       125 1 1 1 1  28 ALA HA  .  28 ALA  HA   1 1 
       125 1 2 1 1  29 ASN H   .  29 ASN  H    1 1 
       126 1 1 1 1  28 ALA HA  .  28 ALA  HA   1 1 
       126 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       127 1 1 1 1  28 ALA HA  .  28 ALA  HA   1 1 
       127 1 2 1 1  36 GLY QA  .  36 GLY  HA3  1 1 
       128 1 1 1 1  28 ALA HA  .  28 ALA  HA   1 1 
       128 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       129 1 1 1 1  28 ALA HA  .  28 ALA  HA   1 1 
       129 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       130 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       130 1 2 1 1  29 ASN H   .  29 ASN  H    1 1 
       131 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       131 1 2 1 1  30 ASN H   .  30 ASN  H    1 1 
       132 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       132 1 2 1 1  31 GLY H   .  31 GLY  H    1 1 
       133 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       133 1 2 1 1  32 ASP H   .  32 ASP  H    1 1 
       134 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       134 1 2 1 1  32 ASP HA  .  32 ASP  HA   1 1 
       135 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       135 1 2 1 1  32 ASP QB  .  32 ASP  HB2  1 1 
       136 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       136 1 2 1 1  33 CYS H   .  33 CYSS H    1 1 
       137 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       137 1 2 1 1  33 CYS HA  .  33 CYSS HA   1 1 
       138 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       138 1 2 1 1  34 GLY H   .  34 GLY  H    1 1 
       139 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       139 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       140 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       140 1 2 1 1  36 GLY QA  .  36 GLY  HA3  1 1 
       141 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       141 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       142 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       142 1 2 1 1  53 VAL HB  .  53 VAL  HB   1 1 
       143 1 1 1 1  28 ALA MB  .  28 ALA  QB   1 1 
       143 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       144 1 1 1 1  29 ASN H   .  29 ASN  H    1 1 
       144 1 2 1 1  30 ASN H   .  30 ASN  H    1 1 
       145 1 1 1 1  29 ASN H   .  29 ASN  H    1 1 
       145 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       146 1 1 1 1  29 ASN H   .  29 ASN  H    1 1 
       146 1 2 1 1  36 GLY QA  .  36 GLY  HA3  1 1 
       147 1 1 1 1  29 ASN H   .  29 ASN  H    1 1 
       147 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       148 1 1 1 1  29 ASN HA  .  29 ASN  HA   1 1 
       148 1 2 1 1  30 ASN H   .  30 ASN  H    1 1 
       149 1 1 1 1  29 ASN QB  .  29 ASN  HB3  1 1 
       149 1 2 1 1  30 ASN H   .  30 ASN  H    1 1 
       150 1 1 1 1  30 ASN H   .  30 ASN  H    1 1 
       150 1 2 1 1  31 GLY H   .  31 GLY  H    1 1 
       151 1 1 1 1  30 ASN H   .  30 ASN  H    1 1 
       151 1 2 1 1  32 ASP H   .  32 ASP  H    1 1 
       152 1 1 1 1  30 ASN HA  .  30 ASN  HA   1 1 
       152 1 2 1 1  31 GLY H   .  31 GLY  H    1 1 
       153 1 1 1 1  31 GLY H   .  31 GLY  H    1 1 
       153 1 2 1 1  32 ASP H   .  32 ASP  H    1 1 
       154 1 1 1 1  31 GLY H   .  31 GLY  H    1 1 
       154 1 2 1 1  33 CYS H   .  33 CYSS H    1 1 
       155 1 1 1 1  31 GLY QA  .  31 GLY  HA3  1 1 
       155 1 2 1 1  32 ASP H   .  32 ASP  H    1 1 
       156 1 1 1 1  32 ASP H   .  32 ASP  H    1 1 
       156 1 2 1 1  33 CYS H   .  33 CYSS H    1 1 
       157 1 1 1 1  32 ASP HA  .  32 ASP  HA   1 1 
       157 1 2 1 1  33 CYS H   .  33 CYSS H    1 1 
       158 1 1 1 1  32 ASP QB  .  32 ASP  HB3  1 1 
       158 1 2 1 1  33 CYS H   .  33 CYSS H    1 1 
       159 1 1 1 1  33 CYS H   .  33 CYSS H    1 1 
       159 1 2 1 1  34 GLY H   .  34 GLY  H    1 1 
       160 1 1 1 1  33 CYS H   .  33 CYSS H    1 1 
       160 1 2 1 1  53 VAL HB  .  53 VAL  HB   1 1 
       161 1 1 1 1  33 CYS H   .  33 CYSS H    1 1 
       161 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       162 1 1 1 1  33 CYS HA  .  33 CYSS HA   1 1 
       162 1 2 1 1  34 GLY H   .  34 GLY  H    1 1 
       163 1 1 1 1  33 CYS HA  .  33 CYSS HA   1 1 
       163 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       164 1 1 1 1  33 CYS HA  .  33 CYSS HA   1 1 
       164 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       165 1 1 1 1  33 CYS QB  .  33 CYSS HB3  1 1 
       165 1 2 1 1  34 GLY H   .  34 GLY  H    1 1 
       166 1 1 1 1  33 CYS QB  .  33 CYSS HB3  1 1 
       166 1 2 1 1  53 VAL HB  .  53 VAL  HB   1 1 
       167 1 1 1 1  33 CYS QB  .  33 CYSS HB3  1 1 
       167 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       168 1 1 1 1  34 GLY H   .  34 GLY  H    1 1 
       168 1 2 1 1  35 GLN H   .  35 GLN  H    1 1 
       169 1 1 1 1  34 GLY H   .  34 GLY  H    1 1 
       169 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       170 1 1 1 1  34 GLY H   .  34 GLY  H    1 1 
       170 1 2 1 1  53 VAL HB  .  53 VAL  HB   1 1 
       171 1 1 1 1  34 GLY H   .  34 GLY  H    1 1 
       171 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       172 1 1 1 1  34 GLY QA  .  34 GLY  HA3  1 1 
       172 1 2 1 1  35 GLN H   .  35 GLN  H    1 1 
       173 1 1 1 1  34 GLY QA  .  34 GLY  HA3  1 1 
       173 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       174 1 1 1 1  35 GLN H   .  35 GLN  H    1 1 
       174 1 2 1 1  35 GLN QG  .  35 GLN  HG3  1 1 
       175 1 1 1 1  35 GLN H   .  35 GLN  H    1 1 
       175 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       176 1 1 1 1  35 GLN H   .  35 GLN  H    1 1 
       176 1 2 1 1  52 ARG QG  .  52 ARG  HG2  1 1 
       177 1 1 1 1  35 GLN HA  .  35 GLN  HA   1 1 
       177 1 2 1 1  35 GLN QG  .  35 GLN  HG3  1 1 
       178 1 1 1 1  35 GLN HA  .  35 GLN  HA   1 1 
       178 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       179 1 1 1 1  35 GLN HA  .  35 GLN  HA   1 1 
       179 1 2 1 1  52 ARG QB  .  52 ARG  HB3  1 1 
       180 1 1 1 1  35 GLN HA  .  35 GLN  HA   1 1 
       180 1 2 1 1  52 ARG QG  .  52 ARG  HG3  1 1 
       181 1 1 1 1  35 GLN HA  .  35 GLN  HA   1 1 
       181 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       182 1 1 1 1  35 GLN QB  .  35 GLN  HB3  1 1 
       182 1 2 1 1  35 GLN QG  .  35 GLN  HG3  1 1 
       183 1 1 1 1  35 GLN QB  .  35 GLN  HB3  1 1 
       183 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       184 1 1 1 1  35 GLN QG  .  35 GLN  HG3  1 1 
       184 1 2 1 1  36 GLY H   .  36 GLY  H    1 1 
       185 1 1 1 1  36 GLY H   .  36 GLY  H    1 1 
       185 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       186 1 1 1 1  36 GLY H   .  36 GLY  H    1 1 
       186 1 2 1 1  50 LYS HA  .  50 LYS  HA   1 1 
       187 1 1 1 1  36 GLY H   .  36 GLY  H    1 1 
       187 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       188 1 1 1 1  36 GLY H   .  36 GLY  H    1 1 
       188 1 2 1 1  52 ARG HA  .  52 ARG  HA   1 1 
       189 1 1 1 1  36 GLY H   .  36 GLY  H    1 1 
       189 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       190 1 1 1 1  36 GLY QA  .  36 GLY  HA3  1 1 
       190 1 2 1 1  37 MET H   .  37 MET  H    1 1 
       191 1 1 1 1  37 MET H   .  37 MET  H    1 1 
       191 1 2 1 1  37 MET QG  .  37 MET  HG3  1 1 
       192 1 1 1 1  37 MET H   .  37 MET  H    1 1 
       192 1 2 1 1  38 ARG H   .  38 ARG  H    1 1 
       193 1 1 1 1  37 MET HA  .  37 MET  HA   1 1 
       193 1 2 1 1  37 MET QG  .  37 MET  HG2  1 1 
       194 1 1 1 1  37 MET HA  .  37 MET  HA   1 1 
       194 1 2 1 1  38 ARG H   .  38 ARG  H    1 1 
       195 1 1 1 1  37 MET HA  .  37 MET  HA   1 1 
       195 1 2 1 1  50 LYS H   .  50 LYS  H    1 1 
       196 1 1 1 1  37 MET HA  .  37 MET  HA   1 1 
       196 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       197 1 1 1 1  37 MET QB  .  37 MET  HB3  1 1 
       197 1 2 1 1  37 MET QG  .  37 MET  HG3  1 1 
       198 1 1 1 1  37 MET QB  .  37 MET  HB3  1 1 
       198 1 2 1 1  38 ARG H   .  38 ARG  H    1 1 
       199 1 1 1 1  37 MET QG  .  37 MET  HG3  1 1 
       199 1 2 1 1  38 ARG H   .  38 ARG  H    1 1 
       200 1 1 1 1  37 MET QG  .  37 MET  HG3  1 1 
       200 1 2 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       201 1 1 1 1  37 MET QG  .  37 MET  HG2  1 1 
       201 1 2 1 1  50 LYS QD  .  50 LYS  HD3  1 1 
       202 1 1 1 1  37 MET QG  .  37 MET  HG2  1 1 
       202 1 2 1 1  50 LYS QE  .  50 LYS  HE3  1 1 
       203 1 1 1 1  37 MET QG  .  37 MET  HG3  1 1 
       203 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       204 1 1 1 1  38 ARG H   .  38 ARG  H    1 1 
       204 1 2 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
       205 1 1 1 1  38 ARG H   .  38 ARG  H    1 1 
       205 1 2 1 1  49 VAL H   .  49 VAL  H    1 1 
       206 1 1 1 1  38 ARG H   .  38 ARG  H    1 1 
       206 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       207 1 1 1 1  38 ARG H   .  38 ARG  H    1 1 
       207 1 2 1 1  50 LYS HA  .  50 LYS  HA   1 1 
       208 1 1 1 1  38 ARG H   .  38 ARG  H    1 1 
       208 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       209 1 1 1 1  38 ARG HA  .  38 ARG  HA   1 1 
       209 1 2 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
       210 1 1 1 1  38 ARG HA  .  38 ARG  HA   1 1 
       210 1 2 1 1  39 GLU H   .  39 GLU  H    1 1 
       211 1 1 1 1  38 ARG HA  .  38 ARG  HA   1 1 
       211 1 2 1 1  39 GLU QB  .  39 GLU  HB3  1 1 
       212 1 1 1 1  38 ARG QB  .  38 ARG  HB3  1 1 
       212 1 2 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
       213 1 1 1 1  38 ARG QB  .  38 ARG  HB3  1 1 
       213 1 2 1 1  39 GLU H   .  39 GLU  H    1 1 
       214 1 1 1 1  38 ARG QB  .  38 ARG  HB3  1 1 
       214 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       215 1 1 1 1  38 ARG QD  .  38 ARG  HD3  1 1 
       215 1 2 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
       216 1 1 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
       216 1 2 1 1  39 GLU H   .  39 GLU  H    1 1 
       217 1 1 1 1  38 ARG QG  .  38 ARG  HG3  1 1 
       217 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       218 1 1 1 1  39 GLU H   .  39 GLU  H    1 1 
       218 1 2 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       219 1 1 1 1  39 GLU H   .  39 GLU  H    1 1 
       219 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
       220 1 1 1 1  39 GLU HA  .  39 GLU  HA   1 1 
       220 1 2 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       221 1 1 1 1  39 GLU HA  .  39 GLU  HA   1 1 
       221 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
       222 1 1 1 1  39 GLU HA  .  39 GLU  HA   1 1 
       222 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
       223 1 1 1 1  39 GLU HA  .  39 GLU  HA   1 1 
       223 1 2 1 1  48 LYS QG  .  48 LYS  HG2  1 1 
       224 1 1 1 1  39 GLU QB  .  39 GLU  HB3  1 1 
       224 1 2 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       225 1 1 1 1  39 GLU QB  .  39 GLU  HB2  1 1 
       225 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
       226 1 1 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       226 1 2 1 1  40 GLY H   .  40 GLY  H    1 1 
       227 1 1 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       227 1 2 1 1  46 THR HB  .  46 THR  HB   1 1 
       228 1 1 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       228 1 2 1 1  46 THR MG  .  46 THR  QG2  1 1 
       229 1 1 1 1  39 GLU QG  .  39 GLU  HG3  1 1 
       229 1 2 1 1  48 LYS QG  .  48 LYS  HG2  1 1 
       230 1 1 1 1  40 GLY H   .  40 GLY  H    1 1 
       230 1 2 1 1  41 THR H   .  41 THR  H    1 1 
       231 1 1 1 1  40 GLY H   .  40 GLY  H    1 1 
       231 1 2 1 1  46 THR HA  .  46 THR  HA   1 1 
       232 1 1 1 1  40 GLY H   .  40 GLY  H    1 1 
       232 1 2 1 1  46 THR HB  .  46 THR  HB   1 1 
       233 1 1 1 1  40 GLY H   .  40 GLY  H    1 1 
       233 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
       234 1 1 1 1  40 GLY H   .  40 GLY  H    1 1 
       234 1 2 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
       235 1 1 1 1  40 GLY H   .  40 GLY  H    1 1 
       235 1 2 1 1  48 LYS QG  .  48 LYS  HG2  1 1 
       236 1 1 1 1  40 GLY QA  .  40 GLY  HA3  1 1 
       236 1 2 1 1  41 THR H   .  41 THR  H    1 1 
       237 1 1 1 1  41 THR H   .  41 THR  H    1 1 
       237 1 2 1 1  41 THR MG  .  41 THR  QG2  1 1 
       238 1 1 1 1  41 THR H   .  41 THR  H    1 1 
       238 1 2 1 1  42 CYS H   .  42 CYSS H    1 1 
       239 1 1 1 1  41 THR HA  .  41 THR  HA   1 1 
       239 1 2 1 1  42 CYS H   .  42 CYSS H    1 1 
       240 1 1 1 1  41 THR HA  .  41 THR  HA   1 1 
       240 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       241 1 1 1 1  41 THR HA  .  41 THR  HA   1 1 
       241 1 2 1 1  46 THR HA  .  46 THR  HA   1 1 
       242 1 1 1 1  41 THR HB  .  41 THR  HB   1 1 
       242 1 2 1 1  42 CYS H   .  42 CYSS H    1 1 
       243 1 1 1 1  41 THR HB  .  41 THR  HB   1 1 
       243 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       244 1 1 1 1  41 THR HB  .  41 THR  HB   1 1 
       244 1 2 1 1  46 THR HB  .  46 THR  HB   1 1 
       245 1 1 1 1  41 THR MG  .  41 THR  QG2  1 1 
       245 1 2 1 1  42 CYS H   .  42 CYSS H    1 1 
       246 1 1 1 1  41 THR MG  .  41 THR  QG2  1 1 
       246 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       247 1 1 1 1  42 CYS H   .  42 CYSS H    1 1 
       247 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       248 1 1 1 1  42 CYS H   .  42 CYSS H    1 1 
       248 1 2 1 1  45 GLN HA  .  45 GLN  HA   1 1 
       249 1 1 1 1  42 CYS H   .  42 CYSS H    1 1 
       249 1 2 1 1  45 GLN QB  .  45 GLN  HB2  1 1 
       250 1 1 1 1  42 CYS H   .  42 CYSS H    1 1 
       250 1 2 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
       251 1 1 1 1  42 CYS H   .  42 CYSS H    1 1 
       251 1 2 1 1  46 THR H   .  46 THR  H    1 1 
       252 1 1 1 1  42 CYS HA  .  42 CYSS HA   1 1 
       252 1 2 1 1  43 ASN H   .  43 ASN  H    1 1 
       253 1 1 1 1  43 ASN HA  .  43 ASN  HA   1 1 
       253 1 2 1 1  44 GLU H   .  44 GLU  H    1 1 
       254 1 1 1 1  43 ASN HA  .  43 ASN  HA   1 1 
       254 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       255 1 1 1 1  43 ASN QB  .  43 ASN  HB3  1 1 
       255 1 2 1 1  44 GLU H   .  44 GLU  H    1 1 
       256 1 1 1 1  43 ASN QB  .  43 ASN  HB2  1 1 
       256 1 2 1 1  44 GLU QB  .  44 GLU  HB2  1 1 
       257 1 1 1 1  43 ASN QB  .  43 ASN  HB3  1 1 
       257 1 2 1 1  44 GLU QG  .  44 GLU  HG3  1 1 
       258 1 1 1 1  43 ASN QB  .  43 ASN  HB3  1 1 
       258 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       259 1 1 1 1  44 GLU H   .  44 GLU  H    1 1 
       259 1 2 1 1  44 GLU QG  .  44 GLU  HG3  1 1 
       260 1 1 1 1  44 GLU H   .  44 GLU  H    1 1 
       260 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       261 1 1 1 1  44 GLU HA  .  44 GLU  HA   1 1 
       261 1 2 1 1  44 GLU QG  .  44 GLU  HG3  1 1 
       262 1 1 1 1  44 GLU HA  .  44 GLU  HA   1 1 
       262 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       263 1 1 1 1  44 GLU QB  .  44 GLU  HB3  1 1 
       263 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       264 1 1 1 1  44 GLU QG  .  44 GLU  HG3  1 1 
       264 1 2 1 1  45 GLN H   .  45 GLN  H    1 1 
       265 1 1 1 1  44 GLU QG  .  44 GLU  HG2  1 1 
       265 1 2 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
       266 1 1 1 1  45 GLN H   .  45 GLN  H    1 1 
       266 1 2 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
       267 1 1 1 1  45 GLN H   .  45 GLN  H    1 1 
       267 1 2 1 1  46 THR H   .  46 THR  H    1 1 
       268 1 1 1 1  45 GLN HA  .  45 GLN  HA   1 1 
       268 1 2 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
       269 1 1 1 1  45 GLN HA  .  45 GLN  HA   1 1 
       269 1 2 1 1  46 THR H   .  46 THR  H    1 1 
       270 1 1 1 1  45 GLN QB  .  45 GLN  HB3  1 1 
       270 1 2 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
       271 1 1 1 1  45 GLN QB  .  45 GLN  HB3  1 1 
       271 1 2 1 1  46 THR H   .  46 THR  H    1 1 
       272 1 1 1 1  45 GLN QG  .  45 GLN  HG3  1 1 
       272 1 2 1 1  46 THR H   .  46 THR  H    1 1 
       273 1 1 1 1  46 THR H   .  46 THR  H    1 1 
       273 1 2 1 1  46 THR MG  .  46 THR  QG2  1 1 
       274 1 1 1 1  46 THR H   .  46 THR  H    1 1 
       274 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
       275 1 1 1 1  46 THR HA  .  46 THR  HA   1 1 
       275 1 2 1 1  46 THR MG  .  46 THR  QG2  1 1 
       276 1 1 1 1  46 THR HA  .  46 THR  HA   1 1 
       276 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
       277 1 1 1 1  46 THR HB  .  46 THR  HB   1 1 
       277 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
       278 1 1 1 1  46 THR MG  .  46 THR  QG2  1 1 
       278 1 2 1 1  47 ARG H   .  47 ARG  H    1 1 
       279 1 1 1 1  46 THR MG  .  46 THR  QG2  1 1 
       279 1 2 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
       280 1 1 1 1  47 ARG H   .  47 ARG  H    1 1 
       280 1 2 1 1  47 ARG QG  .  47 ARG  HG3  1 1 
       281 1 1 1 1  47 ARG HA  .  47 ARG  HA   1 1 
       281 1 2 1 1  47 ARG QG  .  47 ARG  HG3  1 1 
       282 1 1 1 1  47 ARG HA  .  47 ARG  HA   1 1 
       282 1 2 1 1  48 LYS H   .  48 LYS  H    1 1 
       283 1 1 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
       283 1 2 1 1  47 ARG QD  .  47 ARG  HD3  1 1 
       284 1 1 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
       284 1 2 1 1  47 ARG QG  .  47 ARG  HG3  1 1 
       285 1 1 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
       285 1 2 1 1  48 LYS H   .  48 LYS  H    1 1 
       286 1 1 1 1  47 ARG QB  .  47 ARG  HB3  1 1 
       286 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       287 1 1 1 1  47 ARG QD  .  47 ARG  HD3  1 1 
       287 1 2 1 1  47 ARG QG  .  47 ARG  HG3  1 1 
       288 1 1 1 1  47 ARG QD  .  47 ARG  HD2  1 1 
       288 1 2 1 1  48 LYS QD  .  48 LYS  HD2  1 1 
       289 1 1 1 1  47 ARG QD  .  47 ARG  HD2  1 1 
       289 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       290 1 1 1 1  47 ARG QG  .  47 ARG  HG3  1 1 
       290 1 2 1 1  48 LYS H   .  48 LYS  H    1 1 
       291 1 1 1 1  47 ARG QG  .  47 ARG  HG3  1 1 
       291 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       292 1 1 1 1  48 LYS H   .  48 LYS  H    1 1 
       292 1 2 1 1  48 LYS QD  .  48 LYS  HD3  1 1 
       293 1 1 1 1  48 LYS H   .  48 LYS  H    1 1 
       293 1 2 1 1  48 LYS QG  .  48 LYS  HG3  1 1 
       294 1 1 1 1  48 LYS H   .  48 LYS  H    1 1 
       294 1 2 1 1  49 VAL H   .  49 VAL  H    1 1 
       295 1 1 1 1  48 LYS HA  .  48 LYS  HA   1 1 
       295 1 2 1 1  48 LYS QG  .  48 LYS  HG3  1 1 
       296 1 1 1 1  48 LYS HA  .  48 LYS  HA   1 1 
       296 1 2 1 1  49 VAL H   .  49 VAL  H    1 1 
       297 1 1 1 1  48 LYS HA  .  48 LYS  HA   1 1 
       297 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       298 1 1 1 1  48 LYS QB  .  48 LYS  HB3  1 1 
       298 1 2 1 1  48 LYS QE  .  48 LYS  HE3  1 1 
       299 1 1 1 1  48 LYS QB  .  48 LYS  HB3  1 1 
       299 1 2 1 1  48 LYS QG  .  48 LYS  HG3  1 1 
       300 1 1 1 1  48 LYS QB  .  48 LYS  HB3  1 1 
       300 1 2 1 1  49 VAL H   .  49 VAL  H    1 1 
       301 1 1 1 1  48 LYS QB  .  48 LYS  HB3  1 1 
       301 1 2 1 1  49 VAL QG  .  49 VAL  QG2  1 1 
       302 1 1 1 1  48 LYS QD  .  48 LYS  HD3  1 1 
       302 1 2 1 1  48 LYS QG  .  48 LYS  HG2  1 1 
       303 1 1 1 1  48 LYS QE  .  48 LYS  HE3  1 1 
       303 1 2 1 1  48 LYS QG  .  48 LYS  HG3  1 1 
       304 1 1 1 1  48 LYS QG  .  48 LYS  HG2  1 1 
       304 1 2 1 1  49 VAL H   .  49 VAL  H    1 1 
       305 1 1 1 1  49 VAL H   .  49 VAL  H    1 1 
       305 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       306 1 1 1 1  49 VAL H   .  49 VAL  H    1 1 
       306 1 2 1 1  50 LYS H   .  50 LYS  H    1 1 
       307 1 1 1 1  49 VAL HA  .  49 VAL  HA   1 1 
       307 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       308 1 1 1 1  49 VAL HA  .  49 VAL  HA   1 1 
       308 1 2 1 1  50 LYS H   .  50 LYS  H    1 1 
       309 1 1 1 1  49 VAL HB  .  49 VAL  HB   1 1 
       309 1 2 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       310 1 1 1 1  49 VAL HB  .  49 VAL  HB   1 1 
       310 1 2 1 1  50 LYS H   .  50 LYS  H    1 1 
       311 1 1 1 1  49 VAL HB  .  49 VAL  HB   1 1 
       311 1 2 1 1  50 LYS HA  .  50 LYS  HA   1 1 
       312 1 1 1 1  49 VAL MG1 .  49 VAL  QG1  1 1 
       312 1 2 1 1  49 VAL MG2 .  49 VAL  QG2  1 1 
       313 1 1 1 1  49 VAL QG  .  49 VAL  QG1  1 1 
       313 1 2 1 1  50 LYS H   .  50 LYS  H    1 1 
       314 1 1 1 1  50 LYS H   .  50 LYS  H    1 1 
       314 1 2 1 1  50 LYS QD  .  50 LYS  HD3  1 1 
       315 1 1 1 1  50 LYS H   .  50 LYS  H    1 1 
       315 1 2 1 1  50 LYS QE  .  50 LYS  HE3  1 1 
       316 1 1 1 1  50 LYS H   .  50 LYS  H    1 1 
       316 1 2 1 1  50 LYS QG  .  50 LYS  HG3  1 1 
       317 1 1 1 1  50 LYS H   .  50 LYS  H    1 1 
       317 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       318 1 1 1 1  50 LYS HA  .  50 LYS  HA   1 1 
       318 1 2 1 1  50 LYS QG  .  50 LYS  HG3  1 1 
       319 1 1 1 1  50 LYS HA  .  50 LYS  HA   1 1 
       319 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       320 1 1 1 1  50 LYS QB  .  50 LYS  HB3  1 1 
       320 1 2 1 1  50 LYS QG  .  50 LYS  HG3  1 1 
       321 1 1 1 1  50 LYS QB  .  50 LYS  HB3  1 1 
       321 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       322 1 1 1 1  50 LYS QD  .  50 LYS  HD3  1 1 
       322 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       323 1 1 1 1  50 LYS QE  .  50 LYS  HE3  1 1 
       323 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       324 1 1 1 1  50 LYS QG  .  50 LYS  HG3  1 1 
       324 1 2 1 1  51 CYS H   .  51 CYSS H    1 1 
       325 1 1 1 1  51 CYS HA  .  51 CYSS HA   1 1 
       325 1 2 1 1  52 ARG H   .  52 ARG  H    1 1 
       326 1 1 1 1  51 CYS QB  .  51 CYSS HB2  1 1 
       326 1 2 1 1  52 ARG H   .  52 ARG  H    1 1 
       327 1 1 1 1  51 CYS QB  .  51 CYSS HB2  1 1 
       327 1 2 1 1  52 ARG QD  .  52 ARG  HD3  1 1 
       328 1 1 1 1  52 ARG HA  .  52 ARG  HA   1 1 
       328 1 2 1 1  52 ARG QD  .  52 ARG  HD3  1 1 
       329 1 1 1 1  52 ARG HA  .  52 ARG  HA   1 1 
       329 1 2 1 1  52 ARG QG  .  52 ARG  HG3  1 1 
       330 1 1 1 1  52 ARG HA  .  52 ARG  HA   1 1 
       330 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       331 1 1 1 1  52 ARG HA  .  52 ARG  HA   1 1 
       331 1 2 1 1  53 VAL QG  .  53 VAL  QG2  1 1 
       332 1 1 1 1  52 ARG QB  .  52 ARG  HB3  1 1 
       332 1 2 1 1  52 ARG QD  .  52 ARG  HD3  1 1 
       333 1 1 1 1  52 ARG QB  .  52 ARG  HB3  1 1 
       333 1 2 1 1  52 ARG QG  .  52 ARG  HG2  1 1 
       334 1 1 1 1  52 ARG QB  .  52 ARG  HB3  1 1 
       334 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       335 1 1 1 1  52 ARG QD  .  52 ARG  HD3  1 1 
       335 1 2 1 1  52 ARG QG  .  52 ARG  HG3  1 1 
       336 1 1 1 1  52 ARG QD  .  52 ARG  HD3  1 1 
       336 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       337 1 1 1 1  52 ARG QG  .  52 ARG  HG3  1 1 
       337 1 2 1 1  53 VAL H   .  53 VAL  H    1 1 
       338 1 1 1 1  52 ARG QG  .  52 ARG  HG3  1 1 
       338 1 2 1 1  54 PRO QG  .  54 PRO  HG3  1 1 
       339 1 1 1 1  53 VAL H   .  53 VAL  H    1 1 
       339 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       340 1 1 1 1  53 VAL HA  .  53 VAL  HA   1 1 
       340 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       341 1 1 1 1  53 VAL HA  .  53 VAL  HA   1 1 
       341 1 2 1 1  54 PRO QD  .  54 PRO  HD2  1 1 
       342 1 1 1 1  53 VAL HA  .  53 VAL  HA   1 1 
       342 1 2 1 1  54 PRO QG  .  54 PRO  HG3  1 1 
       343 1 1 1 1  53 VAL HB  .  53 VAL  HB   1 1 
       343 1 2 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       344 1 1 1 1  53 VAL MG1 .  53 VAL  QG1  1 1 
       344 1 2 1 1  53 VAL MG2 .  53 VAL  QG2  1 1 
       345 1 1 1 1  53 VAL QG  .  53 VAL  QG1  1 1 
       345 1 2 1 1  54 PRO QD  .  54 PRO  HD2  1 1 
       346 1 1 1 1  54 PRO HA  .  54 PRO  HA   1 1 
       346 1 2 1 1  55 CYS H   .  55 CYSS H    1 1 
       347 1 1 1 1  54 PRO QD  .  54 PRO  HD2  1 1 
       347 1 2 1 1  54 PRO QG  .  54 PRO  HG3  1 1 
       348 1 1 1 1  56 ASN HA  .  56 ASN  HA   1 1 
       348 1 2 1 1  57 TRP H   .  57 TRP  H    1 1 
       349 1 1 1 1  56 ASN QB  .  56 ASN  HB3  1 1 
       349 1 2 1 1  57 TRP H   .  57 TRP  H    1 1 
       350 1 1 1 1  57 TRP H   .  57 TRP  H    1 1 
       350 1 2 1 1  57 TRP HD1 .  57 TRP  HD1  1 1 
       351 1 1 1 1  57 TRP HA  .  57 TRP  HA   1 1 
       351 1 2 1 1  57 TRP HD1 .  57 TRP  HD1  1 1 
       352 1 1 1 1  57 TRP HA  .  57 TRP  HA   1 1 
       352 1 2 1 1  57 TRP HE3 .  57 TRP  HE3  1 1 
       353 1 1 1 1  57 TRP HA  .  57 TRP  HA   1 1 
       353 1 2 1 1  58 LYS H   .  58 LYS  H    1 1 
       354 1 1 1 1  57 TRP QB  .  57 TRP  HB3  1 1 
       354 1 2 1 1  58 LYS H   .  58 LYS  H    1 1 
       355 1 1 1 1  58 LYS H   .  58 LYS  H    1 1 
       355 1 2 1 1  58 LYS QD  .  58 LYS  HD3  1 1 
       356 1 1 1 1  59 LYS HA  .  59 LYS  HA   1 1 
       356 1 2 1 1  60 GLU H   .  60 GLU  H    1 1 
       357 1 1 1 1  59 LYS QB  .  59 LYS  HB3  1 1 
       357 1 2 1 1  60 GLU H   .  60 GLU  H    1 1 
       358 1 1 1 1  59 LYS QD  .  59 LYS  HD3  1 1 
       358 1 2 1 1  60 GLU H   .  60 GLU  H    1 1 
       359 1 1 1 1  59 LYS QE  .  59 LYS  HE3  1 1 
       359 1 2 1 1  60 GLU H   .  60 GLU  H    1 1 
       360 1 1 1 1  59 LYS QG  .  59 LYS  HG3  1 1 
       360 1 2 1 1  60 GLU H   .  60 GLU  H    1 1 
       361 1 1 1 1  61 PHE HA  .  61 PHE  HA   1 1 
       361 1 2 1 1  62 GLY H   .  62 GLY  H    1 1 
       362 1 1 1 1  61 PHE QB  .  61 PHE  HB3  1 1 
       362 1 2 1 1  62 GLY H   .  62 GLY  H    1 1 
       363 1 1 1 1  63 ALA HA  .  63 ALA  HA   1 1 
       363 1 2 1 1  64 ASP H   .  64 ASP  H    1 1 
       364 1 1 1 1  63 ALA MB  .  63 ALA  QB   1 1 
       364 1 2 1 1  64 ASP H   .  64 ASP  H    1 1 
       365 1 1 1 1  63 ALA MB  .  63 ALA  QB   1 1 
       365 1 2 1 1  65 CYS H   .  65 CYSS H    1 1 
       366 1 1 1 1  64 ASP H   .  64 ASP  H    1 1 
       366 1 2 1 1  65 CYS H   .  65 CYSS H    1 1 
       367 1 1 1 1  64 ASP HA  .  64 ASP  HA   1 1 
       367 1 2 1 1  65 CYS H   .  65 CYSS H    1 1 
       368 1 1 1 1  65 CYS HA  .  65 CYSS HA   1 1 
       368 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       369 1 1 1 1  65 CYS QB  .  65 CYSS HB3  1 1 
       369 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       370 1 1 1 1  67 TYR H   .  67 TYR  H    1 1 
       370 1 2 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       371 1 1 1 1  67 TYR HA  .  67 TYR  HA   1 1 
       371 1 2 1 1  68 LYS H   .  68 LYS  H    1 1 
       372 1 1 1 1  67 TYR HA  .  67 TYR  HA   1 1 
       372 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       373 1 1 1 1  67 TYR HA  .  67 TYR  HA   1 1 
       373 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       374 1 1 1 1  67 TYR QB  .  67 TYR  HB3  1 1 
       374 1 2 1 1  68 LYS H   .  68 LYS  H    1 1 
       375 1 1 1 1  67 TYR QB  .  67 TYR  HB3  1 1 
       375 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       376 1 1 1 1  67 TYR QB  .  67 TYR  HB3  1 1 
       376 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       377 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       377 1 2 1 1  68 LYS H   .  68 LYS  H    1 1 
       378 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       378 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       379 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       379 1 2 1 1  88 LEU H   .  88 LEU  H    1 1 
       380 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       380 1 2 1 1  88 LEU HA  .  88 LEU  HA   1 1 
       381 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       381 1 2 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       382 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       382 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       383 1 1 1 1  67 TYR QD  .  67 TYR  HD1  1 1 
       383 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       384 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       384 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       385 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       385 1 2 1 1  87 THR MG  .  87 THR  QG2  1 1 
       386 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       386 1 2 1 1  88 LEU H   .  88 LEU  H    1 1 
       387 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       387 1 2 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       388 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       388 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       389 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       389 1 2 1 1  89 GLN H   .  89 GLN  H    1 1 
       390 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       390 1 2 1 1  99 GLN HA  .  99 GLN  HA   1 1 
       391 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       391 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       392 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       392 1 2 1 1 100 THR HA  . 100 THR  HA   1 1 
       393 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       393 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       394 1 1 1 1  67 TYR QE  .  67 TYR  HE1  1 1 
       394 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       395 1 1 1 1  68 LYS H   .  68 LYS  H    1 1 
       395 1 2 1 1  68 LYS QD  .  68 LYS  HD3  1 1 
       396 1 1 1 1  68 LYS H   .  68 LYS  H    1 1 
       396 1 2 1 1  68 LYS QG  .  68 LYS  HG3  1 1 
       397 1 1 1 1  68 LYS H   .  68 LYS  H    1 1 
       397 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       398 1 1 1 1  68 LYS HA  .  68 LYS  HA   1 1 
       398 1 2 1 1  68 LYS QD  .  68 LYS  HD3  1 1 
       399 1 1 1 1  68 LYS HA  .  68 LYS  HA   1 1 
       399 1 2 1 1  69 PHE H   .  69 PHE  H    1 1 
       400 1 1 1 1  68 LYS QB  .  68 LYS  HB2  1 1 
       400 1 2 1 1  68 LYS QE  .  68 LYS  HE3  1 1 
       401 1 1 1 1  68 LYS QB  .  68 LYS  HB3  1 1 
       401 1 2 1 1  69 PHE H   .  69 PHE  H    1 1 
       402 1 1 1 1  68 LYS QB  .  68 LYS  HB3  1 1 
       402 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       403 1 1 1 1  68 LYS QD  .  68 LYS  HD3  1 1 
       403 1 2 1 1  69 PHE H   .  69 PHE  H    1 1 
       404 1 1 1 1  68 LYS QG  .  68 LYS  HG3  1 1 
       404 1 2 1 1  69 PHE H   .  69 PHE  H    1 1 
       405 1 1 1 1  68 LYS QG  .  68 LYS  HG3  1 1 
       405 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       406 1 1 1 1  69 PHE H   .  69 PHE  H    1 1 
       406 1 2 1 1  69 PHE QD  .  69 PHE  HD1  1 1 
       407 1 1 1 1  69 PHE HA  .  69 PHE  HA   1 1 
       407 1 2 1 1  70 GLY H   .  70 GLY  H    1 1 
       408 1 1 1 1  69 PHE HA  .  69 PHE  HA   1 1 
       408 1 2 1 1  86 GLY QA  .  86 GLY  HA2  1 1 
       409 1 1 1 1  69 PHE HA  .  69 PHE  HA   1 1 
       409 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       410 1 1 1 1  69 PHE QB  .  69 PHE  HB2  1 1 
       410 1 2 1 1  70 GLY H   .  70 GLY  H    1 1 
       411 1 1 1 1  69 PHE QD  .  69 PHE  HD1  1 1 
       411 1 2 1 1  86 GLY H   .  86 GLY  H    1 1 
       412 1 1 1 1  69 PHE QD  .  69 PHE  HD1  1 1 
       412 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       413 1 1 1 1  69 PHE QE  .  69 PHE  HE1  1 1 
       413 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       414 1 1 1 1  69 PHE QE  .  69 PHE  HE1  1 1 
       414 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       415 1 1 1 1  69 PHE QE  .  69 PHE  HE1  1 1 
       415 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       416 1 1 1 1  69 PHE HZ  .  69 PHE  HZ   1 1 
       416 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       417 1 1 1 1  69 PHE HZ  .  69 PHE  HZ   1 1 
       417 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       418 1 1 1 1  70 GLY H   .  70 GLY  H    1 1 
       418 1 2 1 1  71 ASN H   .  71 ASN  H    1 1 
       419 1 1 1 1  70 GLY H   .  70 GLY  H    1 1 
       419 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       420 1 1 1 1  70 GLY H   .  70 GLY  H    1 1 
       420 1 2 1 1  86 GLY QA  .  86 GLY  HA3  1 1 
       421 1 1 1 1  70 GLY H   .  70 GLY  H    1 1 
       421 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       422 1 1 1 1  70 GLY QA  .  70 GLY  HA3  1 1 
       422 1 2 1 1  71 ASN H   .  71 ASN  H    1 1 
       423 1 1 1 1  71 ASN HA  .  71 ASN  HA   1 1 
       423 1 2 1 1  72 TRP H   .  72 TRP  H    1 1 
       424 1 1 1 1  71 ASN HA  .  71 ASN  HA   1 1 
       424 1 2 1 1  72 TRP HD1 .  72 TRP  HD1  1 1 
       425 1 1 1 1  71 ASN QB  .  71 ASN  HB3  1 1 
       425 1 2 1 1  72 TRP H   .  72 TRP  H    1 1 
       426 1 1 1 1  72 TRP H   .  72 TRP  H    1 1 
       426 1 2 1 1  72 TRP HD1 .  72 TRP  HD1  1 1 
       427 1 1 1 1  72 TRP HA  .  72 TRP  HA   1 1 
       427 1 2 1 1  72 TRP HD1 .  72 TRP  HD1  1 1 
       428 1 1 1 1  72 TRP HA  .  72 TRP  HA   1 1 
       428 1 2 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       429 1 1 1 1  72 TRP HA  .  72 TRP  HA   1 1 
       429 1 2 1 1  73 GLY H   .  73 GLY  H    1 1 
       430 1 1 1 1  72 TRP HA  .  72 TRP  HA   1 1 
       430 1 2 1 1  84 ARG QB  .  84 ARG  HB3  1 1 
       431 1 1 1 1  72 TRP HA  .  72 TRP  HA   1 1 
       431 1 2 1 1  84 ARG QG  .  84 ARG  HG2  1 1 
       432 1 1 1 1  72 TRP HA  .  72 TRP  HA   1 1 
       432 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       433 1 1 1 1  72 TRP QB  .  72 TRP  HB3  1 1 
       433 1 2 1 1  73 GLY H   .  73 GLY  H    1 1 
       434 1 1 1 1  72 TRP QB  .  72 TRP  HB2  1 1 
       434 1 2 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       435 1 1 1 1  72 TRP HD1 .  72 TRP  HD1  1 1 
       435 1 2 1 1  82 LYS QD  .  82 LYS  HD2  1 1 
       436 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       436 1 2 1 1  82 LYS QB  .  82 LYS  HB3  1 1 
       437 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       437 1 2 1 1  82 LYS QD  .  82 LYS  HD2  1 1 
       438 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       438 1 2 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       439 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       439 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       440 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       440 1 2 1 1  83 SER HA  .  83 SER  HA   1 1 
       441 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       441 1 2 1 1  84 ARG H   .  84 ARG  H    1 1 
       442 1 1 1 1  72 TRP HE3 .  72 TRP  HE3  1 1 
       442 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       443 1 1 1 1  73 GLY H   .  73 GLY  H    1 1 
       443 1 2 1 1  74 GLU H   .  74 GLU  H    1 1 
       444 1 1 1 1  73 GLY H   .  73 GLY  H    1 1 
       444 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       445 1 1 1 1  73 GLY H   .  73 GLY  H    1 1 
       445 1 2 1 1  84 ARG H   .  84 ARG  H    1 1 
       446 1 1 1 1  73 GLY H   .  73 GLY  H    1 1 
       446 1 2 1 1  84 ARG HA  .  84 ARG  HA   1 1 
       447 1 1 1 1  73 GLY H   .  73 GLY  H    1 1 
       447 1 2 1 1  84 ARG QB  .  84 ARG  HB2  1 1 
       448 1 1 1 1  73 GLY H   .  73 GLY  H    1 1 
       448 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       449 1 1 1 1  73 GLY QA  .  73 GLY  HA3  1 1 
       449 1 2 1 1  74 GLU H   .  74 GLU  H    1 1 
       450 1 1 1 1  73 GLY QA  .  73 GLY  HA3  1 1 
       450 1 2 1 1  74 GLU QG  .  74 GLU  HG3  1 1 
       451 1 1 1 1  74 GLU H   .  74 GLU  H    1 1 
       451 1 2 1 1  74 GLU QG  .  74 GLU  HG3  1 1 
       452 1 1 1 1  74 GLU HA  .  74 GLU  HA   1 1 
       452 1 2 1 1  74 GLU QG  .  74 GLU  HG3  1 1 
       453 1 1 1 1  74 GLU HA  .  74 GLU  HA   1 1 
       453 1 2 1 1  75 CYS H   .  75 CYSS H    1 1 
       454 1 1 1 1  74 GLU QB  .  74 GLU  HB3  1 1 
       454 1 2 1 1  74 GLU QG  .  74 GLU  HG3  1 1 
       455 1 1 1 1  75 CYS HA  .  75 CYSS HA   1 1 
       455 1 2 1 1  76 ASP H   .  76 ASP  H    1 1 
       456 1 1 1 1  75 CYS HA  .  75 CYSS HA   1 1 
       456 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       457 1 1 1 1  75 CYS QB  .  75 CYSS HB3  1 1 
       457 1 2 1 1  76 ASP H   .  76 ASP  H    1 1 
       458 1 1 1 1  75 CYS QB  .  75 CYSS HB2  1 1 
       458 1 2 1 1  77 ALA MB  .  77 ALA  QB   1 1 
       459 1 1 1 1  76 ASP H   .  76 ASP  H    1 1 
       459 1 2 1 1  77 ALA H   .  77 ALA  H    1 1 
       460 1 1 1 1  76 ASP H   .  76 ASP  H    1 1 
       460 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       461 1 1 1 1  76 ASP H   .  76 ASP  H    1 1 
       461 1 2 1 1  82 LYS HA  .  82 LYS  HA   1 1 
       462 1 1 1 1  76 ASP H   .  76 ASP  H    1 1 
       462 1 2 1 1  82 LYS QB  .  82 LYS  HB3  1 1 
       463 1 1 1 1  76 ASP HA  .  76 ASP  HA   1 1 
       463 1 2 1 1  77 ALA H   .  77 ALA  H    1 1 
       464 1 1 1 1  76 ASP HA  .  76 ASP  HA   1 1 
       464 1 2 1 1  77 ALA MB  .  77 ALA  QB   1 1 
       465 1 1 1 1  76 ASP QB  .  76 ASP  HB3  1 1 
       465 1 2 1 1  77 ALA H   .  77 ALA  H    1 1 
       466 1 1 1 1  76 ASP QB  .  76 ASP  HB2  1 1 
       466 1 2 1 1  79 THR H   .  79 THR  H    1 1 
       467 1 1 1 1  76 ASP QB  .  76 ASP  HB2  1 1 
       467 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       468 1 1 1 1  76 ASP QB  .  76 ASP  HB3  1 1 
       468 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       469 1 1 1 1  77 ALA H   .  77 ALA  H    1 1 
       469 1 2 1 1  77 ALA MB  .  77 ALA  QB   1 1 
       470 1 1 1 1  77 ALA H   .  77 ALA  H    1 1 
       470 1 2 1 1  78 ALA H   .  78 ALA  H    1 1 
       471 1 1 1 1  77 ALA H   .  77 ALA  H    1 1 
       471 1 2 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       472 1 1 1 1  77 ALA H   .  77 ALA  H    1 1 
       472 1 2 1 1  79 THR H   .  79 THR  H    1 1 
       473 1 1 1 1  77 ALA HA  .  77 ALA  HA   1 1 
       473 1 2 1 1  78 ALA H   .  78 ALA  H    1 1 
       474 1 1 1 1  77 ALA HA  .  77 ALA  HA   1 1 
       474 1 2 1 1  78 ALA HA  .  78 ALA  HA   1 1 
       475 1 1 1 1  77 ALA HA  .  77 ALA  HA   1 1 
       475 1 2 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       476 1 1 1 1  77 ALA HA  .  77 ALA  HA   1 1 
       476 1 2 1 1  79 THR MG  .  79 THR  QG2  1 1 
       477 1 1 1 1  77 ALA HA  .  77 ALA  HA   1 1 
       477 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       478 1 1 1 1  77 ALA HA  .  77 ALA  HA   1 1 
       478 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       479 1 1 1 1  77 ALA MB  .  77 ALA  QB   1 1 
       479 1 2 1 1  78 ALA H   .  78 ALA  H    1 1 
       480 1 1 1 1  77 ALA MB  .  77 ALA  QB   1 1 
       480 1 2 1 1  79 THR H   .  79 THR  H    1 1 
       481 1 1 1 1  77 ALA MB  .  77 ALA  QB   1 1 
       481 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       482 1 1 1 1  78 ALA H   .  78 ALA  H    1 1 
       482 1 2 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       483 1 1 1 1  78 ALA H   .  78 ALA  H    1 1 
       483 1 2 1 1  79 THR H   .  79 THR  H    1 1 
       484 1 1 1 1  78 ALA H   .  78 ALA  H    1 1 
       484 1 2 1 1  79 THR MG  .  79 THR  QG2  1 1 
       485 1 1 1 1  78 ALA H   .  78 ALA  H    1 1 
       485 1 2 1 1  80 SER HA  .  80 SER  HA   1 1 
       486 1 1 1 1  78 ALA HA  .  78 ALA  HA   1 1 
       486 1 2 1 1  79 THR H   .  79 THR  H    1 1 
       487 1 1 1 1  78 ALA HA  .  78 ALA  HA   1 1 
       487 1 2 1 1  79 THR MG  .  79 THR  QG2  1 1 
       488 1 1 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       488 1 2 1 1  79 THR H   .  79 THR  H    1 1 
       489 1 1 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       489 1 2 1 1  79 THR HA  .  79 THR  HA   1 1 
       490 1 1 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       490 1 2 1 1  79 THR MG  .  79 THR  QG2  1 1 
       491 1 1 1 1  78 ALA MB  .  78 ALA  QB   1 1 
       491 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       492 1 1 1 1  79 THR H   .  79 THR  H    1 1 
       492 1 2 1 1  79 THR MG  .  79 THR  QG2  1 1 
       493 1 1 1 1  79 THR H   .  79 THR  H    1 1 
       493 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       494 1 1 1 1  79 THR H   .  79 THR  H    1 1 
       494 1 2 1 1  80 SER HA  .  80 SER  HA   1 1 
       495 1 1 1 1  79 THR H   .  79 THR  H    1 1 
       495 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       496 1 1 1 1  79 THR HA  .  79 THR  HA   1 1 
       496 1 2 1 1  79 THR MG  .  79 THR  QG2  1 1 
       497 1 1 1 1  79 THR HA  .  79 THR  HA   1 1 
       497 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       498 1 1 1 1  79 THR HB  .  79 THR  HB   1 1 
       498 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       499 1 1 1 1  79 THR HB  .  79 THR  HB   1 1 
       499 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       500 1 1 1 1  79 THR HB  .  79 THR  HB   1 1 
       500 1 2 1 1  81 THR MG  .  81 THR  QG2  1 1 
       501 1 1 1 1  79 THR MG  .  79 THR  QG2  1 1 
       501 1 2 1 1  80 SER H   .  80 SER  H    1 1 
       502 1 1 1 1  79 THR MG  .  79 THR  QG2  1 1 
       502 1 2 1 1 108 THR HB  . 108 THR  HB   1 1 
       503 1 1 1 1  80 SER H   .  80 SER  H    1 1 
       503 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       504 1 1 1 1  80 SER HA  .  80 SER  HA   1 1 
       504 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       505 1 1 1 1  80 SER HA  .  80 SER  HA   1 1 
       505 1 2 1 1  81 THR MG  .  81 THR  QG2  1 1 
       506 1 1 1 1  80 SER HA  .  80 SER  HA   1 1 
       506 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       507 1 1 1 1  80 SER QB  .  80 SER  HB3  1 1 
       507 1 2 1 1  81 THR H   .  81 THR  H    1 1 
       508 1 1 1 1  80 SER QB  .  80 SER  HB3  1 1 
       508 1 2 1 1  81 THR MG  .  81 THR  QG2  1 1 
       509 1 1 1 1  80 SER QB  .  80 SER  HB3  1 1 
       509 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       510 1 1 1 1  81 THR H   .  81 THR  H    1 1 
       510 1 2 1 1  81 THR MG  .  81 THR  QG2  1 1 
       511 1 1 1 1  81 THR H   .  81 THR  H    1 1 
       511 1 2 1 1  82 LYS H   .  82 LYS  H    1 1 
       512 1 1 1 1  81 THR H   .  81 THR  H    1 1 
       512 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       513 1 1 1 1  81 THR HA  .  81 THR  HA   1 1 
       513 1 2 1 1  81 THR MG  .  81 THR  QG2  1 1 
       514 1 1 1 1  81 THR HA  .  81 THR  HA   1 1 
       514 1 2 1 1  82 LYS H   .  82 LYS  H    1 1 
       515 1 1 1 1  81 THR HA  .  81 THR  HA   1 1 
       515 1 2 1 1 106 PRO QB  . 106 PRO  HB2  1 1 
       516 1 1 1 1  81 THR HA  .  81 THR  HA   1 1 
       516 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       517 1 1 1 1  81 THR HB  .  81 THR  HB   1 1 
       517 1 2 1 1  82 LYS H   .  82 LYS  H    1 1 
       518 1 1 1 1  81 THR HB  .  81 THR  HB   1 1 
       518 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       519 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       519 1 2 1 1  82 LYS H   .  82 LYS  H    1 1 
       520 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       520 1 2 1 1 105 LYS HA  . 105 LYS  HA   1 1 
       521 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       521 1 2 1 1 106 PRO HA  . 106 PRO  HA   1 1 
       522 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       522 1 2 1 1 106 PRO QB  . 106 PRO  HB3  1 1 
       523 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       523 1 2 1 1 106 PRO QD  . 106 PRO  HD3  1 1 
       524 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       524 1 2 1 1 106 PRO QG  . 106 PRO  HG3  1 1 
       525 1 1 1 1  81 THR MG  .  81 THR  QG2  1 1 
       525 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       526 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       526 1 2 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       527 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       527 1 2 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       528 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       528 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       529 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       529 1 2 1 1  83 SER HA  .  83 SER  HA   1 1 
       530 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       530 1 2 1 1 104 THR HA  . 104 THR  HA   1 1 
       531 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       531 1 2 1 1 105 LYS H   . 105 LYS  H    1 1 
       532 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       532 1 2 1 1 106 PRO HA  . 106 PRO  HA   1 1 
       533 1 1 1 1  82 LYS H   .  82 LYS  H    1 1 
       533 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       534 1 1 1 1  82 LYS HA  .  82 LYS  HA   1 1 
       534 1 2 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       535 1 1 1 1  82 LYS HA  .  82 LYS  HA   1 1 
       535 1 2 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       536 1 1 1 1  82 LYS HA  .  82 LYS  HA   1 1 
       536 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       537 1 1 1 1  82 LYS HA  .  82 LYS  HA   1 1 
       537 1 2 1 1  83 SER HA  .  83 SER  HA   1 1 
       538 1 1 1 1  82 LYS QB  .  82 LYS  HB3  1 1 
       538 1 2 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       539 1 1 1 1  82 LYS QB  .  82 LYS  HB3  1 1 
       539 1 2 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       540 1 1 1 1  82 LYS QB  .  82 LYS  HB3  1 1 
       540 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       541 1 1 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       541 1 2 1 1  82 LYS QE  .  82 LYS  HE3  1 1 
       542 1 1 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       542 1 2 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       543 1 1 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       543 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       544 1 1 1 1  82 LYS QD  .  82 LYS  HD2  1 1 
       544 1 2 1 1 104 THR MG  . 104 THR  QG2  1 1 
       545 1 1 1 1  82 LYS QD  .  82 LYS  HD3  1 1 
       545 1 2 1 1 105 LYS QE  . 105 LYS  HE3  1 1 
       546 1 1 1 1  82 LYS QE  .  82 LYS  HE3  1 1 
       546 1 2 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       547 1 1 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       547 1 2 1 1  83 SER H   .  83 SER  H    1 1 
       548 1 1 1 1  82 LYS QG  .  82 LYS  HG3  1 1 
       548 1 2 1 1 105 LYS QD  . 105 LYS  HD3  1 1 
       549 1 1 1 1  83 SER H   .  83 SER  H    1 1 
       549 1 2 1 1  84 ARG H   .  84 ARG  H    1 1 
       550 1 1 1 1  83 SER H   .  83 SER  H    1 1 
       550 1 2 1 1 104 THR HA  . 104 THR  HA   1 1 
       551 1 1 1 1  83 SER HA  .  83 SER  HA   1 1 
       551 1 2 1 1  84 ARG H   .  84 ARG  H    1 1 
       552 1 1 1 1  83 SER HA  .  83 SER  HA   1 1 
       552 1 2 1 1 104 THR HA  . 104 THR  HA   1 1 
       553 1 1 1 1  83 SER HA  .  83 SER  HA   1 1 
       553 1 2 1 1 104 THR MG  . 104 THR  QG2  1 1 
       554 1 1 1 1  83 SER HA  .  83 SER  HA   1 1 
       554 1 2 1 1 105 LYS H   . 105 LYS  H    1 1 
       555 1 1 1 1  83 SER QB  .  83 SER  HB3  1 1 
       555 1 2 1 1  84 ARG H   .  84 ARG  H    1 1 
       556 1 1 1 1  83 SER QB  .  83 SER  HB3  1 1 
       556 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       557 1 1 1 1  83 SER QB  .  83 SER  HB2  1 1 
       557 1 2 1 1 104 THR HA  . 104 THR  HA   1 1 
       558 1 1 1 1  83 SER QB  .  83 SER  HB3  1 1 
       558 1 2 1 1 104 THR MG  . 104 THR  QG2  1 1 
       559 1 1 1 1  84 ARG H   .  84 ARG  H    1 1 
       559 1 2 1 1  84 ARG QG  .  84 ARG  HG3  1 1 
       560 1 1 1 1  84 ARG H   .  84 ARG  H    1 1 
       560 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       561 1 1 1 1  84 ARG H   .  84 ARG  H    1 1 
       561 1 2 1 1  85 THR HA  .  85 THR  HA   1 1 
       562 1 1 1 1  84 ARG H   .  84 ARG  H    1 1 
       562 1 2 1 1 103 VAL HA  . 103 VAL  HA   1 1 
       563 1 1 1 1  84 ARG H   .  84 ARG  H    1 1 
       563 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       564 1 1 1 1  84 ARG H   .  84 ARG  H    1 1 
       564 1 2 1 1 104 THR HA  . 104 THR  HA   1 1 
       565 1 1 1 1  84 ARG HA  .  84 ARG  HA   1 1 
       565 1 2 1 1  84 ARG QG  .  84 ARG  HG3  1 1 
       566 1 1 1 1  84 ARG HA  .  84 ARG  HA   1 1 
       566 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       567 1 1 1 1  84 ARG HA  .  84 ARG  HA   1 1 
       567 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       568 1 1 1 1  84 ARG HA  .  84 ARG  HA   1 1 
       568 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       569 1 1 1 1  84 ARG QB  .  84 ARG  HB3  1 1 
       569 1 2 1 1  84 ARG QG  .  84 ARG  HG3  1 1 
       570 1 1 1 1  84 ARG QB  .  84 ARG  HB3  1 1 
       570 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       571 1 1 1 1  84 ARG QB  .  84 ARG  HB2  1 1 
       571 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       572 1 1 1 1  84 ARG QG  .  84 ARG  HG3  1 1 
       572 1 2 1 1  85 THR H   .  85 THR  H    1 1 
       573 1 1 1 1  84 ARG QG  .  84 ARG  HG2  1 1 
       573 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       574 1 1 1 1  84 ARG QG  .  84 ARG  HG2  1 1 
       574 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       575 1 1 1 1  85 THR H   .  85 THR  H    1 1 
       575 1 2 1 1  85 THR MG  .  85 THR  QG2  1 1 
       576 1 1 1 1  85 THR H   .  85 THR  H    1 1 
       576 1 2 1 1  86 GLY H   .  86 GLY  H    1 1 
       577 1 1 1 1  85 THR H   .  85 THR  H    1 1 
       577 1 2 1 1 102 SER HA  . 102 SER  HA   1 1 
       578 1 1 1 1  85 THR H   .  85 THR  H    1 1 
       578 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       579 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       579 1 2 1 1  85 THR MG  .  85 THR  QG2  1 1 
       580 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       580 1 2 1 1  86 GLY H   .  86 GLY  H    1 1 
       581 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       581 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       582 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       582 1 2 1 1 102 SER H   . 102 SER  H    1 1 
       583 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       583 1 2 1 1 102 SER HA  . 102 SER  HA   1 1 
       584 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       584 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       585 1 1 1 1  85 THR HA  .  85 THR  HA   1 1 
       585 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       586 1 1 1 1  85 THR HB  .  85 THR  HB   1 1 
       586 1 2 1 1  86 GLY H   .  86 GLY  H    1 1 
       587 1 1 1 1  85 THR HB  .  85 THR  HB   1 1 
       587 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       588 1 1 1 1  85 THR MG  .  85 THR  QG2  1 1 
       588 1 2 1 1  86 GLY H   .  86 GLY  H    1 1 
       589 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       589 1 2 1 1 100 THR HA  . 100 THR  HA   1 1 
       590 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       590 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       591 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       591 1 2 1 1 101 VAL HA  . 101 VAL  HA   1 1 
       592 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       592 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       593 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       593 1 2 1 1 102 SER HA  . 102 SER  HA   1 1 
       594 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       594 1 2 1 1 102 SER QB  . 102 SER  HB3  1 1 
       595 1 1 1 1  86 GLY H   .  86 GLY  H    1 1 
       595 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       596 1 1 1 1  86 GLY QA  .  86 GLY  HA3  1 1 
       596 1 2 1 1  87 THR H   .  87 THR  H    1 1 
       597 1 1 1 1  86 GLY QA  .  86 GLY  HA3  1 1 
       597 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       598 1 1 1 1  86 GLY QA  .  86 GLY  HA2  1 1 
       598 1 2 1 1 103 VAL QG  . 103 VAL  QG2  1 1 
       599 1 1 1 1  87 THR H   .  87 THR  H    1 1 
       599 1 2 1 1  87 THR MG  .  87 THR  QG2  1 1 
       600 1 1 1 1  87 THR H   .  87 THR  H    1 1 
       600 1 2 1 1  88 LEU H   .  88 LEU  H    1 1 
       601 1 1 1 1  87 THR H   .  87 THR  H    1 1 
       601 1 2 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       602 1 1 1 1  87 THR HA  .  87 THR  HA   1 1 
       602 1 2 1 1  87 THR MG  .  87 THR  QG2  1 1 
       603 1 1 1 1  87 THR HA  .  87 THR  HA   1 1 
       603 1 2 1 1  88 LEU H   .  88 LEU  H    1 1 
       604 1 1 1 1  87 THR HA  .  87 THR  HA   1 1 
       604 1 2 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       605 1 1 1 1  87 THR HA  .  87 THR  HA   1 1 
       605 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       606 1 1 1 1  87 THR HA  .  87 THR  HA   1 1 
       606 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       607 1 1 1 1  87 THR HA  .  87 THR  HA   1 1 
       607 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       608 1 1 1 1  87 THR HB  .  87 THR  HB   1 1 
       608 1 2 1 1  88 LEU H   .  88 LEU  H    1 1 
       609 1 1 1 1  87 THR HB  .  87 THR  HB   1 1 
       609 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       610 1 1 1 1  87 THR MG  .  87 THR  QG2  1 1 
       610 1 2 1 1  88 LEU H   .  88 LEU  H    1 1 
       611 1 1 1 1  87 THR MG  .  87 THR  QG2  1 1 
       611 1 2 1 1  88 LEU QD  .  88 LEU  QD2  1 1 
       612 1 1 1 1  87 THR MG  .  87 THR  QG2  1 1 
       612 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       613 1 1 1 1  87 THR MG  .  87 THR  QG2  1 1 
       613 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       614 1 1 1 1  88 LEU H   .  88 LEU  H    1 1 
       614 1 2 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       615 1 1 1 1  88 LEU H   .  88 LEU  H    1 1 
       615 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       616 1 1 1 1  88 LEU H   .  88 LEU  H    1 1 
       616 1 2 1 1  88 LEU HG  .  88 LEU  HG   1 1 
       617 1 1 1 1  88 LEU H   .  88 LEU  H    1 1 
       617 1 2 1 1  99 GLN HA  .  99 GLN  HA   1 1 
       618 1 1 1 1  88 LEU H   .  88 LEU  H    1 1 
       618 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       619 1 1 1 1  88 LEU H   .  88 LEU  H    1 1 
       619 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       620 1 1 1 1  88 LEU HA  .  88 LEU  HA   1 1 
       620 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       621 1 1 1 1  88 LEU HA  .  88 LEU  HA   1 1 
       621 1 2 1 1  89 GLN H   .  89 GLN  H    1 1 
       622 1 1 1 1  88 LEU HA  .  88 LEU  HA   1 1 
       622 1 2 1 1  90 LYS H   .  90 LYS  H    1 1 
       623 1 1 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       623 1 2 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       624 1 1 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       624 1 2 1 1  89 GLN H   .  89 GLN  H    1 1 
       625 1 1 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       625 1 2 1 1  99 GLN HA  .  99 GLN  HA   1 1 
       626 1 1 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       626 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       627 1 1 1 1  88 LEU QB  .  88 LEU  HB3  1 1 
       627 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       628 1 1 1 1  88 LEU MD1 .  88 LEU  QD1  1 1 
       628 1 2 1 1  88 LEU MD2 .  88 LEU  QD2  1 1 
       629 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       629 1 2 1 1  88 LEU HG  .  88 LEU  HG   1 1 
       630 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       630 1 2 1 1  89 GLN H   .  89 GLN  H    1 1 
       631 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       631 1 2 1 1  90 LYS H   .  90 LYS  H    1 1 
       632 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       632 1 2 1 1  90 LYS HA  .  90 LYS  HA   1 1 
       633 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       633 1 2 1 1  91 ALA MB  .  91 ALA  QB   1 1 
       634 1 1 1 1  88 LEU QD  .  88 LEU  QD2  1 1 
       634 1 2 1 1  97 CYS H   .  97 CYSS H    1 1 
       635 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       635 1 2 1 1  97 CYS QB  .  97 CYSS HB3  1 1 
       636 1 1 1 1  88 LEU QD  .  88 LEU  QD1  1 1 
       636 1 2 1 1  99 GLN HA  .  99 GLN  HA   1 1 
       637 1 1 1 1  88 LEU QD  .  88 LEU  QD2  1 1 
       637 1 2 1 1  99 GLN QB  .  99 GLN  HB3  1 1 
       638 1 1 1 1  88 LEU QD  .  88 LEU  QD2  1 1 
       638 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       639 1 1 1 1  88 LEU HG  .  88 LEU  HG   1 1 
       639 1 2 1 1  89 GLN H   .  89 GLN  H    1 1 
       640 1 1 1 1  89 GLN H   .  89 GLN  H    1 1 
       640 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       641 1 1 1 1  89 GLN H   .  89 GLN  H    1 1 
       641 1 2 1 1  90 LYS H   .  90 LYS  H    1 1 
       642 1 1 1 1  89 GLN HA  .  89 GLN  HA   1 1 
       642 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       643 1 1 1 1  89 GLN HA  .  89 GLN  HA   1 1 
       643 1 2 1 1  90 LYS H   .  90 LYS  H    1 1 
       644 1 1 1 1  89 GLN QB  .  89 GLN  HB3  1 1 
       644 1 2 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       645 1 1 1 1  89 GLN QB  .  89 GLN  HB3  1 1 
       645 1 2 1 1  90 LYS H   .  90 LYS  H    1 1 
       646 1 1 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       646 1 2 1 1  90 LYS H   .  90 LYS  H    1 1 
       647 1 1 1 1  89 GLN QG  .  89 GLN  HG2  1 1 
       647 1 2 1 1  90 LYS QD  .  90 LYS  HD3  1 1 
       648 1 1 1 1  90 LYS H   .  90 LYS  H    1 1 
       648 1 2 1 1  90 LYS QD  .  90 LYS  HD3  1 1 
       649 1 1 1 1  90 LYS H   .  90 LYS  H    1 1 
       649 1 2 1 1  90 LYS QG  .  90 LYS  HG3  1 1 
       650 1 1 1 1  90 LYS H   .  90 LYS  H    1 1 
       650 1 2 1 1  91 ALA H   .  91 ALA  H    1 1 
       651 1 1 1 1  90 LYS HA  .  90 LYS  HA   1 1 
       651 1 2 1 1  90 LYS QD  .  90 LYS  HD3  1 1 
       652 1 1 1 1  90 LYS HA  .  90 LYS  HA   1 1 
       652 1 2 1 1  90 LYS QG  .  90 LYS  HG3  1 1 
       653 1 1 1 1  90 LYS HA  .  90 LYS  HA   1 1 
       653 1 2 1 1  91 ALA H   .  91 ALA  H    1 1 
       654 1 1 1 1  90 LYS HA  .  90 LYS  HA   1 1 
       654 1 2 1 1  91 ALA MB  .  91 ALA  QB   1 1 
       655 1 1 1 1  90 LYS QB  .  90 LYS  HB3  1 1 
       655 1 2 1 1  90 LYS QE  .  90 LYS  HE3  1 1 
       656 1 1 1 1  90 LYS QB  .  90 LYS  HB3  1 1 
       656 1 2 1 1  90 LYS QG  .  90 LYS  HG3  1 1 
       657 1 1 1 1  90 LYS QB  .  90 LYS  HB3  1 1 
       657 1 2 1 1  91 ALA H   .  91 ALA  H    1 1 
       658 1 1 1 1  90 LYS QB  .  90 LYS  HB3  1 1 
       658 1 2 1 1  92 LEU QD  .  92 LEU  QD2  1 1 
       659 1 1 1 1  90 LYS QD  .  90 LYS  HD2  1 1 
       659 1 2 1 1  90 LYS QG  .  90 LYS  HG3  1 1 
       660 1 1 1 1  90 LYS QD  .  90 LYS  HD2  1 1 
       660 1 2 1 1  91 ALA H   .  91 ALA  H    1 1 
       661 1 1 1 1  90 LYS QD  .  90 LYS  HD3  1 1 
       661 1 2 1 1  92 LEU QB  .  92 LEU  HB3  1 1 
       662 1 1 1 1  90 LYS QD  .  90 LYS  HD3  1 1 
       662 1 2 1 1  92 LEU QD  .  92 LEU  QD2  1 1 
       663 1 1 1 1  90 LYS QE  .  90 LYS  HE3  1 1 
       663 1 2 1 1  92 LEU QB  .  92 LEU  HB3  1 1 
       664 1 1 1 1  90 LYS QE  .  90 LYS  HE3  1 1 
       664 1 2 1 1  92 LEU QD  .  92 LEU  QD2  1 1 
       665 1 1 1 1  90 LYS QG  .  90 LYS  HG3  1 1 
       665 1 2 1 1  91 ALA H   .  91 ALA  H    1 1 
       666 1 1 1 1  90 LYS QG  .  90 LYS  HG3  1 1 
       666 1 2 1 1  92 LEU QD  .  92 LEU  QD2  1 1 
       667 1 1 1 1  91 ALA H   .  91 ALA  H    1 1 
       667 1 2 1 1  91 ALA MB  .  91 ALA  QB   1 1 
       668 1 1 1 1  91 ALA HA  .  91 ALA  HA   1 1 
       668 1 2 1 1  92 LEU H   .  92 LEU  H    1 1 
       669 1 1 1 1  91 ALA HA  .  91 ALA  HA   1 1 
       669 1 2 1 1  93 PHE H   .  93 PHE  H    1 1 
       670 1 1 1 1  91 ALA MB  .  91 ALA  QB   1 1 
       670 1 2 1 1  92 LEU H   .  92 LEU  H    1 1 
       671 1 1 1 1  91 ALA MB  .  91 ALA  QB   1 1 
       671 1 2 1 1  95 VAL H   .  95 VAL  H    1 1 
       672 1 1 1 1  92 LEU H   .  92 LEU  H    1 1 
       672 1 2 1 1  92 LEU QB  .  92 LEU  HB3  1 1 
       673 1 1 1 1  92 LEU H   .  92 LEU  H    1 1 
       673 1 2 1 1  92 LEU QD  .  92 LEU  QD1  1 1 
       674 1 1 1 1  92 LEU H   .  92 LEU  H    1 1 
       674 1 2 1 1  92 LEU HG  .  92 LEU  HG   1 1 
       675 1 1 1 1  92 LEU H   .  92 LEU  H    1 1 
       675 1 2 1 1  93 PHE H   .  93 PHE  H    1 1 
       676 1 1 1 1  92 LEU HA  .  92 LEU  HA   1 1 
       676 1 2 1 1  92 LEU QD  .  92 LEU  QD1  1 1 
       677 1 1 1 1  92 LEU HA  .  92 LEU  HA   1 1 
       677 1 2 1 1  93 PHE H   .  93 PHE  H    1 1 
       678 1 1 1 1  92 LEU QB  .  92 LEU  HB3  1 1 
       678 1 2 1 1  92 LEU QD  .  92 LEU  QD1  1 1 
       679 1 1 1 1  92 LEU QB  .  92 LEU  HB3  1 1 
       679 1 2 1 1  93 PHE H   .  93 PHE  H    1 1 
       680 1 1 1 1  92 LEU MD1 .  92 LEU  QD1  1 1 
       680 1 2 1 1  92 LEU MD2 .  92 LEU  QD2  1 1 
       681 1 1 1 1  92 LEU QD  .  92 LEU  QD1  1 1 
       681 1 2 1 1  92 LEU HG  .  92 LEU  HG   1 1 
       682 1 1 1 1  92 LEU QD  .  92 LEU  QD1  1 1 
       682 1 2 1 1  93 PHE H   .  93 PHE  H    1 1 
       683 1 1 1 1  92 LEU HG  .  92 LEU  HG   1 1 
       683 1 2 1 1  93 PHE H   .  93 PHE  H    1 1 
       684 1 1 1 1  93 PHE H   .  93 PHE  H    1 1 
       684 1 2 1 1  93 PHE QD  .  93 PHE  HD1  1 1 
       685 1 1 1 1  93 PHE HA  .  93 PHE  HA   1 1 
       685 1 2 1 1  93 PHE QD  .  93 PHE  HD1  1 1 
       686 1 1 1 1  93 PHE HA  .  93 PHE  HA   1 1 
       686 1 2 1 1  95 VAL H   .  95 VAL  H    1 1 
       687 1 1 1 1  94 ASN HA  .  94 ASN  HA   1 1 
       687 1 2 1 1  95 VAL H   .  95 VAL  H    1 1 
       688 1 1 1 1  94 ASN HA  .  94 ASN  HA   1 1 
       688 1 2 1 1  95 VAL QG  .  95 VAL  QG2  1 1 
       689 1 1 1 1  94 ASN QB  .  94 ASN  HB3  1 1 
       689 1 2 1 1  95 VAL H   .  95 VAL  H    1 1 
       690 1 1 1 1  95 VAL H   .  95 VAL  H    1 1 
       690 1 2 1 1  95 VAL QG  .  95 VAL  QG2  1 1 
       691 1 1 1 1  95 VAL H   .  95 VAL  H    1 1 
       691 1 2 1 1  96 GLU H   .  96 GLU  H    1 1 
       692 1 1 1 1  95 VAL HA  .  95 VAL  HA   1 1 
       692 1 2 1 1  95 VAL QG  .  95 VAL  QG2  1 1 
       693 1 1 1 1  95 VAL HA  .  95 VAL  HA   1 1 
       693 1 2 1 1  96 GLU H   .  96 GLU  H    1 1 
       694 1 1 1 1  95 VAL HB  .  95 VAL  HB   1 1 
       694 1 2 1 1  95 VAL QG  .  95 VAL  QG2  1 1 
       695 1 1 1 1  95 VAL HB  .  95 VAL  HB   1 1 
       695 1 2 1 1  96 GLU H   .  96 GLU  H    1 1 
       696 1 1 1 1  95 VAL QG  .  95 VAL  QG2  1 1 
       696 1 2 1 1  96 GLU H   .  96 GLU  H    1 1 
       697 1 1 1 1  95 VAL QG  .  95 VAL  QG2  1 1 
       697 1 2 1 1  96 GLU QG  .  96 GLU  HG3  1 1 
       698 1 1 1 1  96 GLU H   .  96 GLU  H    1 1 
       698 1 2 1 1  96 GLU QG  .  96 GLU  HG3  1 1 
       699 1 1 1 1  96 GLU H   .  96 GLU  H    1 1 
       699 1 2 1 1  97 CYS H   .  97 CYSS H    1 1 
       700 1 1 1 1  96 GLU HA  .  96 GLU  HA   1 1 
       700 1 2 1 1  96 GLU QG  .  96 GLU  HG3  1 1 
       701 1 1 1 1  96 GLU HA  .  96 GLU  HA   1 1 
       701 1 2 1 1  97 CYS H   .  97 CYSS H    1 1 
       702 1 1 1 1  96 GLU QB  .  96 GLU  HB3  1 1 
       702 1 2 1 1  96 GLU QG  .  96 GLU  HG3  1 1 
       703 1 1 1 1  96 GLU QB  .  96 GLU  HB3  1 1 
       703 1 2 1 1  97 CYS H   .  97 CYSS H    1 1 
       704 1 1 1 1  96 GLU QG  .  96 GLU  HG3  1 1 
       704 1 2 1 1  97 CYS H   .  97 CYSS H    1 1 
       705 1 1 1 1  97 CYS HA  .  97 CYSS HA   1 1 
       705 1 2 1 1  98 GLN H   .  98 GLN  H    1 1 
       706 1 1 1 1  97 CYS HA  .  97 CYSS HA   1 1 
       706 1 2 1 1  98 GLN QB  .  98 GLN  HB2  1 1 
       707 1 1 1 1  97 CYS QB  .  97 CYSS HB2  1 1 
       707 1 2 1 1  98 GLN H   .  98 GLN  H    1 1 
       708 1 1 1 1  98 GLN H   .  98 GLN  H    1 1 
       708 1 2 1 1  98 GLN QG  .  98 GLN  HG3  1 1 
       709 1 1 1 1  98 GLN HA  .  98 GLN  HA   1 1 
       709 1 2 1 1  98 GLN QG  .  98 GLN  HG3  1 1 
       710 1 1 1 1  98 GLN HA  .  98 GLN  HA   1 1 
       710 1 2 1 1  99 GLN H   .  99 GLN  H    1 1 
       711 1 1 1 1  98 GLN QB  .  98 GLN  HB3  1 1 
       711 1 2 1 1  98 GLN QG  .  98 GLN  HG3  1 1 
       712 1 1 1 1  98 GLN QB  .  98 GLN  HB2  1 1 
       712 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       713 1 1 1 1  98 GLN QB  .  98 GLN  HB3  1 1 
       713 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       714 1 1 1 1  98 GLN QE  .  98 GLN  HE21 1 1 
       714 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       715 1 1 1 1  98 GLN QG  .  98 GLN  HG3  1 1 
       715 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       716 1 1 1 1  99 GLN H   .  99 GLN  H    1 1 
       716 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       717 1 1 1 1  99 GLN H   .  99 GLN  H    1 1 
       717 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       718 1 1 1 1  99 GLN HA  .  99 GLN  HA   1 1 
       718 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       719 1 1 1 1  99 GLN HA  .  99 GLN  HA   1 1 
       719 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       720 1 1 1 1  99 GLN QB  .  99 GLN  HB3  1 1 
       720 1 2 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       721 1 1 1 1  99 GLN QB  .  99 GLN  HB3  1 1 
       721 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       722 1 1 1 1  99 GLN QB  .  99 GLN  HB3  1 1 
       722 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       723 1 1 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       723 1 2 1 1 100 THR H   . 100 THR  H    1 1 
       724 1 1 1 1  99 GLN QG  .  99 GLN  HG3  1 1 
       724 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       725 1 1 1 1 100 THR H   . 100 THR  H    1 1 
       725 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       726 1 1 1 1 100 THR H   . 100 THR  H    1 1 
       726 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       727 1 1 1 1 100 THR H   . 100 THR  H    1 1 
       727 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       728 1 1 1 1 100 THR HA  . 100 THR  HA   1 1 
       728 1 2 1 1 100 THR MG  . 100 THR  QG2  1 1 
       729 1 1 1 1 100 THR HA  . 100 THR  HA   1 1 
       729 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       730 1 1 1 1 100 THR HA  . 100 THR  HA   1 1 
       730 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       731 1 1 1 1 100 THR HB  . 100 THR  HB   1 1 
       731 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       732 1 1 1 1 100 THR MG  . 100 THR  QG2  1 1 
       732 1 2 1 1 101 VAL H   . 101 VAL  H    1 1 
       733 1 1 1 1 100 THR MG  . 100 THR  QG2  1 1 
       733 1 2 1 1 101 VAL HB  . 101 VAL  HB   1 1 
       734 1 1 1 1 101 VAL H   . 101 VAL  H    1 1 
       734 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       735 1 1 1 1 101 VAL HA  . 101 VAL  HA   1 1 
       735 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       736 1 1 1 1 101 VAL HA  . 101 VAL  HA   1 1 
       736 1 2 1 1 102 SER H   . 102 SER  H    1 1 
       737 1 1 1 1 101 VAL HB  . 101 VAL  HB   1 1 
       737 1 2 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       738 1 1 1 1 101 VAL HB  . 101 VAL  HB   1 1 
       738 1 2 1 1 102 SER H   . 102 SER  H    1 1 
       739 1 1 1 1 101 VAL HB  . 101 VAL  HB   1 1 
       739 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       740 1 1 1 1 101 VAL MG1 . 101 VAL  QG1  1 1 
       740 1 2 1 1 101 VAL MG2 . 101 VAL  QG2  1 1 
       741 1 1 1 1 101 VAL QG  . 101 VAL  QG1  1 1 
       741 1 2 1 1 102 SER H   . 102 SER  H    1 1 
       742 1 1 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       742 1 2 1 1 102 SER HA  . 102 SER  HA   1 1 
       743 1 1 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       743 1 2 1 1 102 SER QB  . 102 SER  HB3  1 1 
       744 1 1 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       744 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       745 1 1 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       745 1 2 1 1 103 VAL HB  . 103 VAL  HB   1 1 
       746 1 1 1 1 101 VAL QG  . 101 VAL  QG2  1 1 
       746 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       747 1 1 1 1 102 SER H   . 102 SER  H    1 1 
       747 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       748 1 1 1 1 102 SER HA  . 102 SER  HA   1 1 
       748 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       749 1 1 1 1 102 SER HA  . 102 SER  HA   1 1 
       749 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       750 1 1 1 1 102 SER QB  . 102 SER  HB3  1 1 
       750 1 2 1 1 103 VAL H   . 103 VAL  H    1 1 
       751 1 1 1 1 103 VAL H   . 103 VAL  H    1 1 
       751 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       752 1 1 1 1 103 VAL H   . 103 VAL  H    1 1 
       752 1 2 1 1 104 THR H   . 104 THR  H    1 1 
       753 1 1 1 1 103 VAL HA  . 103 VAL  HA   1 1 
       753 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       754 1 1 1 1 103 VAL HA  . 103 VAL  HA   1 1 
       754 1 2 1 1 104 THR H   . 104 THR  H    1 1 
       755 1 1 1 1 103 VAL HB  . 103 VAL  HB   1 1 
       755 1 2 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       756 1 1 1 1 103 VAL HB  . 103 VAL  HB   1 1 
       756 1 2 1 1 104 THR H   . 104 THR  H    1 1 
       757 1 1 1 1 103 VAL MG1 . 103 VAL  QG1  1 1 
       757 1 2 1 1 103 VAL MG2 . 103 VAL  QG2  1 1 
       758 1 1 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       758 1 2 1 1 104 THR H   . 104 THR  H    1 1 
       759 1 1 1 1 103 VAL QG  . 103 VAL  QG1  1 1 
       759 1 2 1 1 104 THR HA  . 104 THR  HA   1 1 
       760 1 1 1 1 104 THR H   . 104 THR  H    1 1 
       760 1 2 1 1 104 THR MG  . 104 THR  QG2  1 1 
       761 1 1 1 1 104 THR H   . 104 THR  H    1 1 
       761 1 2 1 1 105 LYS H   . 105 LYS  H    1 1 
       762 1 1 1 1 104 THR HA  . 104 THR  HA   1 1 
       762 1 2 1 1 104 THR MG  . 104 THR  QG2  1 1 
       763 1 1 1 1 104 THR HA  . 104 THR  HA   1 1 
       763 1 2 1 1 105 LYS H   . 105 LYS  H    1 1 
       764 1 1 1 1 104 THR HB  . 104 THR  HB   1 1 
       764 1 2 1 1 105 LYS H   . 105 LYS  H    1 1 
       765 1 1 1 1 104 THR MG  . 104 THR  QG2  1 1 
       765 1 2 1 1 105 LYS H   . 105 LYS  H    1 1 
       766 1 1 1 1 104 THR MG  . 104 THR  QG2  1 1 
       766 1 2 1 1 105 LYS QB  . 105 LYS  HB3  1 1 
       767 1 1 1 1 105 LYS H   . 105 LYS  H    1 1 
       767 1 2 1 1 105 LYS QG  . 105 LYS  HG3  1 1 
       768 1 1 1 1 105 LYS HA  . 105 LYS  HA   1 1 
       768 1 2 1 1 105 LYS QD  . 105 LYS  HD3  1 1 
       769 1 1 1 1 105 LYS HA  . 105 LYS  HA   1 1 
       769 1 2 1 1 106 PRO QB  . 106 PRO  HB2  1 1 
       770 1 1 1 1 105 LYS HA  . 105 LYS  HA   1 1 
       770 1 2 1 1 106 PRO QD  . 106 PRO  HD3  1 1 
       771 1 1 1 1 105 LYS HA  . 105 LYS  HA   1 1 
       771 1 2 1 1 106 PRO QG  . 106 PRO  HG3  1 1 
       772 1 1 1 1 105 LYS QB  . 105 LYS  HB3  1 1 
       772 1 2 1 1 105 LYS QD  . 105 LYS  HD3  1 1 
       773 1 1 1 1 105 LYS QB  . 105 LYS  HB2  1 1 
       773 1 2 1 1 105 LYS QE  . 105 LYS  HE2  1 1 
       774 1 1 1 1 105 LYS QB  . 105 LYS  HB3  1 1 
       774 1 2 1 1 105 LYS QG  . 105 LYS  HG3  1 1 
       775 1 1 1 1 105 LYS QB  . 105 LYS  HB3  1 1 
       775 1 2 1 1 106 PRO QD  . 106 PRO  HD3  1 1 
       776 1 1 1 1 105 LYS QD  . 105 LYS  HD3  1 1 
       776 1 2 1 1 105 LYS QE  . 105 LYS  HE3  1 1 
       777 1 1 1 1 105 LYS QD  . 105 LYS  HD3  1 1 
       777 1 2 1 1 105 LYS QG  . 105 LYS  HG3  1 1 
       778 1 1 1 1 105 LYS QE  . 105 LYS  HE3  1 1 
       778 1 2 1 1 105 LYS QG  . 105 LYS  HG3  1 1 
       779 1 1 1 1 105 LYS QE  . 105 LYS  HE3  1 1 
       779 1 2 1 1 106 PRO QD  . 106 PRO  HD2  1 1 
       780 1 1 1 1 105 LYS QG  . 105 LYS  HG3  1 1 
       780 1 2 1 1 106 PRO QD  . 106 PRO  HD3  1 1 
       781 1 1 1 1 106 PRO HA  . 106 PRO  HA   1 1 
       781 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       782 1 1 1 1 106 PRO QB  . 106 PRO  HB3  1 1 
       782 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       783 1 1 1 1 106 PRO QD  . 106 PRO  HD3  1 1 
       783 1 2 1 1 106 PRO QG  . 106 PRO  HG3  1 1 
       784 1 1 1 1 106 PRO QD  . 106 PRO  HD3  1 1 
       784 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       785 1 1 1 1 106 PRO QG  . 106 PRO  HG3  1 1 
       785 1 2 1 1 107 CYS H   . 107 CYSS H    1 1 
       786 1 1 1 1 107 CYS HA  . 107 CYSS HA   1 1 
       786 1 2 1 1 108 THR H   . 108 THR  H    1 1 
       787 1 1 1 1 108 THR HA  . 108 THR  HA   1 1 
       787 1 2 1 1 108 THR MG  . 108 THR  QG2  1 1 
       788 1 1 1 1 108 THR HA  . 108 THR  HA   1 1 
       788 1 2 1 1 109 THR H   . 109 THR  H    1 1 
       789 1 1 1 1 108 THR HB  . 108 THR  HB   1 1 
       789 1 2 1 1 109 THR H   . 109 THR  H    1 1 
       790 1 1 1 1 109 THR H   . 109 THR  H    1 1 
       790 1 2 1 1 109 THR MG  . 109 THR  QG2  1 1 
       791 1 1 1 1 109 THR HA  . 109 THR  HA   1 1 
       791 1 2 1 1 109 THR MG  . 109 THR  QG2  1 1 
       792 1 1 1 1 109 THR HA  . 109 THR  HA   1 1 
       792 1 2 1 1 110 LYS H   . 110 LYS  H    1 1 
       793 1 1 1 1 109 THR HA  . 109 THR  HA   1 1 
       793 1 2 1 1 110 LYS QE  . 110 LYS  HE3  1 1 
       794 1 1 1 1 109 THR HB  . 109 THR  HB   1 1 
       794 1 2 1 1 110 LYS H   . 110 LYS  H    1 1 
       795 1 1 1 1 109 THR MG  . 109 THR  QG2  1 1 
       795 1 2 1 1 110 LYS H   . 110 LYS  H    1 1 
       796 1 1 1 1 110 LYS H   . 110 LYS  H    1 1 
       796 1 2 1 1 110 LYS QG  . 110 LYS  HG3  1 1 
       797 1 1 1 1 110 LYS HA  . 110 LYS  HA   1 1 
       797 1 2 1 1 111 VAL H   . 111 VAL  H    1 1 
       798 1 1 1 1 110 LYS QB  . 110 LYS  HB3  1 1 
       798 1 2 1 1 111 VAL H   . 111 VAL  H    1 1 
       799 1 1 1 1 110 LYS QD  . 110 LYS  HD3  1 1 
       799 1 2 1 1 111 VAL H   . 111 VAL  H    1 1 
       800 1 1 1 1 110 LYS QG  . 110 LYS  HG3  1 1 
       800 1 2 1 1 111 VAL H   . 111 VAL  H    1 1 
       801 1 1 1 1 110 LYS QG  . 110 LYS  HG3  1 1 
       801 1 2 1 1 111 VAL HB  . 111 VAL  HB   1 1 
       802 1 1 1 1 111 VAL H   . 111 VAL  H    1 1 
       802 1 2 1 1 111 VAL QG  . 111 VAL  QG1  1 1 
       803 1 1 1 1 111 VAL HA  . 111 VAL  HA   1 1 
       803 1 2 1 1 111 VAL QG  . 111 VAL  QG2  1 1 
       804 1 1 1 1 111 VAL HA  . 111 VAL  HA   1 1 
       804 1 2 1 1 112 LYS H   . 112 LYS  H    1 1 
       805 1 1 1 1 111 VAL HB  . 111 VAL  HB   1 1 
       805 1 2 1 1 111 VAL QG  . 111 VAL  QG2  1 1 
       806 1 1 1 1 111 VAL HB  . 111 VAL  HB   1 1 
       806 1 2 1 1 112 LYS H   . 112 LYS  H    1 1 
       807 1 1 1 1 111 VAL QG  . 111 VAL  QG2  1 1 
       807 1 2 1 1 112 LYS H   . 112 LYS  H    1 1 
       808 1 1 1 1 112 LYS H   . 112 LYS  H    1 1 
       808 1 2 1 1 112 LYS QE  . 112 LYS  HE3  1 1 
       809 1 1 1 1 112 LYS H   . 112 LYS  H    1 1 
       809 1 2 1 1 112 LYS QG  . 112 LYS  HG3  1 1 
       810 1 1 1 1 113 ASN HA  . 113 ASN  HA   1 1 
       810 1 2 1 1 114 LYS H   . 114 LYS  H    1 1 
       811 1 1 1 1 113 ASN QB  . 113 ASN  HB3  1 1 
       811 1 2 1 1 114 LYS H   . 114 LYS  H    1 1 
       812 1 1 1 1 114 LYS H   . 114 LYS  H    1 1 
       812 1 2 1 1 114 LYS QG  . 114 LYS  HG3  1 1 
       813 1 1 1 1 114 LYS HA  . 114 LYS  HA   1 1 
       813 1 2 1 1 115 PRO QD  . 115 PRO  HD3  1 1 
       814 1 1 1 1 114 LYS QB  . 114 LYS  HB3  1 1 
       814 1 2 1 1 115 PRO QD  . 115 PRO  HD3  1 1 
       815 1 1 1 1 115 PRO HA  . 115 PRO  HA   1 1 
       815 1 2 1 1 116 LYS H   . 116 LYS  H    1 1 
       816 1 1 1 1 115 PRO QB  . 115 PRO  HB3  1 1 
       816 1 2 1 1 116 LYS H   . 116 LYS  H    1 1 
       817 1 1 1 1 115 PRO QB  . 115 PRO  HB3  1 1 
       817 1 2 1 1 116 LYS HA  . 116 LYS  HA   1 1 
       818 1 1 1 1 115 PRO QD  . 115 PRO  HD3  1 1 
       818 1 2 1 1 115 PRO QG  . 115 PRO  HG3  1 1 
       819 1 1 1 1 115 PRO QD  . 115 PRO  HD3  1 1 
       819 1 2 1 1 116 LYS QG  . 116 LYS  HG3  1 1 
       820 1 1 1 1 116 LYS H   . 116 LYS  H    1 1 
       820 1 2 1 1 116 LYS QG  . 116 LYS  HG3  1 1 
       821 1 1 1 1 116 LYS HA  . 116 LYS  HA   1 1 
       821 1 2 1 1 117 GLY H   . 117 GLY  H    1 1 
       822 1 1 1 1 117 GLY QA  . 117 GLY  HA2  1 1 
       822 1 2 1 1 118 LYS H   . 118 LYS  H    1 1 
       823 1 1 1 1 118 LYS H   . 118 LYS  H    1 1 
       823 1 2 1 1 121 LYS H   . 121 LYS  H    1 1 
       824 1 1 1 1 118 LYS HA  . 118 LYS  HA   1 1 
       824 1 2 1 1 119 LYS H   . 119 LYS  H    1 1 
       825 1 1 1 1 119 LYS HA  . 119 LYS  HA   1 1 
       825 1 2 1 1 120 GLY H   . 120 GLY  H    1 1 
       826 1 1 1 1 120 GLY QA  . 120 GLY  HA3  1 1 
       826 1 2 1 1 121 LYS H   . 121 LYS  H    1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . . . 1.8 1 1 
         2 1 . . . . . . . 1.8 1 1 
         3 1 . . . . . . . 1.8 1 1 
         4 1 . . . . . . . 1.8 1 1 
         5 1 . . . . . . . 1.8 1 1 
         6 1 . . . . . . . 1.8 1 1 
         7 1 . . . . . . . 1.8 1 1 
         8 1 . . . . . . . 1.8 1 1 
         9 1 . . . . . . . 1.8 1 1 
        10 1 . . . . . . . 1.8 1 1 
        11 1 . . . . . . . 1.8 1 1 
        12 1 . . . . . . . 1.8 1 1 
        13 1 . . . . . . . 1.8 1 1 
        14 1 . . . . . . . 1.8 1 1 
        15 1 . . . . . . . 1.8 1 1 
        16 1 . . . . . . . 1.8 1 1 
        17 1 . . . . . . . 1.8 1 1 
        18 1 . . . . . . . 1.8 1 1 
        19 1 . . . . . . . 1.8 1 1 
        20 1 . . . . . . . 1.8 1 1 
        21 1 . . . . . . . 1.8 1 1 
        22 1 . . . . . . . 1.8 1 1 
        23 1 . . . . . . . 1.8 1 1 
        24 1 . . . . . . . 1.8 1 1 
        25 1 . . . . . . . 1.8 1 1 
        26 1 . . . . . . . 1.8 1 1 
        27 1 . . . . . . . 1.8 1 1 
        28 1 . . . . . . . 1.8 1 1 
        29 1 . . . . . . . 1.8 1 1 
        30 1 . . . . . . . 1.8 1 1 
        31 1 . . . . . . . 1.8 1 1 
        32 1 . . . . . . . 1.8 1 1 
        33 1 . . . . . . . 1.8 1 1 
        34 1 . . . . . . . 1.8 1 1 
        35 1 . . . . . . . 1.8 1 1 
        36 1 . . . . . . . 1.8 1 1 
        37 1 . . . . . . . 1.8 1 1 
        38 1 . . . . . . . 1.8 1 1 
        39 1 . . . . . . . 1.8 1 1 
        40 1 . . . . . . . 1.8 1 1 
        41 1 . . . . . . . 1.8 1 1 
        42 1 . . . . . . . 1.8 1 1 
        43 1 . . . . . . . 1.8 1 1 
        44 1 . . . . . . . 1.8 1 1 
        45 1 . . . . . . . 1.8 1 1 
        46 1 . . . . . . . 1.8 1 1 
        47 1 . . . . . . . 1.8 1 1 
        48 1 . . . . . . . 1.8 1 1 
        49 1 . . . . . . . 1.8 1 1 
        50 1 . . . . . . . 1.8 1 1 
        51 1 . . . . . . . 1.8 1 1 
        52 1 . . . . . . . 1.8 1 1 
        53 1 . . . . . . . 1.8 1 1 
        54 1 . . . . . . . 1.8 1 1 
        55 1 . . . . . . . 1.8 1 1 
        56 1 . . . . . . . 1.8 1 1 
        57 1 . . . . . . . 1.8 1 1 
        58 1 . . . . . . . 1.8 1 1 
        59 1 . . . . . . . 1.8 1 1 
        60 1 . . . . . . . 1.8 1 1 
        61 1 . . . . . . . 1.8 1 1 
        62 1 . . . . . . . 1.8 1 1 
        63 1 . . . . . . . 1.8 1 1 
        64 1 . . . . . . . 1.8 1 1 
        65 1 . . . . . . . 1.8 1 1 
        66 1 . . . . . . . 1.8 1 1 
        67 1 . . . . . . . 1.8 1 1 
        68 1 . . . . . . . 1.8 1 1 
        69 1 . . . . . . . 1.8 1 1 
        70 1 . . . . . . . 1.8 1 1 
        71 1 . . . . . . . 1.8 1 1 
        72 1 . . . . . . . 1.8 1 1 
        73 1 . . . . . . . 1.8 1 1 
        74 1 . . . . . . . 1.8 1 1 
        75 1 . . . . . . . 1.8 1 1 
        76 1 . . . . . . . 1.8 1 1 
        77 1 . . . . . . . 1.8 1 1 
        78 1 . . . . . . . 1.8 1 1 
        79 1 . . . . . . . 1.8 1 1 
        80 1 . . . . . . . 1.8 1 1 
        81 1 . . . . . . . 1.8 1 1 
        82 1 . . . . . . . 1.8 1 1 
        83 1 . . . . . . . 1.8 1 1 
        84 1 . . . . . . . 1.8 1 1 
        85 1 . . . . . . . 1.8 1 1 
        86 1 . . . . . . . 1.8 1 1 
        87 1 . . . . . . . 1.8 1 1 
        88 1 . . . . . . . 1.8 1 1 
        89 1 . . . . . . . 1.8 1 1 
        90 1 . . . . . . . 1.8 1 1 
        91 1 . . . . . . . 1.8 1 1 
        92 1 . . . . . . . 1.8 1 1 
        93 1 . . . . . . . 1.8 1 1 
        94 1 . . . . . . . 1.8 1 1 
        95 1 . . . . . . . 1.8 1 1 
        96 1 . . . . . . . 1.8 1 1 
        97 1 . . . . . . . 1.8 1 1 
        98 1 . . . . . . . 1.8 1 1 
        99 1 . . . . . . . 1.8 1 1 
       100 1 . . . . . . . 1.8 1 1 
       101 1 . . . . . . . 1.8 1 1 
       102 1 . . . . . . . 1.8 1 1 
       103 1 . . . . . . . 1.8 1 1 
       104 1 . . . . . . . 1.8 1 1 
       105 1 . . . . . . . 1.8 1 1 
       106 1 . . . . . . . 1.8 1 1 
       107 1 . . . . . . . 1.8 1 1 
       108 1 . . . . . . . 1.8 1 1 
       109 1 . . . . . . . 1.8 1 1 
       110 1 . . . . . . . 1.8 1 1 
       111 1 . . . . . . . 1.8 1 1 
       112 1 . . . . . . . 1.8 1 1 
       113 1 . . . . . . . 1.8 1 1 
       114 1 . . . . . . . 1.8 1 1 
       115 1 . . . . . . . 1.8 1 1 
       116 1 . . . . . . . 1.8 1 1 
       117 1 . . . . . . . 1.8 1 1 
       118 1 . . . . . . . 1.8 1 1 
       119 1 . . . . . . . 1.8 1 1 
       120 1 . . . . . . . 1.8 1 1 
       121 1 . . . . . . . 1.8 1 1 
       122 1 . . . . . . . 1.8 1 1 
       123 1 . . . . . . . 1.8 1 1 
       124 1 . . . . . . . 1.8 1 1 
       125 1 . . . . . . . 1.8 1 1 
       126 1 . . . . . . . 1.8 1 1 
       127 1 . . . . . . . 1.8 1 1 
       128 1 . . . . . . . 1.8 1 1 
       129 1 . . . . . . . 1.8 1 1 
       130 1 . . . . . . . 1.8 1 1 
       131 1 . . . . . . . 1.8 1 1 
       132 1 . . . . . . . 1.8 1 1 
       133 1 . . . . . . . 1.8 1 1 
       134 1 . . . . . . . 1.8 1 1 
       135 1 . . . . . . . 1.8 1 1 
       136 1 . . . . . . . 1.8 1 1 
       137 1 . . . . . . . 1.8 1 1 
       138 1 . . . . . . . 1.8 1 1 
       139 1 . . . . . . . 1.8 1 1 
       140 1 . . . . . . . 1.8 1 1 
       141 1 . . . . . . . 1.8 1 1 
       142 1 . . . . . . . 1.8 1 1 
       143 1 . . . . . . . 1.8 1 1 
       144 1 . . . . . . . 1.8 1 1 
       145 1 . . . . . . . 1.8 1 1 
       146 1 . . . . . . . 1.8 1 1 
       147 1 . . . . . . . 1.8 1 1 
       148 1 . . . . . . . 1.8 1 1 
       149 1 . . . . . . . 1.8 1 1 
       150 1 . . . . . . . 1.8 1 1 
       151 1 . . . . . . . 1.8 1 1 
       152 1 . . . . . . . 1.8 1 1 
       153 1 . . . . . . . 1.8 1 1 
       154 1 . . . . . . . 1.8 1 1 
       155 1 . . . . . . . 1.8 1 1 
       156 1 . . . . . . . 1.8 1 1 
       157 1 . . . . . . . 1.8 1 1 
       158 1 . . . . . . . 1.8 1 1 
       159 1 . . . . . . . 1.8 1 1 
       160 1 . . . . . . . 1.8 1 1 
       161 1 . . . . . . . 1.8 1 1 
       162 1 . . . . . . . 1.8 1 1 
       163 1 . . . . . . . 1.8 1 1 
       164 1 . . . . . . . 1.8 1 1 
       165 1 . . . . . . . 1.8 1 1 
       166 1 . . . . . . . 1.8 1 1 
       167 1 . . . . . . . 1.8 1 1 
       168 1 . . . . . . . 1.8 1 1 
       169 1 . . . . . . . 1.8 1 1 
       170 1 . . . . . . . 1.8 1 1 
       171 1 . . . . . . . 1.8 1 1 
       172 1 . . . . . . . 1.8 1 1 
       173 1 . . . . . . . 1.8 1 1 
       174 1 . . . . . . . 1.8 1 1 
       175 1 . . . . . . . 1.8 1 1 
       176 1 . . . . . . . 1.8 1 1 
       177 1 . . . . . . . 1.8 1 1 
       178 1 . . . . . . . 1.8 1 1 
       179 1 . . . . . . . 1.8 1 1 
       180 1 . . . . . . . 1.8 1 1 
       181 1 . . . . . . . 1.8 1 1 
       182 1 . . . . . . . 1.8 1 1 
       183 1 . . . . . . . 1.8 1 1 
       184 1 . . . . . . . 1.8 1 1 
       185 1 . . . . . . . 1.8 1 1 
       186 1 . . . . . . . 1.8 1 1 
       187 1 . . . . . . . 1.8 1 1 
       188 1 . . . . . . . 1.8 1 1 
       189 1 . . . . . . . 1.8 1 1 
       190 1 . . . . . . . 1.8 1 1 
       191 1 . . . . . . . 1.8 1 1 
       192 1 . . . . . . . 1.8 1 1 
       193 1 . . . . . . . 1.8 1 1 
       194 1 . . . . . . . 1.8 1 1 
       195 1 . . . . . . . 1.8 1 1 
       196 1 . . . . . . . 1.8 1 1 
       197 1 . . . . . . . 1.8 1 1 
       198 1 . . . . . . . 1.8 1 1 
       199 1 . . . . . . . 1.8 1 1 
       200 1 . . . . . . . 1.8 1 1 
       201 1 . . . . . . . 1.8 1 1 
       202 1 . . . . . . . 1.8 1 1 
       203 1 . . . . . . . 1.8 1 1 
       204 1 . . . . . . . 1.8 1 1 
       205 1 . . . . . . . 1.8 1 1 
       206 1 . . . . . . . 1.8 1 1 
       207 1 . . . . . . . 1.8 1 1 
       208 1 . . . . . . . 1.8 1 1 
       209 1 . . . . . . . 1.8 1 1 
       210 1 . . . . . . . 1.8 1 1 
       211 1 . . . . . . . 1.8 1 1 
       212 1 . . . . . . . 1.8 1 1 
       213 1 . . . . . . . 1.8 1 1 
       214 1 . . . . . . . 1.8 1 1 
       215 1 . . . . . . . 1.8 1 1 
       216 1 . . . . . . . 1.8 1 1 
       217 1 . . . . . . . 1.8 1 1 
       218 1 . . . . . . . 1.8 1 1 
       219 1 . . . . . . . 1.8 1 1 
       220 1 . . . . . . . 1.8 1 1 
       221 1 . . . . . . . 1.8 1 1 
       222 1 . . . . . . . 1.8 1 1 
       223 1 . . . . . . . 1.8 1 1 
       224 1 . . . . . . . 1.8 1 1 
       225 1 . . . . . . . 1.8 1 1 
       226 1 . . . . . . . 1.8 1 1 
       227 1 . . . . . . . 1.8 1 1 
       228 1 . . . . . . . 1.8 1 1 
       229 1 . . . . . . . 1.8 1 1 
       230 1 . . . . . . . 1.8 1 1 
       231 1 . . . . . . . 1.8 1 1 
       232 1 . . . . . . . 1.8 1 1 
       233 1 . . . . . . . 1.8 1 1 
       234 1 . . . . . . . 1.8 1 1 
       235 1 . . . . . . . 1.8 1 1 
       236 1 . . . . . . . 1.8 1 1 
       237 1 . . . . . . . 1.8 1 1 
       238 1 . . . . . . . 1.8 1 1 
       239 1 . . . . . . . 1.8 1 1 
       240 1 . . . . . . . 1.8 1 1 
       241 1 . . . . . . . 1.8 1 1 
       242 1 . . . . . . . 1.8 1 1 
       243 1 . . . . . . . 1.8 1 1 
       244 1 . . . . . . . 1.8 1 1 
       245 1 . . . . . . . 1.8 1 1 
       246 1 . . . . . . . 1.8 1 1 
       247 1 . . . . . . . 1.8 1 1 
       248 1 . . . . . . . 1.8 1 1 
       249 1 . . . . . . . 1.8 1 1 
       250 1 . . . . . . . 1.8 1 1 
       251 1 . . . . . . . 1.8 1 1 
       252 1 . . . . . . . 1.8 1 1 
       253 1 . . . . . . . 1.8 1 1 
       254 1 . . . . . . . 1.8 1 1 
       255 1 . . . . . . . 1.8 1 1 
       256 1 . . . . . . . 1.8 1 1 
       257 1 . . . . . . . 1.8 1 1 
       258 1 . . . . . . . 1.8 1 1 
       259 1 . . . . . . . 1.8 1 1 
       260 1 . . . . . . . 1.8 1 1 
       261 1 . . . . . . . 1.8 1 1 
       262 1 . . . . . . . 1.8 1 1 
       263 1 . . . . . . . 1.8 1 1 
       264 1 . . . . . . . 1.8 1 1 
       265 1 . . . . . . . 1.8 1 1 
       266 1 . . . . . . . 1.8 1 1 
       267 1 . . . . . . . 1.8 1 1 
       268 1 . . . . . . . 1.8 1 1 
       269 1 . . . . . . . 1.8 1 1 
       270 1 . . . . . . . 1.8 1 1 
       271 1 . . . . . . . 1.8 1 1 
       272 1 . . . . . . . 1.8 1 1 
       273 1 . . . . . . . 1.8 1 1 
       274 1 . . . . . . . 1.8 1 1 
       275 1 . . . . . . . 1.8 1 1 
       276 1 . . . . . . . 1.8 1 1 
       277 1 . . . . . . . 1.8 1 1 
       278 1 . . . . . . . 1.8 1 1 
       279 1 . . . . . . . 1.8 1 1 
       280 1 . . . . . . . 1.8 1 1 
       281 1 . . . . . . . 1.8 1 1 
       282 1 . . . . . . . 1.8 1 1 
       283 1 . . . . . . . 1.8 1 1 
       284 1 . . . . . . . 1.8 1 1 
       285 1 . . . . . . . 1.8 1 1 
       286 1 . . . . . . . 1.8 1 1 
       287 1 . . . . . . . 1.8 1 1 
       288 1 . . . . . . . 1.8 1 1 
       289 1 . . . . . . . 1.8 1 1 
       290 1 . . . . . . . 1.8 1 1 
       291 1 . . . . . . . 1.8 1 1 
       292 1 . . . . . . . 1.8 1 1 
       293 1 . . . . . . . 1.8 1 1 
       294 1 . . . . . . . 1.8 1 1 
       295 1 . . . . . . . 1.8 1 1 
       296 1 . . . . . . . 1.8 1 1 
       297 1 . . . . . . . 1.8 1 1 
       298 1 . . . . . . . 1.8 1 1 
       299 1 . . . . . . . 1.8 1 1 
       300 1 . . . . . . . 1.8 1 1 
       301 1 . . . . . . . 1.8 1 1 
       302 1 . . . . . . . 1.8 1 1 
       303 1 . . . . . . . 1.8 1 1 
       304 1 . . . . . . . 1.8 1 1 
       305 1 . . . . . . . 1.8 1 1 
       306 1 . . . . . . . 1.8 1 1 
       307 1 . . . . . . . 1.8 1 1 
       308 1 . . . . . . . 1.8 1 1 
       309 1 . . . . . . . 1.8 1 1 
       310 1 . . . . . . . 1.8 1 1 
       311 1 . . . . . . . 1.8 1 1 
       312 1 . . . . . . . 1.8 1 1 
       313 1 . . . . . . . 1.8 1 1 
       314 1 . . . . . . . 1.8 1 1 
       315 1 . . . . . . . 1.8 1 1 
       316 1 . . . . . . . 1.8 1 1 
       317 1 . . . . . . . 1.8 1 1 
       318 1 . . . . . . . 1.8 1 1 
       319 1 . . . . . . . 1.8 1 1 
       320 1 . . . . . . . 1.8 1 1 
       321 1 . . . . . . . 1.8 1 1 
       322 1 . . . . . . . 1.8 1 1 
       323 1 . . . . . . . 1.8 1 1 
       324 1 . . . . . . . 1.8 1 1 
       325 1 . . . . . . . 1.8 1 1 
       326 1 . . . . . . . 1.8 1 1 
       327 1 . . . . . . . 1.8 1 1 
       328 1 . . . . . . . 1.8 1 1 
       329 1 . . . . . . . 1.8 1 1 
       330 1 . . . . . . . 1.8 1 1 
       331 1 . . . . . . . 1.8 1 1 
       332 1 . . . . . . . 1.8 1 1 
       333 1 . . . . . . . 1.8 1 1 
       334 1 . . . . . . . 1.8 1 1 
       335 1 . . . . . . . 1.8 1 1 
       336 1 . . . . . . . 1.8 1 1 
       337 1 . . . . . . . 1.8 1 1 
       338 1 . . . . . . . 1.8 1 1 
       339 1 . . . . . . . 1.8 1 1 
       340 1 . . . . . . . 1.8 1 1 
       341 1 . . . . . . . 1.8 1 1 
       342 1 . . . . . . . 1.8 1 1 
       343 1 . . . . . . . 1.8 1 1 
       344 1 . . . . . . . 1.8 1 1 
       345 1 . . . . . . . 1.8 1 1 
       346 1 . . . . . . . 1.8 1 1 
       347 1 . . . . . . . 1.8 1 1 
       348 1 . . . . . . . 1.8 1 1 
       349 1 . . . . . . . 1.8 1 1 
       350 1 . . . . . . . 1.8 1 1 
       351 1 . . . . . . . 1.8 1 1 
       352 1 . . . . . . . 1.8 1 1 
       353 1 . . . . . . . 1.8 1 1 
       354 1 . . . . . . . 1.8 1 1 
       355 1 . . . . . . . 1.8 1 1 
       356 1 . . . . . . . 1.8 1 1 
       357 1 . . . . . . . 1.8 1 1 
       358 1 . . . . . . . 1.8 1 1 
       359 1 . . . . . . . 1.8 1 1 
       360 1 . . . . . . . 1.8 1 1 
       361 1 . . . . . . . 1.8 1 1 
       362 1 . . . . . . . 1.8 1 1 
       363 1 . . . . . . . 1.8 1 1 
       364 1 . . . . . . . 1.8 1 1 
       365 1 . . . . . . . 1.8 1 1 
       366 1 . . . . . . . 1.8 1 1 
       367 1 . . . . . . . 1.8 1 1 
       368 1 . . . . . . . 1.8 1 1 
       369 1 . . . . . . . 1.8 1 1 
       370 1 . . . . . . . 1.8 1 1 
       371 1 . . . . . . . 1.8 1 1 
       372 1 . . . . . . . 1.8 1 1 
       373 1 . . . . . . . 1.8 1 1 
       374 1 . . . . . . . 1.8 1 1 
       375 1 . . . . . . . 1.8 1 1 
       376 1 . . . . . . . 1.8 1 1 
       377 1 . . . . . . . 1.8 1 1 
       378 1 . . . . . . . 1.8 1 1 
       379 1 . . . . . . . 1.8 1 1 
       380 1 . . . . . . . 1.8 1 1 
       381 1 . . . . . . . 1.8 1 1 
       382 1 . . . . . . . 1.8 1 1 
       383 1 . . . . . . . 1.8 1 1 
       384 1 . . . . . . . 1.8 1 1 
       385 1 . . . . . . . 1.8 1 1 
       386 1 . . . . . . . 1.8 1 1 
       387 1 . . . . . . . 1.8 1 1 
       388 1 . . . . . . . 1.8 1 1 
       389 1 . . . . . . . 1.8 1 1 
       390 1 . . . . . . . 1.8 1 1 
       391 1 . . . . . . . 1.8 1 1 
       392 1 . . . . . . . 1.8 1 1 
       393 1 . . . . . . . 1.8 1 1 
       394 1 . . . . . . . 1.8 1 1 
       395 1 . . . . . . . 1.8 1 1 
       396 1 . . . . . . . 1.8 1 1 
       397 1 . . . . . . . 1.8 1 1 
       398 1 . . . . . . . 1.8 1 1 
       399 1 . . . . . . . 1.8 1 1 
       400 1 . . . . . . . 1.8 1 1 
       401 1 . . . . . . . 1.8 1 1 
       402 1 . . . . . . . 1.8 1 1 
       403 1 . . . . . . . 1.8 1 1 
       404 1 . . . . . . . 1.8 1 1 
       405 1 . . . . . . . 1.8 1 1 
       406 1 . . . . . . . 1.8 1 1 
       407 1 . . . . . . . 1.8 1 1 
       408 1 . . . . . . . 1.8 1 1 
       409 1 . . . . . . . 1.8 1 1 
       410 1 . . . . . . . 1.8 1 1 
       411 1 . . . . . . . 1.8 1 1 
       412 1 . . . . . . . 1.8 1 1 
       413 1 . . . . . . . 1.8 1 1 
       414 1 . . . . . . . 1.8 1 1 
       415 1 . . . . . . . 1.8 1 1 
       416 1 . . . . . . . 1.8 1 1 
       417 1 . . . . . . . 1.8 1 1 
       418 1 . . . . . . . 1.8 1 1 
       419 1 . . . . . . . 1.8 1 1 
       420 1 . . . . . . . 1.8 1 1 
       421 1 . . . . . . . 1.8 1 1 
       422 1 . . . . . . . 1.8 1 1 
       423 1 . . . . . . . 1.8 1 1 
       424 1 . . . . . . . 1.8 1 1 
       425 1 . . . . . . . 1.8 1 1 
       426 1 . . . . . . . 1.8 1 1 
       427 1 . . . . . . . 1.8 1 1 
       428 1 . . . . . . . 1.8 1 1 
       429 1 . . . . . . . 1.8 1 1 
       430 1 . . . . . . . 1.8 1 1 
       431 1 . . . . . . . 1.8 1 1 
       432 1 . . . . . . . 1.8 1 1 
       433 1 . . . . . . . 1.8 1 1 
       434 1 . . . . . . . 1.8 1 1 
       435 1 . . . . . . . 1.8 1 1 
       436 1 . . . . . . . 1.8 1 1 
       437 1 . . . . . . . 1.8 1 1 
       438 1 . . . . . . . 1.8 1 1 
       439 1 . . . . . . . 1.8 1 1 
       440 1 . . . . . . . 1.8 1 1 
       441 1 . . . . . . . 1.8 1 1 
       442 1 . . . . . . . 1.8 1 1 
       443 1 . . . . . . . 1.8 1 1 
       444 1 . . . . . . . 1.8 1 1 
       445 1 . . . . . . . 1.8 1 1 
       446 1 . . . . . . . 1.8 1 1 
       447 1 . . . . . . . 1.8 1 1 
       448 1 . . . . . . . 1.8 1 1 
       449 1 . . . . . . . 1.8 1 1 
       450 1 . . . . . . . 1.8 1 1 
       451 1 . . . . . . . 1.8 1 1 
       452 1 . . . . . . . 1.8 1 1 
       453 1 . . . . . . . 1.8 1 1 
       454 1 . . . . . . . 1.8 1 1 
       455 1 . . . . . . . 1.8 1 1 
       456 1 . . . . . . . 1.8 1 1 
       457 1 . . . . . . . 1.8 1 1 
       458 1 . . . . . . . 1.8 1 1 
       459 1 . . . . . . . 1.8 1 1 
       460 1 . . . . . . . 1.8 1 1 
       461 1 . . . . . . . 1.8 1 1 
       462 1 . . . . . . . 1.8 1 1 
       463 1 . . . . . . . 1.8 1 1 
       464 1 . . . . . . . 1.8 1 1 
       465 1 . . . . . . . 1.8 1 1 
       466 1 . . . . . . . 1.8 1 1 
       467 1 . . . . . . . 1.8 1 1 
       468 1 . . . . . . . 1.8 1 1 
       469 1 . . . . . . . 1.8 1 1 
       470 1 . . . . . . . 1.8 1 1 
       471 1 . . . . . . . 1.8 1 1 
       472 1 . . . . . . . 1.8 1 1 
       473 1 . . . . . . . 1.8 1 1 
       474 1 . . . . . . . 1.8 1 1 
       475 1 . . . . . . . 1.8 1 1 
       476 1 . . . . . . . 1.8 1 1 
       477 1 . . . . . . . 1.8 1 1 
       478 1 . . . . . . . 1.8 1 1 
       479 1 . . . . . . . 1.8 1 1 
       480 1 . . . . . . . 1.8 1 1 
       481 1 . . . . . . . 1.8 1 1 
       482 1 . . . . . . . 1.8 1 1 
       483 1 . . . . . . . 1.8 1 1 
       484 1 . . . . . . . 1.8 1 1 
       485 1 . . . . . . . 1.8 1 1 
       486 1 . . . . . . . 1.8 1 1 
       487 1 . . . . . . . 1.8 1 1 
       488 1 . . . . . . . 1.8 1 1 
       489 1 . . . . . . . 1.8 1 1 
       490 1 . . . . . . . 1.8 1 1 
       491 1 . . . . . . . 1.8 1 1 
       492 1 . . . . . . . 1.8 1 1 
       493 1 . . . . . . . 1.8 1 1 
       494 1 . . . . . . . 1.8 1 1 
       495 1 . . . . . . . 1.8 1 1 
       496 1 . . . . . . . 1.8 1 1 
       497 1 . . . . . . . 1.8 1 1 
       498 1 . . . . . . . 1.8 1 1 
       499 1 . . . . . . . 1.8 1 1 
       500 1 . . . . . . . 1.8 1 1 
       501 1 . . . . . . . 1.8 1 1 
       502 1 . . . . . . . 1.8 1 1 
       503 1 . . . . . . . 1.8 1 1 
       504 1 . . . . . . . 1.8 1 1 
       505 1 . . . . . . . 1.8 1 1 
       506 1 . . . . . . . 1.8 1 1 
       507 1 . . . . . . . 1.8 1 1 
       508 1 . . . . . . . 1.8 1 1 
       509 1 . . . . . . . 1.8 1 1 
       510 1 . . . . . . . 1.8 1 1 
       511 1 . . . . . . . 1.8 1 1 
       512 1 . . . . . . . 1.8 1 1 
       513 1 . . . . . . . 1.8 1 1 
       514 1 . . . . . . . 1.8 1 1 
       515 1 . . . . . . . 1.8 1 1 
       516 1 . . . . . . . 1.8 1 1 
       517 1 . . . . . . . 1.8 1 1 
       518 1 . . . . . . . 1.8 1 1 
       519 1 . . . . . . . 1.8 1 1 
       520 1 . . . . . . . 1.8 1 1 
       521 1 . . . . . . . 1.8 1 1 
       522 1 . . . . . . . 1.8 1 1 
       523 1 . . . . . . . 1.8 1 1 
       524 1 . . . . . . . 1.8 1 1 
       525 1 . . . . . . . 1.8 1 1 
       526 1 . . . . . . . 1.8 1 1 
       527 1 . . . . . . . 1.8 1 1 
       528 1 . . . . . . . 1.8 1 1 
       529 1 . . . . . . . 1.8 1 1 
       530 1 . . . . . . . 1.8 1 1 
       531 1 . . . . . . . 1.8 1 1 
       532 1 . . . . . . . 1.8 1 1 
       533 1 . . . . . . . 1.8 1 1 
       534 1 . . . . . . . 1.8 1 1 
       535 1 . . . . . . . 1.8 1 1 
       536 1 . . . . . . . 1.8 1 1 
       537 1 . . . . . . . 1.8 1 1 
       538 1 . . . . . . . 1.8 1 1 
       539 1 . . . . . . . 1.8 1 1 
       540 1 . . . . . . . 1.8 1 1 
       541 1 . . . . . . . 1.8 1 1 
       542 1 . . . . . . . 1.8 1 1 
       543 1 . . . . . . . 1.8 1 1 
       544 1 . . . . . . . 1.8 1 1 
       545 1 . . . . . . . 1.8 1 1 
       546 1 . . . . . . . 1.8 1 1 
       547 1 . . . . . . . 1.8 1 1 
       548 1 . . . . . . . 1.8 1 1 
       549 1 . . . . . . . 1.8 1 1 
       550 1 . . . . . . . 1.8 1 1 
       551 1 . . . . . . . 1.8 1 1 
       552 1 . . . . . . . 1.8 1 1 
       553 1 . . . . . . . 1.8 1 1 
       554 1 . . . . . . . 1.8 1 1 
       555 1 . . . . . . . 1.8 1 1 
       556 1 . . . . . . . 1.8 1 1 
       557 1 . . . . . . . 1.8 1 1 
       558 1 . . . . . . . 1.8 1 1 
       559 1 . . . . . . . 1.8 1 1 
       560 1 . . . . . . . 1.8 1 1 
       561 1 . . . . . . . 1.8 1 1 
       562 1 . . . . . . . 1.8 1 1 
       563 1 . . . . . . . 1.8 1 1 
       564 1 . . . . . . . 1.8 1 1 
       565 1 . . . . . . . 1.8 1 1 
       566 1 . . . . . . . 1.8 1 1 
       567 1 . . . . . . . 1.8 1 1 
       568 1 . . . . . . . 1.8 1 1 
       569 1 . . . . . . . 1.8 1 1 
       570 1 . . . . . . . 1.8 1 1 
       571 1 . . . . . . . 1.8 1 1 
       572 1 . . . . . . . 1.8 1 1 
       573 1 . . . . . . . 1.8 1 1 
       574 1 . . . . . . . 1.8 1 1 
       575 1 . . . . . . . 1.8 1 1 
       576 1 . . . . . . . 1.8 1 1 
       577 1 . . . . . . . 1.8 1 1 
       578 1 . . . . . . . 1.8 1 1 
       579 1 . . . . . . . 1.8 1 1 
       580 1 . . . . . . . 1.8 1 1 
       581 1 . . . . . . . 1.8 1 1 
       582 1 . . . . . . . 1.8 1 1 
       583 1 . . . . . . . 1.8 1 1 
       584 1 . . . . . . . 1.8 1 1 
       585 1 . . . . . . . 1.8 1 1 
       586 1 . . . . . . . 1.8 1 1 
       587 1 . . . . . . . 1.8 1 1 
       588 1 . . . . . . . 1.8 1 1 
       589 1 . . . . . . . 1.8 1 1 
       590 1 . . . . . . . 1.8 1 1 
       591 1 . . . . . . . 1.8 1 1 
       592 1 . . . . . . . 1.8 1 1 
       593 1 . . . . . . . 1.8 1 1 
       594 1 . . . . . . . 1.8 1 1 
       595 1 . . . . . . . 1.8 1 1 
       596 1 . . . . . . . 1.8 1 1 
       597 1 . . . . . . . 1.8 1 1 
       598 1 . . . . . . . 1.8 1 1 
       599 1 . . . . . . . 1.8 1 1 
       600 1 . . . . . . . 1.8 1 1 
       601 1 . . . . . . . 1.8 1 1 
       602 1 . . . . . . . 1.8 1 1 
       603 1 . . . . . . . 1.8 1 1 
       604 1 . . . . . . . 1.8 1 1 
       605 1 . . . . . . . 1.8 1 1 
       606 1 . . . . . . . 1.8 1 1 
       607 1 . . . . . . . 1.8 1 1 
       608 1 . . . . . . . 1.8 1 1 
       609 1 . . . . . . . 1.8 1 1 
       610 1 . . . . . . . 1.8 1 1 
       611 1 . . . . . . . 1.8 1 1 
       612 1 . . . . . . . 1.8 1 1 
       613 1 . . . . . . . 1.8 1 1 
       614 1 . . . . . . . 1.8 1 1 
       615 1 . . . . . . . 1.8 1 1 
       616 1 . . . . . . . 1.8 1 1 
       617 1 . . . . . . . 1.8 1 1 
       618 1 . . . . . . . 1.8 1 1 
       619 1 . . . . . . . 1.8 1 1 
       620 1 . . . . . . . 1.8 1 1 
       621 1 . . . . . . . 1.8 1 1 
       622 1 . . . . . . . 1.8 1 1 
       623 1 . . . . . . . 1.8 1 1 
       624 1 . . . . . . . 1.8 1 1 
       625 1 . . . . . . . 1.8 1 1 
       626 1 . . . . . . . 1.8 1 1 
       627 1 . . . . . . . 1.8 1 1 
       628 1 . . . . . . . 1.8 1 1 
       629 1 . . . . . . . 1.8 1 1 
       630 1 . . . . . . . 1.8 1 1 
       631 1 . . . . . . . 1.8 1 1 
       632 1 . . . . . . . 1.8 1 1 
       633 1 . . . . . . . 1.8 1 1 
       634 1 . . . . . . . 1.8 1 1 
       635 1 . . . . . . . 1.8 1 1 
       636 1 . . . . . . . 1.8 1 1 
       637 1 . . . . . . . 1.8 1 1 
       638 1 . . . . . . . 1.8 1 1 
       639 1 . . . . . . . 1.8 1 1 
       640 1 . . . . . . . 1.8 1 1 
       641 1 . . . . . . . 1.8 1 1 
       642 1 . . . . . . . 1.8 1 1 
       643 1 . . . . . . . 1.8 1 1 
       644 1 . . . . . . . 1.8 1 1 
       645 1 . . . . . . . 1.8 1 1 
       646 1 . . . . . . . 1.8 1 1 
       647 1 . . . . . . . 1.8 1 1 
       648 1 . . . . . . . 1.8 1 1 
       649 1 . . . . . . . 1.8 1 1 
       650 1 . . . . . . . 1.8 1 1 
       651 1 . . . . . . . 1.8 1 1 
       652 1 . . . . . . . 1.8 1 1 
       653 1 . . . . . . . 1.8 1 1 
       654 1 . . . . . . . 1.8 1 1 
       655 1 . . . . . . . 1.8 1 1 
       656 1 . . . . . . . 1.8 1 1 
       657 1 . . . . . . . 1.8 1 1 
       658 1 . . . . . . . 1.8 1 1 
       659 1 . . . . . . . 1.8 1 1 
       660 1 . . . . . . . 1.8 1 1 
       661 1 . . . . . . . 1.8 1 1 
       662 1 . . . . . . . 1.8 1 1 
       663 1 . . . . . . . 1.8 1 1 
       664 1 . . . . . . . 1.8 1 1 
       665 1 . . . . . . . 1.8 1 1 
       666 1 . . . . . . . 1.8 1 1 
       667 1 . . . . . . . 1.8 1 1 
       668 1 . . . . . . . 1.8 1 1 
       669 1 . . . . . . . 1.8 1 1 
       670 1 . . . . . . . 1.8 1 1 
       671 1 . . . . . . . 1.8 1 1 
       672 1 . . . . . . . 1.8 1 1 
       673 1 . . . . . . . 1.8 1 1 
       674 1 . . . . . . . 1.8 1 1 
       675 1 . . . . . . . 1.8 1 1 
       676 1 . . . . . . . 1.8 1 1 
       677 1 . . . . . . . 1.8 1 1 
       678 1 . . . . . . . 1.8 1 1 
       679 1 . . . . . . . 1.8 1 1 
       680 1 . . . . . . . 1.8 1 1 
       681 1 . . . . . . . 1.8 1 1 
       682 1 . . . . . . . 1.8 1 1 
       683 1 . . . . . . . 1.8 1 1 
       684 1 . . . . . . . 1.8 1 1 
       685 1 . . . . . . . 1.8 1 1 
       686 1 . . . . . . . 1.8 1 1 
       687 1 . . . . . . . 1.8 1 1 
       688 1 . . . . . . . 1.8 1 1 
       689 1 . . . . . . . 1.8 1 1 
       690 1 . . . . . . . 1.8 1 1 
       691 1 . . . . . . . 1.8 1 1 
       692 1 . . . . . . . 1.8 1 1 
       693 1 . . . . . . . 1.8 1 1 
       694 1 . . . . . . . 1.8 1 1 
       695 1 . . . . . . . 1.8 1 1 
       696 1 . . . . . . . 1.8 1 1 
       697 1 . . . . . . . 1.8 1 1 
       698 1 . . . . . . . 1.8 1 1 
       699 1 . . . . . . . 1.8 1 1 
       700 1 . . . . . . . 1.8 1 1 
       701 1 . . . . . . . 1.8 1 1 
       702 1 . . . . . . . 1.8 1 1 
       703 1 . . . . . . . 1.8 1 1 
       704 1 . . . . . . . 1.8 1 1 
       705 1 . . . . . . . 1.8 1 1 
       706 1 . . . . . . . 1.8 1 1 
       707 1 . . . . . . . 1.8 1 1 
       708 1 . . . . . . . 1.8 1 1 
       709 1 . . . . . . . 1.8 1 1 
       710 1 . . . . . . . 1.8 1 1 
       711 1 . . . . . . . 1.8 1 1 
       712 1 . . . . . . . 1.8 1 1 
       713 1 . . . . . . . 1.8 1 1 
       714 1 . . . . . . . 1.8 1 1 
       715 1 . . . . . . . 1.8 1 1 
       716 1 . . . . . . . 1.8 1 1 
       717 1 . . . . . . . 1.8 1 1 
       718 1 . . . . . . . 1.8 1 1 
       719 1 . . . . . . . 1.8 1 1 
       720 1 . . . . . . . 1.8 1 1 
       721 1 . . . . . . . 1.8 1 1 
       722 1 . . . . . . . 1.8 1 1 
       723 1 . . . . . . . 1.8 1 1 
       724 1 . . . . . . . 1.8 1 1 
       725 1 . . . . . . . 1.8 1 1 
       726 1 . . . . . . . 1.8 1 1 
       727 1 . . . . . . . 1.8 1 1 
       728 1 . . . . . . . 1.8 1 1 
       729 1 . . . . . . . 1.8 1 1 
       730 1 . . . . . . . 1.8 1 1 
       731 1 . . . . . . . 1.8 1 1 
       732 1 . . . . . . . 1.8 1 1 
       733 1 . . . . . . . 1.8 1 1 
       734 1 . . . . . . . 1.8 1 1 
       735 1 . . . . . . . 1.8 1 1 
       736 1 . . . . . . . 1.8 1 1 
       737 1 . . . . . . . 1.8 1 1 
       738 1 . . . . . . . 1.8 1 1 
       739 1 . . . . . . . 1.8 1 1 
       740 1 . . . . . . . 1.8 1 1 
       741 1 . . . . . . . 1.8 1 1 
       742 1 . . . . . . . 1.8 1 1 
       743 1 . . . . . . . 1.8 1 1 
       744 1 . . . . . . . 1.8 1 1 
       745 1 . . . . . . . 1.8 1 1 
       746 1 . . . . . . . 1.8 1 1 
       747 1 . . . . . . . 1.8 1 1 
       748 1 . . . . . . . 1.8 1 1 
       749 1 . . . . . . . 1.8 1 1 
       750 1 . . . . . . . 1.8 1 1 
       751 1 . . . . . . . 1.8 1 1 
       752 1 . . . . . . . 1.8 1 1 
       753 1 . . . . . . . 1.8 1 1 
       754 1 . . . . . . . 1.8 1 1 
       755 1 . . . . . . . 1.8 1 1 
       756 1 . . . . . . . 1.8 1 1 
       757 1 . . . . . . . 1.8 1 1 
       758 1 . . . . . . . 1.8 1 1 
       759 1 . . . . . . . 1.8 1 1 
       760 1 . . . . . . . 1.8 1 1 
       761 1 . . . . . . . 1.8 1 1 
       762 1 . . . . . . . 1.8 1 1 
       763 1 . . . . . . . 1.8 1 1 
       764 1 . . . . . . . 1.8 1 1 
       765 1 . . . . . . . 1.8 1 1 
       766 1 . . . . . . . 1.8 1 1 
       767 1 . . . . . . . 1.8 1 1 
       768 1 . . . . . . . 1.8 1 1 
       769 1 . . . . . . . 1.8 1 1 
       770 1 . . . . . . . 1.8 1 1 
       771 1 . . . . . . . 1.8 1 1 
       772 1 . . . . . . . 1.8 1 1 
       773 1 . . . . . . . 1.8 1 1 
       774 1 . . . . . . . 1.8 1 1 
       775 1 . . . . . . . 1.8 1 1 
       776 1 . . . . . . . 1.8 1 1 
       777 1 . . . . . . . 1.8 1 1 
       778 1 . . . . . . . 1.8 1 1 
       779 1 . . . . . . . 1.8 1 1 
       780 1 . . . . . . . 1.8 1 1 
       781 1 . . . . . . . 1.8 1 1 
       782 1 . . . . . . . 1.8 1 1 
       783 1 . . . . . . . 1.8 1 1 
       784 1 . . . . . . . 1.8 1 1 
       785 1 . . . . . . . 1.8 1 1 
       786 1 . . . . . . . 1.8 1 1 
       787 1 . . . . . . . 1.8 1 1 
       788 1 . . . . . . . 1.8 1 1 
       789 1 . . . . . . . 1.8 1 1 
       790 1 . . . . . . . 1.8 1 1 
       791 1 . . . . . . . 1.8 1 1 
       792 1 . . . . . . . 1.8 1 1 
       793 1 . . . . . . . 1.8 1 1 
       794 1 . . . . . . . 1.8 1 1 
       795 1 . . . . . . . 1.8 1 1 
       796 1 . . . . . . . 1.8 1 1 
       797 1 . . . . . . . 1.8 1 1 
       798 1 . . . . . . . 1.8 1 1 
       799 1 . . . . . . . 1.8 1 1 
       800 1 . . . . . . . 1.8 1 1 
       801 1 . . . . . . . 1.8 1 1 
       802 1 . . . . . . . 1.8 1 1 
       803 1 . . . . . . . 1.8 1 1 
       804 1 . . . . . . . 1.8 1 1 
       805 1 . . . . . . . 1.8 1 1 
       806 1 . . . . . . . 1.8 1 1 
       807 1 . . . . . . . 1.8 1 1 
       808 1 . . . . . . . 1.8 1 1 
       809 1 . . . . . . . 1.8 1 1 
       810 1 . . . . . . . 1.8 1 1 
       811 1 . . . . . . . 1.8 1 1 
       812 1 . . . . . . . 1.8 1 1 
       813 1 . . . . . . . 1.8 1 1 
       814 1 . . . . . . . 1.8 1 1 
       815 1 . . . . . . . 1.8 1 1 
       816 1 . . . . . . . 1.8 1 1 
       817 1 . . . . . . . 1.8 1 1 
       818 1 . . . . . . . 1.8 1 1 
       819 1 . . . . . . . 1.8 1 1 
       820 1 . . . . . . . 1.8 1 1 
       821 1 . . . . . . . 1.8 1 1 
       822 1 . . . . . . . 1.8 1 1 
       823 1 . . . . . . . 1.8 1 1 
       824 1 . . . . . . . 1.8 1 1 
       825 1 . . . . . . . 1.8 1 1 
       826 1 . . . . . . . 1.8 1 1 
    stop_

save_


save_DYANA/DIANA_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 PHI 1 1  20 GLU C 1 1  21 TRP N  1 1  21 TRP CA 1 1  21 TRP C      -91.38     -62.64 .  21 TRP  . .  21 TRP  . .  21 TRP  . .  21 TRP  . 1 1 
         2 PSI 1 1  21 TRP N 1 1  21 TRP CA 1 1  21 TRP C  1 1  22 LEU N   121.09999     145.04 .  21 TRP  . .  21 TRP  . .  21 TRP  . .  21 TRP  . 1 1 
         3 PHI 1 1  21 TRP C 1 1  22 LEU N  1 1  22 LEU CA 1 1  22 LEU C -106.399994     -87.28 .  22 LEU  . .  22 LEU  . .  22 LEU  . .  22 LEU  . 1 1 
         4 PSI 1 1  22 LEU N 1 1  22 LEU CA 1 1  22 LEU C  1 1  23 TYR N      102.39     156.91 .  22 LEU  . .  22 LEU  . .  22 LEU  . .  22 LEU  . 1 1 
         5 PHI 1 1  22 LEU C 1 1  23 TYR N  1 1  23 TYR CA 1 1  23 TYR C     -137.06 -101.23999 .  23 TYR  . .  23 TYR  . .  23 TYR  . .  23 TYR  . 1 1 
         6 PSI 1 1  23 TYR N 1 1  23 TYR CA 1 1  23 TYR C  1 1  24 GLY N       131.1     165.96 .  23 TYR  . .  23 TYR  . .  23 TYR  . .  23 TYR  . 1 1 
         7 PHI 1 1  24 GLY C 1 1  25 SER N  1 1  25 SER CA 1 1  25 SER C  -123.59999     -67.02 .  25 SER  . .  25 SER  . .  25 SER  . .  25 SER  . 1 1 
         8 PSI 1 1  25 SER N 1 1  25 SER CA 1 1  25 SER C  1 1  26 CYS N      127.97     166.03 .  25 SER  . .  25 SER  . .  25 SER  . .  25 SER  . 1 1 
         9 PHI 1 1  25 SER C 1 1  26 CYS N  1 1  26 CYS CA 1 1  26 CYS C     -161.57    -104.55 .  26 CYSS . .  26 CYSS . .  26 CYSS . .  26 CYSS . 1 1 
        10 PSI 1 1  26 CYS N 1 1  26 CYS CA 1 1  26 CYS C  1 1  27 VAL N  126.350006     153.11 .  26 CYSS . .  26 CYSS . .  26 CYSS . .  26 CYSS . 1 1 
        11 PHI 1 1  26 CYS C 1 1  27 VAL N  1 1  27 VAL CA 1 1  27 VAL C     -108.51  -93.52999 .  27 VAL  . .  27 VAL  . .  27 VAL  . .  27 VAL  . 1 1 
        12 PSI 1 1  27 VAL N 1 1  27 VAL CA 1 1  27 VAL C  1 1  28 ALA N      103.84     129.26 .  27 VAL  . .  27 VAL  . .  27 VAL  . .  27 VAL  . 1 1 
        13 PHI 1 1  27 VAL C 1 1  28 ALA N  1 1  28 ALA CA 1 1  28 ALA C      -87.48     -64.74 .  28 ALA  . .  28 ALA  . .  28 ALA  . .  28 ALA  . 1 1 
        14 PSI 1 1  28 ALA N 1 1  28 ALA CA 1 1  28 ALA C  1 1  29 ASN N      106.11     151.59 .  28 ALA  . .  28 ALA  . .  28 ALA  . .  28 ALA  . 1 1 
        15 PHI 1 1  32 ASP C 1 1  33 CYS N  1 1  33 CYS CA 1 1  33 CYS C     -154.71    -130.93 .  33 CYSS . .  33 CYSS . .  33 CYSS . .  33 CYSS . 1 1 
        16 PSI 1 1  33 CYS N 1 1  33 CYS CA 1 1  33 CYS C  1 1  34 GLY N   150.20999     159.29 .  33 CYSS . .  33 CYSS . .  33 CYSS . .  33 CYSS . 1 1 
        17 PHI 1 1  34 GLY C 1 1  35 GLN N  1 1  35 GLN CA 1 1  35 GLN C      -92.14     -45.82 .  35 GLN  . .  35 GLN  . .  35 GLN  . .  35 GLN  . 1 1 
        18 PSI 1 1  35 GLN N 1 1  35 GLN CA 1 1  35 GLN C  1 1  36 GLY N      117.05     155.93 .  35 GLN  . .  35 GLN  . .  35 GLN  . .  35 GLN  . 1 1 
        19 PHI 1 1  36 GLY C 1 1  37 MET N  1 1  37 MET CA 1 1  37 MET C     -158.92    -104.92 .  37 MET  . .  37 MET  . .  37 MET  . .  37 MET  . 1 1 
        20 PSI 1 1  37 MET N 1 1  37 MET CA 1 1  37 MET C  1 1  38 ARG N      138.52     173.64 .  37 MET  . .  37 MET  . .  37 MET  . .  37 MET  . 1 1 
        21 PHI 1 1  37 MET C 1 1  38 ARG N  1 1  38 ARG CA 1 1  38 ARG C     -144.88 -123.55999 .  38 ARG  . .  38 ARG  . .  38 ARG  . .  38 ARG  . 1 1 
        22 PSI 1 1  38 ARG N 1 1  38 ARG CA 1 1  38 ARG C  1 1  39 GLU N      128.43     157.67 .  38 ARG  . .  38 ARG  . .  38 ARG  . .  38 ARG  . 1 1 
        23 PHI 1 1  38 ARG C 1 1  39 GLU N  1 1  39 GLU CA 1 1  39 GLU C -126.409996     -92.79 .  39 GLU  . .  39 GLU  . .  39 GLU  . .  39 GLU  . 1 1 
        24 PSI 1 1  39 GLU N 1 1  39 GLU CA 1 1  39 GLU C  1 1  40 GLY N      116.83     144.87 .  39 GLU  . .  39 GLU  . .  39 GLU  . .  39 GLU  . 1 1 
        25 PHI 1 1  40 GLY C 1 1  41 THR N  1 1  41 THR CA 1 1  41 THR C     -121.27     -83.75 .  41 THR  . .  41 THR  . .  41 THR  . .  41 THR  . 1 1 
        26 PSI 1 1  41 THR N 1 1  41 THR CA 1 1  41 THR C  1 1  42 CYS N  124.189995     145.41 .  41 THR  . .  41 THR  . .  41 THR  . .  41 THR  . 1 1 
        27 PHI 1 1  41 THR C 1 1  42 CYS N  1 1  42 CYS CA 1 1  42 CYS C      -139.9    -109.22 .  42 CYSS . .  42 CYSS . .  42 CYSS . .  42 CYSS . 1 1 
        28 PSI 1 1  42 CYS N 1 1  42 CYS CA 1 1  42 CYS C  1 1  43 ASN N      112.51  154.98999 .  42 CYSS . .  42 CYSS . .  42 CYSS . .  42 CYSS . 1 1 
        29 PHI 1 1  44 GLU C 1 1  45 GLN N  1 1  45 GLN CA 1 1  45 GLN C     -133.72     -83.98 .  45 GLN  . .  45 GLN  . .  45 GLN  . .  45 GLN  . 1 1 
        30 PSI 1 1  45 GLN N 1 1  45 GLN CA 1 1  45 GLN C  1 1  46 THR N      140.34      165.1 .  45 GLN  . .  45 GLN  . .  45 GLN  . .  45 GLN  . 1 1 
        31 PHI 1 1  45 GLN C 1 1  46 THR N  1 1  46 THR CA 1 1  46 THR C     -146.09 -114.92999 .  46 THR  . .  46 THR  . .  46 THR  . .  46 THR  . 1 1 
        32 PSI 1 1  46 THR N 1 1  46 THR CA 1 1  46 THR C  1 1  47 ARG N      122.55     161.33 .  46 THR  . .  46 THR  . .  46 THR  . .  46 THR  . 1 1 
        33 PHI 1 1  46 THR C 1 1  47 ARG N  1 1  47 ARG CA 1 1  47 ARG C     -146.81    -114.05 .  47 ARG  . .  47 ARG  . .  47 ARG  . .  47 ARG  . 1 1 
        34 PSI 1 1  47 ARG N 1 1  47 ARG CA 1 1  47 ARG C  1 1  48 LYS N      127.41     165.37 .  47 ARG  . .  47 ARG  . .  47 ARG  . .  47 ARG  . 1 1 
        35 PHI 1 1  47 ARG C 1 1  48 LYS N  1 1  48 LYS CA 1 1  48 LYS C     -126.55     -93.99 .  48 LYS  . .  48 LYS  . .  48 LYS  . .  48 LYS  . 1 1 
        36 PSI 1 1  48 LYS N 1 1  48 LYS CA 1 1  48 LYS C  1 1  49 VAL N      128.92     149.16 .  48 LYS  . .  48 LYS  . .  48 LYS  . .  48 LYS  . 1 1 
        37 PHI 1 1  48 LYS C 1 1  49 VAL N  1 1  49 VAL CA 1 1  49 VAL C     -152.31    -131.13 .  49 VAL  . .  49 VAL  . .  49 VAL  . .  49 VAL  . 1 1 
        38 PSI 1 1  49 VAL N 1 1  49 VAL CA 1 1  49 VAL C  1 1  50 LYS N      144.42     166.98 .  49 VAL  . .  49 VAL  . .  49 VAL  . .  49 VAL  . 1 1 
        39 PHI 1 1  50 LYS C 1 1  51 CYS N  1 1  51 CYS CA 1 1  51 CYS C     -140.82 -126.55999 .  51 CYSS . .  51 CYSS . .  51 CYSS . .  51 CYSS . 1 1 
        40 PSI 1 1  51 CYS N 1 1  51 CYS CA 1 1  51 CYS C  1 1  52 ARG N      146.02     171.68 .  51 CYSS . .  51 CYSS . .  51 CYSS . .  51 CYSS . 1 1 
        41 PHI 1 1  51 CYS C 1 1  52 ARG N  1 1  52 ARG CA 1 1  52 ARG C     -144.71     -90.37 .  52 ARG  . .  52 ARG  . .  52 ARG  . .  52 ARG  . 1 1 
        42 PSI 1 1  52 ARG N 1 1  52 ARG CA 1 1  52 ARG C  1 1  53 VAL N  117.149994     142.87 .  52 ARG  . .  52 ARG  . .  52 ARG  . .  52 ARG  . 1 1 
        43 PHI 1 1  52 ARG C 1 1  53 VAL N  1 1  53 VAL CA 1 1  53 VAL C     -125.01     -77.53 .  53 VAL  . .  53 VAL  . .  53 VAL  . .  53 VAL  . 1 1 
        44 PSI 1 1  53 VAL N 1 1  53 VAL CA 1 1  53 VAL C  1 1  54 PRO N   62.119995     177.16 .  53 VAL  . .  53 VAL  . .  53 VAL  . .  53 VAL  . 1 1 
        45 PHI 1 1  54 PRO C 1 1  55 CYS N  1 1  55 CYS CA 1 1  55 CYS C     -134.64     -84.56 .  55 CYSS . .  55 CYSS . .  55 CYSS . .  55 CYSS . 1 1 
        46 PSI 1 1  55 CYS N 1 1  55 CYS CA 1 1  55 CYS C  1 1  56 ASN N      119.43     180.45 .  55 CYSS . .  55 CYSS . .  55 CYSS . .  55 CYSS . 1 1 
        47 PHI 1 1  64 ASP C 1 1  65 CYS N  1 1  65 CYS CA 1 1  65 CYS C     -152.86    -111.28 .  65 CYSS . .  65 CYSS . .  65 CYSS . .  65 CYSS . 1 1 
        48 PSI 1 1  65 CYS N 1 1  65 CYS CA 1 1  65 CYS C  1 1  66 LYS N      132.79     171.89 .  65 CYSS . .  65 CYSS . .  65 CYSS . .  65 CYSS . 1 1 
        49 PHI 1 1  65 CYS C 1 1  66 LYS N  1 1  66 LYS CA 1 1  66 LYS C -120.579994     -78.42 .  66 LYS  . .  66 LYS  . .  66 LYS  . .  66 LYS  . 1 1 
        50 PSI 1 1  66 LYS N 1 1  66 LYS CA 1 1  66 LYS C  1 1  67 TYR N   121.76001     148.26 .  66 LYS  . .  66 LYS  . .  66 LYS  . .  66 LYS  . 1 1 
        51 PHI 1 1  66 LYS C 1 1  67 TYR N  1 1  67 TYR CA 1 1  67 TYR C     -148.51     -90.83 .  67 TYR  . .  67 TYR  . .  67 TYR  . .  67 TYR  . 1 1 
        52 PSI 1 1  67 TYR N 1 1  67 TYR CA 1 1  67 TYR C  1 1  68 LYS N       128.3     171.34 .  67 TYR  . .  67 TYR  . .  67 TYR  . .  67 TYR  . 1 1 
        53 PHI 1 1  67 TYR C 1 1  68 LYS N  1 1  68 LYS CA 1 1  68 LYS C     -131.39     -88.01 .  68 LYS  . .  68 LYS  . .  68 LYS  . .  68 LYS  . 1 1 
        54 PSI 1 1  68 LYS N 1 1  68 LYS CA 1 1  68 LYS C  1 1  69 PHE N       98.33     145.57 .  68 LYS  . .  68 LYS  . .  68 LYS  . .  68 LYS  . 1 1 
        55 PHI 1 1  68 LYS C 1 1  69 PHE N  1 1  69 PHE CA 1 1  69 PHE C  -125.40001     -89.78 .  69 PHE  . .  69 PHE  . .  69 PHE  . .  69 PHE  . 1 1 
        56 PSI 1 1  69 PHE N 1 1  69 PHE CA 1 1  69 PHE C  1 1  70 GLY N      131.86     161.16 .  69 PHE  . .  69 PHE  . .  69 PHE  . .  69 PHE  . 1 1 
        57 PHI 1 1  73 GLY C 1 1  74 GLU N  1 1  74 GLU CA 1 1  74 GLU C  -130.57999  -79.67999 .  74 GLU  . .  74 GLU  . .  74 GLU  . .  74 GLU  . 1 1 
        58 PSI 1 1  74 GLU N 1 1  74 GLU CA 1 1  74 GLU C  1 1  75 CYS N      122.01     165.57 .  74 GLU  . .  74 GLU  . .  74 GLU  . .  74 GLU  . 1 1 
        59 PHI 1 1  74 GLU C 1 1  75 CYS N  1 1  75 CYS CA 1 1  75 CYS C     -154.81     -83.31 .  75 CYSS . .  75 CYSS . .  75 CYSS . .  75 CYSS . 1 1 
        60 PSI 1 1  75 CYS N 1 1  75 CYS CA 1 1  75 CYS C  1 1  76 ASP N   125.62999     153.35 .  75 CYSS . .  75 CYSS . .  75 CYSS . .  75 CYSS . 1 1 
        61 PHI 1 1  75 CYS C 1 1  76 ASP N  1 1  76 ASP CA 1 1  76 ASP C      -99.93     -80.21 .  76 ASP  . .  76 ASP  . .  76 ASP  . .  76 ASP  . 1 1 
        62 PSI 1 1  76 ASP N 1 1  76 ASP CA 1 1  76 ASP C  1 1  77 ALA N       98.86     134.58 .  76 ASP  . .  76 ASP  . .  76 ASP  . .  76 ASP  . 1 1 
        63 PHI 1 1  76 ASP C 1 1  77 ALA N  1 1  77 ALA CA 1 1  77 ALA C      -65.67     -53.91 .  77 ALA  . .  77 ALA  . .  77 ALA  . .  77 ALA  . 1 1 
        64 PSI 1 1  77 ALA N 1 1  77 ALA CA 1 1  77 ALA C  1 1  78 ALA N       -45.9      -17.3 .  77 ALA  . .  77 ALA  . .  77 ALA  . .  77 ALA  . 1 1 
        65 PHI 1 1  77 ALA C 1 1  78 ALA N  1 1  78 ALA CA 1 1  78 ALA C      -83.29     -68.05 .  78 ALA  . .  78 ALA  . .  78 ALA  . .  78 ALA  . 1 1 
        66 PSI 1 1  78 ALA N 1 1  78 ALA CA 1 1  78 ALA C  1 1  79 THR N      -33.26      -8.64 .  78 ALA  . .  78 ALA  . .  78 ALA  . .  78 ALA  . 1 1 
        67 PHI 1 1  80 SER C 1 1  81 THR N  1 1  81 THR CA 1 1  81 THR C      -150.1    -113.22 .  81 THR  . .  81 THR  . .  81 THR  . .  81 THR  . 1 1 
        68 PSI 1 1  81 THR N 1 1  81 THR CA 1 1  81 THR C  1 1  82 LYS N      140.28      177.4 .  81 THR  . .  81 THR  . .  81 THR  . .  81 THR  . 1 1 
        69 PHI 1 1  81 THR C 1 1  82 LYS N  1 1  82 LYS CA 1 1  82 LYS C     -147.68     -108.7 .  82 LYS  . .  82 LYS  . .  82 LYS  . .  82 LYS  . 1 1 
        70 PSI 1 1  82 LYS N 1 1  82 LYS CA 1 1  82 LYS C  1 1  83 SER N      135.59  157.86998 .  82 LYS  . .  82 LYS  . .  82 LYS  . .  82 LYS  . 1 1 
        71 PHI 1 1  82 LYS C 1 1  83 SER N  1 1  83 SER CA 1 1  83 SER C     -151.47    -106.19 .  83 SER  . .  83 SER  . .  83 SER  . .  83 SER  . 1 1 
        72 PSI 1 1  83 SER N 1 1  83 SER CA 1 1  83 SER C  1 1  84 ARG N      126.79     155.07 .  83 SER  . .  83 SER  . .  83 SER  . .  83 SER  . 1 1 
        73 PHI 1 1  83 SER C 1 1  84 ARG N  1 1  84 ARG CA 1 1  84 ARG C  -153.65999    -109.96 .  84 ARG  . .  84 ARG  . .  84 ARG  . .  84 ARG  . 1 1 
        74 PSI 1 1  84 ARG N 1 1  84 ARG CA 1 1  84 ARG C  1 1  85 THR N   121.27999     172.04 .  84 ARG  . .  84 ARG  . .  84 ARG  . .  84 ARG  . 1 1 
        75 PHI 1 1  84 ARG C 1 1  85 THR N  1 1  85 THR CA 1 1  85 THR C     -130.56      -94.2 .  85 THR  . .  85 THR  . .  85 THR  . .  85 THR  . 1 1 
        76 PSI 1 1  85 THR N 1 1  85 THR CA 1 1  85 THR C  1 1  86 GLY N   124.53001     140.45 .  85 THR  . .  85 THR  . .  85 THR  . .  85 THR  . 1 1 
        77 PHI 1 1  86 GLY C 1 1  87 THR N  1 1  87 THR CA 1 1  87 THR C      -126.4     -86.74 .  87 THR  . .  87 THR  . .  87 THR  . .  87 THR  . 1 1 
        78 PSI 1 1  87 THR N 1 1  87 THR CA 1 1  87 THR C  1 1  88 LEU N   116.33001     151.47 .  87 THR  . .  87 THR  . .  87 THR  . .  87 THR  . 1 1 
        79 PHI 1 1  87 THR C 1 1  88 LEU N  1 1  88 LEU CA 1 1  88 LEU C       -84.4     -60.94 .  88 LEU  . .  88 LEU  . .  88 LEU  . .  88 LEU  . 1 1 
        80 PSI 1 1  88 LEU N 1 1  88 LEU CA 1 1  88 LEU C  1 1  89 GLN N      119.98     145.48 .  88 LEU  . .  88 LEU  . .  88 LEU  . .  88 LEU  . 1 1 
        81 PHI 1 1  89 GLN C 1 1  90 LYS N  1 1  90 LYS CA 1 1  90 LYS C      -144.6      -73.5 .  90 LYS  . .  90 LYS  . .  90 LYS  . .  90 LYS  . 1 1 
        82 PSI 1 1  90 LYS N 1 1  90 LYS CA 1 1  90 LYS C  1 1  91 ALA N      123.77     159.09 .  90 LYS  . .  90 LYS  . .  90 LYS  . .  90 LYS  . 1 1 
        83 PHI 1 1  90 LYS C 1 1  91 ALA N  1 1  91 ALA CA 1 1  91 ALA C     -143.79     -78.49 .  91 ALA  . .  91 ALA  . .  91 ALA  . .  91 ALA  . 1 1 
        84 PSI 1 1  91 ALA N 1 1  91 ALA CA 1 1  91 ALA C  1 1  92 LEU N      116.27     163.95 .  91 ALA  . .  91 ALA  . .  91 ALA  . .  91 ALA  . 1 1 
        85 PHI 1 1  95 VAL C 1 1  96 GLU N  1 1  96 GLU CA 1 1  96 GLU C     -102.07     -71.11 .  96 GLU  . .  96 GLU  . .  96 GLU  . .  96 GLU  . 1 1 
        86 PSI 1 1  96 GLU N 1 1  96 GLU CA 1 1  96 GLU C  1 1  97 CYS N      113.37     144.77 .  96 GLU  . .  96 GLU  . .  96 GLU  . .  96 GLU  . 1 1 
        87 PHI 1 1  96 GLU C 1 1  97 CYS N  1 1  97 CYS CA 1 1  97 CYS C     -153.45    -102.77 .  97 CYSS . .  97 CYSS . .  97 CYSS . .  97 CYSS . 1 1 
        88 PSI 1 1  97 CYS N 1 1  97 CYS CA 1 1  97 CYS C  1 1  98 GLN N      143.84     164.26 .  97 CYSS . .  97 CYSS . .  97 CYSS . .  97 CYSS . 1 1 
        89 PHI 1 1  97 CYS C 1 1  98 GLN N  1 1  98 GLN CA 1 1  98 GLN C      -86.61     -65.21 .  98 GLN  . .  98 GLN  . .  98 GLN  . .  98 GLN  . 1 1 
        90 PSI 1 1  98 GLN N 1 1  98 GLN CA 1 1  98 GLN C  1 1  99 GLN N      119.24     153.74 .  98 GLN  . .  98 GLN  . .  98 GLN  . .  98 GLN  . 1 1 
        91 PHI 1 1  99 GLN C 1 1 100 THR N  1 1 100 THR CA 1 1 100 THR C     -148.23    -110.57 . 100 THR  . . 100 THR  . . 100 THR  . . 100 THR  . 1 1 
        92 PSI 1 1 100 THR N 1 1 100 THR CA 1 1 100 THR C  1 1 101 VAL N      148.99     164.57 . 100 THR  . . 100 THR  . . 100 THR  . . 100 THR  . 1 1 
        93 PHI 1 1 100 THR C 1 1 101 VAL N  1 1 101 VAL CA 1 1 101 VAL C     -158.98    -117.14 . 101 VAL  . . 101 VAL  . . 101 VAL  . . 101 VAL  . 1 1 
        94 PSI 1 1 101 VAL N 1 1 101 VAL CA 1 1 101 VAL C  1 1 102 SER N      144.28  171.19998 . 101 VAL  . . 101 VAL  . . 101 VAL  . . 101 VAL  . 1 1 
        95 PHI 1 1 101 VAL C 1 1 102 SER N  1 1 102 SER CA 1 1 102 SER C     -124.67     -89.83 . 102 SER  . . 102 SER  . . 102 SER  . . 102 SER  . 1 1 
        96 PSI 1 1 102 SER N 1 1 102 SER CA 1 1 102 SER C  1 1 103 VAL N      134.44     157.94 . 102 SER  . . 102 SER  . . 102 SER  . . 102 SER  . 1 1 
        97 PHI 1 1 102 SER C 1 1 103 VAL N  1 1 103 VAL CA 1 1 103 VAL C     -136.65 -119.52999 . 103 VAL  . . 103 VAL  . . 103 VAL  . . 103 VAL  . 1 1 
        98 PSI 1 1 103 VAL N 1 1 103 VAL CA 1 1 103 VAL C  1 1 104 THR N      132.93     165.93 . 103 VAL  . . 103 VAL  . . 103 VAL  . . 103 VAL  . 1 1 
        99 PHI 1 1 103 VAL C 1 1 104 THR N  1 1 104 THR CA 1 1 104 THR C      -138.5    -102.98 . 104 THR  . . 104 THR  . . 104 THR  . . 104 THR  . 1 1 
       100 PSI 1 1 104 THR N 1 1 104 THR CA 1 1 104 THR C  1 1 105 LYS N      135.87     161.77 . 104 THR  . . 104 THR  . . 104 THR  . . 104 THR  . 1 1 
       101 PHI 1 1 104 THR C 1 1 105 LYS N  1 1 105 LYS CA 1 1 105 LYS C     -149.42     -92.26 . 105 LYS  . . 105 LYS  . . 105 LYS  . . 105 LYS  . 1 1 
       102 PSI 1 1 105 LYS N 1 1 105 LYS CA 1 1 105 LYS C  1 1 106 PRO N      107.13     151.17 . 105 LYS  . . 105 LYS  . . 105 LYS  . . 105 LYS  . 1 1 
       103 PHI 1 1 106 PRO C 1 1 107 CYS N  1 1 107 CYS CA 1 1 107 CYS C     -145.51    -120.91 . 107 CYSS . . 107 CYSS . . 107 CYSS . . 107 CYSS . 1 1 
       104 PSI 1 1 107 CYS N 1 1 107 CYS CA 1 1 107 CYS C  1 1 108 THR N   146.56999     164.85 . 107 CYSS . . 107 CYSS . . 107 CYSS . . 107 CYSS . 1 1 
       105 PHI 1 1 107 CYS C 1 1 108 THR N  1 1 108 THR CA 1 1 108 THR C     -134.61     -85.37 . 108 THR  . . 108 THR  . . 108 THR  . . 108 THR  . 1 1 
       106 PSI 1 1 108 THR N 1 1 108 THR CA 1 1 108 THR C  1 1 109 THR N      121.61  151.78998 . 108 THR  . . 108 THR  . . 108 THR  . . 108 THR  . 1 1 
       107 PHI 1 1 113 ASN C 1 1 114 LYS N  1 1 114 LYS CA 1 1 114 LYS C     -104.57     -63.41 . 114 LYS  . . 114 LYS  . . 114 LYS  . . 114 LYS  . 1 1 
       108 PSI 1 1 114 LYS N 1 1 114 LYS CA 1 1 114 LYS C  1 1 115 PRO N      110.49     167.39 . 114 LYS  . . 114 LYS  . . 114 LYS  . . 114 LYS  . 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 GLY C    C -60.358 -76.526 -21.920 1.00 . A A .   1 GLY C    1 1 
        1     2 1 1   1 GLY CA   C -59.898 -77.456 -23.025 1.00 . A A .   1 GLY CA   1 1 
        1     3 1 1   1 GLY H1   H -60.137 -79.340 -23.629 1.00 . A A .   1 GLY H1   1 1 
        1     4 1 1   1 GLY H2   H -61.194 -78.881 -22.475 1.00 . A A .   1 GLY H2   1 1 
        1     5 1 1   1 GLY H3   H -59.705 -79.346 -22.090 1.00 . A A .   1 GLY H3   1 1 
        1     6 1 1   1 GLY HA2  H -58.828 -77.364 -23.137 1.00 . A A .   1 GLY HA2  1 1 
        1     7 1 1   1 GLY HA3  H -60.375 -77.161 -23.949 1.00 . A A .   1 GLY HA3  1 1 
        1     8 1 1   1 GLY N    N -60.223 -78.843 -22.753 1.00 . A A .   1 GLY N    1 1 
        1     9 1 1   1 GLY O    O -61.556 -76.375 -21.684 1.00 . A A .   1 GLY O    1 1 
        1    10 1 1   2 SER C    C -59.319 -73.558 -20.507 1.00 . A A .   2 SER C    1 1 
        1    11 1 1   2 SER CA   C -59.714 -74.986 -20.147 1.00 . A A .   2 SER CA   1 1 
        1    12 1 1   2 SER CB   C -58.996 -75.418 -18.868 1.00 . A A .   2 SER CB   1 1 
        1    13 1 1   2 SER H    H -58.464 -76.065 -21.472 1.00 . A A .   2 SER H    1 1 
        1    14 1 1   2 SER HA   H -60.781 -75.021 -19.980 1.00 . A A .   2 SER HA   1 1 
        1    15 1 1   2 SER HB2  H -58.109 -75.994 -19.132 1.00 . A A .   2 SER HB2  1 1 
        1    16 1 1   2 SER HB3  H -58.698 -74.541 -18.310 1.00 . A A .   2 SER HB3  1 1 
        1    17 1 1   2 SER HG   H -59.548 -76.159 -17.140 1.00 . A A .   2 SER HG   1 1 
        1    18 1 1   2 SER N    N -59.403 -75.902 -21.238 1.00 . A A .   2 SER N    1 1 
        1    19 1 1   2 SER O    O -58.138 -73.245 -20.653 1.00 . A A .   2 SER O    1 1 
        1    20 1 1   2 SER OG   O -59.840 -76.213 -18.052 1.00 . A A .   2 SER OG   1 1 
        1    21 1 1   3 LYS C    C -59.971 -70.438 -19.734 1.00 . A A .   3 LYS C    1 1 
        1    22 1 1   3 LYS CA   C -60.078 -71.296 -20.992 1.00 . A A .   3 LYS CA   1 1 
        1    23 1 1   3 LYS CB   C -61.200 -70.768 -21.889 1.00 . A A .   3 LYS CB   1 1 
        1    24 1 1   3 LYS CD   C -61.051 -69.741 -24.176 1.00 . A A .   3 LYS CD   1 1 
        1    25 1 1   3 LYS CE   C -60.066 -69.749 -25.336 1.00 . A A .   3 LYS CE   1 1 
        1    26 1 1   3 LYS CG   C -60.968 -71.025 -23.367 1.00 . A A .   3 LYS CG   1 1 
        1    27 1 1   3 LYS H    H -61.240 -73.002 -20.520 1.00 . A A .   3 LYS H    1 1 
        1    28 1 1   3 LYS HA   H -59.144 -71.242 -21.530 1.00 . A A .   3 LYS HA   1 1 
        1    29 1 1   3 LYS HB2  H -62.135 -71.243 -21.594 1.00 . A A .   3 LYS HB2  1 1 
        1    30 1 1   3 LYS HB3  H -61.292 -69.702 -21.740 1.00 . A A .   3 LYS HB3  1 1 
        1    31 1 1   3 LYS HD2  H -62.063 -69.630 -24.568 1.00 . A A .   3 LYS HD2  1 1 
        1    32 1 1   3 LYS HD3  H -60.828 -68.904 -23.531 1.00 . A A .   3 LYS HD3  1 1 
        1    33 1 1   3 LYS HE2  H -59.833 -70.781 -25.598 1.00 . A A .   3 LYS HE2  1 1 
        1    34 1 1   3 LYS HE3  H -60.525 -69.264 -26.184 1.00 . A A .   3 LYS HE3  1 1 
        1    35 1 1   3 LYS HG2  H -59.982 -71.470 -23.502 1.00 . A A .   3 LYS HG2  1 1 
        1    36 1 1   3 LYS HG3  H -61.719 -71.715 -23.725 1.00 . A A .   3 LYS HG3  1 1 
        1    37 1 1   3 LYS HZ1  H -58.044 -69.326 -25.643 1.00 . A A .   3 LYS HZ1  1 1 
        1    38 1 1   3 LYS HZ2  H -58.518 -69.262 -24.020 1.00 . A A .   3 LYS HZ2  1 1 
        1    39 1 1   3 LYS HZ3  H -58.941 -68.009 -25.074 1.00 . A A .   3 LYS HZ3  1 1 
        1    40 1 1   3 LYS N    N -60.318 -72.693 -20.649 1.00 . A A .   3 LYS N    1 1 
        1    41 1 1   3 LYS NZ   N -58.803 -69.036 -24.994 1.00 . A A .   3 LYS NZ   1 1 
        1    42 1 1   3 LYS O    O -60.326 -70.877 -18.641 1.00 . A A .   3 LYS O    1 1 
        1    43 1 1   4 ASN C    C -58.991 -66.889 -19.267 1.00 . A A .   4 ASN C    1 1 
        1    44 1 1   4 ASN CA   C -59.332 -68.294 -18.777 1.00 . A A .   4 ASN CA   1 1 
        1    45 1 1   4 ASN CB   C -58.242 -68.793 -17.824 1.00 . A A .   4 ASN CB   1 1 
        1    46 1 1   4 ASN CG   C -56.859 -68.724 -18.444 1.00 . A A .   4 ASN CG   1 1 
        1    47 1 1   4 ASN H    H -59.216 -68.920 -20.795 1.00 . A A .   4 ASN H    1 1 
        1    48 1 1   4 ASN HA   H -60.271 -68.259 -18.246 1.00 . A A .   4 ASN HA   1 1 
        1    49 1 1   4 ASN HB2  H -58.256 -68.183 -16.921 1.00 . A A .   4 ASN HB2  1 1 
        1    50 1 1   4 ASN HB3  H -58.447 -69.818 -17.558 1.00 . A A .   4 ASN HB3  1 1 
        1    51 1 1   4 ASN HD21 H -56.041 -68.489 -16.646 1.00 . A A .   4 ASN HD21 1 1 
        1    52 1 1   4 ASN HD22 H -54.939 -68.509 -17.977 1.00 . A A .   4 ASN HD22 1 1 
        1    53 1 1   4 ASN N    N -59.483 -69.213 -19.899 1.00 . A A .   4 ASN N    1 1 
        1    54 1 1   4 ASN ND2  N -55.844 -68.558 -17.604 1.00 . A A .   4 ASN ND2  1 1 
        1    55 1 1   4 ASN O    O -58.860 -66.653 -20.467 1.00 . A A .   4 ASN O    1 1 
        1    56 1 1   4 ASN OD1  O -56.706 -68.821 -19.661 1.00 . A A .   4 ASN OD1  1 1 
        1    57 1 1   5 LYS C    C -57.954 -63.846 -17.449 1.00 . A A .   5 LYS C    1 1 
        1    58 1 1   5 LYS CA   C -58.522 -64.579 -18.662 1.00 . A A .   5 LYS CA   1 1 
        1    59 1 1   5 LYS CB   C -59.765 -63.849 -19.175 1.00 . A A .   5 LYS CB   1 1 
        1    60 1 1   5 LYS CD   C -58.954 -62.371 -21.037 1.00 . A A .   5 LYS CD   1 1 
        1    61 1 1   5 LYS CE   C -60.068 -62.144 -22.047 1.00 . A A .   5 LYS CE   1 1 
        1    62 1 1   5 LYS CG   C -59.492 -62.422 -19.616 1.00 . A A .   5 LYS CG   1 1 
        1    63 1 1   5 LYS H    H -58.967 -66.210 -17.386 1.00 . A A .   5 LYS H    1 1 
        1    64 1 1   5 LYS HA   H -57.776 -64.593 -19.440 1.00 . A A .   5 LYS HA   1 1 
        1    65 1 1   5 LYS HB2  H -60.172 -64.404 -20.020 1.00 . A A .   5 LYS HB2  1 1 
        1    66 1 1   5 LYS HB3  H -60.504 -63.824 -18.387 1.00 . A A .   5 LYS HB3  1 1 
        1    67 1 1   5 LYS HD2  H -58.230 -61.559 -21.115 1.00 . A A .   5 LYS HD2  1 1 
        1    68 1 1   5 LYS HD3  H -58.462 -63.307 -21.260 1.00 . A A .   5 LYS HD3  1 1 
        1    69 1 1   5 LYS HE2  H -61.019 -62.437 -21.601 1.00 . A A .   5 LYS HE2  1 1 
        1    70 1 1   5 LYS HE3  H -60.104 -61.094 -22.295 1.00 . A A .   5 LYS HE3  1 1 
        1    71 1 1   5 LYS HG2  H -60.419 -61.849 -19.564 1.00 . A A .   5 LYS HG2  1 1 
        1    72 1 1   5 LYS HG3  H -58.765 -61.980 -18.950 1.00 . A A .   5 LYS HG3  1 1 
        1    73 1 1   5 LYS HZ1  H -58.883 -63.302 -23.320 1.00 . A A .   5 LYS HZ1  1 1 
        1    74 1 1   5 LYS HZ2  H -60.005 -62.326 -24.128 1.00 . A A .   5 LYS HZ2  1 1 
        1    75 1 1   5 LYS HZ3  H -60.519 -63.727 -23.334 1.00 . A A .   5 LYS HZ3  1 1 
        1    76 1 1   5 LYS N    N -58.849 -65.960 -18.327 1.00 . A A .   5 LYS N    1 1 
        1    77 1 1   5 LYS NZ   N -59.853 -62.929 -23.295 1.00 . A A .   5 LYS NZ   1 1 
        1    78 1 1   5 LYS O    O -58.607 -63.744 -16.411 1.00 . A A .   5 LYS O    1 1 
        1    79 1 1   6 LYS C    C -54.792 -61.954 -16.996 1.00 . A A .   6 LYS C    1 1 
        1    80 1 1   6 LYS CA   C -56.079 -62.613 -16.507 1.00 . A A .   6 LYS CA   1 1 
        1    81 1 1   6 LYS CB   C -55.771 -63.559 -15.345 1.00 . A A .   6 LYS CB   1 1 
        1    82 1 1   6 LYS CD   C -57.607 -63.626 -13.634 1.00 . A A .   6 LYS CD   1 1 
        1    83 1 1   6 LYS CE   C -57.678 -63.993 -12.159 1.00 . A A .   6 LYS CE   1 1 
        1    84 1 1   6 LYS CG   C -56.252 -63.045 -13.999 1.00 . A A .   6 LYS CG   1 1 
        1    85 1 1   6 LYS H    H -56.264 -63.453 -18.441 1.00 . A A .   6 LYS H    1 1 
        1    86 1 1   6 LYS HA   H -56.755 -61.844 -16.165 1.00 . A A .   6 LYS HA   1 1 
        1    87 1 1   6 LYS HB2  H -56.244 -64.521 -15.542 1.00 . A A .   6 LYS HB2  1 1 
        1    88 1 1   6 LYS HB3  H -54.701 -63.704 -15.288 1.00 . A A .   6 LYS HB3  1 1 
        1    89 1 1   6 LYS HD2  H -58.382 -62.893 -13.857 1.00 . A A .   6 LYS HD2  1 1 
        1    90 1 1   6 LYS HD3  H -57.780 -64.515 -14.225 1.00 . A A .   6 LYS HD3  1 1 
        1    91 1 1   6 LYS HE2  H -56.679 -64.255 -11.809 1.00 . A A .   6 LYS HE2  1 1 
        1    92 1 1   6 LYS HE3  H -58.032 -63.137 -11.605 1.00 . A A .   6 LYS HE3  1 1 
        1    93 1 1   6 LYS HG2  H -55.528 -63.319 -13.231 1.00 . A A .   6 LYS HG2  1 1 
        1    94 1 1   6 LYS HG3  H -56.333 -61.968 -14.043 1.00 . A A .   6 LYS HG3  1 1 
        1    95 1 1   6 LYS HZ1  H -59.284 -65.220 -12.692 1.00 . A A .   6 LYS HZ1  1 1 
        1    96 1 1   6 LYS HZ2  H -59.109 -65.006 -11.022 1.00 . A A .   6 LYS HZ2  1 1 
        1    97 1 1   6 LYS HZ3  H -58.053 -66.028 -11.859 1.00 . A A .   6 LYS HZ3  1 1 
        1    98 1 1   6 LYS N    N -56.735 -63.339 -17.589 1.00 . A A .   6 LYS N    1 1 
        1    99 1 1   6 LYS NZ   N -58.595 -65.142 -11.916 1.00 . A A .   6 LYS NZ   1 1 
        1   100 1 1   6 LYS O    O -53.769 -62.617 -17.161 1.00 . A A .   6 LYS O    1 1 
        1   101 1 1   7 GLU C    C -53.374 -58.740 -16.751 1.00 . A A .   7 GLU C    1 1 
        1   102 1 1   7 GLU CA   C -53.691 -59.897 -17.692 1.00 . A A .   7 GLU CA   1 1 
        1   103 1 1   7 GLU CB   C -53.934 -59.369 -19.107 1.00 . A A .   7 GLU CB   1 1 
        1   104 1 1   7 GLU CD   C -51.552 -59.820 -19.816 1.00 . A A .   7 GLU CD   1 1 
        1   105 1 1   7 GLU CG   C -53.021 -59.987 -20.152 1.00 . A A .   7 GLU CG   1 1 
        1   106 1 1   7 GLU H    H -55.697 -60.172 -17.072 1.00 . A A .   7 GLU H    1 1 
        1   107 1 1   7 GLU HA   H -52.848 -60.573 -17.709 1.00 . A A .   7 GLU HA   1 1 
        1   108 1 1   7 GLU HB2  H -54.969 -59.571 -19.383 1.00 . A A .   7 GLU HB2  1 1 
        1   109 1 1   7 GLU HB3  H -53.778 -58.302 -19.110 1.00 . A A .   7 GLU HB3  1 1 
        1   110 1 1   7 GLU HG2  H -53.247 -61.051 -20.233 1.00 . A A .   7 GLU HG2  1 1 
        1   111 1 1   7 GLU HG3  H -53.214 -59.515 -21.105 1.00 . A A .   7 GLU HG3  1 1 
        1   112 1 1   7 GLU N    N -54.852 -60.645 -17.223 1.00 . A A .   7 GLU N    1 1 
        1   113 1 1   7 GLU O    O -54.261 -58.199 -16.090 1.00 . A A .   7 GLU O    1 1 
        1   114 1 1   7 GLU OE1  O -50.996 -60.700 -19.128 1.00 . A A .   7 GLU OE1  1 1 
        1   115 1 1   7 GLU OE2  O -50.958 -58.808 -20.244 1.00 . A A .   7 GLU OE2  1 1 
        1   116 1 1   8 LYS C    C -50.391 -56.626 -16.377 1.00 . A A .   8 LYS C    1 1 
        1   117 1 1   8 LYS CA   C -51.664 -57.267 -15.837 1.00 . A A .   8 LYS CA   1 1 
        1   118 1 1   8 LYS CB   C -51.428 -57.772 -14.412 1.00 . A A .   8 LYS CB   1 1 
        1   119 1 1   8 LYS CD   C -51.352 -60.266 -14.127 1.00 . A A .   8 LYS CD   1 1 
        1   120 1 1   8 LYS CE   C -50.456 -61.473 -13.895 1.00 . A A .   8 LYS CE   1 1 
        1   121 1 1   8 LYS CG   C -50.539 -59.002 -14.341 1.00 . A A .   8 LYS CG   1 1 
        1   122 1 1   8 LYS H    H -51.439 -58.832 -17.245 1.00 . A A .   8 LYS H    1 1 
        1   123 1 1   8 LYS HA   H -52.448 -56.524 -15.820 1.00 . A A .   8 LYS HA   1 1 
        1   124 1 1   8 LYS HB2  H -50.966 -56.974 -13.831 1.00 . A A .   8 LYS HB2  1 1 
        1   125 1 1   8 LYS HB3  H -52.381 -58.017 -13.966 1.00 . A A .   8 LYS HB3  1 1 
        1   126 1 1   8 LYS HD2  H -52.002 -60.131 -13.262 1.00 . A A .   8 LYS HD2  1 1 
        1   127 1 1   8 LYS HD3  H -51.960 -60.445 -15.003 1.00 . A A .   8 LYS HD3  1 1 
        1   128 1 1   8 LYS HE2  H -50.708 -62.248 -14.619 1.00 . A A .   8 LYS HE2  1 1 
        1   129 1 1   8 LYS HE3  H -49.429 -61.175 -14.039 1.00 . A A .   8 LYS HE3  1 1 
        1   130 1 1   8 LYS HG2  H -49.979 -59.091 -15.272 1.00 . A A .   8 LYS HG2  1 1 
        1   131 1 1   8 LYS HG3  H -49.846 -58.887 -13.520 1.00 . A A .   8 LYS HG3  1 1 
        1   132 1 1   8 LYS HZ1  H -50.330 -61.311 -11.815 1.00 . A A .   8 LYS HZ1  1 1 
        1   133 1 1   8 LYS HZ2  H -50.015 -62.866 -12.402 1.00 . A A .   8 LYS HZ2  1 1 
        1   134 1 1   8 LYS HZ3  H -51.604 -62.287 -12.351 1.00 . A A .   8 LYS HZ3  1 1 
        1   135 1 1   8 LYS N    N -52.100 -58.361 -16.694 1.00 . A A .   8 LYS N    1 1 
        1   136 1 1   8 LYS NZ   N -50.612 -62.022 -12.519 1.00 . A A .   8 LYS NZ   1 1 
        1   137 1 1   8 LYS O    O -49.629 -57.258 -17.108 1.00 . A A .   8 LYS O    1 1 
        1   138 1 1   9 ASN C    C -48.928 -53.251 -15.838 1.00 . A A .   9 ASN C    1 1 
        1   139 1 1   9 ASN CA   C -48.983 -54.642 -16.461 1.00 . A A .   9 ASN CA   1 1 
        1   140 1 1   9 ASN CB   C -48.976 -54.529 -17.987 1.00 . A A .   9 ASN CB   1 1 
        1   141 1 1   9 ASN CG   C -50.331 -54.136 -18.544 1.00 . A A .   9 ASN CG   1 1 
        1   142 1 1   9 ASN H    H -50.810 -54.917 -15.429 1.00 . A A .   9 ASN H    1 1 
        1   143 1 1   9 ASN HA   H -48.113 -55.200 -16.147 1.00 . A A .   9 ASN HA   1 1 
        1   144 1 1   9 ASN HB2  H -48.241 -53.781 -18.284 1.00 . A A .   9 ASN HB2  1 1 
        1   145 1 1   9 ASN HB3  H -48.697 -55.482 -18.413 1.00 . A A .   9 ASN HB3  1 1 
        1   146 1 1   9 ASN HD21 H -50.818 -56.048 -18.779 1.00 . A A .   9 ASN HD21 1 1 
        1   147 1 1   9 ASN HD22 H -52.020 -54.903 -19.258 1.00 . A A .   9 ASN HD22 1 1 
        1   148 1 1   9 ASN N    N -50.165 -55.367 -16.014 1.00 . A A .   9 ASN N    1 1 
        1   149 1 1   9 ASN ND2  N -51.138 -55.129 -18.896 1.00 . A A .   9 ASN ND2  1 1 
        1   150 1 1   9 ASN O    O -49.006 -52.241 -16.537 1.00 . A A .   9 ASN O    1 1 
        1   151 1 1   9 ASN OD1  O -50.649 -52.951 -18.655 1.00 . A A .   9 ASN OD1  1 1 
        1   152 1 1  10 LYS C    C -47.304 -51.397 -13.781 1.00 . A A .  10 LYS C    1 1 
        1   153 1 1  10 LYS CA   C -48.728 -51.940 -13.796 1.00 . A A .  10 LYS CA   1 1 
        1   154 1 1  10 LYS CB   C -49.232 -52.119 -12.362 1.00 . A A .  10 LYS CB   1 1 
        1   155 1 1  10 LYS CD   C -49.144 -53.882 -10.575 1.00 . A A .  10 LYS CD   1 1 
        1   156 1 1  10 LYS CE   C -49.875 -54.974 -11.340 1.00 . A A .  10 LYS CE   1 1 
        1   157 1 1  10 LYS CG   C -48.334 -52.996 -11.507 1.00 . A A .  10 LYS CG   1 1 
        1   158 1 1  10 LYS H    H -48.739 -54.046 -14.013 1.00 . A A .  10 LYS H    1 1 
        1   159 1 1  10 LYS HA   H -49.365 -51.234 -14.307 1.00 . A A .  10 LYS HA   1 1 
        1   160 1 1  10 LYS HB2  H -49.309 -51.137 -11.894 1.00 . A A .  10 LYS HB2  1 1 
        1   161 1 1  10 LYS HB3  H -50.215 -52.566 -12.391 1.00 . A A .  10 LYS HB3  1 1 
        1   162 1 1  10 LYS HD2  H -48.475 -54.342  -9.847 1.00 . A A .  10 LYS HD2  1 1 
        1   163 1 1  10 LYS HD3  H -49.869 -53.273 -10.054 1.00 . A A .  10 LYS HD3  1 1 
        1   164 1 1  10 LYS HE2  H -50.882 -55.079 -10.938 1.00 . A A .  10 LYS HE2  1 1 
        1   165 1 1  10 LYS HE3  H -49.938 -54.687 -12.380 1.00 . A A .  10 LYS HE3  1 1 
        1   166 1 1  10 LYS HG2  H -47.724 -53.625 -12.157 1.00 . A A .  10 LYS HG2  1 1 
        1   167 1 1  10 LYS HG3  H -47.686 -52.365 -10.916 1.00 . A A .  10 LYS HG3  1 1 
        1   168 1 1  10 LYS HZ1  H -48.587 -56.441 -12.087 1.00 . A A .  10 LYS HZ1  1 1 
        1   169 1 1  10 LYS HZ2  H -49.867 -57.056 -11.165 1.00 . A A .  10 LYS HZ2  1 1 
        1   170 1 1  10 LYS HZ3  H -48.561 -56.300 -10.401 1.00 . A A .  10 LYS HZ3  1 1 
        1   171 1 1  10 LYS N    N -48.795 -53.206 -14.516 1.00 . A A .  10 LYS N    1 1 
        1   172 1 1  10 LYS NZ   N -49.173 -56.285 -11.242 1.00 . A A .  10 LYS NZ   1 1 
        1   173 1 1  10 LYS O    O -46.338 -52.159 -13.784 1.00 . A A .  10 LYS O    1 1 
        1   174 1 1  11 GLY C    C -45.751 -48.319 -14.752 1.00 . A A .  11 GLY C    1 1 
        1   175 1 1  11 GLY CA   C -45.869 -49.451 -13.750 1.00 . A A .  11 GLY CA   1 1 
        1   176 1 1  11 GLY H    H -47.985 -49.513 -13.765 1.00 . A A .  11 GLY H    1 1 
        1   177 1 1  11 GLY HA2  H -45.678 -49.062 -12.760 1.00 . A A .  11 GLY HA2  1 1 
        1   178 1 1  11 GLY HA3  H -45.125 -50.198 -13.981 1.00 . A A .  11 GLY HA3  1 1 
        1   179 1 1  11 GLY N    N -47.179 -50.072 -13.765 1.00 . A A .  11 GLY N    1 1 
        1   180 1 1  11 GLY O    O -46.604 -48.163 -15.625 1.00 . A A .  11 GLY O    1 1 
        1   181 1 1  12 GLY C    C -44.136 -45.128 -14.804 1.00 . A A .  12 GLY C    1 1 
        1   182 1 1  12 GLY CA   C -44.488 -46.411 -15.531 1.00 . A A .  12 GLY CA   1 1 
        1   183 1 1  12 GLY H    H -44.045 -47.697 -13.908 1.00 . A A .  12 GLY H    1 1 
        1   184 1 1  12 GLY HA2  H -43.688 -46.658 -16.212 1.00 . A A .  12 GLY HA2  1 1 
        1   185 1 1  12 GLY HA3  H -45.393 -46.252 -16.098 1.00 . A A .  12 GLY HA3  1 1 
        1   186 1 1  12 GLY N    N -44.692 -47.525 -14.624 1.00 . A A .  12 GLY N    1 1 
        1   187 1 1  12 GLY O    O -44.976 -44.542 -14.120 1.00 . A A .  12 GLY O    1 1 
        1   188 1 1  13 LYS C    C -41.044 -43.074 -14.809 1.00 . A A .  13 LYS C    1 1 
        1   189 1 1  13 LYS CA   C -42.427 -43.470 -14.301 1.00 . A A .  13 LYS CA   1 1 
        1   190 1 1  13 LYS CB   C -42.390 -43.656 -12.783 1.00 . A A .  13 LYS CB   1 1 
        1   191 1 1  13 LYS CD   C -41.384 -41.791 -11.434 1.00 . A A .  13 LYS CD   1 1 
        1   192 1 1  13 LYS CE   C -41.650 -40.489 -10.695 1.00 . A A .  13 LYS CE   1 1 
        1   193 1 1  13 LYS CG   C -42.662 -42.380 -12.006 1.00 . A A .  13 LYS CG   1 1 
        1   194 1 1  13 LYS H    H -42.266 -45.200 -15.508 1.00 . A A .  13 LYS H    1 1 
        1   195 1 1  13 LYS HA   H -43.124 -42.681 -14.541 1.00 . A A .  13 LYS HA   1 1 
        1   196 1 1  13 LYS HB2  H -43.136 -44.401 -12.505 1.00 . A A .  13 LYS HB2  1 1 
        1   197 1 1  13 LYS HB3  H -41.412 -44.022 -12.501 1.00 . A A .  13 LYS HB3  1 1 
        1   198 1 1  13 LYS HD2  H -40.937 -42.507 -10.745 1.00 . A A .  13 LYS HD2  1 1 
        1   199 1 1  13 LYS HD3  H -40.693 -41.600 -12.243 1.00 . A A .  13 LYS HD3  1 1 
        1   200 1 1  13 LYS HE2  H -40.726 -39.913 -10.643 1.00 . A A .  13 LYS HE2  1 1 
        1   201 1 1  13 LYS HE3  H -42.389 -39.923 -11.245 1.00 . A A .  13 LYS HE3  1 1 
        1   202 1 1  13 LYS HG2  H -43.126 -41.650 -12.669 1.00 . A A .  13 LYS HG2  1 1 
        1   203 1 1  13 LYS HG3  H -43.339 -42.601 -11.193 1.00 . A A .  13 LYS HG3  1 1 
        1   204 1 1  13 LYS HZ1  H -41.427 -40.463  -8.618 1.00 . A A .  13 LYS HZ1  1 1 
        1   205 1 1  13 LYS HZ2  H -42.390 -41.733  -9.190 1.00 . A A .  13 LYS HZ2  1 1 
        1   206 1 1  13 LYS HZ3  H -43.008 -40.160  -9.141 1.00 . A A .  13 LYS HZ3  1 1 
        1   207 1 1  13 LYS N    N -42.890 -44.690 -14.950 1.00 . A A .  13 LYS N    1 1 
        1   208 1 1  13 LYS NZ   N -42.154 -40.728  -9.315 1.00 . A A .  13 LYS NZ   1 1 
        1   209 1 1  13 LYS O    O -40.246 -43.927 -15.193 1.00 . A A .  13 LYS O    1 1 
        1   210 1 1  14 GLY C    C -39.353 -39.782 -15.157 1.00 . A A .  14 GLY C    1 1 
        1   211 1 1  14 GLY CA   C -39.480 -41.288 -15.269 1.00 . A A .  14 GLY CA   1 1 
        1   212 1 1  14 GLY H    H -41.442 -41.137 -14.490 1.00 . A A .  14 GLY H    1 1 
        1   213 1 1  14 GLY HA2  H -38.701 -41.750 -14.681 1.00 . A A .  14 GLY HA2  1 1 
        1   214 1 1  14 GLY HA3  H -39.351 -41.572 -16.303 1.00 . A A .  14 GLY HA3  1 1 
        1   215 1 1  14 GLY N    N -40.767 -41.773 -14.808 1.00 . A A .  14 GLY N    1 1 
        1   216 1 1  14 GLY O    O -40.344 -39.060 -15.258 1.00 . A A .  14 GLY O    1 1 
        1   217 1 1  15 GLY C    C -36.897 -37.547 -13.730 1.00 . A A .  15 GLY C    1 1 
        1   218 1 1  15 GLY CA   C -37.899 -37.879 -14.818 1.00 . A A .  15 GLY CA   1 1 
        1   219 1 1  15 GLY H    H -37.377 -39.931 -14.871 1.00 . A A .  15 GLY H    1 1 
        1   220 1 1  15 GLY HA2  H -37.533 -37.501 -15.760 1.00 . A A .  15 GLY HA2  1 1 
        1   221 1 1  15 GLY HA3  H -38.837 -37.395 -14.588 1.00 . A A .  15 GLY HA3  1 1 
        1   222 1 1  15 GLY N    N -38.130 -39.306 -14.943 1.00 . A A .  15 GLY N    1 1 
        1   223 1 1  15 GLY O    O -35.759 -38.016 -13.761 1.00 . A A .  15 GLY O    1 1 
        1   224 1 1  16 ALA C    C -35.253 -35.539 -12.170 1.00 . A A .  16 ALA C    1 1 
        1   225 1 1  16 ALA CA   C -36.450 -36.338 -11.666 1.00 . A A .  16 ALA CA   1 1 
        1   226 1 1  16 ALA CB   C -35.981 -37.566 -10.898 1.00 . A A .  16 ALA CB   1 1 
        1   227 1 1  16 ALA H    H -38.237 -36.391 -12.799 1.00 . A A .  16 ALA H    1 1 
        1   228 1 1  16 ALA HA   H -37.026 -35.721 -10.991 1.00 . A A .  16 ALA HA   1 1 
        1   229 1 1  16 ALA HB1  H -35.601 -37.262  -9.933 1.00 . A A .  16 ALA HB1  1 1 
        1   230 1 1  16 ALA HB2  H -36.811 -38.244 -10.762 1.00 . A A .  16 ALA HB2  1 1 
        1   231 1 1  16 ALA HB3  H -35.199 -38.061 -11.454 1.00 . A A .  16 ALA HB3  1 1 
        1   232 1 1  16 ALA N    N -37.319 -36.734 -12.768 1.00 . A A .  16 ALA N    1 1 
        1   233 1 1  16 ALA O    O -35.005 -35.468 -13.374 1.00 . A A .  16 ALA O    1 1 
        1   234 1 1  17 ASP C    C -32.262 -35.016 -12.214 1.00 . A A .  17 ASP C    1 1 
        1   235 1 1  17 ASP CA   C -33.347 -34.143 -11.593 1.00 . A A .  17 ASP CA   1 1 
        1   236 1 1  17 ASP CB   C -32.798 -33.431 -10.355 1.00 . A A .  17 ASP CB   1 1 
        1   237 1 1  17 ASP CG   C -33.163 -31.959 -10.322 1.00 . A A .  17 ASP CG   1 1 
        1   238 1 1  17 ASP H    H -34.767 -35.031 -10.298 1.00 . A A .  17 ASP H    1 1 
        1   239 1 1  17 ASP HA   H -33.652 -33.402 -12.316 1.00 . A A .  17 ASP HA   1 1 
        1   240 1 1  17 ASP HB2  H -33.198 -33.914  -9.464 1.00 . A A .  17 ASP HB2  1 1 
        1   241 1 1  17 ASP HB3  H -31.720 -33.516 -10.346 1.00 . A A .  17 ASP HB3  1 1 
        1   242 1 1  17 ASP N    N -34.517 -34.937 -11.242 1.00 . A A .  17 ASP N    1 1 
        1   243 1 1  17 ASP O    O -32.434 -36.227 -12.361 1.00 . A A .  17 ASP O    1 1 
        1   244 1 1  17 ASP OD1  O -34.372 -31.649 -10.296 1.00 . A A .  17 ASP OD1  1 1 
        1   245 1 1  17 ASP OD2  O -32.239 -31.119 -10.326 1.00 . A A .  17 ASP OD2  1 1 
        1   246 1 1  18 CYS C    C -29.278 -35.934 -12.142 1.00 . A A .  18 CYS C    1 1 
        1   247 1 1  18 CYS CA   C -30.032 -35.116 -13.186 1.00 . A A .  18 CYS CA   1 1 
        1   248 1 1  18 CYS CB   C -29.076 -34.137 -13.870 1.00 . A A .  18 CYS CB   1 1 
        1   249 1 1  18 CYS H    H -31.066 -33.428 -12.435 1.00 . A A .  18 CYS H    1 1 
        1   250 1 1  18 CYS HA   H -30.437 -35.787 -13.928 1.00 . A A .  18 CYS HA   1 1 
        1   251 1 1  18 CYS HB2  H -29.621 -33.221 -14.098 1.00 . A A .  18 CYS HB2  1 1 
        1   252 1 1  18 CYS HB3  H -28.271 -33.898 -13.190 1.00 . A A .  18 CYS HB3  1 1 
        1   253 1 1  18 CYS HG   H -29.302 -35.040 -16.290 1.00 . A A .  18 CYS HG   1 1 
        1   254 1 1  18 CYS N    N -31.144 -34.395 -12.579 1.00 . A A .  18 CYS N    1 1 
        1   255 1 1  18 CYS O    O -28.476 -36.804 -12.481 1.00 . A A .  18 CYS O    1 1 
        1   256 1 1  18 CYS SG   S -28.336 -34.771 -15.408 1.00 . A A .  18 CYS SG   1 1 
        1   257 1 1  19 ALA C    C -27.393 -36.088  -9.760 1.00 . A A .  19 ALA C    1 1 
        1   258 1 1  19 ALA CA   C -28.894 -36.360  -9.777 1.00 . A A .  19 ALA CA   1 1 
        1   259 1 1  19 ALA CB   C -29.159 -37.855  -9.886 1.00 . A A .  19 ALA CB   1 1 
        1   260 1 1  19 ALA H    H -30.194 -34.946 -10.664 1.00 . A A .  19 ALA H    1 1 
        1   261 1 1  19 ALA HA   H -29.324 -36.011  -8.849 1.00 . A A .  19 ALA HA   1 1 
        1   262 1 1  19 ALA HB1  H -29.664 -38.063 -10.819 1.00 . A A .  19 ALA HB1  1 1 
        1   263 1 1  19 ALA HB2  H -28.221 -38.389  -9.857 1.00 . A A .  19 ALA HB2  1 1 
        1   264 1 1  19 ALA HB3  H -29.780 -38.171  -9.062 1.00 . A A .  19 ALA HB3  1 1 
        1   265 1 1  19 ALA N    N -29.544 -35.650 -10.871 1.00 . A A .  19 ALA N    1 1 
        1   266 1 1  19 ALA O    O -26.663 -36.530 -10.646 1.00 . A A .  19 ALA O    1 1 
        1   267 1 1  20 GLU C    C -25.036 -34.254  -9.840 1.00 . A A .  20 GLU C    1 1 
        1   268 1 1  20 GLU CA   C -25.528 -35.023  -8.617 1.00 . A A .  20 GLU CA   1 1 
        1   269 1 1  20 GLU CB   C -24.696 -36.294  -8.430 1.00 . A A .  20 GLU CB   1 1 
        1   270 1 1  20 GLU CD   C -22.853 -34.763  -7.631 1.00 . A A .  20 GLU CD   1 1 
        1   271 1 1  20 GLU CG   C -23.200 -36.040  -8.373 1.00 . A A .  20 GLU CG   1 1 
        1   272 1 1  20 GLU H    H -27.573 -35.031  -8.071 1.00 . A A .  20 GLU H    1 1 
        1   273 1 1  20 GLU HA   H -25.413 -34.398  -7.744 1.00 . A A .  20 GLU HA   1 1 
        1   274 1 1  20 GLU HB2  H -25.004 -36.780  -7.505 1.00 . A A .  20 GLU HB2  1 1 
        1   275 1 1  20 GLU HB3  H -24.894 -36.962  -9.256 1.00 . A A .  20 GLU HB3  1 1 
        1   276 1 1  20 GLU HG2  H -22.718 -36.880  -7.873 1.00 . A A .  20 GLU HG2  1 1 
        1   277 1 1  20 GLU HG3  H -22.820 -35.966  -9.380 1.00 . A A .  20 GLU HG3  1 1 
        1   278 1 1  20 GLU N    N -26.942 -35.356  -8.746 1.00 . A A .  20 GLU N    1 1 
        1   279 1 1  20 GLU O    O -24.377 -34.816 -10.715 1.00 . A A .  20 GLU O    1 1 
        1   280 1 1  20 GLU OE1  O -23.222 -34.647  -6.443 1.00 . A A .  20 GLU OE1  1 1 
        1   281 1 1  20 GLU OE2  O -22.214 -33.879  -8.239 1.00 . A A .  20 GLU OE2  1 1 
        1   282 1 1  21 TRP C    C -23.438 -31.927 -11.018 1.00 . A A .  21 TRP C    1 1 
        1   283 1 1  21 TRP CA   C -24.950 -32.121 -11.007 1.00 . A A .  21 TRP CA   1 1 
        1   284 1 1  21 TRP CB   C -25.651 -30.764 -10.929 1.00 . A A .  21 TRP CB   1 1 
        1   285 1 1  21 TRP CD1  C -28.126 -31.035 -10.323 1.00 . A A .  21 TRP CD1  1 1 
        1   286 1 1  21 TRP CD2  C -27.742 -30.714 -12.506 1.00 . A A .  21 TRP CD2  1 1 
        1   287 1 1  21 TRP CE2  C -29.131 -30.845 -12.308 1.00 . A A .  21 TRP CE2  1 1 
        1   288 1 1  21 TRP CE3  C -27.264 -30.501 -13.802 1.00 . A A .  21 TRP CE3  1 1 
        1   289 1 1  21 TRP CG   C -27.120 -30.836 -11.223 1.00 . A A .  21 TRP CG   1 1 
        1   290 1 1  21 TRP CH2  C -29.547 -30.566 -14.617 1.00 . A A .  21 TRP CH2  1 1 
        1   291 1 1  21 TRP CZ2  C -30.043 -30.775 -13.359 1.00 . A A .  21 TRP CZ2  1 1 
        1   292 1 1  21 TRP CZ3  C -28.170 -30.431 -14.844 1.00 . A A .  21 TRP CZ3  1 1 
        1   293 1 1  21 TRP H    H -25.884 -32.576  -9.164 1.00 . A A .  21 TRP H    1 1 
        1   294 1 1  21 TRP HA   H -25.243 -32.615 -11.922 1.00 . A A .  21 TRP HA   1 1 
        1   295 1 1  21 TRP HB2  H -25.513 -30.356  -9.928 1.00 . A A .  21 TRP HB2  1 1 
        1   296 1 1  21 TRP HB3  H -25.200 -30.092 -11.644 1.00 . A A .  21 TRP HB3  1 1 
        1   297 1 1  21 TRP HD1  H -27.978 -31.166  -9.262 1.00 . A A .  21 TRP HD1  1 1 
        1   298 1 1  21 TRP HE1  H -30.212 -31.166 -10.539 1.00 . A A .  21 TRP HE1  1 1 
        1   299 1 1  21 TRP HE3  H -26.207 -30.396 -13.996 1.00 . A A .  21 TRP HE3  1 1 
        1   300 1 1  21 TRP HH2  H -30.217 -30.506 -15.460 1.00 . A A .  21 TRP HH2  1 1 
        1   301 1 1  21 TRP HZ2  H -31.106 -30.876 -13.200 1.00 . A A .  21 TRP HZ2  1 1 
        1   302 1 1  21 TRP HZ3  H -27.818 -30.269 -15.851 1.00 . A A .  21 TRP HZ3  1 1 
        1   303 1 1  21 TRP N    N -25.359 -32.968  -9.892 1.00 . A A .  21 TRP N    1 1 
        1   304 1 1  21 TRP NE1  N -29.340 -31.042 -10.969 1.00 . A A .  21 TRP NE1  1 1 
        1   305 1 1  21 TRP O    O -22.835 -31.618  -9.988 1.00 . A A .  21 TRP O    1 1 
        1   306 1 1  22 LEU C    C -21.051 -30.672 -13.091 1.00 . A A .  22 LEU C    1 1 
        1   307 1 1  22 LEU CA   C -21.387 -31.949 -12.328 1.00 . A A .  22 LEU CA   1 1 
        1   308 1 1  22 LEU CB   C -20.792 -33.160 -13.050 1.00 . A A .  22 LEU CB   1 1 
        1   309 1 1  22 LEU CD1  C -20.702 -34.258 -15.301 1.00 . A A .  22 LEU CD1  1 1 
        1   310 1 1  22 LEU CD2  C -22.558 -34.809 -13.717 1.00 . A A .  22 LEU CD2  1 1 
        1   311 1 1  22 LEU CG   C -21.614 -33.721 -14.210 1.00 . A A .  22 LEU CG   1 1 
        1   312 1 1  22 LEU H    H -23.363 -32.351 -12.970 1.00 . A A .  22 LEU H    1 1 
        1   313 1 1  22 LEU HA   H -20.961 -31.886 -11.338 1.00 . A A .  22 LEU HA   1 1 
        1   314 1 1  22 LEU HB2  H -19.809 -32.882 -13.431 1.00 . A A .  22 LEU HB2  1 1 
        1   315 1 1  22 LEU HB3  H -20.663 -33.948 -12.322 1.00 . A A .  22 LEU HB3  1 1 
        1   316 1 1  22 LEU HD11 H -21.074 -35.212 -15.644 1.00 . A A .  22 LEU HD11 1 1 
        1   317 1 1  22 LEU HD12 H -19.704 -34.381 -14.907 1.00 . A A .  22 LEU HD12 1 1 
        1   318 1 1  22 LEU HD13 H -20.679 -33.563 -16.127 1.00 . A A .  22 LEU HD13 1 1 
        1   319 1 1  22 LEU HD21 H -23.192 -35.130 -14.531 1.00 . A A .  22 LEU HD21 1 1 
        1   320 1 1  22 LEU HD22 H -23.169 -34.419 -12.917 1.00 . A A .  22 LEU HD22 1 1 
        1   321 1 1  22 LEU HD23 H -21.982 -35.648 -13.355 1.00 . A A .  22 LEU HD23 1 1 
        1   322 1 1  22 LEU HG   H -22.212 -32.925 -14.637 1.00 . A A .  22 LEU HG   1 1 
        1   323 1 1  22 LEU N    N -22.830 -32.106 -12.185 1.00 . A A .  22 LEU N    1 1 
        1   324 1 1  22 LEU O    O -21.501 -30.475 -14.221 1.00 . A A .  22 LEU O    1 1 
        1   325 1 1  23 TYR C    C -18.378 -28.273 -12.858 1.00 . A A .  23 TYR C    1 1 
        1   326 1 1  23 TYR CA   C -19.859 -28.550 -13.089 1.00 . A A .  23 TYR CA   1 1 
        1   327 1 1  23 TYR CB   C -20.699 -27.398 -12.534 1.00 . A A .  23 TYR CB   1 1 
        1   328 1 1  23 TYR CD1  C -21.079 -28.135 -10.150 1.00 . A A .  23 TYR CD1  1 1 
        1   329 1 1  23 TYR CD2  C -22.982 -27.849 -11.555 1.00 . A A .  23 TYR CD2  1 1 
        1   330 1 1  23 TYR CE1  C -21.901 -28.507  -9.103 1.00 . A A .  23 TYR CE1  1 1 
        1   331 1 1  23 TYR CE2  C -23.812 -28.218 -10.514 1.00 . A A .  23 TYR CE2  1 1 
        1   332 1 1  23 TYR CG   C -21.603 -27.802 -11.392 1.00 . A A .  23 TYR CG   1 1 
        1   333 1 1  23 TYR CZ   C -23.266 -28.546  -9.290 1.00 . A A .  23 TYR CZ   1 1 
        1   334 1 1  23 TYR H    H -19.929 -30.022 -11.570 1.00 . A A .  23 TYR H    1 1 
        1   335 1 1  23 TYR HA   H -20.038 -28.634 -14.151 1.00 . A A .  23 TYR HA   1 1 
        1   336 1 1  23 TYR HB2  H -20.028 -26.612 -12.188 1.00 . A A .  23 TYR HB2  1 1 
        1   337 1 1  23 TYR HB3  H -21.320 -27.001 -13.323 1.00 . A A .  23 TYR HB3  1 1 
        1   338 1 1  23 TYR HD1  H -20.008 -28.104 -10.006 1.00 . A A .  23 TYR HD1  1 1 
        1   339 1 1  23 TYR HD2  H -23.406 -27.592 -12.514 1.00 . A A .  23 TYR HD2  1 1 
        1   340 1 1  23 TYR HE1  H -21.475 -28.763  -8.144 1.00 . A A .  23 TYR HE1  1 1 
        1   341 1 1  23 TYR HE2  H -24.882 -28.249 -10.660 1.00 . A A .  23 TYR HE2  1 1 
        1   342 1 1  23 TYR HH   H -23.993 -28.286  -7.529 1.00 . A A .  23 TYR HH   1 1 
        1   343 1 1  23 TYR N    N -20.255 -29.809 -12.469 1.00 . A A .  23 TYR N    1 1 
        1   344 1 1  23 TYR O    O -17.738 -28.908 -12.021 1.00 . A A .  23 TYR O    1 1 
        1   345 1 1  23 TYR OH   O -24.090 -28.913  -8.249 1.00 . A A .  23 TYR OH   1 1 
        1   346 1 1  24 GLY C    C -16.143 -25.551 -13.920 1.00 . A A .  24 GLY C    1 1 
        1   347 1 1  24 GLY CA   C -16.435 -26.967 -13.468 1.00 . A A .  24 GLY CA   1 1 
        1   348 1 1  24 GLY H    H -18.397 -26.841 -14.257 1.00 . A A .  24 GLY H    1 1 
        1   349 1 1  24 GLY HA2  H -16.151 -27.070 -12.432 1.00 . A A .  24 GLY HA2  1 1 
        1   350 1 1  24 GLY HA3  H -15.847 -27.651 -14.062 1.00 . A A .  24 GLY HA3  1 1 
        1   351 1 1  24 GLY N    N -17.838 -27.314 -13.607 1.00 . A A .  24 GLY N    1 1 
        1   352 1 1  24 GLY O    O -15.457 -24.799 -13.227 1.00 . A A .  24 GLY O    1 1 
        1   353 1 1  25 SER C    C -17.137 -22.793 -14.775 1.00 . A A .  25 SER C    1 1 
        1   354 1 1  25 SER CA   C -16.447 -23.849 -15.634 1.00 . A A .  25 SER CA   1 1 
        1   355 1 1  25 SER CB   C -16.968 -23.773 -17.071 1.00 . A A .  25 SER CB   1 1 
        1   356 1 1  25 SER H    H -17.200 -25.828 -15.594 1.00 . A A .  25 SER H    1 1 
        1   357 1 1  25 SER HA   H -15.386 -23.657 -15.635 1.00 . A A .  25 SER HA   1 1 
        1   358 1 1  25 SER HB2  H -16.188 -23.367 -17.715 1.00 . A A .  25 SER HB2  1 1 
        1   359 1 1  25 SER HB3  H -17.227 -24.766 -17.409 1.00 . A A .  25 SER HB3  1 1 
        1   360 1 1  25 SER HG   H -18.350 -22.816 -18.075 1.00 . A A .  25 SER HG   1 1 
        1   361 1 1  25 SER N    N -16.663 -25.183 -15.088 1.00 . A A .  25 SER N    1 1 
        1   362 1 1  25 SER O    O -18.330 -22.893 -14.485 1.00 . A A .  25 SER O    1 1 
        1   363 1 1  25 SER OG   O -18.117 -22.948 -17.154 1.00 . A A .  25 SER OG   1 1 
        1   364 1 1  26 CYS C    C -16.954 -19.391 -14.321 1.00 . A A .  26 CYS C    1 1 
        1   365 1 1  26 CYS CA   C -16.913 -20.704 -13.545 1.00 . A A .  26 CYS CA   1 1 
        1   366 1 1  26 CYS CB   C -16.068 -20.536 -12.281 1.00 . A A .  26 CYS CB   1 1 
        1   367 1 1  26 CYS H    H -15.434 -21.754 -14.635 1.00 . A A .  26 CYS H    1 1 
        1   368 1 1  26 CYS HA   H -17.919 -20.973 -13.262 1.00 . A A .  26 CYS HA   1 1 
        1   369 1 1  26 CYS HB2  H -15.055 -20.879 -12.491 1.00 . A A .  26 CYS HB2  1 1 
        1   370 1 1  26 CYS HB3  H -16.030 -19.488 -12.019 1.00 . A A .  26 CYS HB3  1 1 
        1   371 1 1  26 CYS HG   H -16.065 -22.616 -10.730 1.00 . A A .  26 CYS HG   1 1 
        1   372 1 1  26 CYS N    N -16.378 -21.780 -14.371 1.00 . A A .  26 CYS N    1 1 
        1   373 1 1  26 CYS O    O -16.003 -19.041 -15.020 1.00 . A A .  26 CYS O    1 1 
        1   374 1 1  26 CYS SG   S -16.703 -21.446 -10.835 1.00 . A A .  26 CYS SG   1 1 
        1   375 1 1  27 VAL C    C -18.156 -16.227 -13.901 1.00 . A A .  27 VAL C    1 1 
        1   376 1 1  27 VAL CA   C -18.228 -17.393 -14.881 1.00 . A A .  27 VAL CA   1 1 
        1   377 1 1  27 VAL CB   C -19.569 -17.332 -15.636 1.00 . A A .  27 VAL CB   1 1 
        1   378 1 1  27 VAL CG1  C -19.639 -16.083 -16.500 1.00 . A A .  27 VAL CG1  1 1 
        1   379 1 1  27 VAL CG2  C -19.761 -18.585 -16.479 1.00 . A A .  27 VAL CG2  1 1 
        1   380 1 1  27 VAL H    H -18.785 -19.000 -13.620 1.00 . A A .  27 VAL H    1 1 
        1   381 1 1  27 VAL HA   H -17.429 -17.296 -15.601 1.00 . A A .  27 VAL HA   1 1 
        1   382 1 1  27 VAL HB   H -20.366 -17.287 -14.909 1.00 . A A .  27 VAL HB   1 1 
        1   383 1 1  27 VAL HG11 H -18.645 -15.818 -16.831 1.00 . A A .  27 VAL HG11 1 1 
        1   384 1 1  27 VAL HG12 H -20.267 -16.273 -17.358 1.00 . A A .  27 VAL HG12 1 1 
        1   385 1 1  27 VAL HG13 H -20.053 -15.270 -15.923 1.00 . A A .  27 VAL HG13 1 1 
        1   386 1 1  27 VAL HG21 H -19.916 -19.435 -15.830 1.00 . A A .  27 VAL HG21 1 1 
        1   387 1 1  27 VAL HG22 H -20.622 -18.457 -17.118 1.00 . A A .  27 VAL HG22 1 1 
        1   388 1 1  27 VAL HG23 H -18.883 -18.752 -17.085 1.00 . A A .  27 VAL HG23 1 1 
        1   389 1 1  27 VAL N    N -18.062 -18.668 -14.193 1.00 . A A .  27 VAL N    1 1 
        1   390 1 1  27 VAL O    O -18.842 -16.219 -12.880 1.00 . A A .  27 VAL O    1 1 
        1   391 1 1  28 ALA C    C -18.193 -13.002 -13.709 1.00 . A A .  28 ALA C    1 1 
        1   392 1 1  28 ALA CA   C -17.160 -14.071 -13.369 1.00 . A A .  28 ALA CA   1 1 
        1   393 1 1  28 ALA CB   C -15.753 -13.511 -13.504 1.00 . A A .  28 ALA CB   1 1 
        1   394 1 1  28 ALA H    H -16.800 -15.309 -15.048 1.00 . A A .  28 ALA H    1 1 
        1   395 1 1  28 ALA HA   H -17.301 -14.381 -12.343 1.00 . A A .  28 ALA HA   1 1 
        1   396 1 1  28 ALA HB1  H -15.163 -14.165 -14.129 1.00 . A A .  28 ALA HB1  1 1 
        1   397 1 1  28 ALA HB2  H -15.797 -12.529 -13.951 1.00 . A A .  28 ALA HB2  1 1 
        1   398 1 1  28 ALA HB3  H -15.298 -13.440 -12.527 1.00 . A A .  28 ALA HB3  1 1 
        1   399 1 1  28 ALA N    N -17.320 -15.245 -14.220 1.00 . A A .  28 ALA N    1 1 
        1   400 1 1  28 ALA O    O -18.380 -12.655 -14.875 1.00 . A A .  28 ALA O    1 1 
        1   401 1 1  29 ASN C    C -19.239 -10.072 -12.960 1.00 . A A .  29 ASN C    1 1 
        1   402 1 1  29 ASN CA   C -19.876 -11.455 -12.874 1.00 . A A .  29 ASN CA   1 1 
        1   403 1 1  29 ASN CB   C -20.891 -11.491 -11.729 1.00 . A A .  29 ASN CB   1 1 
        1   404 1 1  29 ASN CG   C -22.227 -12.065 -12.159 1.00 . A A .  29 ASN CG   1 1 
        1   405 1 1  29 ASN H    H -18.666 -12.802 -11.777 1.00 . A A .  29 ASN H    1 1 
        1   406 1 1  29 ASN HA   H -20.387 -11.661 -13.803 1.00 . A A .  29 ASN HA   1 1 
        1   407 1 1  29 ASN HB2  H -20.489 -12.101 -10.920 1.00 . A A .  29 ASN HB2  1 1 
        1   408 1 1  29 ASN HB3  H -21.051 -10.488 -11.364 1.00 . A A .  29 ASN HB3  1 1 
        1   409 1 1  29 ASN HD21 H -22.690 -10.362 -13.076 1.00 . A A .  29 ASN HD21 1 1 
        1   410 1 1  29 ASN HD22 H -23.882 -11.609 -13.162 1.00 . A A .  29 ASN HD22 1 1 
        1   411 1 1  29 ASN N    N -18.861 -12.484 -12.684 1.00 . A A .  29 ASN N    1 1 
        1   412 1 1  29 ASN ND2  N -23.013 -11.265 -12.871 1.00 . A A .  29 ASN ND2  1 1 
        1   413 1 1  29 ASN O    O -19.613  -9.255 -13.800 1.00 . A A .  29 ASN O    1 1 
        1   414 1 1  29 ASN OD1  O -22.549 -13.213 -11.857 1.00 . A A .  29 ASN OD1  1 1 
        1   415 1 1  30 ASN C    C -16.901  -8.254 -13.396 1.00 . A A .  30 ASN C    1 1 
        1   416 1 1  30 ASN CA   C -17.582  -8.532 -12.059 1.00 . A A .  30 ASN CA   1 1 
        1   417 1 1  30 ASN CB   C -16.547  -8.506 -10.932 1.00 . A A .  30 ASN CB   1 1 
        1   418 1 1  30 ASN CG   C -16.911  -7.523  -9.836 1.00 . A A .  30 ASN CG   1 1 
        1   419 1 1  30 ASN H    H -18.017 -10.507 -11.437 1.00 . A A .  30 ASN H    1 1 
        1   420 1 1  30 ASN HA   H -18.319  -7.763 -11.878 1.00 . A A .  30 ASN HA   1 1 
        1   421 1 1  30 ASN HB2  H -16.470  -9.504 -10.500 1.00 . A A .  30 ASN HB2  1 1 
        1   422 1 1  30 ASN HB3  H -15.587  -8.226 -11.340 1.00 . A A .  30 ASN HB3  1 1 
        1   423 1 1  30 ASN HD21 H -18.744  -8.285  -9.726 1.00 . A A .  30 ASN HD21 1 1 
        1   424 1 1  30 ASN HD22 H -18.406  -6.981  -8.645 1.00 . A A .  30 ASN HD22 1 1 
        1   425 1 1  30 ASN N    N -18.272  -9.816 -12.083 1.00 . A A .  30 ASN N    1 1 
        1   426 1 1  30 ASN ND2  N -18.145  -7.604  -9.354 1.00 . A A .  30 ASN ND2  1 1 
        1   427 1 1  30 ASN O    O -16.815  -7.108 -13.835 1.00 . A A .  30 ASN O    1 1 
        1   428 1 1  30 ASN OD1  O -16.090  -6.700  -9.427 1.00 . A A .  30 ASN OD1  1 1 
        1   429 1 1  31 GLY C    C -14.466  -9.960 -15.401 1.00 . A A .  31 GLY C    1 1 
        1   430 1 1  31 GLY CA   C -15.754  -9.164 -15.321 1.00 . A A .  31 GLY CA   1 1 
        1   431 1 1  31 GLY H    H -16.518 -10.204 -13.642 1.00 . A A .  31 GLY H    1 1 
        1   432 1 1  31 GLY HA2  H -16.421  -9.497 -16.101 1.00 . A A .  31 GLY HA2  1 1 
        1   433 1 1  31 GLY HA3  H -15.527  -8.119 -15.475 1.00 . A A .  31 GLY HA3  1 1 
        1   434 1 1  31 GLY N    N -16.420  -9.313 -14.039 1.00 . A A .  31 GLY N    1 1 
        1   435 1 1  31 GLY O    O -14.370 -10.921 -16.164 1.00 . A A .  31 GLY O    1 1 
        1   436 1 1  32 ASP C    C -12.222 -11.450 -13.669 1.00 . A A .  32 ASP C    1 1 
        1   437 1 1  32 ASP CA   C -12.186 -10.242 -14.599 1.00 . A A .  32 ASP CA   1 1 
        1   438 1 1  32 ASP CB   C -11.080  -9.279 -14.163 1.00 . A A .  32 ASP CB   1 1 
        1   439 1 1  32 ASP CG   C  -9.723  -9.668 -14.716 1.00 . A A .  32 ASP CG   1 1 
        1   440 1 1  32 ASP H    H -13.613  -8.786 -14.027 1.00 . A A .  32 ASP H    1 1 
        1   441 1 1  32 ASP HA   H -11.980 -10.582 -15.603 1.00 . A A .  32 ASP HA   1 1 
        1   442 1 1  32 ASP HB2  H -11.328  -8.275 -14.507 1.00 . A A .  32 ASP HB2  1 1 
        1   443 1 1  32 ASP HB3  H -11.021  -9.275 -13.084 1.00 . A A .  32 ASP HB3  1 1 
        1   444 1 1  32 ASP N    N -13.475  -9.559 -14.613 1.00 . A A .  32 ASP N    1 1 
        1   445 1 1  32 ASP O    O -12.071 -12.590 -14.110 1.00 . A A .  32 ASP O    1 1 
        1   446 1 1  32 ASP OD1  O  -9.441 -10.881 -14.800 1.00 . A A .  32 ASP OD1  1 1 
        1   447 1 1  32 ASP OD2  O  -8.944  -8.757 -15.067 1.00 . A A .  32 ASP OD2  1 1 
        1   448 1 1  33 CYS C    C -13.293 -11.831 -10.172 1.00 . A A .  33 CYS C    1 1 
        1   449 1 1  33 CYS CA   C -12.476 -12.261 -11.388 1.00 . A A .  33 CYS CA   1 1 
        1   450 1 1  33 CYS CB   C -11.063 -12.653 -10.952 1.00 . A A .  33 CYS CB   1 1 
        1   451 1 1  33 CYS H    H -12.536 -10.264 -12.090 1.00 . A A .  33 CYS H    1 1 
        1   452 1 1  33 CYS HA   H -12.953 -13.114 -11.844 1.00 . A A .  33 CYS HA   1 1 
        1   453 1 1  33 CYS HB2  H -11.113 -13.082  -9.952 1.00 . A A .  33 CYS HB2  1 1 
        1   454 1 1  33 CYS HB3  H -10.681 -13.402 -11.630 1.00 . A A .  33 CYS HB3  1 1 
        1   455 1 1  33 CYS HG   H -10.469 -10.185 -10.417 1.00 . A A .  33 CYS HG   1 1 
        1   456 1 1  33 CYS N    N -12.423 -11.194 -12.381 1.00 . A A .  33 CYS N    1 1 
        1   457 1 1  33 CYS O    O -13.341 -10.650  -9.829 1.00 . A A .  33 CYS O    1 1 
        1   458 1 1  33 CYS SG   S  -9.880 -11.268 -10.933 1.00 . A A .  33 CYS SG   1 1 
        1   459 1 1  34 GLY C    C -15.952 -13.405  -8.243 1.00 . A A .  34 GLY C    1 1 
        1   460 1 1  34 GLY CA   C -14.741 -12.502  -8.356 1.00 . A A .  34 GLY CA   1 1 
        1   461 1 1  34 GLY H    H -13.860 -13.723  -9.846 1.00 . A A .  34 GLY H    1 1 
        1   462 1 1  34 GLY HA2  H -14.132 -12.621  -7.473 1.00 . A A .  34 GLY HA2  1 1 
        1   463 1 1  34 GLY HA3  H -15.076 -11.476  -8.415 1.00 . A A .  34 GLY HA3  1 1 
        1   464 1 1  34 GLY N    N -13.935 -12.799  -9.526 1.00 . A A .  34 GLY N    1 1 
        1   465 1 1  34 GLY O    O -16.143 -14.305  -9.060 1.00 . A A .  34 GLY O    1 1 
        1   466 1 1  35 GLN C    C -18.983 -13.753  -8.128 1.00 . A A .  35 GLN C    1 1 
        1   467 1 1  35 GLN CA   C -17.971 -13.969  -7.006 1.00 . A A .  35 GLN CA   1 1 
        1   468 1 1  35 GLN CB   C -18.606 -13.620  -5.658 1.00 . A A .  35 GLN CB   1 1 
        1   469 1 1  35 GLN CD   C -21.046 -14.234  -5.871 1.00 . A A .  35 GLN CD   1 1 
        1   470 1 1  35 GLN CG   C -19.711 -14.576  -5.241 1.00 . A A .  35 GLN CG   1 1 
        1   471 1 1  35 GLN H    H -16.568 -12.436  -6.606 1.00 . A A .  35 GLN H    1 1 
        1   472 1 1  35 GLN HA   H -17.679 -15.007  -6.998 1.00 . A A .  35 GLN HA   1 1 
        1   473 1 1  35 GLN HB2  H -17.829 -13.630  -4.894 1.00 . A A .  35 GLN HB2  1 1 
        1   474 1 1  35 GLN HB3  H -19.022 -12.624  -5.715 1.00 . A A .  35 GLN HB3  1 1 
        1   475 1 1  35 GLN HE21 H -21.266 -12.693  -4.635 1.00 . A A .  35 GLN HE21 1 1 
        1   476 1 1  35 GLN HE22 H -22.551 -12.940  -5.761 1.00 . A A .  35 GLN HE22 1 1 
        1   477 1 1  35 GLN HG2  H -19.431 -15.588  -5.531 1.00 . A A .  35 GLN HG2  1 1 
        1   478 1 1  35 GLN HG3  H -19.817 -14.536  -4.167 1.00 . A A .  35 GLN HG3  1 1 
        1   479 1 1  35 GLN N    N -16.773 -13.167  -7.224 1.00 . A A .  35 GLN N    1 1 
        1   480 1 1  35 GLN NE2  N -21.687 -13.183  -5.372 1.00 . A A .  35 GLN NE2  1 1 
        1   481 1 1  35 GLN O    O -19.486 -12.647  -8.318 1.00 . A A .  35 GLN O    1 1 
        1   482 1 1  35 GLN OE1  O -21.499 -14.908  -6.798 1.00 . A A .  35 GLN OE1  1 1 
        1   483 1 1  36 GLY C    C -21.101 -15.956 -10.074 1.00 . A A .  36 GLY C    1 1 
        1   484 1 1  36 GLY CA   C -20.225 -14.726  -9.960 1.00 . A A .  36 GLY CA   1 1 
        1   485 1 1  36 GLY H    H -18.842 -15.676  -8.668 1.00 . A A .  36 GLY H    1 1 
        1   486 1 1  36 GLY HA2  H -20.854 -13.862  -9.803 1.00 . A A .  36 GLY HA2  1 1 
        1   487 1 1  36 GLY HA3  H -19.680 -14.598 -10.884 1.00 . A A .  36 GLY HA3  1 1 
        1   488 1 1  36 GLY N    N -19.276 -14.819  -8.866 1.00 . A A .  36 GLY N    1 1 
        1   489 1 1  36 GLY O    O -21.370 -16.629  -9.080 1.00 . A A .  36 GLY O    1 1 
        1   490 1 1  37 MET C    C -21.644 -18.492 -12.300 1.00 . A A .  37 MET C    1 1 
        1   491 1 1  37 MET CA   C -22.399 -17.412 -11.530 1.00 . A A .  37 MET CA   1 1 
        1   492 1 1  37 MET CB   C -23.652 -16.999 -12.305 1.00 . A A .  37 MET CB   1 1 
        1   493 1 1  37 MET CE   C -27.103 -16.883 -13.270 1.00 . A A .  37 MET CE   1 1 
        1   494 1 1  37 MET CG   C -24.817 -17.961 -12.134 1.00 . A A .  37 MET CG   1 1 
        1   495 1 1  37 MET H    H -21.298 -15.679 -12.045 1.00 . A A .  37 MET H    1 1 
        1   496 1 1  37 MET HA   H -22.694 -17.810 -10.572 1.00 . A A .  37 MET HA   1 1 
        1   497 1 1  37 MET HB2  H -23.962 -16.010 -11.967 1.00 . A A .  37 MET HB2  1 1 
        1   498 1 1  37 MET HB3  H -23.410 -16.946 -13.356 1.00 . A A .  37 MET HB3  1 1 
        1   499 1 1  37 MET HE1  H -26.878 -17.727 -13.906 1.00 . A A .  37 MET HE1  1 1 
        1   500 1 1  37 MET HE2  H -28.172 -16.795 -13.153 1.00 . A A .  37 MET HE2  1 1 
        1   501 1 1  37 MET HE3  H -26.714 -15.981 -13.719 1.00 . A A .  37 MET HE3  1 1 
        1   502 1 1  37 MET HG2  H -24.978 -18.492 -13.072 1.00 . A A .  37 MET HG2  1 1 
        1   503 1 1  37 MET HG3  H -24.564 -18.677 -11.364 1.00 . A A .  37 MET HG3  1 1 
        1   504 1 1  37 MET N    N -21.547 -16.252 -11.290 1.00 . A A .  37 MET N    1 1 
        1   505 1 1  37 MET O    O -20.559 -18.247 -12.827 1.00 . A A .  37 MET O    1 1 
        1   506 1 1  37 MET SD   S -26.345 -17.124 -11.665 1.00 . A A .  37 MET SD   1 1 
        1   507 1 1  38 ARG C    C -22.663 -21.677 -13.732 1.00 . A A .  38 ARG C    1 1 
        1   508 1 1  38 ARG CA   C -21.605 -20.802 -13.064 1.00 . A A .  38 ARG CA   1 1 
        1   509 1 1  38 ARG CB   C -20.770 -21.642 -12.096 1.00 . A A .  38 ARG CB   1 1 
        1   510 1 1  38 ARG CD   C -19.351 -23.707 -11.897 1.00 . A A .  38 ARG CD   1 1 
        1   511 1 1  38 ARG CG   C -20.572 -23.079 -12.553 1.00 . A A .  38 ARG CG   1 1 
        1   512 1 1  38 ARG CZ   C -18.729 -24.468  -9.642 1.00 . A A .  38 ARG CZ   1 1 
        1   513 1 1  38 ARG H    H -23.090 -19.819 -11.920 1.00 . A A .  38 ARG H    1 1 
        1   514 1 1  38 ARG HA   H -20.957 -20.395 -13.825 1.00 . A A .  38 ARG HA   1 1 
        1   515 1 1  38 ARG HB2  H -19.792 -21.173 -11.981 1.00 . A A .  38 ARG HB2  1 1 
        1   516 1 1  38 ARG HB3  H -21.261 -21.657 -11.136 1.00 . A A .  38 ARG HB3  1 1 
        1   517 1 1  38 ARG HD2  H -19.267 -24.744 -12.222 1.00 . A A .  38 ARG HD2  1 1 
        1   518 1 1  38 ARG HD3  H -18.472 -23.166 -12.212 1.00 . A A .  38 ARG HD3  1 1 
        1   519 1 1  38 ARG HE   H -20.042 -23.019 -10.035 1.00 . A A .  38 ARG HE   1 1 
        1   520 1 1  38 ARG HG2  H -21.456 -23.661 -12.294 1.00 . A A .  38 ARG HG2  1 1 
        1   521 1 1  38 ARG HG3  H -20.440 -23.092 -13.624 1.00 . A A .  38 ARG HG3  1 1 
        1   522 1 1  38 ARG HH11 H -17.795 -25.431 -11.153 1.00 . A A .  38 ARG HH11 1 1 
        1   523 1 1  38 ARG HH12 H -17.367 -25.957  -9.560 1.00 . A A .  38 ARG HH12 1 1 
        1   524 1 1  38 ARG HH21 H -19.487 -23.703  -7.932 1.00 . A A .  38 ARG HH21 1 1 
        1   525 1 1  38 ARG HH22 H -18.329 -24.975  -7.728 1.00 . A A .  38 ARG HH22 1 1 
        1   526 1 1  38 ARG N    N -22.224 -19.686 -12.360 1.00 . A A .  38 ARG N    1 1 
        1   527 1 1  38 ARG NE   N -19.433 -23.670 -10.438 1.00 . A A .  38 ARG NE   1 1 
        1   528 1 1  38 ARG NH1  N -17.896 -25.358 -10.162 1.00 . A A .  38 ARG NH1  1 1 
        1   529 1 1  38 ARG NH2  N -18.859 -24.374  -8.326 1.00 . A A .  38 ARG NH2  1 1 
        1   530 1 1  38 ARG O    O -23.712 -21.950 -13.152 1.00 . A A .  38 ARG O    1 1 
        1   531 1 1  39 GLU C    C -22.737 -24.363 -15.875 1.00 . A A .  39 GLU C    1 1 
        1   532 1 1  39 GLU CA   C -23.302 -22.954 -15.701 1.00 . A A .  39 GLU CA   1 1 
        1   533 1 1  39 GLU CB   C -23.597 -22.339 -17.070 1.00 . A A .  39 GLU CB   1 1 
        1   534 1 1  39 GLU CD   C -24.548 -20.046 -17.541 1.00 . A A .  39 GLU CD   1 1 
        1   535 1 1  39 GLU CG   C -24.839 -21.463 -17.088 1.00 . A A .  39 GLU CG   1 1 
        1   536 1 1  39 GLU H    H -21.521 -21.862 -15.364 1.00 . A A .  39 GLU H    1 1 
        1   537 1 1  39 GLU HA   H -24.221 -23.016 -15.138 1.00 . A A .  39 GLU HA   1 1 
        1   538 1 1  39 GLU HB2  H -22.740 -21.736 -17.374 1.00 . A A .  39 GLU HB2  1 1 
        1   539 1 1  39 GLU HB3  H -23.733 -23.134 -17.788 1.00 . A A .  39 GLU HB3  1 1 
        1   540 1 1  39 GLU HG2  H -25.572 -21.906 -17.762 1.00 . A A .  39 GLU HG2  1 1 
        1   541 1 1  39 GLU HG3  H -25.255 -21.431 -16.092 1.00 . A A .  39 GLU HG3  1 1 
        1   542 1 1  39 GLU N    N -22.376 -22.113 -14.955 1.00 . A A .  39 GLU N    1 1 
        1   543 1 1  39 GLU O    O -21.707 -24.555 -16.520 1.00 . A A .  39 GLU O    1 1 
        1   544 1 1  39 GLU OE1  O -23.511 -19.492 -17.121 1.00 . A A .  39 GLU OE1  1 1 
        1   545 1 1  39 GLU OE2  O -25.356 -19.491 -18.314 1.00 . A A .  39 GLU OE2  1 1 
        1   546 1 1  40 GLY C    C -23.866 -27.555 -16.296 1.00 . A A .  40 GLY C    1 1 
        1   547 1 1  40 GLY CA   C -22.975 -26.721 -15.398 1.00 . A A .  40 GLY CA   1 1 
        1   548 1 1  40 GLY H    H -24.237 -25.132 -14.795 1.00 . A A .  40 GLY H    1 1 
        1   549 1 1  40 GLY HA2  H -21.970 -26.733 -15.795 1.00 . A A .  40 GLY HA2  1 1 
        1   550 1 1  40 GLY HA3  H -22.966 -27.159 -14.411 1.00 . A A .  40 GLY HA3  1 1 
        1   551 1 1  40 GLY N    N -23.422 -25.345 -15.296 1.00 . A A .  40 GLY N    1 1 
        1   552 1 1  40 GLY O    O -25.053 -27.266 -16.448 1.00 . A A .  40 GLY O    1 1 
        1   553 1 1  41 THR C    C -23.997 -30.918 -17.299 1.00 . A A .  41 THR C    1 1 
        1   554 1 1  41 THR CA   C -24.044 -29.473 -17.784 1.00 . A A .  41 THR CA   1 1 
        1   555 1 1  41 THR CB   C -23.502 -29.409 -19.225 1.00 . A A .  41 THR CB   1 1 
        1   556 1 1  41 THR CG2  C -22.002 -29.662 -19.251 1.00 . A A .  41 THR CG2  1 1 
        1   557 1 1  41 THR H    H -22.344 -28.776 -16.734 1.00 . A A .  41 THR H    1 1 
        1   558 1 1  41 THR HA   H -25.071 -29.140 -17.793 1.00 . A A .  41 THR HA   1 1 
        1   559 1 1  41 THR HB   H -23.692 -28.422 -19.621 1.00 . A A .  41 THR HB   1 1 
        1   560 1 1  41 THR HG1  H -24.076 -30.133 -20.967 1.00 . A A .  41 THR HG1  1 1 
        1   561 1 1  41 THR HG21 H -21.765 -30.337 -20.060 1.00 . A A .  41 THR HG21 1 1 
        1   562 1 1  41 THR HG22 H -21.695 -30.104 -18.314 1.00 . A A .  41 THR HG22 1 1 
        1   563 1 1  41 THR HG23 H -21.481 -28.728 -19.396 1.00 . A A .  41 THR HG23 1 1 
        1   564 1 1  41 THR N    N -23.294 -28.595 -16.895 1.00 . A A .  41 THR N    1 1 
        1   565 1 1  41 THR O    O -22.950 -31.407 -16.875 1.00 . A A .  41 THR O    1 1 
        1   566 1 1  41 THR OG1  O -24.168 -30.377 -20.043 1.00 . A A .  41 THR OG1  1 1 
        1   567 1 1  42 CYS C    C -26.060 -33.809 -17.915 1.00 . A A .  42 CYS C    1 1 
        1   568 1 1  42 CYS CA   C -25.226 -32.987 -16.935 1.00 . A A .  42 CYS CA   1 1 
        1   569 1 1  42 CYS CB   C -25.836 -33.070 -15.535 1.00 . A A .  42 CYS CB   1 1 
        1   570 1 1  42 CYS H    H -25.939 -31.153 -17.715 1.00 . A A .  42 CYS H    1 1 
        1   571 1 1  42 CYS HA   H -24.225 -33.390 -16.907 1.00 . A A .  42 CYS HA   1 1 
        1   572 1 1  42 CYS HB2  H -25.128 -32.648 -14.821 1.00 . A A .  42 CYS HB2  1 1 
        1   573 1 1  42 CYS HB3  H -26.742 -32.482 -15.510 1.00 . A A .  42 CYS HB3  1 1 
        1   574 1 1  42 CYS HG   H -25.155 -35.378 -14.568 1.00 . A A .  42 CYS HG   1 1 
        1   575 1 1  42 CYS N    N -25.136 -31.597 -17.366 1.00 . A A .  42 CYS N    1 1 
        1   576 1 1  42 CYS O    O -27.261 -33.587 -18.060 1.00 . A A .  42 CYS O    1 1 
        1   577 1 1  42 CYS SG   S -26.256 -34.761 -15.006 1.00 . A A .  42 CYS SG   1 1 
        1   578 1 1  43 ASN C    C -26.516 -34.813 -20.778 1.00 . A A .  43 ASN C    1 1 
        1   579 1 1  43 ASN CA   C -26.092 -35.611 -19.550 1.00 . A A .  43 ASN CA   1 1 
        1   580 1 1  43 ASN CB   C -27.315 -36.268 -18.908 1.00 . A A .  43 ASN CB   1 1 
        1   581 1 1  43 ASN CG   C -27.159 -37.770 -18.767 1.00 . A A .  43 ASN CG   1 1 
        1   582 1 1  43 ASN H    H -24.453 -34.885 -18.424 1.00 . A A .  43 ASN H    1 1 
        1   583 1 1  43 ASN HA   H -25.400 -36.380 -19.856 1.00 . A A .  43 ASN HA   1 1 
        1   584 1 1  43 ASN HB2  H -27.472 -35.834 -17.920 1.00 . A A .  43 ASN HB2  1 1 
        1   585 1 1  43 ASN HB3  H -28.184 -36.071 -19.518 1.00 . A A .  43 ASN HB3  1 1 
        1   586 1 1  43 ASN HD21 H -28.515 -38.071 -20.190 1.00 . A A .  43 ASN HD21 1 1 
        1   587 1 1  43 ASN HD22 H -27.828 -39.494 -19.495 1.00 . A A .  43 ASN HD22 1 1 
        1   588 1 1  43 ASN N    N -25.411 -34.757 -18.583 1.00 . A A .  43 ASN N    1 1 
        1   589 1 1  43 ASN ND2  N -27.909 -38.522 -19.564 1.00 . A A .  43 ASN ND2  1 1 
        1   590 1 1  43 ASN O    O -25.886 -34.895 -21.832 1.00 . A A .  43 ASN O    1 1 
        1   591 1 1  43 ASN OD1  O -26.370 -38.249 -17.951 1.00 . A A .  43 ASN OD1  1 1 
        1   592 1 1  44 GLU C    C -28.912 -32.049 -21.207 1.00 . A A .  44 GLU C    1 1 
        1   593 1 1  44 GLU CA   C -28.096 -33.227 -21.734 1.00 . A A .  44 GLU CA   1 1 
        1   594 1 1  44 GLU CB   C -28.955 -34.077 -22.672 1.00 . A A .  44 GLU CB   1 1 
        1   595 1 1  44 GLU CD   C -29.596 -34.612 -25.056 1.00 . A A .  44 GLU CD   1 1 
        1   596 1 1  44 GLU CG   C -28.834 -33.680 -24.134 1.00 . A A .  44 GLU CG   1 1 
        1   597 1 1  44 GLU H    H -28.049 -34.017 -19.770 1.00 . A A .  44 GLU H    1 1 
        1   598 1 1  44 GLU HA   H -27.249 -32.845 -22.282 1.00 . A A .  44 GLU HA   1 1 
        1   599 1 1  44 GLU HB2  H -28.658 -35.121 -22.568 1.00 . A A .  44 GLU HB2  1 1 
        1   600 1 1  44 GLU HB3  H -29.990 -33.981 -22.379 1.00 . A A .  44 GLU HB3  1 1 
        1   601 1 1  44 GLU HG2  H -29.218 -32.668 -24.259 1.00 . A A .  44 GLU HG2  1 1 
        1   602 1 1  44 GLU HG3  H -27.790 -33.696 -24.413 1.00 . A A .  44 GLU HG3  1 1 
        1   603 1 1  44 GLU N    N -27.588 -34.040 -20.635 1.00 . A A .  44 GLU N    1 1 
        1   604 1 1  44 GLU O    O -29.821 -31.563 -21.879 1.00 . A A .  44 GLU O    1 1 
        1   605 1 1  44 GLU OE1  O -29.021 -35.645 -25.462 1.00 . A A .  44 GLU OE1  1 1 
        1   606 1 1  44 GLU OE2  O -30.765 -34.309 -25.373 1.00 . A A .  44 GLU OE2  1 1 
        1   607 1 1  45 GLN C    C -28.297 -29.480 -18.790 1.00 . A A .  45 GLN C    1 1 
        1   608 1 1  45 GLN CA   C -29.283 -30.480 -19.384 1.00 . A A .  45 GLN CA   1 1 
        1   609 1 1  45 GLN CB   C -30.235 -30.985 -18.298 1.00 . A A .  45 GLN CB   1 1 
        1   610 1 1  45 GLN CD   C -31.999 -32.666 -17.634 1.00 . A A .  45 GLN CD   1 1 
        1   611 1 1  45 GLN CG   C -31.085 -32.165 -18.736 1.00 . A A .  45 GLN CG   1 1 
        1   612 1 1  45 GLN H    H -27.846 -32.029 -19.516 1.00 . A A .  45 GLN H    1 1 
        1   613 1 1  45 GLN HA   H -29.857 -29.986 -20.153 1.00 . A A .  45 GLN HA   1 1 
        1   614 1 1  45 GLN HB2  H -29.648 -31.280 -17.428 1.00 . A A .  45 GLN HB2  1 1 
        1   615 1 1  45 GLN HB3  H -30.895 -30.179 -18.013 1.00 . A A .  45 GLN HB3  1 1 
        1   616 1 1  45 GLN HE21 H -32.758 -34.040 -18.854 1.00 . A A .  45 GLN HE21 1 1 
        1   617 1 1  45 GLN HE22 H -33.402 -34.022 -17.251 1.00 . A A .  45 GLN HE22 1 1 
        1   618 1 1  45 GLN HG2  H -31.692 -31.866 -19.590 1.00 . A A .  45 GLN HG2  1 1 
        1   619 1 1  45 GLN HG3  H -30.432 -32.972 -19.035 1.00 . A A .  45 GLN HG3  1 1 
        1   620 1 1  45 GLN N    N -28.580 -31.599 -20.002 1.00 . A A .  45 GLN N    1 1 
        1   621 1 1  45 GLN NE2  N -32.801 -33.678 -17.944 1.00 . A A .  45 GLN NE2  1 1 
        1   622 1 1  45 GLN O    O -27.116 -29.783 -18.618 1.00 . A A .  45 GLN O    1 1 
        1   623 1 1  45 GLN OE1  O -31.984 -32.149 -16.516 1.00 . A A .  45 GLN OE1  1 1 
        1   624 1 1  46 THR C    C -28.390 -26.905 -16.479 1.00 . A A .  46 THR C    1 1 
        1   625 1 1  46 THR CA   C -27.953 -27.240 -17.901 1.00 . A A .  46 THR CA   1 1 
        1   626 1 1  46 THR CB   C -27.991 -25.958 -18.753 1.00 . A A .  46 THR CB   1 1 
        1   627 1 1  46 THR CG2  C -26.865 -25.952 -19.775 1.00 . A A .  46 THR CG2  1 1 
        1   628 1 1  46 THR H    H -29.740 -28.105 -18.635 1.00 . A A .  46 THR H    1 1 
        1   629 1 1  46 THR HA   H -26.936 -27.602 -17.879 1.00 . A A .  46 THR HA   1 1 
        1   630 1 1  46 THR HB   H -27.869 -25.106 -18.101 1.00 . A A .  46 THR HB   1 1 
        1   631 1 1  46 THR HG1  H -29.523 -24.933 -19.458 1.00 . A A .  46 THR HG1  1 1 
        1   632 1 1  46 THR HG21 H -25.932 -26.191 -19.283 1.00 . A A .  46 THR HG21 1 1 
        1   633 1 1  46 THR HG22 H -26.792 -24.975 -20.226 1.00 . A A .  46 THR HG22 1 1 
        1   634 1 1  46 THR HG23 H -27.067 -26.688 -20.539 1.00 . A A .  46 THR HG23 1 1 
        1   635 1 1  46 THR N    N -28.791 -28.285 -18.476 1.00 . A A .  46 THR N    1 1 
        1   636 1 1  46 THR O    O -29.527 -27.172 -16.090 1.00 . A A .  46 THR O    1 1 
        1   637 1 1  46 THR OG1  O -29.251 -25.855 -19.426 1.00 . A A .  46 THR OG1  1 1 
        1   638 1 1  47 ARG C    C -27.013 -24.685 -13.934 1.00 . A A .  47 ARG C    1 1 
        1   639 1 1  47 ARG CA   C -27.771 -25.949 -14.329 1.00 . A A .  47 ARG CA   1 1 
        1   640 1 1  47 ARG CB   C -27.405 -27.093 -13.382 1.00 . A A .  47 ARG CB   1 1 
        1   641 1 1  47 ARG CD   C -29.406 -26.675 -11.921 1.00 . A A .  47 ARG CD   1 1 
        1   642 1 1  47 ARG CG   C -27.901 -26.890 -11.961 1.00 . A A .  47 ARG CG   1 1 
        1   643 1 1  47 ARG CZ   C -31.298 -27.232 -10.452 1.00 . A A .  47 ARG CZ   1 1 
        1   644 1 1  47 ARG H    H -26.590 -26.132 -16.076 1.00 . A A .  47 ARG H    1 1 
        1   645 1 1  47 ARG HA   H -28.831 -25.756 -14.254 1.00 . A A .  47 ARG HA   1 1 
        1   646 1 1  47 ARG HB2  H -27.830 -28.018 -13.772 1.00 . A A .  47 ARG HB2  1 1 
        1   647 1 1  47 ARG HB3  H -26.331 -27.192 -13.355 1.00 . A A .  47 ARG HB3  1 1 
        1   648 1 1  47 ARG HD2  H -29.611 -25.611 -11.797 1.00 . A A .  47 ARG HD2  1 1 
        1   649 1 1  47 ARG HD3  H -29.828 -27.007 -12.859 1.00 . A A .  47 ARG HD3  1 1 
        1   650 1 1  47 ARG HE   H -29.491 -28.073 -10.354 1.00 . A A .  47 ARG HE   1 1 
        1   651 1 1  47 ARG HG2  H -27.650 -27.768 -11.366 1.00 . A A .  47 ARG HG2  1 1 
        1   652 1 1  47 ARG HG3  H -27.412 -26.025 -11.538 1.00 . A A .  47 ARG HG3  1 1 
        1   653 1 1  47 ARG HH11 H -31.684 -25.809 -11.834 1.00 . A A .  47 ARG HH11 1 1 
        1   654 1 1  47 ARG HH12 H -33.008 -26.211 -10.792 1.00 . A A .  47 ARG HH12 1 1 
        1   655 1 1  47 ARG HH21 H -31.228 -28.610  -8.976 1.00 . A A .  47 ARG HH21 1 1 
        1   656 1 1  47 ARG HH22 H -32.748 -27.804  -9.166 1.00 . A A .  47 ARG HH22 1 1 
        1   657 1 1  47 ARG N    N -27.479 -26.319 -15.709 1.00 . A A .  47 ARG N    1 1 
        1   658 1 1  47 ARG NE   N -30.036 -27.412 -10.829 1.00 . A A .  47 ARG NE   1 1 
        1   659 1 1  47 ARG NH1  N -32.060 -26.344 -11.076 1.00 . A A .  47 ARG NH1  1 1 
        1   660 1 1  47 ARG NH2  N -31.799 -27.940  -9.449 1.00 . A A .  47 ARG NH2  1 1 
        1   661 1 1  47 ARG O    O -26.020 -24.320 -14.565 1.00 . A A .  47 ARG O    1 1 
        1   662 1 1  48 LYS C    C -26.404 -22.952 -10.955 1.00 . A A .  48 LYS C    1 1 
        1   663 1 1  48 LYS CA   C -26.853 -22.798 -12.404 1.00 . A A .  48 LYS CA   1 1 
        1   664 1 1  48 LYS CB   C -27.820 -21.618 -12.526 1.00 . A A .  48 LYS CB   1 1 
        1   665 1 1  48 LYS CD   C -28.914 -19.960 -14.065 1.00 . A A .  48 LYS CD   1 1 
        1   666 1 1  48 LYS CE   C -29.056 -19.552 -15.522 1.00 . A A .  48 LYS CE   1 1 
        1   667 1 1  48 LYS CG   C -27.736 -20.898 -13.861 1.00 . A A .  48 LYS CG   1 1 
        1   668 1 1  48 LYS H    H -28.281 -24.361 -12.423 1.00 . A A .  48 LYS H    1 1 
        1   669 1 1  48 LYS HA   H -25.986 -22.609 -13.020 1.00 . A A .  48 LYS HA   1 1 
        1   670 1 1  48 LYS HB2  H -28.837 -21.983 -12.389 1.00 . A A .  48 LYS HB2  1 1 
        1   671 1 1  48 LYS HB3  H -27.599 -20.905 -11.744 1.00 . A A .  48 LYS HB3  1 1 
        1   672 1 1  48 LYS HD2  H -29.828 -20.460 -13.744 1.00 . A A .  48 LYS HD2  1 1 
        1   673 1 1  48 LYS HD3  H -28.765 -19.075 -13.463 1.00 . A A .  48 LYS HD3  1 1 
        1   674 1 1  48 LYS HE2  H -28.704 -18.527 -15.640 1.00 . A A .  48 LYS HE2  1 1 
        1   675 1 1  48 LYS HE3  H -28.446 -20.206 -16.127 1.00 . A A .  48 LYS HE3  1 1 
        1   676 1 1  48 LYS HG2  H -26.811 -20.324 -13.901 1.00 . A A .  48 LYS HG2  1 1 
        1   677 1 1  48 LYS HG3  H -27.732 -21.634 -14.655 1.00 . A A .  48 LYS HG3  1 1 
        1   678 1 1  48 LYS HZ1  H -30.860 -20.575 -15.770 1.00 . A A .  48 LYS HZ1  1 1 
        1   679 1 1  48 LYS HZ2  H -30.515 -19.484 -17.016 1.00 . A A .  48 LYS HZ2  1 1 
        1   680 1 1  48 LYS HZ3  H -31.045 -18.914 -15.514 1.00 . A A .  48 LYS HZ3  1 1 
        1   681 1 1  48 LYS N    N -27.487 -24.020 -12.886 1.00 . A A .  48 LYS N    1 1 
        1   682 1 1  48 LYS NZ   N -30.468 -19.637 -15.988 1.00 . A A .  48 LYS NZ   1 1 
        1   683 1 1  48 LYS O    O -27.126 -23.507 -10.126 1.00 . A A .  48 LYS O    1 1 
        1   684 1 1  49 VAL C    C -23.725 -21.370  -9.020 1.00 . A A .  49 VAL C    1 1 
        1   685 1 1  49 VAL CA   C -24.661 -22.539  -9.305 1.00 . A A .  49 VAL CA   1 1 
        1   686 1 1  49 VAL CB   C -23.899 -23.858  -9.087 1.00 . A A .  49 VAL CB   1 1 
        1   687 1 1  49 VAL CG1  C -24.830 -25.049  -9.259 1.00 . A A .  49 VAL CG1  1 1 
        1   688 1 1  49 VAL CG2  C -22.716 -23.955 -10.038 1.00 . A A .  49 VAL CG2  1 1 
        1   689 1 1  49 VAL H    H -24.678 -22.027 -11.360 1.00 . A A .  49 VAL H    1 1 
        1   690 1 1  49 VAL HA   H -25.487 -22.504  -8.610 1.00 . A A .  49 VAL HA   1 1 
        1   691 1 1  49 VAL HB   H -23.522 -23.869  -8.075 1.00 . A A .  49 VAL HB   1 1 
        1   692 1 1  49 VAL HG11 H -25.066 -25.171 -10.306 1.00 . A A .  49 VAL HG11 1 1 
        1   693 1 1  49 VAL HG12 H -24.346 -25.942  -8.890 1.00 . A A .  49 VAL HG12 1 1 
        1   694 1 1  49 VAL HG13 H -25.740 -24.877  -8.705 1.00 . A A .  49 VAL HG13 1 1 
        1   695 1 1  49 VAL HG21 H -22.197 -24.887  -9.875 1.00 . A A .  49 VAL HG21 1 1 
        1   696 1 1  49 VAL HG22 H -23.070 -23.911 -11.057 1.00 . A A .  49 VAL HG22 1 1 
        1   697 1 1  49 VAL HG23 H -22.040 -23.130  -9.857 1.00 . A A .  49 VAL HG23 1 1 
        1   698 1 1  49 VAL N    N -25.206 -22.457 -10.655 1.00 . A A .  49 VAL N    1 1 
        1   699 1 1  49 VAL O    O -23.036 -20.879  -9.915 1.00 . A A .  49 VAL O    1 1 
        1   700 1 1  50 LYS C    C -21.463 -20.312  -6.970 1.00 . A A .  50 LYS C    1 1 
        1   701 1 1  50 LYS CA   C -22.851 -19.817  -7.361 1.00 . A A .  50 LYS CA   1 1 
        1   702 1 1  50 LYS CB   C -23.484 -19.063  -6.190 1.00 . A A .  50 LYS CB   1 1 
        1   703 1 1  50 LYS CD   C -24.830 -17.218  -7.237 1.00 . A A .  50 LYS CD   1 1 
        1   704 1 1  50 LYS CE   C -26.020 -17.063  -8.170 1.00 . A A .  50 LYS CE   1 1 
        1   705 1 1  50 LYS CG   C -24.879 -18.538  -6.486 1.00 . A A .  50 LYS CG   1 1 
        1   706 1 1  50 LYS H    H -24.277 -21.360  -7.099 1.00 . A A .  50 LYS H    1 1 
        1   707 1 1  50 LYS HA   H -22.758 -19.146  -8.202 1.00 . A A .  50 LYS HA   1 1 
        1   708 1 1  50 LYS HB2  H -23.538 -19.732  -5.331 1.00 . A A .  50 LYS HB2  1 1 
        1   709 1 1  50 LYS HB3  H -22.854 -18.224  -5.936 1.00 . A A .  50 LYS HB3  1 1 
        1   710 1 1  50 LYS HD2  H -24.831 -16.399  -6.518 1.00 . A A .  50 LYS HD2  1 1 
        1   711 1 1  50 LYS HD3  H -23.919 -17.177  -7.818 1.00 . A A .  50 LYS HD3  1 1 
        1   712 1 1  50 LYS HE2  H -26.018 -16.055  -8.585 1.00 . A A .  50 LYS HE2  1 1 
        1   713 1 1  50 LYS HE3  H -25.925 -17.776  -8.975 1.00 . A A .  50 LYS HE3  1 1 
        1   714 1 1  50 LYS HG2  H -25.415 -19.271  -7.088 1.00 . A A .  50 LYS HG2  1 1 
        1   715 1 1  50 LYS HG3  H -25.405 -18.393  -5.553 1.00 . A A .  50 LYS HG3  1 1 
        1   716 1 1  50 LYS HZ1  H -28.106 -17.004  -8.070 1.00 . A A .  50 LYS HZ1  1 1 
        1   717 1 1  50 LYS HZ2  H -27.341 -16.748  -6.583 1.00 . A A .  50 LYS HZ2  1 1 
        1   718 1 1  50 LYS HZ3  H -27.417 -18.305  -7.238 1.00 . A A .  50 LYS HZ3  1 1 
        1   719 1 1  50 LYS N    N -23.705 -20.928  -7.767 1.00 . A A .  50 LYS N    1 1 
        1   720 1 1  50 LYS NZ   N -27.311 -17.296  -7.466 1.00 . A A .  50 LYS NZ   1 1 
        1   721 1 1  50 LYS O    O -21.324 -21.203  -6.131 1.00 . A A .  50 LYS O    1 1 
        1   722 1 1  51 CYS C    C -18.148 -18.885  -7.282 1.00 . A A .  51 CYS C    1 1 
        1   723 1 1  51 CYS CA   C -19.059 -20.110  -7.296 1.00 . A A .  51 CYS CA   1 1 
        1   724 1 1  51 CYS CB   C -18.562 -21.117  -8.336 1.00 . A A .  51 CYS CB   1 1 
        1   725 1 1  51 CYS H    H -20.611 -19.024  -8.242 1.00 . A A .  51 CYS H    1 1 
        1   726 1 1  51 CYS HA   H -19.038 -20.572  -6.321 1.00 . A A .  51 CYS HA   1 1 
        1   727 1 1  51 CYS HB2  H -17.688 -21.630  -7.933 1.00 . A A .  51 CYS HB2  1 1 
        1   728 1 1  51 CYS HB3  H -19.336 -21.848  -8.518 1.00 . A A .  51 CYS HB3  1 1 
        1   729 1 1  51 CYS HG   H -18.840 -19.269 -10.136 1.00 . A A .  51 CYS HG   1 1 
        1   730 1 1  51 CYS N    N -20.437 -19.729  -7.582 1.00 . A A .  51 CYS N    1 1 
        1   731 1 1  51 CYS O    O -18.567 -17.784  -7.636 1.00 . A A .  51 CYS O    1 1 
        1   732 1 1  51 CYS SG   S -18.112 -20.372  -9.937 1.00 . A A .  51 CYS SG   1 1 
        1   733 1 1  52 ARG C    C -14.932 -18.098  -7.956 1.00 . A A .  52 ARG C    1 1 
        1   734 1 1  52 ARG CA   C -15.932 -18.001  -6.807 1.00 . A A .  52 ARG CA   1 1 
        1   735 1 1  52 ARG CB   C -15.192 -18.026  -5.470 1.00 . A A .  52 ARG CB   1 1 
        1   736 1 1  52 ARG CD   C -16.722 -16.398  -4.318 1.00 . A A .  52 ARG CD   1 1 
        1   737 1 1  52 ARG CG   C -15.284 -16.720  -4.698 1.00 . A A .  52 ARG CG   1 1 
        1   738 1 1  52 ARG CZ   C -18.082 -16.458  -2.272 1.00 . A A .  52 ARG CZ   1 1 
        1   739 1 1  52 ARG H    H -16.626 -19.989  -6.601 1.00 . A A .  52 ARG H    1 1 
        1   740 1 1  52 ARG HA   H -16.472 -17.069  -6.893 1.00 . A A .  52 ARG HA   1 1 
        1   741 1 1  52 ARG HB2  H -15.607 -18.825  -4.856 1.00 . A A .  52 ARG HB2  1 1 
        1   742 1 1  52 ARG HB3  H -14.148 -18.237  -5.652 1.00 . A A .  52 ARG HB3  1 1 
        1   743 1 1  52 ARG HD2  H -16.999 -15.439  -4.756 1.00 . A A .  52 ARG HD2  1 1 
        1   744 1 1  52 ARG HD3  H -17.366 -17.168  -4.718 1.00 . A A .  52 ARG HD3  1 1 
        1   745 1 1  52 ARG HE   H -16.107 -16.181  -2.320 1.00 . A A .  52 ARG HE   1 1 
        1   746 1 1  52 ARG HG2  H -14.684 -16.798  -3.791 1.00 . A A .  52 ARG HG2  1 1 
        1   747 1 1  52 ARG HG3  H -14.896 -15.922  -5.312 1.00 . A A .  52 ARG HG3  1 1 
        1   748 1 1  52 ARG HH11 H -19.116 -16.717  -3.988 1.00 . A A .  52 ARG HH11 1 1 
        1   749 1 1  52 ARG HH12 H -20.063 -16.759  -2.537 1.00 . A A .  52 ARG HH12 1 1 
        1   750 1 1  52 ARG HH21 H -17.344 -16.233  -0.403 1.00 . A A .  52 ARG HH21 1 1 
        1   751 1 1  52 ARG HH22 H -19.054 -16.481  -0.498 1.00 . A A .  52 ARG HH22 1 1 
        1   752 1 1  52 ARG N    N -16.902 -19.088  -6.870 1.00 . A A .  52 ARG N    1 1 
        1   753 1 1  52 ARG NE   N -16.903 -16.330  -2.871 1.00 . A A .  52 ARG NE   1 1 
        1   754 1 1  52 ARG NH1  N -19.177 -16.660  -2.991 1.00 . A A .  52 ARG NH1  1 1 
        1   755 1 1  52 ARG NH2  N -18.167 -16.385  -0.949 1.00 . A A .  52 ARG NH2  1 1 
        1   756 1 1  52 ARG O    O -14.402 -19.171  -8.243 1.00 . A A .  52 ARG O    1 1 
        1   757 1 1  53 VAL C    C -12.504 -16.112  -9.375 1.00 . A A .  53 VAL C    1 1 
        1   758 1 1  53 VAL CA   C -13.742 -16.927  -9.728 1.00 . A A .  53 VAL CA   1 1 
        1   759 1 1  53 VAL CB   C -14.396 -16.327 -10.987 1.00 . A A .  53 VAL CB   1 1 
        1   760 1 1  53 VAL CG1  C -13.493 -16.508 -12.196 1.00 . A A .  53 VAL CG1  1 1 
        1   761 1 1  53 VAL CG2  C -15.761 -16.957 -11.229 1.00 . A A .  53 VAL CG2  1 1 
        1   762 1 1  53 VAL H    H -15.132 -16.146  -8.336 1.00 . A A .  53 VAL H    1 1 
        1   763 1 1  53 VAL HA   H -13.443 -17.941  -9.952 1.00 . A A .  53 VAL HA   1 1 
        1   764 1 1  53 VAL HB   H -14.536 -15.268 -10.826 1.00 . A A .  53 VAL HB   1 1 
        1   765 1 1  53 VAL HG11 H -13.648 -15.692 -12.887 1.00 . A A .  53 VAL HG11 1 1 
        1   766 1 1  53 VAL HG12 H -12.461 -16.520 -11.877 1.00 . A A .  53 VAL HG12 1 1 
        1   767 1 1  53 VAL HG13 H -13.730 -17.442 -12.685 1.00 . A A .  53 VAL HG13 1 1 
        1   768 1 1  53 VAL HG21 H -15.827 -17.890 -10.689 1.00 . A A .  53 VAL HG21 1 1 
        1   769 1 1  53 VAL HG22 H -16.532 -16.285 -10.886 1.00 . A A .  53 VAL HG22 1 1 
        1   770 1 1  53 VAL HG23 H -15.889 -17.142 -12.286 1.00 . A A .  53 VAL HG23 1 1 
        1   771 1 1  53 VAL N    N -14.678 -16.969  -8.611 1.00 . A A .  53 VAL N    1 1 
        1   772 1 1  53 VAL O    O -12.338 -14.970  -9.805 1.00 . A A .  53 VAL O    1 1 
        1   773 1 1  54 PRO C    C  -9.376 -15.893  -9.291 1.00 . A A .  54 PRO C    1 1 
        1   774 1 1  54 PRO CA   C -10.369 -16.059  -8.145 1.00 . A A .  54 PRO CA   1 1 
        1   775 1 1  54 PRO CB   C  -9.811 -17.017  -7.090 1.00 . A A .  54 PRO CB   1 1 
        1   776 1 1  54 PRO CD   C -11.742 -18.070  -8.024 1.00 . A A .  54 PRO CD   1 1 
        1   777 1 1  54 PRO CG   C -10.382 -18.346  -7.444 1.00 . A A .  54 PRO CG   1 1 
        1   778 1 1  54 PRO HA   H -10.560 -15.096  -7.695 1.00 . A A .  54 PRO HA   1 1 
        1   779 1 1  54 PRO HB2  H  -8.723 -17.046  -7.144 1.00 . A A .  54 PRO HB2  1 1 
        1   780 1 1  54 PRO HB3  H -10.128 -16.700  -6.107 1.00 . A A .  54 PRO HB3  1 1 
        1   781 1 1  54 PRO HD2  H -11.975 -18.783  -8.815 1.00 . A A .  54 PRO HD2  1 1 
        1   782 1 1  54 PRO HD3  H -12.496 -18.101  -7.250 1.00 . A A .  54 PRO HD3  1 1 
        1   783 1 1  54 PRO HG2  H  -9.751 -18.843  -8.181 1.00 . A A .  54 PRO HG2  1 1 
        1   784 1 1  54 PRO HG3  H -10.471 -18.955  -6.557 1.00 . A A .  54 PRO HG3  1 1 
        1   785 1 1  54 PRO N    N -11.610 -16.711  -8.573 1.00 . A A .  54 PRO N    1 1 
        1   786 1 1  54 PRO O    O  -9.310 -16.728 -10.194 1.00 . A A .  54 PRO O    1 1 
        1   787 1 1  55 CYS C    C  -6.314 -15.279 -10.002 1.00 . A A .  55 CYS C    1 1 
        1   788 1 1  55 CYS CA   C  -7.616 -14.535 -10.283 1.00 . A A .  55 CYS CA   1 1 
        1   789 1 1  55 CYS CB   C  -7.349 -13.031 -10.375 1.00 . A A .  55 CYS CB   1 1 
        1   790 1 1  55 CYS H    H  -8.706 -14.182  -8.503 1.00 . A A .  55 CYS H    1 1 
        1   791 1 1  55 CYS HA   H  -8.016 -14.878 -11.227 1.00 . A A .  55 CYS HA   1 1 
        1   792 1 1  55 CYS HB2  H  -7.686 -12.561  -9.451 1.00 . A A .  55 CYS HB2  1 1 
        1   793 1 1  55 CYS HB3  H  -6.286 -12.869 -10.475 1.00 . A A .  55 CYS HB3  1 1 
        1   794 1 1  55 CYS HG   H  -7.480 -12.442 -12.897 1.00 . A A .  55 CYS HG   1 1 
        1   795 1 1  55 CYS N    N  -8.605 -14.812  -9.250 1.00 . A A .  55 CYS N    1 1 
        1   796 1 1  55 CYS O    O  -5.668 -15.055  -8.980 1.00 . A A .  55 CYS O    1 1 
        1   797 1 1  55 CYS SG   S  -8.173 -12.213 -11.778 1.00 . A A .  55 CYS SG   1 1 
        1   798 1 1  56 ASN C    C  -4.526 -17.898 -11.944 1.00 . A A .  56 ASN C    1 1 
        1   799 1 1  56 ASN CA   C  -4.710 -16.941 -10.769 1.00 . A A .  56 ASN CA   1 1 
        1   800 1 1  56 ASN CB   C  -4.736 -17.727  -9.457 1.00 . A A .  56 ASN CB   1 1 
        1   801 1 1  56 ASN CG   C  -6.110 -18.289  -9.147 1.00 . A A .  56 ASN CG   1 1 
        1   802 1 1  56 ASN H    H  -6.492 -16.298 -11.713 1.00 . A A .  56 ASN H    1 1 
        1   803 1 1  56 ASN HA   H  -3.879 -16.251 -10.748 1.00 . A A .  56 ASN HA   1 1 
        1   804 1 1  56 ASN HB2  H  -4.024 -18.550  -9.523 1.00 . A A .  56 ASN HB2  1 1 
        1   805 1 1  56 ASN HB3  H  -4.443 -17.075  -8.648 1.00 . A A .  56 ASN HB3  1 1 
        1   806 1 1  56 ASN HD21 H  -5.854 -17.916  -7.211 1.00 . A A .  56 ASN HD21 1 1 
        1   807 1 1  56 ASN HD22 H  -7.362 -18.638  -7.644 1.00 . A A .  56 ASN HD22 1 1 
        1   808 1 1  56 ASN N    N  -5.934 -16.165 -10.918 1.00 . A A .  56 ASN N    1 1 
        1   809 1 1  56 ASN ND2  N  -6.480 -18.279  -7.872 1.00 . A A .  56 ASN ND2  1 1 
        1   810 1 1  56 ASN O    O  -4.015 -19.005 -11.781 1.00 . A A .  56 ASN O    1 1 
        1   811 1 1  56 ASN OD1  O  -6.831 -18.728 -10.045 1.00 . A A .  56 ASN OD1  1 1 
        1   812 1 1  57 TRP C    C  -3.463 -18.088 -14.983 1.00 . A A .  57 TRP C    1 1 
        1   813 1 1  57 TRP CA   C  -4.826 -18.278 -14.328 1.00 . A A .  57 TRP CA   1 1 
        1   814 1 1  57 TRP CB   C  -5.936 -17.925 -15.320 1.00 . A A .  57 TRP CB   1 1 
        1   815 1 1  57 TRP CD1  C  -7.899 -19.395 -14.576 1.00 . A A .  57 TRP CD1  1 1 
        1   816 1 1  57 TRP CD2  C  -8.276 -17.195 -14.395 1.00 . A A .  57 TRP CD2  1 1 
        1   817 1 1  57 TRP CE2  C  -9.423 -17.884 -13.957 1.00 . A A .  57 TRP CE2  1 1 
        1   818 1 1  57 TRP CE3  C  -8.278 -15.798 -14.371 1.00 . A A .  57 TRP CE3  1 1 
        1   819 1 1  57 TRP CG   C  -7.313 -18.180 -14.786 1.00 . A A .  57 TRP CG   1 1 
        1   820 1 1  57 TRP CH2  C -10.537 -15.853 -13.491 1.00 . A A .  57 TRP CH2  1 1 
        1   821 1 1  57 TRP CZ2  C -10.561 -17.222 -13.505 1.00 . A A .  57 TRP CZ2  1 1 
        1   822 1 1  57 TRP CZ3  C  -9.408 -15.141 -13.920 1.00 . A A .  57 TRP CZ3  1 1 
        1   823 1 1  57 TRP H    H  -5.344 -16.569 -13.192 1.00 . A A .  57 TRP H    1 1 
        1   824 1 1  57 TRP HA   H  -4.931 -19.312 -14.036 1.00 . A A .  57 TRP HA   1 1 
        1   825 1 1  57 TRP HB2  H  -5.850 -16.871 -15.583 1.00 . A A .  57 TRP HB2  1 1 
        1   826 1 1  57 TRP HB3  H  -5.811 -18.519 -16.215 1.00 . A A .  57 TRP HB3  1 1 
        1   827 1 1  57 TRP HD1  H  -7.425 -20.343 -14.779 1.00 . A A .  57 TRP HD1  1 1 
        1   828 1 1  57 TRP HE1  H  -9.791 -19.945 -13.847 1.00 . A A .  57 TRP HE1  1 1 
        1   829 1 1  57 TRP HE3  H  -7.419 -15.230 -14.698 1.00 . A A .  57 TRP HE3  1 1 
        1   830 1 1  57 TRP HH2  H -11.396 -15.300 -13.147 1.00 . A A .  57 TRP HH2  1 1 
        1   831 1 1  57 TRP HZ2  H -11.437 -17.757 -13.169 1.00 . A A .  57 TRP HZ2  1 1 
        1   832 1 1  57 TRP HZ3  H  -9.430 -14.062 -13.895 1.00 . A A .  57 TRP HZ3  1 1 
        1   833 1 1  57 TRP N    N  -4.945 -17.461 -13.127 1.00 . A A .  57 TRP N    1 1 
        1   834 1 1  57 TRP NE1  N  -9.170 -19.225 -14.080 1.00 . A A .  57 TRP NE1  1 1 
        1   835 1 1  57 TRP O    O  -2.656 -19.016 -15.042 1.00 . A A .  57 TRP O    1 1 
        1   836 1 1  58 LYS C    C  -0.937 -16.017 -15.117 1.00 . A A .  58 LYS C    1 1 
        1   837 1 1  58 LYS CA   C  -1.944 -16.566 -16.124 1.00 . A A .  58 LYS CA   1 1 
        1   838 1 1  58 LYS CB   C  -2.161 -15.551 -17.248 1.00 . A A .  58 LYS CB   1 1 
        1   839 1 1  58 LYS CD   C  -0.434 -14.309 -18.586 1.00 . A A .  58 LYS CD   1 1 
        1   840 1 1  58 LYS CE   C   0.022 -14.157 -20.029 1.00 . A A .  58 LYS CE   1 1 
        1   841 1 1  58 LYS CG   C  -1.128 -15.641 -18.359 1.00 . A A .  58 LYS CG   1 1 
        1   842 1 1  58 LYS H    H  -3.894 -16.180 -15.398 1.00 . A A .  58 LYS H    1 1 
        1   843 1 1  58 LYS HA   H  -1.552 -17.479 -16.545 1.00 . A A .  58 LYS HA   1 1 
        1   844 1 1  58 LYS HB2  H  -3.150 -15.711 -17.677 1.00 . A A .  58 LYS HB2  1 1 
        1   845 1 1  58 LYS HB3  H  -2.121 -14.555 -16.831 1.00 . A A .  58 LYS HB3  1 1 
        1   846 1 1  58 LYS HD2  H  -1.125 -13.501 -18.343 1.00 . A A .  58 LYS HD2  1 1 
        1   847 1 1  58 LYS HD3  H   0.427 -14.245 -17.937 1.00 . A A .  58 LYS HD3  1 1 
        1   848 1 1  58 LYS HE2  H   0.610 -15.030 -20.311 1.00 . A A .  58 LYS HE2  1 1 
        1   849 1 1  58 LYS HE3  H  -0.851 -14.099 -20.664 1.00 . A A .  58 LYS HE3  1 1 
        1   850 1 1  58 LYS HG2  H  -0.382 -16.391 -18.092 1.00 . A A .  58 LYS HG2  1 1 
        1   851 1 1  58 LYS HG3  H  -1.620 -15.942 -19.272 1.00 . A A .  58 LYS HG3  1 1 
        1   852 1 1  58 LYS HZ1  H   1.163 -12.870 -21.214 1.00 . A A .  58 LYS HZ1  1 1 
        1   853 1 1  58 LYS HZ2  H   1.679 -12.960 -19.604 1.00 . A A .  58 LYS HZ2  1 1 
        1   854 1 1  58 LYS HZ3  H   0.285 -12.086 -19.997 1.00 . A A .  58 LYS HZ3  1 1 
        1   855 1 1  58 LYS N    N  -3.210 -16.879 -15.475 1.00 . A A .  58 LYS N    1 1 
        1   856 1 1  58 LYS NZ   N   0.844 -12.932 -20.225 1.00 . A A .  58 LYS NZ   1 1 
        1   857 1 1  58 LYS O    O  -1.313 -15.396 -14.122 1.00 . A A .  58 LYS O    1 1 
        1   858 1 1  59 LYS C    C   2.772 -15.934 -15.164 1.00 . A A .  59 LYS C    1 1 
        1   859 1 1  59 LYS CA   C   1.406 -15.777 -14.502 1.00 . A A .  59 LYS CA   1 1 
        1   860 1 1  59 LYS CB   C   1.379 -16.544 -13.178 1.00 . A A .  59 LYS CB   1 1 
        1   861 1 1  59 LYS CD   C   2.285 -18.729 -12.336 1.00 . A A .  59 LYS CD   1 1 
        1   862 1 1  59 LYS CE   C   2.573 -20.172 -12.723 1.00 . A A .  59 LYS CE   1 1 
        1   863 1 1  59 LYS CG   C   1.377 -18.053 -13.350 1.00 . A A .  59 LYS CG   1 1 
        1   864 1 1  59 LYS H    H   0.582 -16.750 -16.191 1.00 . A A .  59 LYS H    1 1 
        1   865 1 1  59 LYS HA   H   1.233 -14.729 -14.306 1.00 . A A .  59 LYS HA   1 1 
        1   866 1 1  59 LYS HB2  H   2.252 -16.260 -12.591 1.00 . A A .  59 LYS HB2  1 1 
        1   867 1 1  59 LYS HB3  H   0.488 -16.264 -12.633 1.00 . A A .  59 LYS HB3  1 1 
        1   868 1 1  59 LYS HD2  H   3.225 -18.181 -12.276 1.00 . A A .  59 LYS HD2  1 1 
        1   869 1 1  59 LYS HD3  H   1.804 -18.715 -11.369 1.00 . A A .  59 LYS HD3  1 1 
        1   870 1 1  59 LYS HE2  H   1.974 -20.835 -12.098 1.00 . A A .  59 LYS HE2  1 1 
        1   871 1 1  59 LYS HE3  H   2.296 -20.317 -13.756 1.00 . A A .  59 LYS HE3  1 1 
        1   872 1 1  59 LYS HG2  H   0.360 -18.426 -13.224 1.00 . A A .  59 LYS HG2  1 1 
        1   873 1 1  59 LYS HG3  H   1.722 -18.293 -14.345 1.00 . A A .  59 LYS HG3  1 1 
        1   874 1 1  59 LYS HZ1  H   4.543 -19.679 -12.240 1.00 . A A .  59 LYS HZ1  1 1 
        1   875 1 1  59 LYS HZ2  H   4.407 -20.848 -13.456 1.00 . A A .  59 LYS HZ2  1 1 
        1   876 1 1  59 LYS HZ3  H   4.120 -21.268 -11.845 1.00 . A A .  59 LYS HZ3  1 1 
        1   877 1 1  59 LYS N    N   0.344 -16.249 -15.383 1.00 . A A .  59 LYS N    1 1 
        1   878 1 1  59 LYS NZ   N   4.012 -20.515 -12.554 1.00 . A A .  59 LYS NZ   1 1 
        1   879 1 1  59 LYS O    O   2.871 -16.390 -16.302 1.00 . A A .  59 LYS O    1 1 
        1   880 1 1  60 GLU C    C   6.204 -15.426 -13.852 1.00 . A A .  60 GLU C    1 1 
        1   881 1 1  60 GLU CA   C   5.181 -15.652 -14.960 1.00 . A A .  60 GLU CA   1 1 
        1   882 1 1  60 GLU CB   C   5.397 -14.635 -16.083 1.00 . A A .  60 GLU CB   1 1 
        1   883 1 1  60 GLU CD   C   5.056 -12.199 -16.655 1.00 . A A .  60 GLU CD   1 1 
        1   884 1 1  60 GLU CG   C   4.467 -13.436 -16.007 1.00 . A A .  60 GLU CG   1 1 
        1   885 1 1  60 GLU H    H   3.678 -15.196 -13.541 1.00 . A A .  60 GLU H    1 1 
        1   886 1 1  60 GLU HA   H   5.313 -16.646 -15.358 1.00 . A A .  60 GLU HA   1 1 
        1   887 1 1  60 GLU HB2  H   6.427 -14.281 -16.040 1.00 . A A .  60 GLU HB2  1 1 
        1   888 1 1  60 GLU HB3  H   5.240 -15.126 -17.032 1.00 . A A .  60 GLU HB3  1 1 
        1   889 1 1  60 GLU HG2  H   3.529 -13.684 -16.505 1.00 . A A .  60 GLU HG2  1 1 
        1   890 1 1  60 GLU HG3  H   4.265 -13.219 -14.968 1.00 . A A .  60 GLU HG3  1 1 
        1   891 1 1  60 GLU N    N   3.821 -15.552 -14.441 1.00 . A A .  60 GLU N    1 1 
        1   892 1 1  60 GLU O    O   6.838 -16.368 -13.376 1.00 . A A .  60 GLU O    1 1 
        1   893 1 1  60 GLU OE1  O   5.814 -11.477 -15.975 1.00 . A A .  60 GLU OE1  1 1 
        1   894 1 1  60 GLU OE2  O   4.760 -11.953 -17.844 1.00 . A A .  60 GLU OE2  1 1 
        1   895 1 1  61 PHE C    C   7.158 -12.355 -11.993 1.00 . A A .  61 PHE C    1 1 
        1   896 1 1  61 PHE CA   C   7.307 -13.821 -12.392 1.00 . A A .  61 PHE CA   1 1 
        1   897 1 1  61 PHE CB   C   8.740 -14.091 -12.856 1.00 . A A .  61 PHE CB   1 1 
        1   898 1 1  61 PHE CD1  C   9.208 -12.156 -14.382 1.00 . A A .  61 PHE CD1  1 1 
        1   899 1 1  61 PHE CD2  C   9.184 -14.352 -15.311 1.00 . A A .  61 PHE CD2  1 1 
        1   900 1 1  61 PHE CE1  C   9.492 -11.629 -15.628 1.00 . A A .  61 PHE CE1  1 1 
        1   901 1 1  61 PHE CE2  C   9.469 -13.831 -16.559 1.00 . A A .  61 PHE CE2  1 1 
        1   902 1 1  61 PHE CG   C   9.049 -13.522 -14.210 1.00 . A A .  61 PHE CG   1 1 
        1   903 1 1  61 PHE CZ   C   9.624 -12.468 -16.718 1.00 . A A .  61 PHE CZ   1 1 
        1   904 1 1  61 PHE H    H   5.825 -13.464 -13.862 1.00 . A A .  61 PHE H    1 1 
        1   905 1 1  61 PHE HA   H   7.091 -14.439 -11.534 1.00 . A A .  61 PHE HA   1 1 
        1   906 1 1  61 PHE HB2  H   9.430 -13.662 -12.129 1.00 . A A .  61 PHE HB2  1 1 
        1   907 1 1  61 PHE HB3  H   8.900 -15.157 -12.897 1.00 . A A .  61 PHE HB3  1 1 
        1   908 1 1  61 PHE HD1  H   9.106 -11.499 -13.530 1.00 . A A .  61 PHE HD1  1 1 
        1   909 1 1  61 PHE HD2  H   9.063 -15.419 -15.189 1.00 . A A .  61 PHE HD2  1 1 
        1   910 1 1  61 PHE HE1  H   9.613 -10.564 -15.749 1.00 . A A .  61 PHE HE1  1 1 
        1   911 1 1  61 PHE HE2  H   9.571 -14.490 -17.408 1.00 . A A .  61 PHE HE2  1 1 
        1   912 1 1  61 PHE HZ   H   9.847 -12.058 -17.692 1.00 . A A .  61 PHE HZ   1 1 
        1   913 1 1  61 PHE N    N   6.360 -14.171 -13.444 1.00 . A A .  61 PHE N    1 1 
        1   914 1 1  61 PHE O    O   6.313 -11.638 -12.526 1.00 . A A .  61 PHE O    1 1 
        1   915 1 1  62 GLY C    C   9.306  -9.907 -10.496 1.00 . A A .  62 GLY C    1 1 
        1   916 1 1  62 GLY CA   C   7.933 -10.541 -10.594 1.00 . A A .  62 GLY CA   1 1 
        1   917 1 1  62 GLY H    H   8.643 -12.534 -10.661 1.00 . A A .  62 GLY H    1 1 
        1   918 1 1  62 GLY HA2  H   7.331  -9.968 -11.284 1.00 . A A .  62 GLY HA2  1 1 
        1   919 1 1  62 GLY HA3  H   7.466 -10.515  -9.620 1.00 . A A .  62 GLY HA3  1 1 
        1   920 1 1  62 GLY N    N   7.987 -11.917 -11.050 1.00 . A A .  62 GLY N    1 1 
        1   921 1 1  62 GLY O    O  10.288 -10.583 -10.192 1.00 . A A .  62 GLY O    1 1 
        1   922 1 1  63 ALA C    C  10.680  -6.950  -9.487 1.00 . A A .  63 ALA C    1 1 
        1   923 1 1  63 ALA CA   C  10.638  -7.880 -10.694 1.00 . A A .  63 ALA CA   1 1 
        1   924 1 1  63 ALA CB   C  10.857  -7.093 -11.977 1.00 . A A .  63 ALA CB   1 1 
        1   925 1 1  63 ALA H    H   8.557  -8.121 -10.992 1.00 . A A .  63 ALA H    1 1 
        1   926 1 1  63 ALA HA   H  11.435  -8.604 -10.606 1.00 . A A .  63 ALA HA   1 1 
        1   927 1 1  63 ALA HB1  H  11.819  -7.350 -12.397 1.00 . A A .  63 ALA HB1  1 1 
        1   928 1 1  63 ALA HB2  H  10.079  -7.334 -12.685 1.00 . A A .  63 ALA HB2  1 1 
        1   929 1 1  63 ALA HB3  H  10.830  -6.036 -11.760 1.00 . A A .  63 ALA HB3  1 1 
        1   930 1 1  63 ALA N    N   9.375  -8.605 -10.755 1.00 . A A .  63 ALA N    1 1 
        1   931 1 1  63 ALA O    O   9.810  -7.007  -8.617 1.00 . A A .  63 ALA O    1 1 
        1   932 1 1  64 ASP C    C  12.688  -3.951  -8.764 1.00 . A A .  64 ASP C    1 1 
        1   933 1 1  64 ASP CA   C  11.850  -5.152  -8.338 1.00 . A A .  64 ASP CA   1 1 
        1   934 1 1  64 ASP CB   C  12.497  -5.841  -7.135 1.00 . A A .  64 ASP CB   1 1 
        1   935 1 1  64 ASP CG   C  12.670  -4.905  -5.955 1.00 . A A .  64 ASP CG   1 1 
        1   936 1 1  64 ASP H    H  12.356  -6.098 -10.162 1.00 . A A .  64 ASP H    1 1 
        1   937 1 1  64 ASP HA   H  10.866  -4.807  -8.056 1.00 . A A .  64 ASP HA   1 1 
        1   938 1 1  64 ASP HB2  H  11.872  -6.681  -6.832 1.00 . A A .  64 ASP HB2  1 1 
        1   939 1 1  64 ASP HB3  H  13.469  -6.213  -7.422 1.00 . A A .  64 ASP HB3  1 1 
        1   940 1 1  64 ASP N    N  11.695  -6.096  -9.438 1.00 . A A .  64 ASP N    1 1 
        1   941 1 1  64 ASP O    O  12.178  -2.838  -8.891 1.00 . A A .  64 ASP O    1 1 
        1   942 1 1  64 ASP OD1  O  11.817  -4.010  -5.779 1.00 . A A .  64 ASP OD1  1 1 
        1   943 1 1  64 ASP OD2  O  13.657  -5.067  -5.208 1.00 . A A .  64 ASP OD2  1 1 
        1   944 1 1  65 CYS C    C  15.764  -3.578 -10.558 1.00 . A A .  65 CYS C    1 1 
        1   945 1 1  65 CYS CA   C  14.888  -3.124  -9.395 1.00 . A A .  65 CYS CA   1 1 
        1   946 1 1  65 CYS CB   C  15.766  -2.692  -8.217 1.00 . A A .  65 CYS CB   1 1 
        1   947 1 1  65 CYS H    H  14.327  -5.095  -8.866 1.00 . A A .  65 CYS H    1 1 
        1   948 1 1  65 CYS HA   H  14.294  -2.282  -9.715 1.00 . A A .  65 CYS HA   1 1 
        1   949 1 1  65 CYS HB2  H  15.521  -3.313  -7.355 1.00 . A A .  65 CYS HB2  1 1 
        1   950 1 1  65 CYS HB3  H  16.803  -2.853  -8.474 1.00 . A A .  65 CYS HB3  1 1 
        1   951 1 1  65 CYS HG   H  15.015  -0.270  -8.757 1.00 . A A .  65 CYS HG   1 1 
        1   952 1 1  65 CYS N    N  13.977  -4.185  -8.983 1.00 . A A .  65 CYS N    1 1 
        1   953 1 1  65 CYS O    O  16.335  -4.668 -10.530 1.00 . A A .  65 CYS O    1 1 
        1   954 1 1  65 CYS SG   S  15.575  -0.943  -7.748 1.00 . A A .  65 CYS SG   1 1 
        1   955 1 1  66 LYS C    C  17.947  -2.208 -12.774 1.00 . A A .  66 LYS C    1 1 
        1   956 1 1  66 LYS CA   C  16.673  -3.046 -12.752 1.00 . A A .  66 LYS CA   1 1 
        1   957 1 1  66 LYS CB   C  15.867  -2.802 -14.031 1.00 . A A .  66 LYS CB   1 1 
        1   958 1 1  66 LYS CD   C  16.077  -4.959 -15.303 1.00 . A A .  66 LYS CD   1 1 
        1   959 1 1  66 LYS CE   C  15.338  -6.163 -15.865 1.00 . A A .  66 LYS CE   1 1 
        1   960 1 1  66 LYS CG   C  15.142  -4.038 -14.537 1.00 . A A .  66 LYS CG   1 1 
        1   961 1 1  66 LYS H    H  15.387  -1.880 -11.542 1.00 . A A .  66 LYS H    1 1 
        1   962 1 1  66 LYS HA   H  16.944  -4.090 -12.700 1.00 . A A .  66 LYS HA   1 1 
        1   963 1 1  66 LYS HB2  H  15.133  -2.020 -13.838 1.00 . A A .  66 LYS HB2  1 1 
        1   964 1 1  66 LYS HB3  H  16.540  -2.463 -14.806 1.00 . A A .  66 LYS HB3  1 1 
        1   965 1 1  66 LYS HD2  H  16.532  -4.404 -16.123 1.00 . A A .  66 LYS HD2  1 1 
        1   966 1 1  66 LYS HD3  H  16.854  -5.304 -14.634 1.00 . A A .  66 LYS HD3  1 1 
        1   967 1 1  66 LYS HE2  H  14.286  -5.906 -15.994 1.00 . A A .  66 LYS HE2  1 1 
        1   968 1 1  66 LYS HE3  H  15.761  -6.412 -16.828 1.00 . A A .  66 LYS HE3  1 1 
        1   969 1 1  66 LYS HG2  H  14.723  -4.579 -13.688 1.00 . A A .  66 LYS HG2  1 1 
        1   970 1 1  66 LYS HG3  H  14.340  -3.729 -15.192 1.00 . A A .  66 LYS HG3  1 1 
        1   971 1 1  66 LYS HZ1  H  16.405  -7.737 -15.001 1.00 . A A .  66 LYS HZ1  1 1 
        1   972 1 1  66 LYS HZ2  H  14.771  -8.083 -15.268 1.00 . A A .  66 LYS HZ2  1 1 
        1   973 1 1  66 LYS HZ3  H  15.224  -7.074 -13.989 1.00 . A A .  66 LYS HZ3  1 1 
        1   974 1 1  66 LYS N    N  15.865  -2.734 -11.579 1.00 . A A .  66 LYS N    1 1 
        1   975 1 1  66 LYS NZ   N  15.443  -7.347 -14.968 1.00 . A A .  66 LYS NZ   1 1 
        1   976 1 1  66 LYS O    O  17.936  -1.034 -12.407 1.00 . A A .  66 LYS O    1 1 
        1   977 1 1  67 TYR C    C  21.039  -2.435 -14.594 1.00 . A A .  67 TYR C    1 1 
        1   978 1 1  67 TYR CA   C  20.327  -2.128 -13.280 1.00 . A A .  67 TYR CA   1 1 
        1   979 1 1  67 TYR CB   C  21.212  -2.534 -12.101 1.00 . A A .  67 TYR CB   1 1 
        1   980 1 1  67 TYR CD1  C  19.709  -2.131 -10.111 1.00 . A A .  67 TYR CD1  1 1 
        1   981 1 1  67 TYR CD2  C  21.703  -0.838 -10.294 1.00 . A A .  67 TYR CD2  1 1 
        1   982 1 1  67 TYR CE1  C  19.390  -1.482  -8.935 1.00 . A A .  67 TYR CE1  1 1 
        1   983 1 1  67 TYR CE2  C  21.393  -0.185  -9.118 1.00 . A A .  67 TYR CE2  1 1 
        1   984 1 1  67 TYR CG   C  20.868  -1.822 -10.812 1.00 . A A .  67 TYR CG   1 1 
        1   985 1 1  67 TYR CZ   C  20.236  -0.511  -8.442 1.00 . A A .  67 TYR CZ   1 1 
        1   986 1 1  67 TYR H    H  18.990  -3.757 -13.491 1.00 . A A .  67 TYR H    1 1 
        1   987 1 1  67 TYR HA   H  20.135  -1.068 -13.225 1.00 . A A .  67 TYR HA   1 1 
        1   988 1 1  67 TYR HB2  H  21.115  -3.608 -11.944 1.00 . A A .  67 TYR HB2  1 1 
        1   989 1 1  67 TYR HB3  H  22.241  -2.311 -12.338 1.00 . A A .  67 TYR HB3  1 1 
        1   990 1 1  67 TYR HD1  H  19.050  -2.894 -10.500 1.00 . A A .  67 TYR HD1  1 1 
        1   991 1 1  67 TYR HD2  H  22.609  -0.586 -10.827 1.00 . A A .  67 TYR HD2  1 1 
        1   992 1 1  67 TYR HE1  H  18.485  -1.736  -8.404 1.00 . A A .  67 TYR HE1  1 1 
        1   993 1 1  67 TYR HE2  H  22.054   0.577  -8.731 1.00 . A A .  67 TYR HE2  1 1 
        1   994 1 1  67 TYR HH   H  19.565   1.007  -7.468 1.00 . A A .  67 TYR HH   1 1 
        1   995 1 1  67 TYR N    N  19.044  -2.819 -13.210 1.00 . A A .  67 TYR N    1 1 
        1   996 1 1  67 TYR O    O  20.613  -3.299 -15.360 1.00 . A A .  67 TYR O    1 1 
        1   997 1 1  67 TYR OH   O  19.923   0.138  -7.269 1.00 . A A .  67 TYR OH   1 1 
        1   998 1 1  68 LYS C    C  24.246  -2.571 -15.760 1.00 . A A .  68 LYS C    1 1 
        1   999 1 1  68 LYS CA   C  22.905  -1.914 -16.068 1.00 . A A .  68 LYS CA   1 1 
        1  1000 1 1  68 LYS CB   C  23.130  -0.573 -16.771 1.00 . A A .  68 LYS CB   1 1 
        1  1001 1 1  68 LYS CD   C  24.252  -0.699 -19.016 1.00 . A A .  68 LYS CD   1 1 
        1  1002 1 1  68 LYS CE   C  24.209   0.106 -20.306 1.00 . A A .  68 LYS CE   1 1 
        1  1003 1 1  68 LYS CG   C  22.927  -0.635 -18.276 1.00 . A A .  68 LYS CG   1 1 
        1  1004 1 1  68 LYS H    H  22.421  -1.044 -14.198 1.00 . A A .  68 LYS H    1 1 
        1  1005 1 1  68 LYS HA   H  22.341  -2.562 -16.720 1.00 . A A .  68 LYS HA   1 1 
        1  1006 1 1  68 LYS HB2  H  22.440   0.161 -16.355 1.00 . A A .  68 LYS HB2  1 1 
        1  1007 1 1  68 LYS HB3  H  24.141  -0.245 -16.580 1.00 . A A .  68 LYS HB3  1 1 
        1  1008 1 1  68 LYS HD2  H  25.039  -0.304 -18.374 1.00 . A A .  68 LYS HD2  1 1 
        1  1009 1 1  68 LYS HD3  H  24.472  -1.731 -19.254 1.00 . A A .  68 LYS HD3  1 1 
        1  1010 1 1  68 LYS HE2  H  23.667  -0.461 -21.062 1.00 . A A .  68 LYS HE2  1 1 
        1  1011 1 1  68 LYS HE3  H  23.688   1.033 -20.118 1.00 . A A .  68 LYS HE3  1 1 
        1  1012 1 1  68 LYS HG2  H  22.338  -1.519 -18.521 1.00 . A A .  68 LYS HG2  1 1 
        1  1013 1 1  68 LYS HG3  H  22.390   0.248 -18.593 1.00 . A A .  68 LYS HG3  1 1 
        1  1014 1 1  68 LYS HZ1  H  26.083  -0.470 -21.029 1.00 . A A .  68 LYS HZ1  1 1 
        1  1015 1 1  68 LYS HZ2  H  26.112   0.943 -20.098 1.00 . A A .  68 LYS HZ2  1 1 
        1  1016 1 1  68 LYS HZ3  H  25.515   0.985 -21.679 1.00 . A A .  68 LYS HZ3  1 1 
        1  1017 1 1  68 LYS N    N  22.129  -1.719 -14.848 1.00 . A A .  68 LYS N    1 1 
        1  1018 1 1  68 LYS NZ   N  25.575   0.412 -20.813 1.00 . A A .  68 LYS NZ   1 1 
        1  1019 1 1  68 LYS O    O  25.201  -1.900 -15.362 1.00 . A A .  68 LYS O    1 1 
        1  1020 1 1  69 PHE C    C  26.420  -4.676 -16.939 1.00 . A A .  69 PHE C    1 1 
        1  1021 1 1  69 PHE CA   C  25.540  -4.631 -15.694 1.00 . A A .  69 PHE CA   1 1 
        1  1022 1 1  69 PHE CB   C  25.211  -6.052 -15.236 1.00 . A A .  69 PHE CB   1 1 
        1  1023 1 1  69 PHE CD1  C  24.934  -5.308 -12.855 1.00 . A A .  69 PHE CD1  1 1 
        1  1024 1 1  69 PHE CD2  C  23.439  -6.960 -13.707 1.00 . A A .  69 PHE CD2  1 1 
        1  1025 1 1  69 PHE CE1  C  24.295  -5.356 -11.631 1.00 . A A .  69 PHE CE1  1 1 
        1  1026 1 1  69 PHE CE2  C  22.797  -7.011 -12.485 1.00 . A A .  69 PHE CE2  1 1 
        1  1027 1 1  69 PHE CG   C  24.514  -6.108 -13.906 1.00 . A A .  69 PHE CG   1 1 
        1  1028 1 1  69 PHE CZ   C  23.225  -6.210 -11.446 1.00 . A A .  69 PHE CZ   1 1 
        1  1029 1 1  69 PHE H    H  23.521  -4.361 -16.271 1.00 . A A .  69 PHE H    1 1 
        1  1030 1 1  69 PHE HA   H  26.078  -4.123 -14.907 1.00 . A A .  69 PHE HA   1 1 
        1  1031 1 1  69 PHE HB2  H  24.573  -6.522 -15.984 1.00 . A A .  69 PHE HB2  1 1 
        1  1032 1 1  69 PHE HB3  H  26.126  -6.618 -15.157 1.00 . A A .  69 PHE HB3  1 1 
        1  1033 1 1  69 PHE HD1  H  25.771  -4.640 -13.000 1.00 . A A .  69 PHE HD1  1 1 
        1  1034 1 1  69 PHE HD2  H  23.103  -7.588 -14.519 1.00 . A A .  69 PHE HD2  1 1 
        1  1035 1 1  69 PHE HE1  H  24.634  -4.727 -10.820 1.00 . A A .  69 PHE HE1  1 1 
        1  1036 1 1  69 PHE HE2  H  21.960  -7.680 -12.342 1.00 . A A .  69 PHE HE2  1 1 
        1  1037 1 1  69 PHE HZ   H  22.725  -6.249 -10.489 1.00 . A A .  69 PHE HZ   1 1 
        1  1038 1 1  69 PHE N    N  24.315  -3.883 -15.951 1.00 . A A .  69 PHE N    1 1 
        1  1039 1 1  69 PHE O    O  25.950  -4.983 -18.033 1.00 . A A .  69 PHE O    1 1 
        1  1040 1 1  70 GLY C    C  29.329  -5.713 -18.040 1.00 . A A .  70 GLY C    1 1 
        1  1041 1 1  70 GLY CA   C  28.628  -4.379 -17.882 1.00 . A A .  70 GLY CA   1 1 
        1  1042 1 1  70 GLY H    H  28.022  -4.130 -15.868 1.00 . A A .  70 GLY H    1 1 
        1  1043 1 1  70 GLY HA2  H  28.083  -4.160 -18.788 1.00 . A A .  70 GLY HA2  1 1 
        1  1044 1 1  70 GLY HA3  H  29.371  -3.611 -17.727 1.00 . A A .  70 GLY HA3  1 1 
        1  1045 1 1  70 GLY N    N  27.702  -4.368 -16.765 1.00 . A A .  70 GLY N    1 1 
        1  1046 1 1  70 GLY O    O  28.809  -6.623 -18.683 1.00 . A A .  70 GLY O    1 1 
        1  1047 1 1  71 ASN C    C  31.743  -7.512 -16.150 1.00 . A A .  71 ASN C    1 1 
        1  1048 1 1  71 ASN CA   C  31.293  -7.062 -17.536 1.00 . A A .  71 ASN CA   1 1 
        1  1049 1 1  71 ASN CB   C  32.511  -6.864 -18.441 1.00 . A A .  71 ASN CB   1 1 
        1  1050 1 1  71 ASN CG   C  32.218  -7.209 -19.888 1.00 . A A .  71 ASN CG   1 1 
        1  1051 1 1  71 ASN H    H  30.881  -5.068 -16.957 1.00 . A A .  71 ASN H    1 1 
        1  1052 1 1  71 ASN HA   H  30.658  -7.824 -17.962 1.00 . A A .  71 ASN HA   1 1 
        1  1053 1 1  71 ASN HB2  H  32.827  -5.822 -18.384 1.00 . A A .  71 ASN HB2  1 1 
        1  1054 1 1  71 ASN HB3  H  33.315  -7.493 -18.095 1.00 . A A .  71 ASN HB3  1 1 
        1  1055 1 1  71 ASN HD21 H  32.121  -9.142 -19.432 1.00 . A A .  71 ASN HD21 1 1 
        1  1056 1 1  71 ASN HD22 H  31.859  -8.749 -21.093 1.00 . A A .  71 ASN HD22 1 1 
        1  1057 1 1  71 ASN N    N  30.517  -5.829 -17.455 1.00 . A A .  71 ASN N    1 1 
        1  1058 1 1  71 ASN ND2  N  32.048  -8.497 -20.165 1.00 . A A .  71 ASN ND2  1 1 
        1  1059 1 1  71 ASN O    O  32.406  -6.767 -15.429 1.00 . A A .  71 ASN O    1 1 
        1  1060 1 1  71 ASN OD1  O  32.144  -6.330 -20.746 1.00 . A A .  71 ASN OD1  1 1 
        1  1061 1 1  72 TRP C    C  33.242  -9.133 -14.232 1.00 . A A .  72 TRP C    1 1 
        1  1062 1 1  72 TRP CA   C  31.747  -9.289 -14.487 1.00 . A A .  72 TRP CA   1 1 
        1  1063 1 1  72 TRP CB   C  31.353 -10.764 -14.406 1.00 . A A .  72 TRP CB   1 1 
        1  1064 1 1  72 TRP CD1  C  29.424 -11.326 -15.997 1.00 . A A .  72 TRP CD1  1 1 
        1  1065 1 1  72 TRP CD2  C  28.796 -10.980 -13.875 1.00 . A A .  72 TRP CD2  1 1 
        1  1066 1 1  72 TRP CE2  C  27.651 -11.277 -14.639 1.00 . A A .  72 TRP CE2  1 1 
        1  1067 1 1  72 TRP CE3  C  28.647 -10.727 -12.509 1.00 . A A .  72 TRP CE3  1 1 
        1  1068 1 1  72 TRP CG   C  29.919 -11.017 -14.762 1.00 . A A .  72 TRP CG   1 1 
        1  1069 1 1  72 TRP CH2  C  26.259 -11.075 -12.742 1.00 . A A .  72 TRP CH2  1 1 
        1  1070 1 1  72 TRP CZ2  C  26.376 -11.327 -14.082 1.00 . A A .  72 TRP CZ2  1 1 
        1  1071 1 1  72 TRP CZ3  C  27.381 -10.776 -11.957 1.00 . A A .  72 TRP CZ3  1 1 
        1  1072 1 1  72 TRP H    H  30.851  -9.283 -16.405 1.00 . A A .  72 TRP H    1 1 
        1  1073 1 1  72 TRP HA   H  31.206  -8.740 -13.729 1.00 . A A .  72 TRP HA   1 1 
        1  1074 1 1  72 TRP HB2  H  31.989 -11.334 -15.084 1.00 . A A .  72 TRP HB2  1 1 
        1  1075 1 1  72 TRP HB3  H  31.514 -11.118 -13.398 1.00 . A A .  72 TRP HB3  1 1 
        1  1076 1 1  72 TRP HD1  H  30.027 -11.426 -16.886 1.00 . A A .  72 TRP HD1  1 1 
        1  1077 1 1  72 TRP HE1  H  27.476 -11.709 -16.686 1.00 . A A .  72 TRP HE1  1 1 
        1  1078 1 1  72 TRP HE3  H  29.499 -10.495 -11.887 1.00 . A A .  72 TRP HE3  1 1 
        1  1079 1 1  72 TRP HH2  H  25.290 -11.101 -12.270 1.00 . A A .  72 TRP HH2  1 1 
        1  1080 1 1  72 TRP HZ2  H  25.503 -11.556 -14.674 1.00 . A A .  72 TRP HZ2  1 1 
        1  1081 1 1  72 TRP HZ3  H  27.246 -10.583 -10.903 1.00 . A A .  72 TRP HZ3  1 1 
        1  1082 1 1  72 TRP N    N  31.379  -8.737 -15.786 1.00 . A A .  72 TRP N    1 1 
        1  1083 1 1  72 TRP NE1  N  28.060 -11.483 -15.931 1.00 . A A .  72 TRP NE1  1 1 
        1  1084 1 1  72 TRP O    O  34.065  -9.484 -15.079 1.00 . A A .  72 TRP O    1 1 
        1  1085 1 1  73 GLY C    C  35.757  -9.721 -12.680 1.00 . A A .  73 GLY C    1 1 
        1  1086 1 1  73 GLY CA   C  34.985  -8.416 -12.718 1.00 . A A .  73 GLY CA   1 1 
        1  1087 1 1  73 GLY H    H  32.890  -8.347 -12.426 1.00 . A A .  73 GLY H    1 1 
        1  1088 1 1  73 GLY HA2  H  35.438  -7.764 -13.449 1.00 . A A .  73 GLY HA2  1 1 
        1  1089 1 1  73 GLY HA3  H  35.044  -7.948 -11.746 1.00 . A A .  73 GLY HA3  1 1 
        1  1090 1 1  73 GLY N    N  33.588  -8.608 -13.061 1.00 . A A .  73 GLY N    1 1 
        1  1091 1 1  73 GLY O    O  35.278 -10.746 -13.162 1.00 . A A .  73 GLY O    1 1 
        1  1092 1 1  74 GLU C    C  37.342 -11.764 -10.860 1.00 . A A .  74 GLU C    1 1 
        1  1093 1 1  74 GLU CA   C  37.795 -10.869 -12.009 1.00 . A A .  74 GLU CA   1 1 
        1  1094 1 1  74 GLU CB   C  39.260 -10.472 -11.815 1.00 . A A .  74 GLU CB   1 1 
        1  1095 1 1  74 GLU CD   C  39.977 -10.817  -9.418 1.00 . A A .  74 GLU CD   1 1 
        1  1096 1 1  74 GLU CG   C  39.539  -9.819 -10.471 1.00 . A A .  74 GLU CG   1 1 
        1  1097 1 1  74 GLU H    H  37.282  -8.833 -11.739 1.00 . A A .  74 GLU H    1 1 
        1  1098 1 1  74 GLU HA   H  37.700 -11.418 -12.935 1.00 . A A .  74 GLU HA   1 1 
        1  1099 1 1  74 GLU HB2  H  39.879 -11.364 -11.905 1.00 . A A .  74 GLU HB2  1 1 
        1  1100 1 1  74 GLU HB3  H  39.537  -9.778 -12.593 1.00 . A A .  74 GLU HB3  1 1 
        1  1101 1 1  74 GLU HG2  H  40.323  -9.072 -10.598 1.00 . A A .  74 GLU HG2  1 1 
        1  1102 1 1  74 GLU HG3  H  38.640  -9.328 -10.129 1.00 . A A .  74 GLU HG3  1 1 
        1  1103 1 1  74 GLU N    N  36.955  -9.681 -12.106 1.00 . A A .  74 GLU N    1 1 
        1  1104 1 1  74 GLU O    O  37.100 -11.291  -9.748 1.00 . A A .  74 GLU O    1 1 
        1  1105 1 1  74 GLU OE1  O  40.976 -11.530  -9.652 1.00 . A A .  74 GLU OE1  1 1 
        1  1106 1 1  74 GLU OE2  O  39.320 -10.887  -8.357 1.00 . A A .  74 GLU OE2  1 1 
        1  1107 1 1  75 CYS C    C  37.981 -14.451  -9.253 1.00 . A A .  75 CYS C    1 1 
        1  1108 1 1  75 CYS CA   C  36.803 -14.021 -10.123 1.00 . A A .  75 CYS CA   1 1 
        1  1109 1 1  75 CYS CB   C  36.173 -15.246 -10.789 1.00 . A A .  75 CYS CB   1 1 
        1  1110 1 1  75 CYS H    H  37.436 -13.376 -12.039 1.00 . A A .  75 CYS H    1 1 
        1  1111 1 1  75 CYS HA   H  36.066 -13.542  -9.498 1.00 . A A .  75 CYS HA   1 1 
        1  1112 1 1  75 CYS HB2  H  36.969 -15.873 -11.189 1.00 . A A .  75 CYS HB2  1 1 
        1  1113 1 1  75 CYS HB3  H  35.629 -15.810 -10.046 1.00 . A A .  75 CYS HB3  1 1 
        1  1114 1 1  75 CYS HG   H  35.176 -13.569 -12.498 1.00 . A A .  75 CYS HG   1 1 
        1  1115 1 1  75 CYS N    N  37.228 -13.059 -11.134 1.00 . A A .  75 CYS N    1 1 
        1  1116 1 1  75 CYS O    O  39.072 -14.721  -9.756 1.00 . A A .  75 CYS O    1 1 
        1  1117 1 1  75 CYS SG   S  35.016 -14.845 -12.138 1.00 . A A .  75 CYS SG   1 1 
        1  1118 1 1  76 ASP C    C  38.626 -16.373  -6.598 1.00 . A A .  76 ASP C    1 1 
        1  1119 1 1  76 ASP CA   C  38.792 -14.913  -7.005 1.00 . A A .  76 ASP CA   1 1 
        1  1120 1 1  76 ASP CB   C  38.760 -14.017  -5.767 1.00 . A A .  76 ASP CB   1 1 
        1  1121 1 1  76 ASP CG   C  40.018 -13.184  -5.621 1.00 . A A .  76 ASP CG   1 1 
        1  1122 1 1  76 ASP H    H  36.861 -14.288  -7.605 1.00 . A A .  76 ASP H    1 1 
        1  1123 1 1  76 ASP HA   H  39.746 -14.797  -7.497 1.00 . A A .  76 ASP HA   1 1 
        1  1124 1 1  76 ASP HB2  H  37.900 -13.350  -5.836 1.00 . A A .  76 ASP HB2  1 1 
        1  1125 1 1  76 ASP HB3  H  38.654 -14.635  -4.887 1.00 . A A .  76 ASP HB3  1 1 
        1  1126 1 1  76 ASP N    N  37.752 -14.514  -7.946 1.00 . A A .  76 ASP N    1 1 
        1  1127 1 1  76 ASP O    O  37.769 -16.706  -5.779 1.00 . A A .  76 ASP O    1 1 
        1  1128 1 1  76 ASP OD1  O  41.122 -13.766  -5.666 1.00 . A A .  76 ASP OD1  1 1 
        1  1129 1 1  76 ASP OD2  O  39.898 -11.953  -5.462 1.00 . A A .  76 ASP OD2  1 1 
        1  1130 1 1  77 ALA C    C  39.555 -18.915  -5.376 1.00 . A A .  77 ALA C    1 1 
        1  1131 1 1  77 ALA CA   C  39.393 -18.666  -6.872 1.00 . A A .  77 ALA CA   1 1 
        1  1132 1 1  77 ALA CB   C  40.464 -19.415  -7.652 1.00 . A A .  77 ALA CB   1 1 
        1  1133 1 1  77 ALA H    H  40.111 -16.916  -7.821 1.00 . A A .  77 ALA H    1 1 
        1  1134 1 1  77 ALA HA   H  38.428 -19.037  -7.186 1.00 . A A .  77 ALA HA   1 1 
        1  1135 1 1  77 ALA HB1  H  40.721 -20.323  -7.127 1.00 . A A .  77 ALA HB1  1 1 
        1  1136 1 1  77 ALA HB2  H  40.087 -19.661  -8.634 1.00 . A A .  77 ALA HB2  1 1 
        1  1137 1 1  77 ALA HB3  H  41.340 -18.792  -7.748 1.00 . A A .  77 ALA HB3  1 1 
        1  1138 1 1  77 ALA N    N  39.450 -17.242  -7.175 1.00 . A A .  77 ALA N    1 1 
        1  1139 1 1  77 ALA O    O  39.149 -19.958  -4.863 1.00 . A A .  77 ALA O    1 1 
        1  1140 1 1  78 ALA C    C  39.042 -18.035  -2.488 1.00 . A A .  78 ALA C    1 1 
        1  1141 1 1  78 ALA CA   C  40.366 -18.067  -3.245 1.00 . A A .  78 ALA CA   1 1 
        1  1142 1 1  78 ALA CB   C  41.281 -16.953  -2.757 1.00 . A A .  78 ALA CB   1 1 
        1  1143 1 1  78 ALA H    H  40.453 -17.144  -5.147 1.00 . A A .  78 ALA H    1 1 
        1  1144 1 1  78 ALA HA   H  40.856 -19.011  -3.055 1.00 . A A .  78 ALA HA   1 1 
        1  1145 1 1  78 ALA HB1  H  40.687 -16.169  -2.310 1.00 . A A .  78 ALA HB1  1 1 
        1  1146 1 1  78 ALA HB2  H  41.967 -17.347  -2.023 1.00 . A A .  78 ALA HB2  1 1 
        1  1147 1 1  78 ALA HB3  H  41.837 -16.552  -3.591 1.00 . A A .  78 ALA HB3  1 1 
        1  1148 1 1  78 ALA N    N  40.152 -17.952  -4.681 1.00 . A A .  78 ALA N    1 1 
        1  1149 1 1  78 ALA O    O  38.948 -18.520  -1.359 1.00 . A A .  78 ALA O    1 1 
        1  1150 1 1  79 THR C    C  35.631 -17.972  -3.400 1.00 . A A .  79 THR C    1 1 
        1  1151 1 1  79 THR CA   C  36.703 -17.367  -2.501 1.00 . A A .  79 THR CA   1 1 
        1  1152 1 1  79 THR CB   C  36.331 -15.904  -2.192 1.00 . A A .  79 THR CB   1 1 
        1  1153 1 1  79 THR CG2  C  36.296 -15.074  -3.467 1.00 . A A .  79 THR CG2  1 1 
        1  1154 1 1  79 THR H    H  38.157 -17.095  -4.013 1.00 . A A .  79 THR H    1 1 
        1  1155 1 1  79 THR HA   H  36.728 -17.915  -1.569 1.00 . A A .  79 THR HA   1 1 
        1  1156 1 1  79 THR HB   H  37.079 -15.491  -1.530 1.00 . A A .  79 THR HB   1 1 
        1  1157 1 1  79 THR HG1  H  35.169 -15.964  -0.599 1.00 . A A .  79 THR HG1  1 1 
        1  1158 1 1  79 THR HG21 H  36.281 -15.731  -4.323 1.00 . A A .  79 THR HG21 1 1 
        1  1159 1 1  79 THR HG22 H  37.175 -14.446  -3.510 1.00 . A A .  79 THR HG22 1 1 
        1  1160 1 1  79 THR HG23 H  35.411 -14.456  -3.470 1.00 . A A .  79 THR HG23 1 1 
        1  1161 1 1  79 THR N    N  38.021 -17.463  -3.116 1.00 . A A .  79 THR N    1 1 
        1  1162 1 1  79 THR O    O  34.462 -18.055  -3.021 1.00 . A A .  79 THR O    1 1 
        1  1163 1 1  79 THR OG1  O  35.055 -15.849  -1.546 1.00 . A A .  79 THR OG1  1 1 
        1  1164 1 1  80 SER C    C  33.887 -18.097  -5.749 1.00 . A A .  80 SER C    1 1 
        1  1165 1 1  80 SER CA   C  35.109 -18.988  -5.550 1.00 . A A .  80 SER CA   1 1 
        1  1166 1 1  80 SER CB   C  34.671 -20.374  -5.073 1.00 . A A .  80 SER CB   1 1 
        1  1167 1 1  80 SER H    H  36.979 -18.300  -4.838 1.00 . A A .  80 SER H    1 1 
        1  1168 1 1  80 SER HA   H  35.624 -19.088  -6.494 1.00 . A A .  80 SER HA   1 1 
        1  1169 1 1  80 SER HB2  H  33.732 -20.284  -4.527 1.00 . A A .  80 SER HB2  1 1 
        1  1170 1 1  80 SER HB3  H  34.524 -21.017  -5.929 1.00 . A A .  80 SER HB3  1 1 
        1  1171 1 1  80 SER HG   H  36.254 -21.480  -4.753 1.00 . A A .  80 SER HG   1 1 
        1  1172 1 1  80 SER N    N  36.035 -18.394  -4.594 1.00 . A A .  80 SER N    1 1 
        1  1173 1 1  80 SER O    O  32.767 -18.583  -5.909 1.00 . A A .  80 SER O    1 1 
        1  1174 1 1  80 SER OG   O  35.648 -20.955  -4.227 1.00 . A A .  80 SER OG   1 1 
        1  1175 1 1  81 THR C    C  33.533 -14.545  -6.573 1.00 . A A .  81 THR C    1 1 
        1  1176 1 1  81 THR CA   C  33.028 -15.825  -5.914 1.00 . A A .  81 THR CA   1 1 
        1  1177 1 1  81 THR CB   C  32.366 -15.470  -4.570 1.00 . A A .  81 THR CB   1 1 
        1  1178 1 1  81 THR CG2  C  31.273 -16.471  -4.225 1.00 . A A .  81 THR CG2  1 1 
        1  1179 1 1  81 THR H    H  35.024 -16.459  -5.606 1.00 . A A .  81 THR H    1 1 
        1  1180 1 1  81 THR HA   H  32.283 -16.276  -6.552 1.00 . A A .  81 THR HA   1 1 
        1  1181 1 1  81 THR HB   H  31.922 -14.489  -4.653 1.00 . A A .  81 THR HB   1 1 
        1  1182 1 1  81 THR HG1  H  32.922 -15.602  -2.682 1.00 . A A .  81 THR HG1  1 1 
        1  1183 1 1  81 THR HG21 H  30.942 -16.967  -5.125 1.00 . A A .  81 THR HG21 1 1 
        1  1184 1 1  81 THR HG22 H  30.440 -15.952  -3.773 1.00 . A A .  81 THR HG22 1 1 
        1  1185 1 1  81 THR HG23 H  31.660 -17.203  -3.533 1.00 . A A .  81 THR HG23 1 1 
        1  1186 1 1  81 THR N    N  34.110 -16.786  -5.737 1.00 . A A .  81 THR N    1 1 
        1  1187 1 1  81 THR O    O  34.630 -14.073  -6.275 1.00 . A A .  81 THR O    1 1 
        1  1188 1 1  81 THR OG1  O  33.348 -15.453  -3.529 1.00 . A A .  81 THR OG1  1 1 
        1  1189 1 1  82 LYS C    C  32.245 -11.588  -7.679 1.00 . A A .  82 LYS C    1 1 
        1  1190 1 1  82 LYS CA   C  33.088 -12.762  -8.168 1.00 . A A .  82 LYS CA   1 1 
        1  1191 1 1  82 LYS CB   C  32.907 -12.940  -9.678 1.00 . A A .  82 LYS CB   1 1 
        1  1192 1 1  82 LYS CD   C  31.169 -13.007 -11.490 1.00 . A A .  82 LYS CD   1 1 
        1  1193 1 1  82 LYS CE   C  31.130 -14.202 -12.429 1.00 . A A .  82 LYS CE   1 1 
        1  1194 1 1  82 LYS CG   C  31.523 -13.424 -10.072 1.00 . A A .  82 LYS CG   1 1 
        1  1195 1 1  82 LYS H    H  31.862 -14.413  -7.663 1.00 . A A .  82 LYS H    1 1 
        1  1196 1 1  82 LYS HA   H  34.127 -12.556  -7.960 1.00 . A A .  82 LYS HA   1 1 
        1  1197 1 1  82 LYS HB2  H  33.096 -11.985 -10.167 1.00 . A A .  82 LYS HB2  1 1 
        1  1198 1 1  82 LYS HB3  H  33.631 -13.659 -10.032 1.00 . A A .  82 LYS HB3  1 1 
        1  1199 1 1  82 LYS HD2  H  30.192 -12.523 -11.487 1.00 . A A .  82 LYS HD2  1 1 
        1  1200 1 1  82 LYS HD3  H  31.911 -12.305 -11.845 1.00 . A A .  82 LYS HD3  1 1 
        1  1201 1 1  82 LYS HE2  H  32.151 -14.503 -12.664 1.00 . A A .  82 LYS HE2  1 1 
        1  1202 1 1  82 LYS HE3  H  30.628 -15.019 -11.932 1.00 . A A .  82 LYS HE3  1 1 
        1  1203 1 1  82 LYS HG2  H  31.491 -14.511 -10.001 1.00 . A A .  82 LYS HG2  1 1 
        1  1204 1 1  82 LYS HG3  H  30.796 -13.003  -9.391 1.00 . A A .  82 LYS HG3  1 1 
        1  1205 1 1  82 LYS HZ1  H  29.523 -13.393 -13.489 1.00 . A A .  82 LYS HZ1  1 1 
        1  1206 1 1  82 LYS HZ2  H  30.195 -14.769 -14.209 1.00 . A A .  82 LYS HZ2  1 1 
        1  1207 1 1  82 LYS HZ3  H  31.003 -13.286 -14.302 1.00 . A A .  82 LYS HZ3  1 1 
        1  1208 1 1  82 LYS N    N  32.724 -13.990  -7.468 1.00 . A A .  82 LYS N    1 1 
        1  1209 1 1  82 LYS NZ   N  30.413 -13.890 -13.696 1.00 . A A .  82 LYS NZ   1 1 
        1  1210 1 1  82 LYS O    O  31.160 -11.776  -7.129 1.00 . A A .  82 LYS O    1 1 
        1  1211 1 1  83 SER C    C  31.959  -8.165  -8.605 1.00 . A A .  83 SER C    1 1 
        1  1212 1 1  83 SER CA   C  32.048  -9.171  -7.462 1.00 . A A .  83 SER CA   1 1 
        1  1213 1 1  83 SER CB   C  32.753  -8.537  -6.263 1.00 . A A .  83 SER CB   1 1 
        1  1214 1 1  83 SER H    H  33.622 -10.292  -8.328 1.00 . A A .  83 SER H    1 1 
        1  1215 1 1  83 SER HA   H  31.047  -9.458  -7.171 1.00 . A A .  83 SER HA   1 1 
        1  1216 1 1  83 SER HB2  H  33.806  -8.816  -6.277 1.00 . A A .  83 SER HB2  1 1 
        1  1217 1 1  83 SER HB3  H  32.670  -7.460  -6.328 1.00 . A A .  83 SER HB3  1 1 
        1  1218 1 1  83 SER HG   H  32.466  -8.396  -4.330 1.00 . A A .  83 SER HG   1 1 
        1  1219 1 1  83 SER N    N  32.753 -10.377  -7.884 1.00 . A A .  83 SER N    1 1 
        1  1220 1 1  83 SER O    O  32.836  -8.109  -9.467 1.00 . A A .  83 SER O    1 1 
        1  1221 1 1  83 SER OG   O  32.172  -8.965  -5.044 1.00 . A A .  83 SER OG   1 1 
        1  1222 1 1  84 ARG C    C  29.802  -5.235  -9.136 1.00 . A A .  84 ARG C    1 1 
        1  1223 1 1  84 ARG CA   C  30.686  -6.369  -9.644 1.00 . A A .  84 ARG CA   1 1 
        1  1224 1 1  84 ARG CB   C  30.055  -7.007 -10.882 1.00 . A A .  84 ARG CB   1 1 
        1  1225 1 1  84 ARG CD   C  29.455  -6.338 -13.230 1.00 . A A .  84 ARG CD   1 1 
        1  1226 1 1  84 ARG CG   C  30.564  -6.428 -12.193 1.00 . A A .  84 ARG CG   1 1 
        1  1227 1 1  84 ARG CZ   C  29.886  -4.096 -14.140 1.00 . A A .  84 ARG CZ   1 1 
        1  1228 1 1  84 ARG H    H  30.226  -7.466  -7.893 1.00 . A A .  84 ARG H    1 1 
        1  1229 1 1  84 ARG HA   H  31.652  -5.965  -9.911 1.00 . A A .  84 ARG HA   1 1 
        1  1230 1 1  84 ARG HB2  H  30.264  -8.077 -10.869 1.00 . A A .  84 ARG HB2  1 1 
        1  1231 1 1  84 ARG HB3  H  28.986  -6.863 -10.841 1.00 . A A .  84 ARG HB3  1 1 
        1  1232 1 1  84 ARG HD2  H  29.790  -6.817 -14.150 1.00 . A A .  84 ARG HD2  1 1 
        1  1233 1 1  84 ARG HD3  H  28.588  -6.862 -12.856 1.00 . A A .  84 ARG HD3  1 1 
        1  1234 1 1  84 ARG HE   H  28.197  -4.654 -13.236 1.00 . A A .  84 ARG HE   1 1 
        1  1235 1 1  84 ARG HG2  H  30.964  -5.431 -12.011 1.00 . A A .  84 ARG HG2  1 1 
        1  1236 1 1  84 ARG HG3  H  31.350  -7.061 -12.573 1.00 . A A .  84 ARG HG3  1 1 
        1  1237 1 1  84 ARG HH11 H  31.402  -5.412 -14.366 1.00 . A A .  84 ARG HH11 1 1 
        1  1238 1 1  84 ARG HH12 H  31.694  -3.827 -15.004 1.00 . A A .  84 ARG HH12 1 1 
        1  1239 1 1  84 ARG HH21 H  28.569  -2.564 -14.071 1.00 . A A .  84 ARG HH21 1 1 
        1  1240 1 1  84 ARG HH22 H  30.082  -2.208 -14.834 1.00 . A A .  84 ARG HH22 1 1 
        1  1241 1 1  84 ARG N    N  30.892  -7.373  -8.607 1.00 . A A .  84 ARG N    1 1 
        1  1242 1 1  84 ARG NE   N  29.086  -4.955 -13.520 1.00 . A A .  84 ARG NE   1 1 
        1  1243 1 1  84 ARG NH1  N  31.094  -4.476 -14.535 1.00 . A A .  84 ARG NH1  1 1 
        1  1244 1 1  84 ARG NH2  N  29.479  -2.854 -14.368 1.00 . A A .  84 ARG NH2  1 1 
        1  1245 1 1  84 ARG O    O  29.240  -5.312  -8.042 1.00 . A A .  84 ARG O    1 1 
        1  1246 1 1  85 THR C    C  27.955  -2.611 -10.713 1.00 . A A .  85 THR C    1 1 
        1  1247 1 1  85 THR CA   C  28.868  -3.029  -9.566 1.00 . A A .  85 THR CA   1 1 
        1  1248 1 1  85 THR CB   C  29.745  -1.827  -9.161 1.00 . A A .  85 THR CB   1 1 
        1  1249 1 1  85 THR CG2  C  29.798  -1.684  -7.647 1.00 . A A .  85 THR CG2  1 1 
        1  1250 1 1  85 THR H    H  30.155  -4.177 -10.794 1.00 . A A .  85 THR H    1 1 
        1  1251 1 1  85 THR HA   H  28.262  -3.308  -8.718 1.00 . A A .  85 THR HA   1 1 
        1  1252 1 1  85 THR HB   H  29.312  -0.929  -9.578 1.00 . A A .  85 THR HB   1 1 
        1  1253 1 1  85 THR HG1  H  31.122  -1.603 -10.553 1.00 . A A .  85 THR HG1  1 1 
        1  1254 1 1  85 THR HG21 H  30.366  -0.803  -7.390 1.00 . A A .  85 THR HG21 1 1 
        1  1255 1 1  85 THR HG22 H  30.272  -2.555  -7.220 1.00 . A A .  85 THR HG22 1 1 
        1  1256 1 1  85 THR HG23 H  28.794  -1.593  -7.259 1.00 . A A .  85 THR HG23 1 1 
        1  1257 1 1  85 THR N    N  29.684  -4.179  -9.936 1.00 . A A .  85 THR N    1 1 
        1  1258 1 1  85 THR O    O  28.410  -2.393 -11.835 1.00 . A A .  85 THR O    1 1 
        1  1259 1 1  85 THR OG1  O  31.070  -1.993  -9.678 1.00 . A A .  85 THR OG1  1 1 
        1  1260 1 1  86 GLY C    C  25.099  -0.748 -11.173 1.00 . A A .  86 GLY C    1 1 
        1  1261 1 1  86 GLY CA   C  25.703  -2.112 -11.441 1.00 . A A .  86 GLY CA   1 1 
        1  1262 1 1  86 GLY H    H  26.356  -2.690  -9.512 1.00 . A A .  86 GLY H    1 1 
        1  1263 1 1  86 GLY HA2  H  26.200  -2.092 -12.400 1.00 . A A .  86 GLY HA2  1 1 
        1  1264 1 1  86 GLY HA3  H  24.911  -2.845 -11.473 1.00 . A A .  86 GLY HA3  1 1 
        1  1265 1 1  86 GLY N    N  26.662  -2.503 -10.424 1.00 . A A .  86 GLY N    1 1 
        1  1266 1 1  86 GLY O    O  24.758  -0.423 -10.035 1.00 . A A .  86 GLY O    1 1 
        1  1267 1 1  87 THR C    C  22.894   1.378 -12.343 1.00 . A A .  87 THR C    1 1 
        1  1268 1 1  87 THR CA   C  24.398   1.391 -12.098 1.00 . A A .  87 THR CA   1 1 
        1  1269 1 1  87 THR CB   C  25.057   2.376 -13.082 1.00 . A A .  87 THR CB   1 1 
        1  1270 1 1  87 THR CG2  C  24.815   3.815 -12.653 1.00 . A A .  87 THR CG2  1 1 
        1  1271 1 1  87 THR H    H  25.252  -0.262 -13.107 1.00 . A A .  87 THR H    1 1 
        1  1272 1 1  87 THR HA   H  24.587   1.740 -11.093 1.00 . A A .  87 THR HA   1 1 
        1  1273 1 1  87 THR HB   H  24.622   2.230 -14.060 1.00 . A A .  87 THR HB   1 1 
        1  1274 1 1  87 THR HG1  H  26.867   2.303 -12.301 1.00 . A A .  87 THR HG1  1 1 
        1  1275 1 1  87 THR HG21 H  24.699   4.437 -13.527 1.00 . A A .  87 THR HG21 1 1 
        1  1276 1 1  87 THR HG22 H  25.656   4.164 -12.071 1.00 . A A .  87 THR HG22 1 1 
        1  1277 1 1  87 THR HG23 H  23.918   3.865 -12.053 1.00 . A A .  87 THR HG23 1 1 
        1  1278 1 1  87 THR N    N  24.963   0.054 -12.225 1.00 . A A .  87 THR N    1 1 
        1  1279 1 1  87 THR O    O  22.416   0.776 -13.305 1.00 . A A .  87 THR O    1 1 
        1  1280 1 1  87 THR OG1  O  26.466   2.125 -13.156 1.00 . A A .  87 THR OG1  1 1 
        1  1281 1 1  88 LEU C    C  20.291   2.774 -12.901 1.00 . A A .  88 LEU C    1 1 
        1  1282 1 1  88 LEU CA   C  20.698   2.110 -11.590 1.00 . A A .  88 LEU CA   1 1 
        1  1283 1 1  88 LEU CB   C  20.101   2.879 -10.409 1.00 . A A .  88 LEU CB   1 1 
        1  1284 1 1  88 LEU CD1  C  17.971   1.558 -10.378 1.00 . A A .  88 LEU CD1  1 1 
        1  1285 1 1  88 LEU CD2  C  18.118   3.717  -9.124 1.00 . A A .  88 LEU CD2  1 1 
        1  1286 1 1  88 LEU CG   C  18.574   2.952 -10.359 1.00 . A A .  88 LEU CG   1 1 
        1  1287 1 1  88 LEU H    H  22.587   2.505 -10.721 1.00 . A A .  88 LEU H    1 1 
        1  1288 1 1  88 LEU HA   H  20.318   1.099 -11.579 1.00 . A A .  88 LEU HA   1 1 
        1  1289 1 1  88 LEU HB2  H  20.451   2.416  -9.487 1.00 . A A .  88 LEU HB2  1 1 
        1  1290 1 1  88 LEU HB3  H  20.482   3.889 -10.448 1.00 . A A .  88 LEU HB3  1 1 
        1  1291 1 1  88 LEU HD11 H  17.304   1.442  -9.537 1.00 . A A .  88 LEU HD11 1 1 
        1  1292 1 1  88 LEU HD12 H  18.761   0.823 -10.313 1.00 . A A .  88 LEU HD12 1 1 
        1  1293 1 1  88 LEU HD13 H  17.422   1.415 -11.297 1.00 . A A .  88 LEU HD13 1 1 
        1  1294 1 1  88 LEU HD21 H  18.237   4.777  -9.292 1.00 . A A .  88 LEU HD21 1 1 
        1  1295 1 1  88 LEU HD22 H  18.715   3.417  -8.275 1.00 . A A .  88 LEU HD22 1 1 
        1  1296 1 1  88 LEU HD23 H  17.078   3.497  -8.929 1.00 . A A .  88 LEU HD23 1 1 
        1  1297 1 1  88 LEU HG   H  18.218   3.482 -11.231 1.00 . A A .  88 LEU HG   1 1 
        1  1298 1 1  88 LEU N    N  22.150   2.045 -11.468 1.00 . A A .  88 LEU N    1 1 
        1  1299 1 1  88 LEU O    O  20.635   3.927 -13.155 1.00 . A A .  88 LEU O    1 1 
        1  1300 1 1  89 GLN C    C  17.886   3.464 -14.832 1.00 . A A .  89 GLN C    1 1 
        1  1301 1 1  89 GLN CA   C  19.099   2.557 -15.012 1.00 . A A .  89 GLN CA   1 1 
        1  1302 1 1  89 GLN CB   C  18.755   1.406 -15.958 1.00 . A A .  89 GLN CB   1 1 
        1  1303 1 1  89 GLN CD   C  19.603   0.313 -18.072 1.00 . A A .  89 GLN CD   1 1 
        1  1304 1 1  89 GLN CG   C  19.959   0.846 -16.699 1.00 . A A .  89 GLN CG   1 1 
        1  1305 1 1  89 GLN H    H  19.312   1.125 -13.467 1.00 . A A .  89 GLN H    1 1 
        1  1306 1 1  89 GLN HA   H  19.905   3.134 -15.440 1.00 . A A .  89 GLN HA   1 1 
        1  1307 1 1  89 GLN HB2  H  18.296   0.603 -15.380 1.00 . A A .  89 GLN HB2  1 1 
        1  1308 1 1  89 GLN HB3  H  18.042   1.757 -16.689 1.00 . A A .  89 GLN HB3  1 1 
        1  1309 1 1  89 GLN HE21 H  19.651  -1.553 -17.386 1.00 . A A .  89 GLN HE21 1 1 
        1  1310 1 1  89 GLN HE22 H  19.267  -1.378 -19.061 1.00 . A A .  89 GLN HE22 1 1 
        1  1311 1 1  89 GLN HG2  H  20.704   1.635 -16.809 1.00 . A A .  89 GLN HG2  1 1 
        1  1312 1 1  89 GLN HG3  H  20.384   0.043 -16.115 1.00 . A A .  89 GLN HG3  1 1 
        1  1313 1 1  89 GLN N    N  19.555   2.038 -13.728 1.00 . A A .  89 GLN N    1 1 
        1  1314 1 1  89 GLN NE2  N  19.497  -1.007 -18.185 1.00 . A A .  89 GLN NE2  1 1 
        1  1315 1 1  89 GLN O    O  17.992   4.687 -14.926 1.00 . A A .  89 GLN O    1 1 
        1  1316 1 1  89 GLN OE1  O  19.425   1.077 -19.022 1.00 . A A .  89 GLN OE1  1 1 
        1  1317 1 1  90 LYS C    C  14.615   2.943 -13.331 1.00 . A A .  90 LYS C    1 1 
        1  1318 1 1  90 LYS CA   C  15.497   3.608 -14.384 1.00 . A A .  90 LYS CA   1 1 
        1  1319 1 1  90 LYS CB   C  14.735   3.724 -15.705 1.00 . A A .  90 LYS CB   1 1 
        1  1320 1 1  90 LYS CD   C  15.359   1.689 -17.042 1.00 . A A .  90 LYS CD   1 1 
        1  1321 1 1  90 LYS CE   C  14.874   1.272 -18.422 1.00 . A A .  90 LYS CE   1 1 
        1  1322 1 1  90 LYS CG   C  14.262   2.388 -16.255 1.00 . A A .  90 LYS CG   1 1 
        1  1323 1 1  90 LYS H    H  16.710   1.878 -14.513 1.00 . A A .  90 LYS H    1 1 
        1  1324 1 1  90 LYS HA   H  15.761   4.596 -14.042 1.00 . A A .  90 LYS HA   1 1 
        1  1325 1 1  90 LYS HB2  H  13.868   4.366 -15.553 1.00 . A A .  90 LYS HB2  1 1 
        1  1326 1 1  90 LYS HB3  H  15.381   4.183 -16.442 1.00 . A A .  90 LYS HB3  1 1 
        1  1327 1 1  90 LYS HD2  H  16.207   2.365 -17.150 1.00 . A A .  90 LYS HD2  1 1 
        1  1328 1 1  90 LYS HD3  H  15.673   0.809 -16.499 1.00 . A A .  90 LYS HD3  1 1 
        1  1329 1 1  90 LYS HE2  H  15.665   0.715 -18.924 1.00 . A A .  90 LYS HE2  1 1 
        1  1330 1 1  90 LYS HE3  H  14.010   0.634 -18.307 1.00 . A A .  90 LYS HE3  1 1 
        1  1331 1 1  90 LYS HG2  H  13.956   1.750 -15.426 1.00 . A A .  90 LYS HG2  1 1 
        1  1332 1 1  90 LYS HG3  H  13.415   2.556 -16.905 1.00 . A A .  90 LYS HG3  1 1 
        1  1333 1 1  90 LYS HZ1  H  15.150   3.238 -19.072 1.00 . A A .  90 LYS HZ1  1 1 
        1  1334 1 1  90 LYS HZ2  H  13.531   2.750 -19.036 1.00 . A A .  90 LYS HZ2  1 1 
        1  1335 1 1  90 LYS HZ3  H  14.554   2.199 -20.266 1.00 . A A .  90 LYS HZ3  1 1 
        1  1336 1 1  90 LYS N    N  16.732   2.857 -14.577 1.00 . A A .  90 LYS N    1 1 
        1  1337 1 1  90 LYS NZ   N  14.501   2.447 -19.257 1.00 . A A .  90 LYS NZ   1 1 
        1  1338 1 1  90 LYS O    O  14.759   1.755 -13.047 1.00 . A A .  90 LYS O    1 1 
        1  1339 1 1  91 ALA C    C  11.454   2.797 -12.355 1.00 . A A .  91 ALA C    1 1 
        1  1340 1 1  91 ALA CA   C  12.791   3.203 -11.743 1.00 . A A .  91 ALA CA   1 1 
        1  1341 1 1  91 ALA CB   C  12.579   4.239 -10.650 1.00 . A A .  91 ALA CB   1 1 
        1  1342 1 1  91 ALA H    H  13.632   4.657 -13.030 1.00 . A A .  91 ALA H    1 1 
        1  1343 1 1  91 ALA HA   H  13.248   2.333 -11.296 1.00 . A A .  91 ALA HA   1 1 
        1  1344 1 1  91 ALA HB1  H  12.944   3.851  -9.711 1.00 . A A .  91 ALA HB1  1 1 
        1  1345 1 1  91 ALA HB2  H  13.119   5.141 -10.900 1.00 . A A .  91 ALA HB2  1 1 
        1  1346 1 1  91 ALA HB3  H  11.527   4.463 -10.563 1.00 . A A .  91 ALA HB3  1 1 
        1  1347 1 1  91 ALA N    N  13.699   3.718 -12.760 1.00 . A A .  91 ALA N    1 1 
        1  1348 1 1  91 ALA O    O  10.725   3.636 -12.890 1.00 . A A .  91 ALA O    1 1 
        1  1349 1 1  92 LEU C    C   8.851   0.799 -11.721 1.00 . A A .  92 LEU C    1 1 
        1  1350 1 1  92 LEU CA   C   9.887   0.994 -12.822 1.00 . A A .  92 LEU CA   1 1 
        1  1351 1 1  92 LEU CB   C  10.134  -0.330 -13.546 1.00 . A A .  92 LEU CB   1 1 
        1  1352 1 1  92 LEU CD1  C  10.476  -2.771 -13.088 1.00 . A A .  92 LEU CD1  1 1 
        1  1353 1 1  92 LEU CD2  C  12.442  -1.227 -13.149 1.00 . A A .  92 LEU CD2  1 1 
        1  1354 1 1  92 LEU CG   C  10.969  -1.364 -12.790 1.00 . A A .  92 LEU CG   1 1 
        1  1355 1 1  92 LEU H    H  11.758   0.892 -11.838 1.00 . A A .  92 LEU H    1 1 
        1  1356 1 1  92 LEU HA   H   9.512   1.718 -13.529 1.00 . A A .  92 LEU HA   1 1 
        1  1357 1 1  92 LEU HB2  H   9.168  -0.776 -13.781 1.00 . A A .  92 LEU HB2  1 1 
        1  1358 1 1  92 LEU HB3  H  10.641  -0.110 -14.475 1.00 . A A .  92 LEU HB3  1 1 
        1  1359 1 1  92 LEU HD11 H   9.398  -2.769 -13.153 1.00 . A A .  92 LEU HD11 1 1 
        1  1360 1 1  92 LEU HD12 H  10.787  -3.437 -12.297 1.00 . A A .  92 LEU HD12 1 1 
        1  1361 1 1  92 LEU HD13 H  10.892  -3.108 -14.026 1.00 . A A .  92 LEU HD13 1 1 
        1  1362 1 1  92 LEU HD21 H  13.042  -1.344 -12.260 1.00 . A A .  92 LEU HD21 1 1 
        1  1363 1 1  92 LEU HD22 H  12.617  -0.250 -13.577 1.00 . A A .  92 LEU HD22 1 1 
        1  1364 1 1  92 LEU HD23 H  12.709  -1.987 -13.870 1.00 . A A .  92 LEU HD23 1 1 
        1  1365 1 1  92 LEU HG   H  10.866  -1.193 -11.728 1.00 . A A .  92 LEU HG   1 1 
        1  1366 1 1  92 LEU N    N  11.138   1.511 -12.276 1.00 . A A .  92 LEU N    1 1 
        1  1367 1 1  92 LEU O    O   7.646   0.835 -11.973 1.00 . A A .  92 LEU O    1 1 
        1  1368 1 1  93 PHE C    C   8.548   1.558  -8.374 1.00 . A A .  93 PHE C    1 1 
        1  1369 1 1  93 PHE CA   C   8.441   0.396  -9.356 1.00 . A A .  93 PHE CA   1 1 
        1  1370 1 1  93 PHE CB   C   8.776  -0.918  -8.645 1.00 . A A .  93 PHE CB   1 1 
        1  1371 1 1  93 PHE CD1  C   6.680  -2.288  -8.812 1.00 . A A .  93 PHE CD1  1 1 
        1  1372 1 1  93 PHE CD2  C   8.606  -3.011 -10.017 1.00 . A A .  93 PHE CD2  1 1 
        1  1373 1 1  93 PHE CE1  C   5.970  -3.372  -9.292 1.00 . A A .  93 PHE CE1  1 1 
        1  1374 1 1  93 PHE CE2  C   7.900  -4.097 -10.501 1.00 . A A .  93 PHE CE2  1 1 
        1  1375 1 1  93 PHE CG   C   8.006  -2.096  -9.168 1.00 . A A .  93 PHE CG   1 1 
        1  1376 1 1  93 PHE CZ   C   6.580  -4.276 -10.138 1.00 . A A .  93 PHE CZ   1 1 
        1  1377 1 1  93 PHE H    H  10.297   0.577 -10.358 1.00 . A A .  93 PHE H    1 1 
        1  1378 1 1  93 PHE HA   H   7.430   0.345  -9.727 1.00 . A A .  93 PHE HA   1 1 
        1  1379 1 1  93 PHE HB2  H   9.841  -1.117  -8.762 1.00 . A A .  93 PHE HB2  1 1 
        1  1380 1 1  93 PHE HB3  H   8.555  -0.816  -7.593 1.00 . A A .  93 PHE HB3  1 1 
        1  1381 1 1  93 PHE HD1  H   6.201  -1.580  -8.152 1.00 . A A .  93 PHE HD1  1 1 
        1  1382 1 1  93 PHE HD2  H   9.639  -2.873 -10.303 1.00 . A A .  93 PHE HD2  1 1 
        1  1383 1 1  93 PHE HE1  H   4.937  -3.509  -9.008 1.00 . A A .  93 PHE HE1  1 1 
        1  1384 1 1  93 PHE HE2  H   8.380  -4.803 -11.162 1.00 . A A .  93 PHE HE2  1 1 
        1  1385 1 1  93 PHE HZ   H   6.026  -5.125 -10.514 1.00 . A A .  93 PHE HZ   1 1 
        1  1386 1 1  93 PHE N    N   9.326   0.595 -10.497 1.00 . A A .  93 PHE N    1 1 
        1  1387 1 1  93 PHE O    O   7.729   1.698  -7.467 1.00 . A A .  93 PHE O    1 1 
        1  1388 1 1  94 ASN C    C  10.077   3.099  -6.265 1.00 . A A .  94 ASN C    1 1 
        1  1389 1 1  94 ASN CA   C   9.781   3.544  -7.695 1.00 . A A .  94 ASN CA   1 1 
        1  1390 1 1  94 ASN CB   C   8.555   4.460  -7.713 1.00 . A A .  94 ASN CB   1 1 
        1  1391 1 1  94 ASN CG   C   7.927   4.558  -9.089 1.00 . A A .  94 ASN CG   1 1 
        1  1392 1 1  94 ASN H    H  10.186   2.231  -9.304 1.00 . A A .  94 ASN H    1 1 
        1  1393 1 1  94 ASN HA   H  10.633   4.090  -8.073 1.00 . A A .  94 ASN HA   1 1 
        1  1394 1 1  94 ASN HB2  H   7.814   4.072  -7.014 1.00 . A A .  94 ASN HB2  1 1 
        1  1395 1 1  94 ASN HB3  H   8.849   5.451  -7.398 1.00 . A A .  94 ASN HB3  1 1 
        1  1396 1 1  94 ASN HD21 H   6.205   3.863  -8.380 1.00 . A A .  94 ASN HD21 1 1 
        1  1397 1 1  94 ASN HD22 H   6.228   4.234 -10.068 1.00 . A A .  94 ASN HD22 1 1 
        1  1398 1 1  94 ASN N    N   9.565   2.392  -8.564 1.00 . A A .  94 ASN N    1 1 
        1  1399 1 1  94 ASN ND2  N   6.658   4.181  -9.190 1.00 . A A .  94 ASN ND2  1 1 
        1  1400 1 1  94 ASN O    O   9.898   3.863  -5.317 1.00 . A A .  94 ASN O    1 1 
        1  1401 1 1  94 ASN OD1  O   8.576   4.970 -10.051 1.00 . A A .  94 ASN OD1  1 1 
        1  1402 1 1  95 VAL C    C  12.144   1.916  -4.262 1.00 . A A .  95 VAL C    1 1 
        1  1403 1 1  95 VAL CA   C  10.853   1.313  -4.807 1.00 . A A .  95 VAL CA   1 1 
        1  1404 1 1  95 VAL CB   C  10.998  -0.219  -4.857 1.00 . A A .  95 VAL CB   1 1 
        1  1405 1 1  95 VAL CG1  C   9.675  -0.869  -5.231 1.00 . A A .  95 VAL CG1  1 1 
        1  1406 1 1  95 VAL CG2  C  12.093  -0.620  -5.834 1.00 . A A .  95 VAL CG2  1 1 
        1  1407 1 1  95 VAL H    H  10.653   1.299  -6.913 1.00 . A A .  95 VAL H    1 1 
        1  1408 1 1  95 VAL HA   H  10.042   1.555  -4.136 1.00 . A A .  95 VAL HA   1 1 
        1  1409 1 1  95 VAL HB   H  11.278  -0.567  -3.874 1.00 . A A .  95 VAL HB   1 1 
        1  1410 1 1  95 VAL HG11 H   9.812  -1.486  -6.107 1.00 . A A .  95 VAL HG11 1 1 
        1  1411 1 1  95 VAL HG12 H   9.328  -1.479  -4.411 1.00 . A A .  95 VAL HG12 1 1 
        1  1412 1 1  95 VAL HG13 H   8.945  -0.102  -5.443 1.00 . A A .  95 VAL HG13 1 1 
        1  1413 1 1  95 VAL HG21 H  13.037  -0.211  -5.505 1.00 . A A .  95 VAL HG21 1 1 
        1  1414 1 1  95 VAL HG22 H  12.161  -1.696  -5.877 1.00 . A A .  95 VAL HG22 1 1 
        1  1415 1 1  95 VAL HG23 H  11.857  -0.236  -6.817 1.00 . A A .  95 VAL HG23 1 1 
        1  1416 1 1  95 VAL N    N  10.531   1.858  -6.120 1.00 . A A .  95 VAL N    1 1 
        1  1417 1 1  95 VAL O    O  12.739   2.795  -4.883 1.00 . A A .  95 VAL O    1 1 
        1  1418 1 1  96 GLU C    C  15.021   1.267  -3.081 1.00 . A A .  96 GLU C    1 1 
        1  1419 1 1  96 GLU CA   C  13.789   1.929  -2.469 1.00 . A A .  96 GLU CA   1 1 
        1  1420 1 1  96 GLU CB   C  13.752   1.671  -0.961 1.00 . A A .  96 GLU CB   1 1 
        1  1421 1 1  96 GLU CD   C  14.865   3.044   0.844 1.00 . A A .  96 GLU CD   1 1 
        1  1422 1 1  96 GLU CG   C  15.053   2.014  -0.254 1.00 . A A .  96 GLU CG   1 1 
        1  1423 1 1  96 GLU H    H  12.051   0.734  -2.652 1.00 . A A .  96 GLU H    1 1 
        1  1424 1 1  96 GLU HA   H  13.844   2.994  -2.641 1.00 . A A .  96 GLU HA   1 1 
        1  1425 1 1  96 GLU HB2  H  12.949   2.265  -0.524 1.00 . A A .  96 GLU HB2  1 1 
        1  1426 1 1  96 GLU HB3  H  13.541   0.625  -0.793 1.00 . A A .  96 GLU HB3  1 1 
        1  1427 1 1  96 GLU HG2  H  15.469   1.105   0.181 1.00 . A A .  96 GLU HG2  1 1 
        1  1428 1 1  96 GLU HG3  H  15.750   2.407  -0.979 1.00 . A A .  96 GLU HG3  1 1 
        1  1429 1 1  96 GLU N    N  12.569   1.436  -3.098 1.00 . A A .  96 GLU N    1 1 
        1  1430 1 1  96 GLU O    O  15.233   0.065  -2.930 1.00 . A A .  96 GLU O    1 1 
        1  1431 1 1  96 GLU OE1  O  14.605   4.220   0.517 1.00 . A A .  96 GLU OE1  1 1 
        1  1432 1 1  96 GLU OE2  O  14.978   2.671   2.031 1.00 . A A .  96 GLU OE2  1 1 
        1  1433 1 1  97 CYS C    C  18.118   2.640  -4.464 1.00 . A A .  97 CYS C    1 1 
        1  1434 1 1  97 CYS CA   C  17.042   1.558  -4.404 1.00 . A A .  97 CYS CA   1 1 
        1  1435 1 1  97 CYS CB   C  16.731   1.054  -5.815 1.00 . A A .  97 CYS CB   1 1 
        1  1436 1 1  97 CYS H    H  15.611   3.016  -3.854 1.00 . A A .  97 CYS H    1 1 
        1  1437 1 1  97 CYS HA   H  17.410   0.736  -3.811 1.00 . A A .  97 CYS HA   1 1 
        1  1438 1 1  97 CYS HB2  H  15.907   1.642  -6.220 1.00 . A A .  97 CYS HB2  1 1 
        1  1439 1 1  97 CYS HB3  H  17.599   1.201  -6.441 1.00 . A A .  97 CYS HB3  1 1 
        1  1440 1 1  97 CYS HG   H  16.553  -1.289  -4.719 1.00 . A A .  97 CYS HG   1 1 
        1  1441 1 1  97 CYS N    N  15.832   2.064  -3.769 1.00 . A A .  97 CYS N    1 1 
        1  1442 1 1  97 CYS O    O  17.816   3.817  -4.659 1.00 . A A .  97 CYS O    1 1 
        1  1443 1 1  97 CYS SG   S  16.282  -0.708  -5.891 1.00 . A A .  97 CYS SG   1 1 
        1  1444 1 1  98 GLN C    C  20.977   3.379  -5.760 1.00 . A A .  98 GLN C    1 1 
        1  1445 1 1  98 GLN CA   C  20.490   3.163  -4.331 1.00 . A A .  98 GLN CA   1 1 
        1  1446 1 1  98 GLN CB   C  21.639   2.649  -3.461 1.00 . A A .  98 GLN CB   1 1 
        1  1447 1 1  98 GLN CD   C  22.302   2.048  -1.099 1.00 . A A .  98 GLN CD   1 1 
        1  1448 1 1  98 GLN CG   C  21.466   2.954  -1.982 1.00 . A A .  98 GLN CG   1 1 
        1  1449 1 1  98 GLN H    H  19.547   1.279  -4.145 1.00 . A A .  98 GLN H    1 1 
        1  1450 1 1  98 GLN HA   H  20.147   4.108  -3.934 1.00 . A A .  98 GLN HA   1 1 
        1  1451 1 1  98 GLN HB2  H  21.717   1.569  -3.588 1.00 . A A .  98 GLN HB2  1 1 
        1  1452 1 1  98 GLN HB3  H  22.559   3.104  -3.795 1.00 . A A .  98 GLN HB3  1 1 
        1  1453 1 1  98 GLN HE21 H  21.505   0.439  -1.953 1.00 . A A .  98 GLN HE21 1 1 
        1  1454 1 1  98 GLN HE22 H  22.670   0.133  -0.715 1.00 . A A .  98 GLN HE22 1 1 
        1  1455 1 1  98 GLN HG2  H  21.753   3.990  -1.799 1.00 . A A .  98 GLN HG2  1 1 
        1  1456 1 1  98 GLN HG3  H  20.427   2.828  -1.720 1.00 . A A .  98 GLN HG3  1 1 
        1  1457 1 1  98 GLN N    N  19.371   2.231  -4.296 1.00 . A A .  98 GLN N    1 1 
        1  1458 1 1  98 GLN NE2  N  22.142   0.740  -1.272 1.00 . A A .  98 GLN NE2  1 1 
        1  1459 1 1  98 GLN O    O  20.810   2.513  -6.618 1.00 . A A .  98 GLN O    1 1 
        1  1460 1 1  98 GLN OE1  O  23.081   2.517  -0.268 1.00 . A A .  98 GLN OE1  1 1 
        1  1461 1 1  99 GLN C    C  22.982   3.755  -7.864 1.00 . A A .  99 GLN C    1 1 
        1  1462 1 1  99 GLN CA   C  22.084   4.868  -7.335 1.00 . A A .  99 GLN CA   1 1 
        1  1463 1 1  99 GLN CB   C  22.855   6.188  -7.296 1.00 . A A .  99 GLN CB   1 1 
        1  1464 1 1  99 GLN CD   C  22.154   7.613  -9.261 1.00 . A A .  99 GLN CD   1 1 
        1  1465 1 1  99 GLN CG   C  23.226   6.717  -8.671 1.00 . A A .  99 GLN CG   1 1 
        1  1466 1 1  99 GLN H    H  21.678   5.189  -5.283 1.00 . A A .  99 GLN H    1 1 
        1  1467 1 1  99 GLN HA   H  21.238   4.976  -7.996 1.00 . A A .  99 GLN HA   1 1 
        1  1468 1 1  99 GLN HB2  H  22.245   6.934  -6.787 1.00 . A A .  99 GLN HB2  1 1 
        1  1469 1 1  99 GLN HB3  H  23.766   6.042  -6.732 1.00 . A A .  99 GLN HB3  1 1 
        1  1470 1 1  99 GLN HE21 H  23.418   9.148  -9.285 1.00 . A A .  99 GLN HE21 1 1 
        1  1471 1 1  99 GLN HE22 H  21.828   9.473  -9.880 1.00 . A A .  99 GLN HE22 1 1 
        1  1472 1 1  99 GLN HG2  H  24.155   7.282  -8.594 1.00 . A A .  99 GLN HG2  1 1 
        1  1473 1 1  99 GLN HG3  H  23.380   5.879  -9.335 1.00 . A A .  99 GLN HG3  1 1 
        1  1474 1 1  99 GLN N    N  21.575   4.539  -6.008 1.00 . A A .  99 GLN N    1 1 
        1  1475 1 1  99 GLN NE2  N  22.502   8.872  -9.499 1.00 . A A .  99 GLN NE2  1 1 
        1  1476 1 1  99 GLN O    O  22.950   3.428  -9.051 1.00 . A A .  99 GLN O    1 1 
        1  1477 1 1  99 GLN OE1  O  21.028   7.178  -9.499 1.00 . A A .  99 GLN OE1  1 1 
        1  1478 1 1 100 THR C    C  24.600   0.933  -6.379 1.00 . A A . 100 THR C    1 1 
        1  1479 1 1 100 THR CA   C  24.693   2.100  -7.354 1.00 . A A . 100 THR CA   1 1 
        1  1480 1 1 100 THR CB   C  26.151   2.592  -7.410 1.00 . A A . 100 THR CB   1 1 
        1  1481 1 1 100 THR CG2  C  26.938   1.832  -8.469 1.00 . A A . 100 THR CG2  1 1 
        1  1482 1 1 100 THR H    H  23.765   3.481  -6.045 1.00 . A A . 100 THR H    1 1 
        1  1483 1 1 100 THR HA   H  24.412   1.758  -8.341 1.00 . A A . 100 THR HA   1 1 
        1  1484 1 1 100 THR HB   H  26.611   2.419  -6.448 1.00 . A A . 100 THR HB   1 1 
        1  1485 1 1 100 THR HG1  H  25.563   4.191  -8.403 1.00 . A A . 100 THR HG1  1 1 
        1  1486 1 1 100 THR HG21 H  26.602   2.130  -9.450 1.00 . A A . 100 THR HG21 1 1 
        1  1487 1 1 100 THR HG22 H  26.781   0.771  -8.341 1.00 . A A . 100 THR HG22 1 1 
        1  1488 1 1 100 THR HG23 H  27.989   2.056  -8.365 1.00 . A A . 100 THR HG23 1 1 
        1  1489 1 1 100 THR N    N  23.783   3.176  -6.976 1.00 . A A . 100 THR N    1 1 
        1  1490 1 1 100 THR O    O  24.331   1.122  -5.193 1.00 . A A . 100 THR O    1 1 
        1  1491 1 1 100 THR OG1  O  26.186   3.994  -7.699 1.00 . A A . 100 THR OG1  1 1 
        1  1492 1 1 101 VAL C    C  25.732  -2.538  -6.564 1.00 . A A . 101 VAL C    1 1 
        1  1493 1 1 101 VAL CA   C  24.764  -1.474  -6.060 1.00 . A A . 101 VAL CA   1 1 
        1  1494 1 1 101 VAL CB   C  23.342  -2.066  -6.026 1.00 . A A . 101 VAL CB   1 1 
        1  1495 1 1 101 VAL CG1  C  22.336  -1.012  -5.590 1.00 . A A . 101 VAL CG1  1 1 
        1  1496 1 1 101 VAL CG2  C  22.972  -2.639  -7.386 1.00 . A A . 101 VAL CG2  1 1 
        1  1497 1 1 101 VAL H    H  25.031  -0.362  -7.841 1.00 . A A . 101 VAL H    1 1 
        1  1498 1 1 101 VAL HA   H  25.040  -1.199  -5.052 1.00 . A A . 101 VAL HA   1 1 
        1  1499 1 1 101 VAL HB   H  23.325  -2.869  -5.304 1.00 . A A . 101 VAL HB   1 1 
        1  1500 1 1 101 VAL HG11 H  21.348  -1.450  -5.557 1.00 . A A . 101 VAL HG11 1 1 
        1  1501 1 1 101 VAL HG12 H  22.600  -0.644  -4.610 1.00 . A A . 101 VAL HG12 1 1 
        1  1502 1 1 101 VAL HG13 H  22.342  -0.194  -6.297 1.00 . A A . 101 VAL HG13 1 1 
        1  1503 1 1 101 VAL HG21 H  23.712  -2.344  -8.115 1.00 . A A . 101 VAL HG21 1 1 
        1  1504 1 1 101 VAL HG22 H  22.935  -3.716  -7.324 1.00 . A A . 101 VAL HG22 1 1 
        1  1505 1 1 101 VAL HG23 H  22.004  -2.261  -7.685 1.00 . A A . 101 VAL HG23 1 1 
        1  1506 1 1 101 VAL N    N  24.821  -0.275  -6.887 1.00 . A A . 101 VAL N    1 1 
        1  1507 1 1 101 VAL O    O  25.969  -2.658  -7.766 1.00 . A A . 101 VAL O    1 1 
        1  1508 1 1 102 SER C    C  26.527  -5.700  -6.151 1.00 . A A . 102 SER C    1 1 
        1  1509 1 1 102 SER CA   C  27.239  -4.361  -5.988 1.00 . A A . 102 SER CA   1 1 
        1  1510 1 1 102 SER CB   C  28.326  -4.476  -4.917 1.00 . A A . 102 SER CB   1 1 
        1  1511 1 1 102 SER H    H  26.064  -3.164  -4.694 1.00 . A A . 102 SER H    1 1 
        1  1512 1 1 102 SER HA   H  27.699  -4.093  -6.927 1.00 . A A . 102 SER HA   1 1 
        1  1513 1 1 102 SER HB2  H  28.897  -5.389  -5.083 1.00 . A A . 102 SER HB2  1 1 
        1  1514 1 1 102 SER HB3  H  28.988  -3.624  -4.987 1.00 . A A . 102 SER HB3  1 1 
        1  1515 1 1 102 SER HG   H  26.897  -4.927  -3.654 1.00 . A A . 102 SER HG   1 1 
        1  1516 1 1 102 SER N    N  26.293  -3.309  -5.638 1.00 . A A . 102 SER N    1 1 
        1  1517 1 1 102 SER O    O  25.428  -5.899  -5.634 1.00 . A A . 102 SER O    1 1 
        1  1518 1 1 102 SER OG   O  27.761  -4.508  -3.618 1.00 . A A . 102 SER OG   1 1 
        1  1519 1 1 103 VAL C    C  27.626  -9.032  -6.870 1.00 . A A . 103 VAL C    1 1 
        1  1520 1 1 103 VAL CA   C  26.590  -7.937  -7.108 1.00 . A A . 103 VAL CA   1 1 
        1  1521 1 1 103 VAL CB   C  26.042  -8.067  -8.541 1.00 . A A . 103 VAL CB   1 1 
        1  1522 1 1 103 VAL CG1  C  25.144  -6.887  -8.878 1.00 . A A . 103 VAL CG1  1 1 
        1  1523 1 1 103 VAL CG2  C  27.183  -8.182  -9.539 1.00 . A A . 103 VAL CG2  1 1 
        1  1524 1 1 103 VAL H    H  28.036  -6.398  -7.262 1.00 . A A . 103 VAL H    1 1 
        1  1525 1 1 103 VAL HA   H  25.772  -8.073  -6.416 1.00 . A A . 103 VAL HA   1 1 
        1  1526 1 1 103 VAL HB   H  25.449  -8.969  -8.597 1.00 . A A . 103 VAL HB   1 1 
        1  1527 1 1 103 VAL HG11 H  24.945  -6.318  -7.981 1.00 . A A . 103 VAL HG11 1 1 
        1  1528 1 1 103 VAL HG12 H  25.636  -6.256  -9.604 1.00 . A A . 103 VAL HG12 1 1 
        1  1529 1 1 103 VAL HG13 H  24.212  -7.248  -9.287 1.00 . A A . 103 VAL HG13 1 1 
        1  1530 1 1 103 VAL HG21 H  26.820  -7.950 -10.530 1.00 . A A . 103 VAL HG21 1 1 
        1  1531 1 1 103 VAL HG22 H  27.968  -7.491  -9.271 1.00 . A A . 103 VAL HG22 1 1 
        1  1532 1 1 103 VAL HG23 H  27.572  -9.191  -9.527 1.00 . A A . 103 VAL HG23 1 1 
        1  1533 1 1 103 VAL N    N  27.162  -6.616  -6.875 1.00 . A A . 103 VAL N    1 1 
        1  1534 1 1 103 VAL O    O  28.823  -8.761  -6.780 1.00 . A A . 103 VAL O    1 1 
        1  1535 1 1 104 THR C    C  27.625 -12.605  -7.391 1.00 . A A . 104 THR C    1 1 
        1  1536 1 1 104 THR CA   C  28.039 -11.409  -6.542 1.00 . A A . 104 THR CA   1 1 
        1  1537 1 1 104 THR CB   C  28.048 -11.825  -5.060 1.00 . A A . 104 THR CB   1 1 
        1  1538 1 1 104 THR CG2  C  29.362 -12.497  -4.694 1.00 . A A . 104 THR CG2  1 1 
        1  1539 1 1 104 THR H    H  26.191 -10.423  -6.850 1.00 . A A . 104 THR H    1 1 
        1  1540 1 1 104 THR HA   H  29.041 -11.113  -6.817 1.00 . A A . 104 THR HA   1 1 
        1  1541 1 1 104 THR HB   H  27.242 -12.527  -4.893 1.00 . A A . 104 THR HB   1 1 
        1  1542 1 1 104 THR HG1  H  28.688 -10.244  -4.068 1.00 . A A . 104 THR HG1  1 1 
        1  1543 1 1 104 THR HG21 H  30.007 -11.783  -4.204 1.00 . A A . 104 THR HG21 1 1 
        1  1544 1 1 104 THR HG22 H  29.843 -12.859  -5.591 1.00 . A A . 104 THR HG22 1 1 
        1  1545 1 1 104 THR HG23 H  29.170 -13.325  -4.028 1.00 . A A . 104 THR HG23 1 1 
        1  1546 1 1 104 THR N    N  27.155 -10.271  -6.770 1.00 . A A . 104 THR N    1 1 
        1  1547 1 1 104 THR O    O  26.448 -12.774  -7.713 1.00 . A A . 104 THR O    1 1 
        1  1548 1 1 104 THR OG1  O  27.845 -10.678  -4.227 1.00 . A A . 104 THR OG1  1 1 
        1  1549 1 1 105 LYS C    C  29.317 -15.734  -8.227 1.00 . A A . 105 LYS C    1 1 
        1  1550 1 1 105 LYS CA   C  28.336 -14.616  -8.565 1.00 . A A . 105 LYS CA   1 1 
        1  1551 1 1 105 LYS CB   C  28.430 -14.270 -10.052 1.00 . A A . 105 LYS CB   1 1 
        1  1552 1 1 105 LYS CD   C  27.543 -15.619 -11.977 1.00 . A A . 105 LYS CD   1 1 
        1  1553 1 1 105 LYS CE   C  26.751 -15.303 -13.236 1.00 . A A . 105 LYS CE   1 1 
        1  1554 1 1 105 LYS CG   C  27.197 -14.664 -10.847 1.00 . A A . 105 LYS CG   1 1 
        1  1555 1 1 105 LYS H    H  29.517 -13.244  -7.467 1.00 . A A . 105 LYS H    1 1 
        1  1556 1 1 105 LYS HA   H  27.335 -14.953  -8.345 1.00 . A A . 105 LYS HA   1 1 
        1  1557 1 1 105 LYS HB2  H  28.582 -13.196 -10.152 1.00 . A A . 105 LYS HB2  1 1 
        1  1558 1 1 105 LYS HB3  H  29.284 -14.782 -10.474 1.00 . A A . 105 LYS HB3  1 1 
        1  1559 1 1 105 LYS HD2  H  28.608 -15.541 -12.197 1.00 . A A . 105 LYS HD2  1 1 
        1  1560 1 1 105 LYS HD3  H  27.320 -16.629 -11.664 1.00 . A A . 105 LYS HD3  1 1 
        1  1561 1 1 105 LYS HE2  H  25.721 -15.073 -12.961 1.00 . A A . 105 LYS HE2  1 1 
        1  1562 1 1 105 LYS HE3  H  27.189 -14.441 -13.714 1.00 . A A . 105 LYS HE3  1 1 
        1  1563 1 1 105 LYS HG2  H  26.480 -15.144 -10.181 1.00 . A A . 105 LYS HG2  1 1 
        1  1564 1 1 105 LYS HG3  H  26.751 -13.772 -11.266 1.00 . A A . 105 LYS HG3  1 1 
        1  1565 1 1 105 LYS HZ1  H  25.908 -17.032 -14.054 1.00 . A A . 105 LYS HZ1  1 1 
        1  1566 1 1 105 LYS HZ2  H  27.601 -17.031 -14.047 1.00 . A A . 105 LYS HZ2  1 1 
        1  1567 1 1 105 LYS HZ3  H  26.759 -16.089 -15.172 1.00 . A A . 105 LYS HZ3  1 1 
        1  1568 1 1 105 LYS N    N  28.598 -13.433  -7.754 1.00 . A A . 105 LYS N    1 1 
        1  1569 1 1 105 LYS NZ   N  26.755 -16.444 -14.194 1.00 . A A . 105 LYS NZ   1 1 
        1  1570 1 1 105 LYS O    O  30.503 -15.504  -7.994 1.00 . A A . 105 LYS O    1 1 
        1  1571 1 1 106 PRO C    C  30.622 -18.476  -9.010 1.00 . A A . 106 PRO C    1 1 
        1  1572 1 1 106 PRO CA   C  29.628 -18.157  -7.899 1.00 . A A . 106 PRO CA   1 1 
        1  1573 1 1 106 PRO CB   C  28.595 -19.279  -7.767 1.00 . A A . 106 PRO CB   1 1 
        1  1574 1 1 106 PRO CD   C  27.408 -17.327  -8.472 1.00 . A A . 106 PRO CD   1 1 
        1  1575 1 1 106 PRO CG   C  27.438 -18.826  -8.589 1.00 . A A . 106 PRO CG   1 1 
        1  1576 1 1 106 PRO HA   H  30.158 -18.042  -6.965 1.00 . A A . 106 PRO HA   1 1 
        1  1577 1 1 106 PRO HB2  H  28.997 -20.212  -8.161 1.00 . A A . 106 PRO HB2  1 1 
        1  1578 1 1 106 PRO HB3  H  28.319 -19.399  -6.730 1.00 . A A . 106 PRO HB3  1 1 
        1  1579 1 1 106 PRO HD2  H  27.072 -16.875  -9.406 1.00 . A A . 106 PRO HD2  1 1 
        1  1580 1 1 106 PRO HD3  H  26.772 -17.024  -7.653 1.00 . A A . 106 PRO HD3  1 1 
        1  1581 1 1 106 PRO HG2  H  27.578 -19.120  -9.630 1.00 . A A . 106 PRO HG2  1 1 
        1  1582 1 1 106 PRO HG3  H  26.524 -19.250  -8.202 1.00 . A A . 106 PRO HG3  1 1 
        1  1583 1 1 106 PRO N    N  28.812 -16.978  -8.203 1.00 . A A . 106 PRO N    1 1 
        1  1584 1 1 106 PRO O    O  30.433 -19.424  -9.773 1.00 . A A . 106 PRO O    1 1 
        1  1585 1 1 107 CYS C    C  34.072 -18.116  -9.472 1.00 . A A . 107 CYS C    1 1 
        1  1586 1 1 107 CYS CA   C  32.709 -17.878 -10.113 1.00 . A A . 107 CYS CA   1 1 
        1  1587 1 1 107 CYS CB   C  32.775 -16.665 -11.044 1.00 . A A . 107 CYS CB   1 1 
        1  1588 1 1 107 CYS H    H  31.779 -16.941  -8.459 1.00 . A A . 107 CYS H    1 1 
        1  1589 1 1 107 CYS HA   H  32.439 -18.750 -10.691 1.00 . A A . 107 CYS HA   1 1 
        1  1590 1 1 107 CYS HB2  H  31.814 -16.561 -11.549 1.00 . A A . 107 CYS HB2  1 1 
        1  1591 1 1 107 CYS HB3  H  32.951 -15.778 -10.453 1.00 . A A . 107 CYS HB3  1 1 
        1  1592 1 1 107 CYS HG   H  34.043 -17.959 -12.898 1.00 . A A . 107 CYS HG   1 1 
        1  1593 1 1 107 CYS N    N  31.683 -17.681  -9.095 1.00 . A A . 107 CYS N    1 1 
        1  1594 1 1 107 CYS O    O  34.399 -17.526  -8.442 1.00 . A A . 107 CYS O    1 1 
        1  1595 1 1 107 CYS SG   S  34.086 -16.764 -12.302 1.00 . A A . 107 CYS SG   1 1 
        1  1596 1 1 108 THR C    C  37.214 -19.375 -10.709 1.00 . A A . 108 THR C    1 1 
        1  1597 1 1 108 THR CA   C  36.194 -19.303  -9.579 1.00 . A A . 108 THR CA   1 1 
        1  1598 1 1 108 THR CB   C  36.198 -20.641  -8.814 1.00 . A A . 108 THR CB   1 1 
        1  1599 1 1 108 THR CG2  C  35.461 -21.715  -9.601 1.00 . A A . 108 THR CG2  1 1 
        1  1600 1 1 108 THR H    H  34.550 -19.424 -10.906 1.00 . A A . 108 THR H    1 1 
        1  1601 1 1 108 THR HA   H  36.485 -18.520  -8.894 1.00 . A A . 108 THR HA   1 1 
        1  1602 1 1 108 THR HB   H  35.694 -20.498  -7.869 1.00 . A A . 108 THR HB   1 1 
        1  1603 1 1 108 THR HG1  H  37.552 -21.992  -8.336 1.00 . A A . 108 THR HG1  1 1 
        1  1604 1 1 108 THR HG21 H  35.817 -22.688  -9.298 1.00 . A A . 108 THR HG21 1 1 
        1  1605 1 1 108 THR HG22 H  35.643 -21.578 -10.656 1.00 . A A . 108 THR HG22 1 1 
        1  1606 1 1 108 THR HG23 H  34.403 -21.642  -9.405 1.00 . A A . 108 THR HG23 1 1 
        1  1607 1 1 108 THR N    N  34.866 -18.986 -10.089 1.00 . A A . 108 THR N    1 1 
        1  1608 1 1 108 THR O    O  36.900 -19.809 -11.818 1.00 . A A . 108 THR O    1 1 
        1  1609 1 1 108 THR OG1  O  37.545 -21.061  -8.569 1.00 . A A . 108 THR OG1  1 1 
        1  1610 1 1 109 THR C    C  40.829 -18.511 -10.807 1.00 . A A . 109 THR C    1 1 
        1  1611 1 1 109 THR CA   C  39.506 -18.961 -11.416 1.00 . A A . 109 THR CA   1 1 
        1  1612 1 1 109 THR CB   C  39.171 -18.055 -12.614 1.00 . A A . 109 THR CB   1 1 
        1  1613 1 1 109 THR CG2  C  39.225 -16.588 -12.215 1.00 . A A . 109 THR CG2  1 1 
        1  1614 1 1 109 THR H    H  38.630 -18.612  -9.520 1.00 . A A . 109 THR H    1 1 
        1  1615 1 1 109 THR HA   H  39.614 -19.974 -11.775 1.00 . A A . 109 THR HA   1 1 
        1  1616 1 1 109 THR HB   H  38.171 -18.286 -12.950 1.00 . A A . 109 THR HB   1 1 
        1  1617 1 1 109 THR HG1  H  39.622 -18.274 -14.522 1.00 . A A . 109 THR HG1  1 1 
        1  1618 1 1 109 THR HG21 H  38.611 -16.010 -12.889 1.00 . A A . 109 THR HG21 1 1 
        1  1619 1 1 109 THR HG22 H  40.245 -16.238 -12.268 1.00 . A A . 109 THR HG22 1 1 
        1  1620 1 1 109 THR HG23 H  38.855 -16.475 -11.207 1.00 . A A . 109 THR HG23 1 1 
        1  1621 1 1 109 THR N    N  38.440 -18.946 -10.423 1.00 . A A . 109 THR N    1 1 
        1  1622 1 1 109 THR O    O  40.859 -17.658  -9.919 1.00 . A A . 109 THR O    1 1 
        1  1623 1 1 109 THR OG1  O  40.092 -18.298 -13.683 1.00 . A A . 109 THR OG1  1 1 
        1  1624 1 1 110 LYS C    C  44.291 -18.844 -11.910 1.00 . A A . 110 LYS C    1 1 
        1  1625 1 1 110 LYS CA   C  43.254 -18.744 -10.796 1.00 . A A . 110 LYS CA   1 1 
        1  1626 1 1 110 LYS CB   C  43.643 -19.665  -9.638 1.00 . A A . 110 LYS CB   1 1 
        1  1627 1 1 110 LYS CD   C  43.490 -22.055  -8.879 1.00 . A A . 110 LYS CD   1 1 
        1  1628 1 1 110 LYS CE   C  43.143 -23.455  -9.365 1.00 . A A . 110 LYS CE   1 1 
        1  1629 1 1 110 LYS CG   C  43.788 -21.122 -10.041 1.00 . A A . 110 LYS CG   1 1 
        1  1630 1 1 110 LYS H    H  41.838 -19.761 -11.998 1.00 . A A . 110 LYS H    1 1 
        1  1631 1 1 110 LYS HA   H  43.222 -17.727 -10.440 1.00 . A A . 110 LYS HA   1 1 
        1  1632 1 1 110 LYS HB2  H  44.590 -19.322  -9.222 1.00 . A A . 110 LYS HB2  1 1 
        1  1633 1 1 110 LYS HB3  H  42.884 -19.600  -8.871 1.00 . A A . 110 LYS HB3  1 1 
        1  1634 1 1 110 LYS HD2  H  44.364 -22.108  -8.230 1.00 . A A . 110 LYS HD2  1 1 
        1  1635 1 1 110 LYS HD3  H  42.655 -21.661  -8.318 1.00 . A A . 110 LYS HD3  1 1 
        1  1636 1 1 110 LYS HE2  H  42.199 -23.764  -8.916 1.00 . A A . 110 LYS HE2  1 1 
        1  1637 1 1 110 LYS HE3  H  43.033 -23.433 -10.439 1.00 . A A . 110 LYS HE3  1 1 
        1  1638 1 1 110 LYS HG2  H  43.099 -21.337 -10.858 1.00 . A A . 110 LYS HG2  1 1 
        1  1639 1 1 110 LYS HG3  H  44.802 -21.293 -10.378 1.00 . A A . 110 LYS HG3  1 1 
        1  1640 1 1 110 LYS HZ1  H  45.123 -23.972  -8.945 1.00 . A A . 110 LYS HZ1  1 1 
        1  1641 1 1 110 LYS HZ2  H  44.249 -25.188  -9.731 1.00 . A A . 110 LYS HZ2  1 1 
        1  1642 1 1 110 LYS HZ3  H  43.983 -24.880  -8.089 1.00 . A A . 110 LYS HZ3  1 1 
        1  1643 1 1 110 LYS N    N  41.925 -19.087 -11.290 1.00 . A A . 110 LYS N    1 1 
        1  1644 1 1 110 LYS NZ   N  44.199 -24.443  -9.007 1.00 . A A . 110 LYS NZ   1 1 
        1  1645 1 1 110 LYS O    O  43.979 -19.252 -13.029 1.00 . A A . 110 LYS O    1 1 
        1  1646 1 1 111 VAL C    C  46.225 -17.806 -13.860 1.00 . A A . 111 VAL C    1 1 
        1  1647 1 1 111 VAL CA   C  46.611 -18.521 -12.570 1.00 . A A . 111 VAL CA   1 1 
        1  1648 1 1 111 VAL CB   C  47.004 -19.973 -12.898 1.00 . A A . 111 VAL CB   1 1 
        1  1649 1 1 111 VAL CG1  C  48.099 -20.006 -13.953 1.00 . A A . 111 VAL CG1  1 1 
        1  1650 1 1 111 VAL CG2  C  47.443 -20.704 -11.638 1.00 . A A . 111 VAL CG2  1 1 
        1  1651 1 1 111 VAL H    H  45.715 -18.155 -10.688 1.00 . A A . 111 VAL H    1 1 
        1  1652 1 1 111 VAL HA   H  47.470 -18.027 -12.138 1.00 . A A . 111 VAL HA   1 1 
        1  1653 1 1 111 VAL HB   H  46.136 -20.479 -13.297 1.00 . A A . 111 VAL HB   1 1 
        1  1654 1 1 111 VAL HG11 H  47.653 -20.098 -14.932 1.00 . A A . 111 VAL HG11 1 1 
        1  1655 1 1 111 VAL HG12 H  48.676 -19.093 -13.902 1.00 . A A . 111 VAL HG12 1 1 
        1  1656 1 1 111 VAL HG13 H  48.748 -20.851 -13.774 1.00 . A A . 111 VAL HG13 1 1 
        1  1657 1 1 111 VAL HG21 H  48.500 -20.921 -11.698 1.00 . A A . 111 VAL HG21 1 1 
        1  1658 1 1 111 VAL HG22 H  47.252 -20.081 -10.777 1.00 . A A . 111 VAL HG22 1 1 
        1  1659 1 1 111 VAL HG23 H  46.891 -21.628 -11.545 1.00 . A A . 111 VAL HG23 1 1 
        1  1660 1 1 111 VAL N    N  45.528 -18.470 -11.596 1.00 . A A . 111 VAL N    1 1 
        1  1661 1 1 111 VAL O    O  45.698 -18.419 -14.788 1.00 . A A . 111 VAL O    1 1 
        1  1662 1 1 112 LYS C    C  46.888 -16.248 -16.323 1.00 . A A . 112 LYS C    1 1 
        1  1663 1 1 112 LYS CA   C  46.175 -15.706 -15.088 1.00 . A A . 112 LYS CA   1 1 
        1  1664 1 1 112 LYS CB   C  46.570 -14.246 -14.859 1.00 . A A . 112 LYS CB   1 1 
        1  1665 1 1 112 LYS CD   C  45.951 -12.013 -13.888 1.00 . A A . 112 LYS CD   1 1 
        1  1666 1 1 112 LYS CE   C  46.120 -11.136 -15.119 1.00 . A A . 112 LYS CE   1 1 
        1  1667 1 1 112 LYS CG   C  45.459 -13.403 -14.256 1.00 . A A . 112 LYS CG   1 1 
        1  1668 1 1 112 LYS H    H  46.915 -16.074 -13.140 1.00 . A A . 112 LYS H    1 1 
        1  1669 1 1 112 LYS HA   H  45.109 -15.760 -15.249 1.00 . A A . 112 LYS HA   1 1 
        1  1670 1 1 112 LYS HB2  H  47.432 -14.217 -14.192 1.00 . A A . 112 LYS HB2  1 1 
        1  1671 1 1 112 LYS HB3  H  46.851 -13.807 -15.806 1.00 . A A . 112 LYS HB3  1 1 
        1  1672 1 1 112 LYS HD2  H  45.233 -11.547 -13.214 1.00 . A A . 112 LYS HD2  1 1 
        1  1673 1 1 112 LYS HD3  H  46.904 -12.099 -13.384 1.00 . A A . 112 LYS HD3  1 1 
        1  1674 1 1 112 LYS HE2  H  47.168 -10.853 -15.214 1.00 . A A . 112 LYS HE2  1 1 
        1  1675 1 1 112 LYS HE3  H  45.828 -11.703 -15.991 1.00 . A A . 112 LYS HE3  1 1 
        1  1676 1 1 112 LYS HG2  H  44.646 -13.314 -14.977 1.00 . A A . 112 LYS HG2  1 1 
        1  1677 1 1 112 LYS HG3  H  45.092 -13.891 -13.366 1.00 . A A . 112 LYS HG3  1 1 
        1  1678 1 1 112 LYS HZ1  H  44.372 -10.117 -14.599 1.00 . A A . 112 LYS HZ1  1 1 
        1  1679 1 1 112 LYS HZ2  H  45.122  -9.524 -15.995 1.00 . A A . 112 LYS HZ2  1 1 
        1  1680 1 1 112 LYS HZ3  H  45.774  -9.180 -14.473 1.00 . A A . 112 LYS HZ3  1 1 
        1  1681 1 1 112 LYS N    N  46.493 -16.505 -13.912 1.00 . A A . 112 LYS N    1 1 
        1  1682 1 1 112 LYS NZ   N  45.288  -9.903 -15.041 1.00 . A A . 112 LYS NZ   1 1 
        1  1683 1 1 112 LYS O    O  47.830 -17.031 -16.213 1.00 . A A . 112 LYS O    1 1 
        1  1684 1 1 113 ASN C    C  48.188 -15.362 -19.154 1.00 . A A . 113 ASN C    1 1 
        1  1685 1 1 113 ASN CA   C  47.027 -16.267 -18.754 1.00 . A A . 113 ASN CA   1 1 
        1  1686 1 1 113 ASN CB   C  45.974 -16.285 -19.863 1.00 . A A . 113 ASN CB   1 1 
        1  1687 1 1 113 ASN CG   C  44.966 -17.403 -19.685 1.00 . A A . 113 ASN CG   1 1 
        1  1688 1 1 113 ASN H    H  45.677 -15.200 -17.521 1.00 . A A . 113 ASN H    1 1 
        1  1689 1 1 113 ASN HA   H  47.400 -17.270 -18.608 1.00 . A A . 113 ASN HA   1 1 
        1  1690 1 1 113 ASN HB2  H  45.447 -15.331 -19.865 1.00 . A A . 113 ASN HB2  1 1 
        1  1691 1 1 113 ASN HB3  H  46.465 -16.415 -20.815 1.00 . A A . 113 ASN HB3  1 1 
        1  1692 1 1 113 ASN HD21 H  45.589 -18.266 -21.365 1.00 . A A . 113 ASN HD21 1 1 
        1  1693 1 1 113 ASN HD22 H  44.312 -19.079 -20.532 1.00 . A A . 113 ASN HD22 1 1 
        1  1694 1 1 113 ASN N    N  46.431 -15.824 -17.497 1.00 . A A . 113 ASN N    1 1 
        1  1695 1 1 113 ASN ND2  N  44.955 -18.344 -20.622 1.00 . A A . 113 ASN ND2  1 1 
        1  1696 1 1 113 ASN O    O  48.122 -14.656 -20.161 1.00 . A A . 113 ASN O    1 1 
        1  1697 1 1 113 ASN OD1  O  44.206 -17.421 -18.717 1.00 . A A . 113 ASN OD1  1 1 
        1  1698 1 1 114 LYS C    C  51.509 -15.392 -19.334 1.00 . A A . 114 LYS C    1 1 
        1  1699 1 1 114 LYS CA   C  50.431 -14.573 -18.629 1.00 . A A . 114 LYS CA   1 1 
        1  1700 1 1 114 LYS CB   C  50.986 -13.992 -17.327 1.00 . A A . 114 LYS CB   1 1 
        1  1701 1 1 114 LYS CD   C  51.456 -11.701 -16.412 1.00 . A A . 114 LYS CD   1 1 
        1  1702 1 1 114 LYS CE   C  51.450 -11.688 -14.892 1.00 . A A . 114 LYS CE   1 1 
        1  1703 1 1 114 LYS CG   C  50.397 -12.640 -16.965 1.00 . A A . 114 LYS CG   1 1 
        1  1704 1 1 114 LYS H    H  49.247 -15.972 -17.571 1.00 . A A . 114 LYS H    1 1 
        1  1705 1 1 114 LYS HA   H  50.131 -13.762 -19.277 1.00 . A A . 114 LYS HA   1 1 
        1  1706 1 1 114 LYS HB2  H  50.778 -14.691 -16.517 1.00 . A A . 114 LYS HB2  1 1 
        1  1707 1 1 114 LYS HB3  H  52.056 -13.882 -17.422 1.00 . A A . 114 LYS HB3  1 1 
        1  1708 1 1 114 LYS HD2  H  52.437 -12.022 -16.763 1.00 . A A . 114 LYS HD2  1 1 
        1  1709 1 1 114 LYS HD3  H  51.261 -10.701 -16.772 1.00 . A A . 114 LYS HD3  1 1 
        1  1710 1 1 114 LYS HE2  H  50.782 -10.900 -14.544 1.00 . A A . 114 LYS HE2  1 1 
        1  1711 1 1 114 LYS HE3  H  51.086 -12.641 -14.538 1.00 . A A . 114 LYS HE3  1 1 
        1  1712 1 1 114 LYS HG2  H  49.954 -12.194 -17.855 1.00 . A A . 114 LYS HG2  1 1 
        1  1713 1 1 114 LYS HG3  H  49.628 -12.779 -16.218 1.00 . A A . 114 LYS HG3  1 1 
        1  1714 1 1 114 LYS HZ1  H  52.800 -10.631 -13.697 1.00 . A A . 114 LYS HZ1  1 1 
        1  1715 1 1 114 LYS HZ2  H  53.487 -11.272 -15.105 1.00 . A A . 114 LYS HZ2  1 1 
        1  1716 1 1 114 LYS HZ3  H  53.129 -12.287 -13.800 1.00 . A A . 114 LYS HZ3  1 1 
        1  1717 1 1 114 LYS N    N  49.253 -15.388 -18.359 1.00 . A A . 114 LYS N    1 1 
        1  1718 1 1 114 LYS NZ   N  52.811 -11.453 -14.334 1.00 . A A . 114 LYS NZ   1 1 
        1  1719 1 1 114 LYS O    O  51.509 -16.623 -19.298 1.00 . A A . 114 LYS O    1 1 
        1  1720 1 1 115 PRO C    C  54.555 -15.998 -19.767 1.00 . A A . 115 PRO C    1 1 
        1  1721 1 1 115 PRO CA   C  53.553 -15.336 -20.707 1.00 . A A . 115 PRO CA   1 1 
        1  1722 1 1 115 PRO CB   C  54.211 -14.174 -21.457 1.00 . A A . 115 PRO CB   1 1 
        1  1723 1 1 115 PRO CD   C  52.513 -13.225 -20.068 1.00 . A A . 115 PRO CD   1 1 
        1  1724 1 1 115 PRO CG   C  53.874 -12.966 -20.654 1.00 . A A . 115 PRO CG   1 1 
        1  1725 1 1 115 PRO HA   H  53.192 -16.066 -21.417 1.00 . A A . 115 PRO HA   1 1 
        1  1726 1 1 115 PRO HB2  H  55.292 -14.313 -21.497 1.00 . A A . 115 PRO HB2  1 1 
        1  1727 1 1 115 PRO HB3  H  53.804 -14.110 -22.456 1.00 . A A . 115 PRO HB3  1 1 
        1  1728 1 1 115 PRO HD2  H  52.432 -12.781 -19.076 1.00 . A A . 115 PRO HD2  1 1 
        1  1729 1 1 115 PRO HD3  H  51.741 -12.843 -20.720 1.00 . A A . 115 PRO HD3  1 1 
        1  1730 1 1 115 PRO HG2  H  54.606 -12.826 -19.859 1.00 . A A . 115 PRO HG2  1 1 
        1  1731 1 1 115 PRO HG3  H  53.845 -12.096 -21.294 1.00 . A A . 115 PRO HG3  1 1 
        1  1732 1 1 115 PRO N    N  52.451 -14.694 -19.985 1.00 . A A . 115 PRO N    1 1 
        1  1733 1 1 115 PRO O    O  55.061 -15.367 -18.839 1.00 . A A . 115 PRO O    1 1 
        1  1734 1 1 116 LYS C    C  56.452 -19.126 -19.998 1.00 . A A . 116 LYS C    1 1 
        1  1735 1 1 116 LYS CA   C  55.781 -18.020 -19.190 1.00 . A A . 116 LYS CA   1 1 
        1  1736 1 1 116 LYS CB   C  55.066 -18.622 -17.977 1.00 . A A . 116 LYS CB   1 1 
        1  1737 1 1 116 LYS CD   C  53.649 -18.240 -15.939 1.00 . A A . 116 LYS CD   1 1 
        1  1738 1 1 116 LYS CE   C  54.304 -17.850 -14.623 1.00 . A A . 116 LYS CE   1 1 
        1  1739 1 1 116 LYS CG   C  54.347 -17.592 -17.123 1.00 . A A . 116 LYS CG   1 1 
        1  1740 1 1 116 LYS H    H  54.403 -17.721 -20.768 1.00 . A A . 116 LYS H    1 1 
        1  1741 1 1 116 LYS HA   H  56.539 -17.332 -18.845 1.00 . A A . 116 LYS HA   1 1 
        1  1742 1 1 116 LYS HB2  H  54.339 -19.354 -18.329 1.00 . A A . 116 LYS HB2  1 1 
        1  1743 1 1 116 LYS HB3  H  55.794 -19.126 -17.359 1.00 . A A . 116 LYS HB3  1 1 
        1  1744 1 1 116 LYS HD2  H  52.605 -17.927 -15.925 1.00 . A A . 116 LYS HD2  1 1 
        1  1745 1 1 116 LYS HD3  H  53.694 -19.315 -16.049 1.00 . A A . 116 LYS HD3  1 1 
        1  1746 1 1 116 LYS HE2  H  55.029 -18.614 -14.346 1.00 . A A . 116 LYS HE2  1 1 
        1  1747 1 1 116 LYS HE3  H  54.816 -16.909 -14.757 1.00 . A A . 116 LYS HE3  1 1 
        1  1748 1 1 116 LYS HG2  H  55.071 -16.864 -16.756 1.00 . A A . 116 LYS HG2  1 1 
        1  1749 1 1 116 LYS HG3  H  53.611 -17.084 -17.730 1.00 . A A . 116 LYS HG3  1 1 
        1  1750 1 1 116 LYS HZ1  H  52.623 -16.957 -13.761 1.00 . A A . 116 LYS HZ1  1 1 
        1  1751 1 1 116 LYS HZ2  H  53.784 -17.462 -12.638 1.00 . A A . 116 LYS HZ2  1 1 
        1  1752 1 1 116 LYS HZ3  H  52.790 -18.601 -13.395 1.00 . A A . 116 LYS HZ3  1 1 
        1  1753 1 1 116 LYS N    N  54.838 -17.272 -20.013 1.00 . A A . 116 LYS N    1 1 
        1  1754 1 1 116 LYS NZ   N  53.305 -17.707 -13.528 1.00 . A A . 116 LYS NZ   1 1 
        1  1755 1 1 116 LYS O    O  55.868 -19.663 -20.939 1.00 . A A . 116 LYS O    1 1 
        1  1756 1 1 117 GLY C    C  59.534 -19.951 -21.180 1.00 . A A . 117 GLY C    1 1 
        1  1757 1 1 117 GLY CA   C  58.411 -20.503 -20.325 1.00 . A A . 117 GLY CA   1 1 
        1  1758 1 1 117 GLY H    H  58.099 -19.000 -18.867 1.00 . A A . 117 GLY H    1 1 
        1  1759 1 1 117 GLY HA2  H  58.828 -21.188 -19.600 1.00 . A A . 117 GLY HA2  1 1 
        1  1760 1 1 117 GLY HA3  H  57.724 -21.043 -20.960 1.00 . A A . 117 GLY HA3  1 1 
        1  1761 1 1 117 GLY N    N  57.683 -19.463 -19.626 1.00 . A A . 117 GLY N    1 1 
        1  1762 1 1 117 GLY O    O  59.360 -18.952 -21.878 1.00 . A A . 117 GLY O    1 1 
        1  1763 1 1 118 LYS C    C  62.618 -21.368 -22.446 1.00 . A A . 118 LYS C    1 1 
        1  1764 1 1 118 LYS CA   C  61.851 -20.168 -21.900 1.00 . A A . 118 LYS CA   1 1 
        1  1765 1 1 118 LYS CB   C  62.774 -19.307 -21.036 1.00 . A A . 118 LYS CB   1 1 
        1  1766 1 1 118 LYS CD   C  63.590 -16.935 -21.156 1.00 . A A . 118 LYS CD   1 1 
        1  1767 1 1 118 LYS CE   C  63.481 -15.700 -20.273 1.00 . A A . 118 LYS CE   1 1 
        1  1768 1 1 118 LYS CG   C  62.381 -17.839 -21.001 1.00 . A A . 118 LYS CG   1 1 
        1  1769 1 1 118 LYS H    H  60.770 -21.391 -20.551 1.00 . A A . 118 LYS H    1 1 
        1  1770 1 1 118 LYS HA   H  61.492 -19.578 -22.730 1.00 . A A . 118 LYS HA   1 1 
        1  1771 1 1 118 LYS HB2  H  62.764 -19.697 -20.018 1.00 . A A . 118 LYS HB2  1 1 
        1  1772 1 1 118 LYS HB3  H  63.780 -19.378 -21.425 1.00 . A A . 118 LYS HB3  1 1 
        1  1773 1 1 118 LYS HD2  H  64.489 -17.489 -20.885 1.00 . A A . 118 LYS HD2  1 1 
        1  1774 1 1 118 LYS HD3  H  63.664 -16.622 -22.189 1.00 . A A . 118 LYS HD3  1 1 
        1  1775 1 1 118 LYS HE2  H  62.767 -15.897 -19.474 1.00 . A A . 118 LYS HE2  1 1 
        1  1776 1 1 118 LYS HE3  H  64.449 -15.498 -19.840 1.00 . A A . 118 LYS HE3  1 1 
        1  1777 1 1 118 LYS HG2  H  61.678 -17.638 -21.809 1.00 . A A . 118 LYS HG2  1 1 
        1  1778 1 1 118 LYS HG3  H  61.903 -17.628 -20.054 1.00 . A A . 118 LYS HG3  1 1 
        1  1779 1 1 118 LYS HZ1  H  63.312 -13.636 -20.545 1.00 . A A . 118 LYS HZ1  1 1 
        1  1780 1 1 118 LYS HZ2  H  61.998 -14.517 -21.145 1.00 . A A . 118 LYS HZ2  1 1 
        1  1781 1 1 118 LYS HZ3  H  63.463 -14.508 -21.988 1.00 . A A . 118 LYS HZ3  1 1 
        1  1782 1 1 118 LYS N    N  60.692 -20.601 -21.125 1.00 . A A . 118 LYS N    1 1 
        1  1783 1 1 118 LYS NZ   N  63.032 -14.507 -21.041 1.00 . A A . 118 LYS NZ   1 1 
        1  1784 1 1 118 LYS O    O  63.532 -21.880 -21.798 1.00 . A A . 118 LYS O    1 1 
        1  1785 1 1 119 LYS C    C  62.859 -24.176 -23.367 1.00 . A A . 119 LYS C    1 1 
        1  1786 1 1 119 LYS CA   C  62.898 -22.950 -24.274 1.00 . A A . 119 LYS CA   1 1 
        1  1787 1 1 119 LYS CB   C  64.348 -22.604 -24.617 1.00 . A A . 119 LYS CB   1 1 
        1  1788 1 1 119 LYS CD   C  66.384 -23.116 -25.995 1.00 . A A . 119 LYS CD   1 1 
        1  1789 1 1 119 LYS CE   C  66.583 -22.212 -27.202 1.00 . A A . 119 LYS CE   1 1 
        1  1790 1 1 119 LYS CG   C  64.914 -23.422 -25.765 1.00 . A A . 119 LYS CG   1 1 
        1  1791 1 1 119 LYS H    H  61.506 -21.363 -24.107 1.00 . A A . 119 LYS H    1 1 
        1  1792 1 1 119 LYS HA   H  62.365 -23.174 -25.184 1.00 . A A . 119 LYS HA   1 1 
        1  1793 1 1 119 LYS HB2  H  64.402 -21.548 -24.882 1.00 . A A . 119 LYS HB2  1 1 
        1  1794 1 1 119 LYS HB3  H  64.963 -22.774 -23.745 1.00 . A A . 119 LYS HB3  1 1 
        1  1795 1 1 119 LYS HD2  H  66.790 -22.626 -25.110 1.00 . A A . 119 LYS HD2  1 1 
        1  1796 1 1 119 LYS HD3  H  66.914 -24.044 -26.161 1.00 . A A . 119 LYS HD3  1 1 
        1  1797 1 1 119 LYS HE2  H  66.055 -22.636 -28.055 1.00 . A A . 119 LYS HE2  1 1 
        1  1798 1 1 119 LYS HE3  H  66.169 -21.240 -26.978 1.00 . A A . 119 LYS HE3  1 1 
        1  1799 1 1 119 LYS HG2  H  64.800 -24.482 -25.538 1.00 . A A . 119 LYS HG2  1 1 
        1  1800 1 1 119 LYS HG3  H  64.362 -23.192 -26.665 1.00 . A A . 119 LYS HG3  1 1 
        1  1801 1 1 119 LYS HZ1  H  68.515 -22.967 -27.445 1.00 . A A . 119 LYS HZ1  1 1 
        1  1802 1 1 119 LYS HZ2  H  68.469 -21.359 -26.920 1.00 . A A . 119 LYS HZ2  1 1 
        1  1803 1 1 119 LYS HZ3  H  68.122 -21.734 -28.533 1.00 . A A . 119 LYS HZ3  1 1 
        1  1804 1 1 119 LYS N    N  62.243 -21.813 -23.640 1.00 . A A . 119 LYS N    1 1 
        1  1805 1 1 119 LYS NZ   N  68.023 -22.058 -27.549 1.00 . A A . 119 LYS NZ   1 1 
        1  1806 1 1 119 LYS O    O  63.788 -24.982 -23.355 1.00 . A A . 119 LYS O    1 1 
        1  1807 1 1 120 GLY C    C  62.465 -25.291 -20.453 1.00 . A A . 120 GLY C    1 1 
        1  1808 1 1 120 GLY CA   C  61.633 -25.442 -21.711 1.00 . A A . 120 GLY CA   1 1 
        1  1809 1 1 120 GLY H    H  61.063 -23.638 -22.660 1.00 . A A . 120 GLY H    1 1 
        1  1810 1 1 120 GLY HA2  H  60.594 -25.541 -21.434 1.00 . A A . 120 GLY HA2  1 1 
        1  1811 1 1 120 GLY HA3  H  61.943 -26.338 -22.228 1.00 . A A . 120 GLY HA3  1 1 
        1  1812 1 1 120 GLY N    N  61.775 -24.312 -22.609 1.00 . A A . 120 GLY N    1 1 
        1  1813 1 1 120 GLY O    O  63.321 -26.126 -20.163 1.00 . A A . 120 GLY O    1 1 
        1  1814 1 1 121 LYS C    C  64.453 -23.978 -18.718 1.00 . A A . 121 LYS C    1 1 
        1  1815 1 1 121 LYS CA   C  62.947 -23.963 -18.471 1.00 . A A . 121 LYS CA   1 1 
        1  1816 1 1 121 LYS CB   C  62.583 -25.002 -17.409 1.00 . A A . 121 LYS CB   1 1 
        1  1817 1 1 121 LYS CD   C  62.901 -25.328 -14.939 1.00 . A A . 121 LYS CD   1 1 
        1  1818 1 1 121 LYS CE   C  63.056 -24.594 -13.615 1.00 . A A . 121 LYS CE   1 1 
        1  1819 1 1 121 LYS CG   C  62.369 -24.410 -16.027 1.00 . A A . 121 LYS CG   1 1 
        1  1820 1 1 121 LYS H    H  61.520 -23.592 -19.990 1.00 . A A . 121 LYS H    1 1 
        1  1821 1 1 121 LYS HA   H  62.662 -22.982 -18.117 1.00 . A A . 121 LYS HA   1 1 
        1  1822 1 1 121 LYS HB2  H  61.669 -25.511 -17.717 1.00 . A A . 121 LYS HB2  1 1 
        1  1823 1 1 121 LYS HB3  H  63.380 -25.730 -17.348 1.00 . A A . 121 LYS HB3  1 1 
        1  1824 1 1 121 LYS HD2  H  62.210 -26.161 -14.806 1.00 . A A . 121 LYS HD2  1 1 
        1  1825 1 1 121 LYS HD3  H  63.864 -25.713 -15.243 1.00 . A A . 121 LYS HD3  1 1 
        1  1826 1 1 121 LYS HE2  H  62.918 -23.526 -13.783 1.00 . A A . 121 LYS HE2  1 1 
        1  1827 1 1 121 LYS HE3  H  62.297 -24.945 -12.933 1.00 . A A . 121 LYS HE3  1 1 
        1  1828 1 1 121 LYS HG2  H  62.881 -23.450 -15.967 1.00 . A A . 121 LYS HG2  1 1 
        1  1829 1 1 121 LYS HG3  H  61.312 -24.258 -15.871 1.00 . A A . 121 LYS HG3  1 1 
        1  1830 1 1 121 LYS HZ1  H  64.763 -25.754 -13.290 1.00 . A A . 121 LYS HZ1  1 1 
        1  1831 1 1 121 LYS HZ2  H  64.330 -24.785 -11.972 1.00 . A A . 121 LYS HZ2  1 1 
        1  1832 1 1 121 LYS HZ3  H  65.063 -24.089 -13.328 1.00 . A A . 121 LYS HZ3  1 1 
        1  1833 1 1 121 LYS N    N  62.215 -24.222 -19.705 1.00 . A A . 121 LYS N    1 1 
        1  1834 1 1 121 LYS NZ   N  64.397 -24.822 -13.009 1.00 . A A . 121 LYS NZ   1 1 
        1  1835 1 1 121 LYS O    O  65.224 -24.442 -17.880 1.00 . A A . 121 LYS O    1 1 
        1  1836 1 1 122 GLY C    C  66.868 -24.815 -20.367 1.00 . A A . 122 GLY C    1 1 
        1  1837 1 1 122 GLY CA   C  66.275 -23.430 -20.210 1.00 . A A . 122 GLY CA   1 1 
        1  1838 1 1 122 GLY H    H  64.202 -23.109 -20.505 1.00 . A A . 122 GLY H    1 1 
        1  1839 1 1 122 GLY HA2  H  66.400 -22.888 -21.136 1.00 . A A . 122 GLY HA2  1 1 
        1  1840 1 1 122 GLY HA3  H  66.805 -22.909 -19.426 1.00 . A A . 122 GLY HA3  1 1 
        1  1841 1 1 122 GLY N    N  64.863 -23.465 -19.874 1.00 . A A . 122 GLY N    1 1 
        1  1842 1 1 122 GLY O    O  66.142 -25.798 -20.507 1.00 . A A . 122 GLY O    1 1 
        1  1843 1 1 123 LYS C    C  69.075 -26.840 -19.128 1.00 . A A . 123 LYS C    1 1 
        1  1844 1 1 123 LYS CA   C  68.888 -26.169 -20.485 1.00 . A A . 123 LYS CA   1 1 
        1  1845 1 1 123 LYS CB   C  70.247 -25.962 -21.155 1.00 . A A . 123 LYS CB   1 1 
        1  1846 1 1 123 LYS CD   C  72.565 -25.524 -20.289 1.00 . A A . 123 LYS CD   1 1 
        1  1847 1 1 123 LYS CE   C  73.547 -24.419 -19.927 1.00 . A A . 123 LYS CE   1 1 
        1  1848 1 1 123 LYS CG   C  71.149 -24.987 -20.417 1.00 . A A . 123 LYS CG   1 1 
        1  1849 1 1 123 LYS H    H  68.721 -24.074 -20.228 1.00 . A A . 123 LYS H    1 1 
        1  1850 1 1 123 LYS HA   H  68.283 -26.808 -21.108 1.00 . A A . 123 LYS HA   1 1 
        1  1851 1 1 123 LYS HB2  H  70.754 -26.925 -21.221 1.00 . A A . 123 LYS HB2  1 1 
        1  1852 1 1 123 LYS HB3  H  70.088 -25.586 -22.156 1.00 . A A . 123 LYS HB3  1 1 
        1  1853 1 1 123 LYS HD2  H  72.589 -26.291 -19.515 1.00 . A A . 123 LYS HD2  1 1 
        1  1854 1 1 123 LYS HD3  H  72.860 -25.962 -21.231 1.00 . A A . 123 LYS HD3  1 1 
        1  1855 1 1 123 LYS HE2  H  73.053 -23.454 -20.032 1.00 . A A . 123 LYS HE2  1 1 
        1  1856 1 1 123 LYS HE3  H  73.853 -24.551 -18.901 1.00 . A A . 123 LYS HE3  1 1 
        1  1857 1 1 123 LYS HG2  H  71.173 -24.042 -20.959 1.00 . A A . 123 LYS HG2  1 1 
        1  1858 1 1 123 LYS HG3  H  70.746 -24.818 -19.428 1.00 . A A . 123 LYS HG3  1 1 
        1  1859 1 1 123 LYS HZ1  H  74.602 -23.849 -21.639 1.00 . A A . 123 LYS HZ1  1 1 
        1  1860 1 1 123 LYS HZ2  H  74.950 -25.419 -21.111 1.00 . A A . 123 LYS HZ2  1 1 
        1  1861 1 1 123 LYS HZ3  H  75.580 -24.088 -20.279 1.00 . A A . 123 LYS HZ3  1 1 
        1  1862 1 1 123 LYS N    N  68.195 -24.894 -20.343 1.00 . A A . 123 LYS N    1 1 
        1  1863 1 1 123 LYS NZ   N  74.755 -24.446 -20.800 1.00 . A A . 123 LYS NZ   1 1 
        1  1864 1 1 123 LYS O    O  68.691 -26.292 -18.096 1.00 . A A . 123 LYS O    1 1 
        1  1865 1 1 124 GLY C    C  70.399 -30.164 -18.139 1.00 . A A . 124 GLY C    1 1 
        1  1866 1 1 124 GLY CA   C  69.901 -28.753 -17.900 1.00 . A A . 124 GLY CA   1 1 
        1  1867 1 1 124 GLY H    H  69.958 -28.416 -19.990 1.00 . A A . 124 GLY H    1 1 
        1  1868 1 1 124 GLY HA2  H  70.633 -28.218 -17.313 1.00 . A A . 124 GLY HA2  1 1 
        1  1869 1 1 124 GLY HA3  H  68.975 -28.800 -17.346 1.00 . A A . 124 GLY HA3  1 1 
        1  1870 1 1 124 GLY N    N  69.672 -28.029 -19.136 1.00 . A A . 124 GLY N    1 1 
        1  1871 1 1 124 GLY O    O  70.104 -30.767 -19.169 1.00 . A A . 124 GLY O    1 1 
        1  1872 1 1 125 ASN C    C  72.584 -32.170 -18.535 1.00 . A A . 125 ASN C    1 1 
        1  1873 1 1 125 ASN CA   C  71.702 -32.041 -17.297 1.00 . A A . 125 ASN CA   1 1 
        1  1874 1 1 125 ASN CB   C  70.569 -33.064 -17.356 1.00 . A A . 125 ASN CB   1 1 
        1  1875 1 1 125 ASN CG   C  70.850 -34.288 -16.505 1.00 . A A . 125 ASN CG   1 1 
        1  1876 1 1 125 ASN H    H  71.361 -30.160 -16.385 1.00 . A A . 125 ASN H    1 1 
        1  1877 1 1 125 ASN HA   H  72.302 -32.231 -16.420 1.00 . A A . 125 ASN HA   1 1 
        1  1878 1 1 125 ASN HB2  H  69.649 -32.595 -17.008 1.00 . A A . 125 ASN HB2  1 1 
        1  1879 1 1 125 ASN HB3  H  70.433 -33.385 -18.379 1.00 . A A . 125 ASN HB3  1 1 
        1  1880 1 1 125 ASN HD21 H  68.910 -34.495 -16.118 1.00 . A A . 125 ASN HD21 1 1 
        1  1881 1 1 125 ASN HD22 H  69.949 -35.669 -15.392 1.00 . A A . 125 ASN HD22 1 1 
        1  1882 1 1 125 ASN N    N  71.159 -30.691 -17.185 1.00 . A A . 125 ASN N    1 1 
        1  1883 1 1 125 ASN ND2  N  69.796 -34.877 -15.949 1.00 . A A . 125 ASN ND2  1 1 
        1  1884 1 1 125 ASN O    O  73.789 -32.401 -18.428 1.00 . A A . 125 ASN O    1 1 
        1  1885 1 1 125 ASN OXT  O  72.087 -32.041 -19.651 1.00 . A A . 125 ASN OXT  1 1 
        1  1886 1 1 125 ASN OD1  O  71.999 -34.699 -16.348 1.00 . A A . 125 ASN OD1  1 1 
        2  1887 1 1   1 GLY C    C -76.523  21.320 -23.960 1.00 . A A .   1 GLY C    1 1 
        2  1888 1 1   1 GLY CA   C -77.471  22.380 -24.486 1.00 . A A .   1 GLY CA   1 1 
        2  1889 1 1   1 GLY H1   H -77.680  22.840 -26.414 1.00 . A A .   1 GLY H1   1 1 
        2  1890 1 1   1 GLY H2   H -78.969  22.070 -25.780 1.00 . A A .   1 GLY H2   1 1 
        2  1891 1 1   1 GLY H3   H -77.677  21.249 -26.265 1.00 . A A .   1 GLY H3   1 1 
        2  1892 1 1   1 GLY HA2  H -76.957  23.328 -24.511 1.00 . A A .   1 GLY HA2  1 1 
        2  1893 1 1   1 GLY HA3  H -78.315  22.455 -23.815 1.00 . A A .   1 GLY HA3  1 1 
        2  1894 1 1   1 GLY N    N -77.960  22.074 -25.818 1.00 . A A .   1 GLY N    1 1 
        2  1895 1 1   1 GLY O    O -76.803  20.125 -24.051 1.00 . A A .   1 GLY O    1 1 
        2  1896 1 1   2 SER C    C -73.456  21.560 -21.913 1.00 . A A .   2 SER C    1 1 
        2  1897 1 1   2 SER CA   C -74.398  20.839 -22.872 1.00 . A A .   2 SER CA   1 1 
        2  1898 1 1   2 SER CB   C -73.599  20.200 -24.008 1.00 . A A .   2 SER CB   1 1 
        2  1899 1 1   2 SER H    H -75.229  22.724 -23.365 1.00 . A A .   2 SER H    1 1 
        2  1900 1 1   2 SER HA   H -74.922  20.065 -22.330 1.00 . A A .   2 SER HA   1 1 
        2  1901 1 1   2 SER HB2  H -74.057  19.248 -24.278 1.00 . A A .   2 SER HB2  1 1 
        2  1902 1 1   2 SER HB3  H -73.611  20.855 -24.866 1.00 . A A .   2 SER HB3  1 1 
        2  1903 1 1   2 SER HG   H -71.794  19.505 -24.320 1.00 . A A .   2 SER HG   1 1 
        2  1904 1 1   2 SER N    N -75.395  21.759 -23.410 1.00 . A A .   2 SER N    1 1 
        2  1905 1 1   2 SER O    O -73.372  21.221 -20.733 1.00 . A A .   2 SER O    1 1 
        2  1906 1 1   2 SER OG   O -72.255  19.976 -23.621 1.00 . A A .   2 SER OG   1 1 
        2  1907 1 1   3 LYS C    C -70.717  22.430 -21.051 1.00 . A A .   3 LYS C    1 1 
        2  1908 1 1   3 LYS CA   C -71.809  23.329 -21.623 1.00 . A A .   3 LYS CA   1 1 
        2  1909 1 1   3 LYS CB   C -72.548  24.040 -20.486 1.00 . A A .   3 LYS CB   1 1 
        2  1910 1 1   3 LYS CD   C -74.778  25.049 -19.922 1.00 . A A .   3 LYS CD   1 1 
        2  1911 1 1   3 LYS CE   C -74.483  26.145 -18.910 1.00 . A A .   3 LYS CE   1 1 
        2  1912 1 1   3 LYS CG   C -73.676  24.938 -20.963 1.00 . A A .   3 LYS CG   1 1 
        2  1913 1 1   3 LYS H    H -72.856  22.780 -23.378 1.00 . A A .   3 LYS H    1 1 
        2  1914 1 1   3 LYS HA   H -71.352  24.069 -22.262 1.00 . A A .   3 LYS HA   1 1 
        2  1915 1 1   3 LYS HB2  H -72.961  23.287 -19.814 1.00 . A A .   3 LYS HB2  1 1 
        2  1916 1 1   3 LYS HB3  H -71.841  24.644 -19.936 1.00 . A A .   3 LYS HB3  1 1 
        2  1917 1 1   3 LYS HD2  H -75.721  25.270 -20.423 1.00 . A A .   3 LYS HD2  1 1 
        2  1918 1 1   3 LYS HD3  H -74.866  24.105 -19.403 1.00 . A A .   3 LYS HD3  1 1 
        2  1919 1 1   3 LYS HE2  H -73.495  25.976 -18.480 1.00 . A A .   3 LYS HE2  1 1 
        2  1920 1 1   3 LYS HE3  H -74.487  27.098 -19.420 1.00 . A A .   3 LYS HE3  1 1 
        2  1921 1 1   3 LYS HG2  H -73.277  25.932 -21.167 1.00 . A A .   3 LYS HG2  1 1 
        2  1922 1 1   3 LYS HG3  H -74.089  24.530 -21.872 1.00 . A A .   3 LYS HG3  1 1 
        2  1923 1 1   3 LYS HZ1  H -76.412  26.482 -18.186 1.00 . A A .   3 LYS HZ1  1 1 
        2  1924 1 1   3 LYS HZ2  H -75.191  26.837 -17.071 1.00 . A A .   3 LYS HZ2  1 1 
        2  1925 1 1   3 LYS HZ3  H -75.595  25.227 -17.399 1.00 . A A .   3 LYS HZ3  1 1 
        2  1926 1 1   3 LYS N    N -72.747  22.558 -22.431 1.00 . A A .   3 LYS N    1 1 
        2  1927 1 1   3 LYS NZ   N -75.491  26.174 -17.816 1.00 . A A .   3 LYS NZ   1 1 
        2  1928 1 1   3 LYS O    O -70.803  21.985 -19.906 1.00 . A A .   3 LYS O    1 1 
        2  1929 1 1   4 ASN C    C -67.328  21.616 -22.247 1.00 . A A .   4 ASN C    1 1 
        2  1930 1 1   4 ASN CA   C -68.580  21.327 -21.425 1.00 . A A .   4 ASN CA   1 1 
        2  1931 1 1   4 ASN CB   C -68.956  19.850 -21.552 1.00 . A A .   4 ASN CB   1 1 
        2  1932 1 1   4 ASN CG   C -67.763  18.931 -21.383 1.00 . A A .   4 ASN CG   1 1 
        2  1933 1 1   4 ASN H    H -69.677  22.556 -22.754 1.00 . A A .   4 ASN H    1 1 
        2  1934 1 1   4 ASN HA   H -68.375  21.550 -20.388 1.00 . A A .   4 ASN HA   1 1 
        2  1935 1 1   4 ASN HB2  H -69.698  19.608 -20.791 1.00 . A A .   4 ASN HB2  1 1 
        2  1936 1 1   4 ASN HB3  H -69.386  19.676 -22.528 1.00 . A A .   4 ASN HB3  1 1 
        2  1937 1 1   4 ASN HD21 H -67.375  19.725 -19.600 1.00 . A A .   4 ASN HD21 1 1 
        2  1938 1 1   4 ASN HD22 H -66.298  18.475 -20.117 1.00 . A A .   4 ASN HD22 1 1 
        2  1939 1 1   4 ASN N    N -69.690  22.172 -21.853 1.00 . A A .   4 ASN N    1 1 
        2  1940 1 1   4 ASN ND2  N -67.076  19.056 -20.252 1.00 . A A .   4 ASN ND2  1 1 
        2  1941 1 1   4 ASN O    O -67.412  21.985 -23.419 1.00 . A A .   4 ASN O    1 1 
        2  1942 1 1   4 ASN OD1  O -67.460  18.119 -22.257 1.00 . A A .   4 ASN OD1  1 1 
        2  1943 1 1   5 LYS C    C -63.763  20.930 -21.611 1.00 . A A .   5 LYS C    1 1 
        2  1944 1 1   5 LYS CA   C -64.895  21.686 -22.299 1.00 . A A .   5 LYS CA   1 1 
        2  1945 1 1   5 LYS CB   C -64.582  23.184 -22.323 1.00 . A A .   5 LYS CB   1 1 
        2  1946 1 1   5 LYS CD   C -66.230  24.425 -20.888 1.00 . A A .   5 LYS CD   1 1 
        2  1947 1 1   5 LYS CE   C -66.233  25.874 -20.427 1.00 . A A .   5 LYS CE   1 1 
        2  1948 1 1   5 LYS CG   C -64.817  23.876 -20.990 1.00 . A A .   5 LYS CG   1 1 
        2  1949 1 1   5 LYS H    H -66.163  21.151 -20.691 1.00 . A A .   5 LYS H    1 1 
        2  1950 1 1   5 LYS HA   H -64.985  21.330 -23.315 1.00 . A A .   5 LYS HA   1 1 
        2  1951 1 1   5 LYS HB2  H -63.538  23.318 -22.607 1.00 . A A .   5 LYS HB2  1 1 
        2  1952 1 1   5 LYS HB3  H -65.206  23.658 -23.065 1.00 . A A .   5 LYS HB3  1 1 
        2  1953 1 1   5 LYS HD2  H -66.710  24.359 -21.865 1.00 . A A .   5 LYS HD2  1 1 
        2  1954 1 1   5 LYS HD3  H -66.788  23.829 -20.179 1.00 . A A .   5 LYS HD3  1 1 
        2  1955 1 1   5 LYS HE2  H -67.263  26.196 -20.272 1.00 . A A .   5 LYS HE2  1 1 
        2  1956 1 1   5 LYS HE3  H -65.697  25.942 -19.493 1.00 . A A .   5 LYS HE3  1 1 
        2  1957 1 1   5 LYS HG2  H -64.652  23.162 -20.183 1.00 . A A .   5 LYS HG2  1 1 
        2  1958 1 1   5 LYS HG3  H -64.115  24.692 -20.890 1.00 . A A .   5 LYS HG3  1 1 
        2  1959 1 1   5 LYS HZ1  H -65.560  26.314 -22.356 1.00 . A A .   5 LYS HZ1  1 1 
        2  1960 1 1   5 LYS HZ2  H -64.614  26.992 -21.128 1.00 . A A .   5 LYS HZ2  1 1 
        2  1961 1 1   5 LYS HZ3  H -66.121  27.662 -21.502 1.00 . A A .   5 LYS HZ3  1 1 
        2  1962 1 1   5 LYS N    N -66.166  21.446 -21.626 1.00 . A A .   5 LYS N    1 1 
        2  1963 1 1   5 LYS NZ   N -65.587  26.773 -21.424 1.00 . A A .   5 LYS NZ   1 1 
        2  1964 1 1   5 LYS O    O -63.895  20.505 -20.462 1.00 . A A .   5 LYS O    1 1 
        2  1965 1 1   6 LYS C    C -60.234  20.399 -22.566 1.00 . A A .   6 LYS C    1 1 
        2  1966 1 1   6 LYS CA   C -61.494  20.065 -21.775 1.00 . A A .   6 LYS CA   1 1 
        2  1967 1 1   6 LYS CB   C -61.734  18.554 -21.794 1.00 . A A .   6 LYS CB   1 1 
        2  1968 1 1   6 LYS CD   C -62.803  17.926 -19.608 1.00 . A A .   6 LYS CD   1 1 
        2  1969 1 1   6 LYS CE   C -62.944  16.678 -18.752 1.00 . A A .   6 LYS CE   1 1 
        2  1970 1 1   6 LYS CG   C -61.533  17.889 -20.444 1.00 . A A .   6 LYS CG   1 1 
        2  1971 1 1   6 LYS H    H -62.606  21.129 -23.230 1.00 . A A .   6 LYS H    1 1 
        2  1972 1 1   6 LYS HA   H -61.360  20.387 -20.755 1.00 . A A .   6 LYS HA   1 1 
        2  1973 1 1   6 LYS HB2  H -62.755  18.366 -22.127 1.00 . A A .   6 LYS HB2  1 1 
        2  1974 1 1   6 LYS HB3  H -61.051  18.101 -22.499 1.00 . A A .   6 LYS HB3  1 1 
        2  1975 1 1   6 LYS HD2  H -62.779  18.802 -18.960 1.00 . A A .   6 LYS HD2  1 1 
        2  1976 1 1   6 LYS HD3  H -63.656  17.998 -20.270 1.00 . A A .   6 LYS HD3  1 1 
        2  1977 1 1   6 LYS HE2  H -62.903  15.798 -19.395 1.00 . A A .   6 LYS HE2  1 1 
        2  1978 1 1   6 LYS HE3  H -62.122  16.642 -18.052 1.00 . A A .   6 LYS HE3  1 1 
        2  1979 1 1   6 LYS HG2  H -61.236  16.851 -20.597 1.00 . A A .   6 LYS HG2  1 1 
        2  1980 1 1   6 LYS HG3  H -60.749  18.407 -19.911 1.00 . A A .   6 LYS HG3  1 1 
        2  1981 1 1   6 LYS HZ1  H -64.412  17.609 -17.593 1.00 . A A .   6 LYS HZ1  1 1 
        2  1982 1 1   6 LYS HZ2  H -64.175  15.976 -17.217 1.00 . A A .   6 LYS HZ2  1 1 
        2  1983 1 1   6 LYS HZ3  H -65.012  16.408 -18.623 1.00 . A A .   6 LYS HZ3  1 1 
        2  1984 1 1   6 LYS N    N -62.650  20.767 -22.318 1.00 . A A .   6 LYS N    1 1 
        2  1985 1 1   6 LYS NZ   N -64.225  16.668 -17.994 1.00 . A A .   6 LYS NZ   1 1 
        2  1986 1 1   6 LYS O    O -60.309  20.908 -23.684 1.00 . A A .   6 LYS O    1 1 
        2  1987 1 1   7 GLU C    C -56.637  19.931 -21.752 1.00 . A A .   7 GLU C    1 1 
        2  1988 1 1   7 GLU CA   C -57.801  20.379 -22.631 1.00 . A A .   7 GLU CA   1 1 
        2  1989 1 1   7 GLU CB   C -57.672  21.870 -22.948 1.00 . A A .   7 GLU CB   1 1 
        2  1990 1 1   7 GLU CD   C -56.575  23.583 -24.447 1.00 . A A .   7 GLU CD   1 1 
        2  1991 1 1   7 GLU CG   C -57.060  22.153 -24.309 1.00 . A A .   7 GLU CG   1 1 
        2  1992 1 1   7 GLU H    H -59.082  19.704 -21.086 1.00 . A A .   7 GLU H    1 1 
        2  1993 1 1   7 GLU HA   H -57.776  19.822 -23.554 1.00 . A A .   7 GLU HA   1 1 
        2  1994 1 1   7 GLU HB2  H -58.662  22.323 -22.908 1.00 . A A .   7 GLU HB2  1 1 
        2  1995 1 1   7 GLU HB3  H -57.049  22.333 -22.195 1.00 . A A .   7 GLU HB3  1 1 
        2  1996 1 1   7 GLU HG2  H -56.218  21.478 -24.465 1.00 . A A .   7 GLU HG2  1 1 
        2  1997 1 1   7 GLU HG3  H -57.804  21.965 -25.069 1.00 . A A .   7 GLU HG3  1 1 
        2  1998 1 1   7 GLU N    N -59.076  20.109 -21.978 1.00 . A A .   7 GLU N    1 1 
        2  1999 1 1   7 GLU O    O -56.708  19.992 -20.526 1.00 . A A .   7 GLU O    1 1 
        2  2000 1 1   7 GLU OE1  O -57.419  24.502 -24.394 1.00 . A A .   7 GLU OE1  1 1 
        2  2001 1 1   7 GLU OE2  O -55.354  23.783 -24.609 1.00 . A A .   7 GLU OE2  1 1 
        2  2002 1 1   8 LYS C    C -53.279  18.604 -22.641 1.00 . A A .   8 LYS C    1 1 
        2  2003 1 1   8 LYS CA   C -54.379  19.021 -21.671 1.00 . A A .   8 LYS CA   1 1 
        2  2004 1 1   8 LYS CB   C -54.738  17.847 -20.756 1.00 . A A .   8 LYS CB   1 1 
        2  2005 1 1   8 LYS CD   C -53.984  16.887 -18.561 1.00 . A A .   8 LYS CD   1 1 
        2  2006 1 1   8 LYS CE   C -54.860  16.545 -17.366 1.00 . A A .   8 LYS CE   1 1 
        2  2007 1 1   8 LYS CG   C -54.487  18.125 -19.285 1.00 . A A .   8 LYS CG   1 1 
        2  2008 1 1   8 LYS H    H -55.564  19.454 -23.372 1.00 . A A .   8 LYS H    1 1 
        2  2009 1 1   8 LYS HA   H -54.020  19.839 -21.068 1.00 . A A .   8 LYS HA   1 1 
        2  2010 1 1   8 LYS HB2  H -55.793  17.607 -20.892 1.00 . A A .   8 LYS HB2  1 1 
        2  2011 1 1   8 LYS HB3  H -54.148  16.989 -21.045 1.00 . A A .   8 LYS HB3  1 1 
        2  2012 1 1   8 LYS HD2  H -53.982  16.045 -19.254 1.00 . A A .   8 LYS HD2  1 1 
        2  2013 1 1   8 LYS HD3  H -52.975  17.065 -18.218 1.00 . A A .   8 LYS HD3  1 1 
        2  2014 1 1   8 LYS HE2  H -54.557  17.157 -16.516 1.00 . A A .   8 LYS HE2  1 1 
        2  2015 1 1   8 LYS HE3  H -55.888  16.770 -17.613 1.00 . A A .   8 LYS HE3  1 1 
        2  2016 1 1   8 LYS HG2  H -53.745  18.918 -19.193 1.00 . A A .   8 LYS HG2  1 1 
        2  2017 1 1   8 LYS HG3  H -55.410  18.449 -18.826 1.00 . A A .   8 LYS HG3  1 1 
        2  2018 1 1   8 LYS HZ1  H -53.777  14.777 -17.118 1.00 . A A .   8 LYS HZ1  1 1 
        2  2019 1 1   8 LYS HZ2  H -55.383  14.535 -17.590 1.00 . A A .   8 LYS HZ2  1 1 
        2  2020 1 1   8 LYS HZ3  H -55.026  14.977 -15.997 1.00 . A A .   8 LYS HZ3  1 1 
        2  2021 1 1   8 LYS N    N -55.562  19.480 -22.391 1.00 . A A .   8 LYS N    1 1 
        2  2022 1 1   8 LYS NZ   N -54.754  15.108 -16.992 1.00 . A A .   8 LYS NZ   1 1 
        2  2023 1 1   8 LYS O    O -53.446  18.688 -23.858 1.00 . A A .   8 LYS O    1 1 
        2  2024 1 1   9 ASN C    C -50.186  16.684 -22.178 1.00 . A A .   9 ASN C    1 1 
        2  2025 1 1   9 ASN CA   C -51.025  17.725 -22.914 1.00 . A A .   9 ASN CA   1 1 
        2  2026 1 1   9 ASN CB   C -50.155  18.924 -23.291 1.00 . A A .   9 ASN CB   1 1 
        2  2027 1 1   9 ASN CG   C -49.903  19.011 -24.784 1.00 . A A .   9 ASN CG   1 1 
        2  2028 1 1   9 ASN H    H -52.080  18.111 -21.119 1.00 . A A .   9 ASN H    1 1 
        2  2029 1 1   9 ASN HA   H -51.420  17.280 -23.815 1.00 . A A .   9 ASN HA   1 1 
        2  2030 1 1   9 ASN HB2  H -50.653  19.837 -22.963 1.00 . A A .   9 ASN HB2  1 1 
        2  2031 1 1   9 ASN HB3  H -49.203  18.845 -22.787 1.00 . A A .   9 ASN HB3  1 1 
        2  2032 1 1   9 ASN HD21 H -48.072  19.713 -24.459 1.00 . A A .   9 ASN HD21 1 1 
        2  2033 1 1   9 ASN HD22 H -48.522  19.529 -26.117 1.00 . A A .   9 ASN HD22 1 1 
        2  2034 1 1   9 ASN N    N -52.154  18.155 -22.095 1.00 . A A .   9 ASN N    1 1 
        2  2035 1 1   9 ASN ND2  N -48.712  19.464 -25.157 1.00 . A A .   9 ASN ND2  1 1 
        2  2036 1 1   9 ASN O    O -50.582  16.181 -21.126 1.00 . A A .   9 ASN O    1 1 
        2  2037 1 1   9 ASN OD1  O -50.769  18.673 -25.592 1.00 . A A .   9 ASN OD1  1 1 
        2  2038 1 1  10 LYS C    C -46.718  15.516 -22.711 1.00 . A A .  10 LYS C    1 1 
        2  2039 1 1  10 LYS CA   C -48.126  15.387 -22.138 1.00 . A A .  10 LYS CA   1 1 
        2  2040 1 1  10 LYS CB   C -48.655  13.970 -22.369 1.00 . A A .  10 LYS CB   1 1 
        2  2041 1 1  10 LYS CD   C -48.879  11.813 -21.101 1.00 . A A .  10 LYS CD   1 1 
        2  2042 1 1  10 LYS CE   C -48.660  11.460 -19.638 1.00 . A A .  10 LYS CE   1 1 
        2  2043 1 1  10 LYS CG   C -47.931  12.910 -21.556 1.00 . A A .  10 LYS CG   1 1 
        2  2044 1 1  10 LYS H    H -48.764  16.801 -23.579 1.00 . A A .  10 LYS H    1 1 
        2  2045 1 1  10 LYS HA   H -48.089  15.580 -21.077 1.00 . A A .  10 LYS HA   1 1 
        2  2046 1 1  10 LYS HB2  H -49.714  13.946 -22.112 1.00 . A A .  10 LYS HB2  1 1 
        2  2047 1 1  10 LYS HB3  H -48.547  13.725 -23.416 1.00 . A A .  10 LYS HB3  1 1 
        2  2048 1 1  10 LYS HD2  H -49.907  12.150 -21.237 1.00 . A A .  10 LYS HD2  1 1 
        2  2049 1 1  10 LYS HD3  H -48.712  10.932 -21.704 1.00 . A A .  10 LYS HD3  1 1 
        2  2050 1 1  10 LYS HE2  H -47.637  11.105 -19.507 1.00 . A A .  10 LYS HE2  1 1 
        2  2051 1 1  10 LYS HE3  H -48.805  12.348 -19.041 1.00 . A A .  10 LYS HE3  1 1 
        2  2052 1 1  10 LYS HG2  H -47.141  12.470 -22.165 1.00 . A A .  10 LYS HG2  1 1 
        2  2053 1 1  10 LYS HG3  H -47.490  13.377 -20.687 1.00 . A A .  10 LYS HG3  1 1 
        2  2054 1 1  10 LYS HZ1  H -49.209   9.909 -18.351 1.00 . A A .  10 LYS HZ1  1 1 
        2  2055 1 1  10 LYS HZ2  H -49.770   9.715 -19.936 1.00 . A A .  10 LYS HZ2  1 1 
        2  2056 1 1  10 LYS HZ3  H -50.514  10.832 -18.907 1.00 . A A .  10 LYS HZ3  1 1 
        2  2057 1 1  10 LYS N    N -49.024  16.366 -22.739 1.00 . A A .  10 LYS N    1 1 
        2  2058 1 1  10 LYS NZ   N -49.604  10.404 -19.176 1.00 . A A .  10 LYS NZ   1 1 
        2  2059 1 1  10 LYS O    O -45.768  15.813 -21.989 1.00 . A A .  10 LYS O    1 1 
        2  2060 1 1  11 GLY C    C -44.770  14.039 -25.111 1.00 . A A .  11 GLY C    1 1 
        2  2061 1 1  11 GLY CA   C -45.297  15.389 -24.663 1.00 . A A .  11 GLY CA   1 1 
        2  2062 1 1  11 GLY H    H -47.385  15.057 -24.542 1.00 . A A .  11 GLY H    1 1 
        2  2063 1 1  11 GLY HA2  H -45.386  16.034 -25.525 1.00 . A A .  11 GLY HA2  1 1 
        2  2064 1 1  11 GLY HA3  H -44.592  15.825 -23.970 1.00 . A A .  11 GLY HA3  1 1 
        2  2065 1 1  11 GLY N    N -46.592  15.290 -24.015 1.00 . A A .  11 GLY N    1 1 
        2  2066 1 1  11 GLY O    O -45.538  13.099 -25.308 1.00 . A A .  11 GLY O    1 1 
        2  2067 1 1  12 GLY C    C -41.448  12.514 -25.151 1.00 . A A .  12 GLY C    1 1 
        2  2068 1 1  12 GLY CA   C -42.847  12.698 -25.703 1.00 . A A .  12 GLY CA   1 1 
        2  2069 1 1  12 GLY H    H -42.890  14.729 -25.104 1.00 . A A .  12 GLY H    1 1 
        2  2070 1 1  12 GLY HA2  H -43.465  11.878 -25.370 1.00 . A A .  12 GLY HA2  1 1 
        2  2071 1 1  12 GLY HA3  H -42.801  12.686 -26.781 1.00 . A A .  12 GLY HA3  1 1 
        2  2072 1 1  12 GLY N    N -43.453  13.946 -25.275 1.00 . A A .  12 GLY N    1 1 
        2  2073 1 1  12 GLY O    O -41.090  13.107 -24.132 1.00 . A A .  12 GLY O    1 1 
        2  2074 1 1  13 LYS C    C -38.542  10.585 -26.427 1.00 . A A .  13 LYS C    1 1 
        2  2075 1 1  13 LYS CA   C -39.283  11.427 -25.393 1.00 . A A .  13 LYS CA   1 1 
        2  2076 1 1  13 LYS CB   C -39.279  10.714 -24.040 1.00 . A A .  13 LYS CB   1 1 
        2  2077 1 1  13 LYS CD   C -40.923   9.313 -22.758 1.00 . A A .  13 LYS CD   1 1 
        2  2078 1 1  13 LYS CE   C -42.023   8.273 -22.907 1.00 . A A .  13 LYS CE   1 1 
        2  2079 1 1  13 LYS CG   C -40.092   9.432 -24.025 1.00 . A A .  13 LYS CG   1 1 
        2  2080 1 1  13 LYS H    H -40.994  11.245 -26.627 1.00 . A A .  13 LYS H    1 1 
        2  2081 1 1  13 LYS HA   H -38.780  12.377 -25.293 1.00 . A A .  13 LYS HA   1 1 
        2  2082 1 1  13 LYS HB2  H -38.249  10.477 -23.773 1.00 . A A .  13 LYS HB2  1 1 
        2  2083 1 1  13 LYS HB3  H -39.685  11.382 -23.293 1.00 . A A .  13 LYS HB3  1 1 
        2  2084 1 1  13 LYS HD2  H -40.273   9.030 -21.930 1.00 . A A .  13 LYS HD2  1 1 
        2  2085 1 1  13 LYS HD3  H -41.373  10.272 -22.542 1.00 . A A .  13 LYS HD3  1 1 
        2  2086 1 1  13 LYS HE2  H -42.536   8.158 -21.952 1.00 . A A .  13 LYS HE2  1 1 
        2  2087 1 1  13 LYS HE3  H -42.729   8.619 -23.648 1.00 . A A .  13 LYS HE3  1 1 
        2  2088 1 1  13 LYS HG2  H -40.756   9.420 -24.889 1.00 . A A .  13 LYS HG2  1 1 
        2  2089 1 1  13 LYS HG3  H -39.419   8.588 -24.084 1.00 . A A .  13 LYS HG3  1 1 
        2  2090 1 1  13 LYS HZ1  H -40.780   6.614 -22.644 1.00 . A A .  13 LYS HZ1  1 1 
        2  2091 1 1  13 LYS HZ2  H -41.027   7.036 -24.265 1.00 . A A .  13 LYS HZ2  1 1 
        2  2092 1 1  13 LYS HZ3  H -42.251   6.255 -23.397 1.00 . A A .  13 LYS HZ3  1 1 
        2  2093 1 1  13 LYS N    N -40.653  11.689 -25.822 1.00 . A A .  13 LYS N    1 1 
        2  2094 1 1  13 LYS NZ   N -41.483   6.952 -23.333 1.00 . A A .  13 LYS NZ   1 1 
        2  2095 1 1  13 LYS O    O -39.102  10.215 -27.458 1.00 . A A .  13 LYS O    1 1 
        2  2096 1 1  14 GLY C    C -35.073   9.256 -26.546 1.00 . A A .  14 GLY C    1 1 
        2  2097 1 1  14 GLY CA   C -36.481   9.486 -27.055 1.00 . A A .  14 GLY CA   1 1 
        2  2098 1 1  14 GLY H    H -36.884  10.607 -25.304 1.00 . A A .  14 GLY H    1 1 
        2  2099 1 1  14 GLY HA2  H -36.963   8.530 -27.195 1.00 . A A .  14 GLY HA2  1 1 
        2  2100 1 1  14 GLY HA3  H -36.429   9.994 -28.008 1.00 . A A .  14 GLY HA3  1 1 
        2  2101 1 1  14 GLY N    N -37.279  10.284 -26.142 1.00 . A A .  14 GLY N    1 1 
        2  2102 1 1  14 GLY O    O -34.878   8.836 -25.406 1.00 . A A .  14 GLY O    1 1 
        2  2103 1 1  15 GLY C    C -31.802  10.458 -27.504 1.00 . A A .  15 GLY C    1 1 
        2  2104 1 1  15 GLY CA   C -32.700   9.342 -27.005 1.00 . A A .  15 GLY CA   1 1 
        2  2105 1 1  15 GLY H    H -34.301   9.862 -28.291 1.00 . A A .  15 GLY H    1 1 
        2  2106 1 1  15 GLY HA2  H -32.642   9.300 -25.928 1.00 . A A .  15 GLY HA2  1 1 
        2  2107 1 1  15 GLY HA3  H -32.348   8.405 -27.412 1.00 . A A .  15 GLY HA3  1 1 
        2  2108 1 1  15 GLY N    N -34.085   9.530 -27.395 1.00 . A A .  15 GLY N    1 1 
        2  2109 1 1  15 GLY O    O -31.333  11.282 -26.721 1.00 . A A .  15 GLY O    1 1 
        2  2110 1 1  16 ALA C    C -29.258  11.324 -28.996 1.00 . A A .  16 ALA C    1 1 
        2  2111 1 1  16 ALA CA   C -30.713  11.505 -29.412 1.00 . A A .  16 ALA CA   1 1 
        2  2112 1 1  16 ALA CB   C -31.207  12.892 -29.027 1.00 . A A .  16 ALA CB   1 1 
        2  2113 1 1  16 ALA H    H -31.964   9.796 -29.384 1.00 . A A .  16 ALA H    1 1 
        2  2114 1 1  16 ALA HA   H -30.787  11.409 -30.486 1.00 . A A .  16 ALA HA   1 1 
        2  2115 1 1  16 ALA HB1  H -31.991  12.802 -28.289 1.00 . A A .  16 ALA HB1  1 1 
        2  2116 1 1  16 ALA HB2  H -30.388  13.463 -28.616 1.00 . A A .  16 ALA HB2  1 1 
        2  2117 1 1  16 ALA HB3  H -31.592  13.391 -29.903 1.00 . A A .  16 ALA HB3  1 1 
        2  2118 1 1  16 ALA N    N -31.562  10.482 -28.810 1.00 . A A .  16 ALA N    1 1 
        2  2119 1 1  16 ALA O    O -28.439  10.824 -29.768 1.00 . A A .  16 ALA O    1 1 
        2  2120 1 1  17 ASP C    C -27.588  11.529 -25.733 1.00 . A A .  17 ASP C    1 1 
        2  2121 1 1  17 ASP CA   C -27.583  11.620 -27.256 1.00 . A A .  17 ASP CA   1 1 
        2  2122 1 1  17 ASP CB   C -26.739  12.815 -27.704 1.00 . A A .  17 ASP CB   1 1 
        2  2123 1 1  17 ASP CG   C -25.562  12.400 -28.565 1.00 . A A .  17 ASP CG   1 1 
        2  2124 1 1  17 ASP H    H -29.637  12.127 -27.206 1.00 . A A .  17 ASP H    1 1 
        2  2125 1 1  17 ASP HA   H -27.151  10.715 -27.657 1.00 . A A .  17 ASP HA   1 1 
        2  2126 1 1  17 ASP HB2  H -27.369  13.499 -28.273 1.00 . A A .  17 ASP HB2  1 1 
        2  2127 1 1  17 ASP HB3  H -26.362  13.328 -26.833 1.00 . A A .  17 ASP HB3  1 1 
        2  2128 1 1  17 ASP N    N -28.941  11.736 -27.774 1.00 . A A .  17 ASP N    1 1 
        2  2129 1 1  17 ASP O    O -28.646  11.458 -25.108 1.00 . A A .  17 ASP O    1 1 
        2  2130 1 1  17 ASP OD1  O -25.791  11.920 -29.693 1.00 . A A .  17 ASP OD1  1 1 
        2  2131 1 1  17 ASP OD2  O -24.409  12.557 -28.108 1.00 . A A .  17 ASP OD2  1 1 
        2  2132 1 1  18 CYS C    C -25.305  12.513 -23.171 1.00 . A A .  18 CYS C    1 1 
        2  2133 1 1  18 CYS CA   C -26.264  11.445 -23.692 1.00 . A A .  18 CYS CA   1 1 
        2  2134 1 1  18 CYS CB   C -25.770  10.056 -23.284 1.00 . A A .  18 CYS CB   1 1 
        2  2135 1 1  18 CYS H    H -25.589  11.589 -25.693 1.00 . A A .  18 CYS H    1 1 
        2  2136 1 1  18 CYS HA   H -27.239  11.613 -23.258 1.00 . A A .  18 CYS HA   1 1 
        2  2137 1 1  18 CYS HB2  H -26.188   9.321 -23.972 1.00 . A A .  18 CYS HB2  1 1 
        2  2138 1 1  18 CYS HB3  H -24.693  10.029 -23.365 1.00 . A A .  18 CYS HB3  1 1 
        2  2139 1 1  18 CYS HG   H -25.967  10.597 -20.755 1.00 . A A .  18 CYS HG   1 1 
        2  2140 1 1  18 CYS N    N -26.398  11.530 -25.141 1.00 . A A .  18 CYS N    1 1 
        2  2141 1 1  18 CYS O    O -24.136  12.549 -23.554 1.00 . A A .  18 CYS O    1 1 
        2  2142 1 1  18 CYS SG   S -26.213   9.578 -21.583 1.00 . A A .  18 CYS SG   1 1 
        2  2143 1 1  19 ALA C    C -23.758  13.879 -21.033 1.00 . A A .  19 ALA C    1 1 
        2  2144 1 1  19 ALA CA   C -24.997  14.442 -21.722 1.00 . A A .  19 ALA CA   1 1 
        2  2145 1 1  19 ALA CB   C -25.820  15.263 -20.740 1.00 . A A .  19 ALA CB   1 1 
        2  2146 1 1  19 ALA H    H -26.748  13.296 -22.031 1.00 . A A .  19 ALA H    1 1 
        2  2147 1 1  19 ALA HA   H -24.684  15.094 -22.525 1.00 . A A .  19 ALA HA   1 1 
        2  2148 1 1  19 ALA HB1  H -26.549  14.625 -20.262 1.00 . A A .  19 ALA HB1  1 1 
        2  2149 1 1  19 ALA HB2  H -25.170  15.691 -19.994 1.00 . A A .  19 ALA HB2  1 1 
        2  2150 1 1  19 ALA HB3  H -26.329  16.054 -21.272 1.00 . A A .  19 ALA HB3  1 1 
        2  2151 1 1  19 ALA N    N -25.808  13.377 -22.296 1.00 . A A .  19 ALA N    1 1 
        2  2152 1 1  19 ALA O    O -22.754  14.570 -20.879 1.00 . A A .  19 ALA O    1 1 
        2  2153 1 1  20 GLU C    C -22.611  10.503 -20.375 1.00 . A A .  20 GLU C    1 1 
        2  2154 1 1  20 GLU CA   C -22.726  11.962 -19.946 1.00 . A A .  20 GLU CA   1 1 
        2  2155 1 1  20 GLU CB   C -22.898  12.046 -18.427 1.00 . A A .  20 GLU CB   1 1 
        2  2156 1 1  20 GLU CD   C -24.200  10.401 -17.020 1.00 . A A .  20 GLU CD   1 1 
        2  2157 1 1  20 GLU CG   C -24.269  11.600 -17.945 1.00 . A A .  20 GLU CG   1 1 
        2  2158 1 1  20 GLU H    H -24.668  12.117 -20.770 1.00 . A A .  20 GLU H    1 1 
        2  2159 1 1  20 GLU HA   H -21.820  12.478 -20.224 1.00 . A A .  20 GLU HA   1 1 
        2  2160 1 1  20 GLU HB2  H -22.141  11.420 -17.954 1.00 . A A .  20 GLU HB2  1 1 
        2  2161 1 1  20 GLU HB3  H -22.745  13.068 -18.115 1.00 . A A .  20 GLU HB3  1 1 
        2  2162 1 1  20 GLU HG2  H -24.744  12.427 -17.418 1.00 . A A .  20 GLU HG2  1 1 
        2  2163 1 1  20 GLU HG3  H -24.870  11.340 -18.804 1.00 . A A .  20 GLU HG3  1 1 
        2  2164 1 1  20 GLU N    N -23.839  12.618 -20.619 1.00 . A A .  20 GLU N    1 1 
        2  2165 1 1  20 GLU O    O -23.091   9.602 -19.687 1.00 . A A .  20 GLU O    1 1 
        2  2166 1 1  20 GLU OE1  O -23.298  10.368 -16.157 1.00 . A A .  20 GLU OE1  1 1 
        2  2167 1 1  20 GLU OE2  O -25.049   9.496 -17.159 1.00 . A A .  20 GLU OE2  1 1 
        2  2168 1 1  21 TRP C    C -20.958   8.081 -21.091 1.00 . A A .  21 TRP C    1 1 
        2  2169 1 1  21 TRP CA   C -21.797   8.927 -22.043 1.00 . A A .  21 TRP CA   1 1 
        2  2170 1 1  21 TRP CB   C -21.137   8.975 -23.420 1.00 . A A .  21 TRP CB   1 1 
        2  2171 1 1  21 TRP CD1  C -21.939  10.767 -25.068 1.00 . A A .  21 TRP CD1  1 1 
        2  2172 1 1  21 TRP CD2  C -23.146   8.881 -25.100 1.00 . A A .  21 TRP CD2  1 1 
        2  2173 1 1  21 TRP CE2  C -23.688   9.777 -26.044 1.00 . A A .  21 TRP CE2  1 1 
        2  2174 1 1  21 TRP CE3  C -23.742   7.626 -24.943 1.00 . A A .  21 TRP CE3  1 1 
        2  2175 1 1  21 TRP CG   C -22.029   9.534 -24.487 1.00 . A A .  21 TRP CG   1 1 
        2  2176 1 1  21 TRP CH2  C -25.358   8.222 -26.650 1.00 . A A .  21 TRP CH2  1 1 
        2  2177 1 1  21 TRP CZ2  C -24.795   9.456 -26.824 1.00 . A A .  21 TRP CZ2  1 1 
        2  2178 1 1  21 TRP CZ3  C -24.841   7.310 -25.719 1.00 . A A .  21 TRP CZ3  1 1 
        2  2179 1 1  21 TRP H    H -21.613  11.036 -22.023 1.00 . A A .  21 TRP H    1 1 
        2  2180 1 1  21 TRP HA   H -22.775   8.478 -22.137 1.00 . A A .  21 TRP HA   1 1 
        2  2181 1 1  21 TRP HB2  H -20.237   9.588 -23.357 1.00 . A A .  21 TRP HB2  1 1 
        2  2182 1 1  21 TRP HB3  H -20.856   7.974 -23.712 1.00 . A A .  21 TRP HB3  1 1 
        2  2183 1 1  21 TRP HD1  H -21.192  11.504 -24.817 1.00 . A A .  21 TRP HD1  1 1 
        2  2184 1 1  21 TRP HE1  H -23.077  11.717 -26.555 1.00 . A A .  21 TRP HE1  1 1 
        2  2185 1 1  21 TRP HE3  H -23.359   6.911 -24.231 1.00 . A A .  21 TRP HE3  1 1 
        2  2186 1 1  21 TRP HH2  H -26.218   7.933 -27.234 1.00 . A A .  21 TRP HH2  1 1 
        2  2187 1 1  21 TRP HZ2  H -25.204  10.147 -27.546 1.00 . A A .  21 TRP HZ2  1 1 
        2  2188 1 1  21 TRP HZ3  H -25.316   6.346 -25.613 1.00 . A A .  21 TRP HZ3  1 1 
        2  2189 1 1  21 TRP N    N -21.975  10.276 -21.518 1.00 . A A .  21 TRP N    1 1 
        2  2190 1 1  21 TRP NE1  N -22.933  10.920 -26.004 1.00 . A A .  21 TRP NE1  1 1 
        2  2191 1 1  21 TRP O    O -19.849   8.463 -20.720 1.00 . A A .  21 TRP O    1 1 
        2  2192 1 1  22 LEU C    C -20.274   4.802 -20.538 1.00 . A A .  22 LEU C    1 1 
        2  2193 1 1  22 LEU CA   C -20.793   6.027 -19.794 1.00 . A A .  22 LEU CA   1 1 
        2  2194 1 1  22 LEU CB   C -21.721   5.594 -18.658 1.00 . A A .  22 LEU CB   1 1 
        2  2195 1 1  22 LEU CD1  C -23.658   4.034 -18.348 1.00 . A A .  22 LEU CD1  1 1 
        2  2196 1 1  22 LEU CD2  C -24.067   6.473 -18.727 1.00 . A A .  22 LEU CD2  1 1 
        2  2197 1 1  22 LEU CG   C -23.167   5.290 -19.052 1.00 . A A .  22 LEU CG   1 1 
        2  2198 1 1  22 LEU H    H -22.382   6.679 -21.032 1.00 . A A .  22 LEU H    1 1 
        2  2199 1 1  22 LEU HA   H -19.953   6.563 -19.378 1.00 . A A .  22 LEU HA   1 1 
        2  2200 1 1  22 LEU HB2  H -21.299   4.703 -18.193 1.00 . A A .  22 LEU HB2  1 1 
        2  2201 1 1  22 LEU HB3  H -21.735   6.386 -17.924 1.00 . A A .  22 LEU HB3  1 1 
        2  2202 1 1  22 LEU HD11 H -23.011   3.206 -18.595 1.00 . A A .  22 LEU HD11 1 1 
        2  2203 1 1  22 LEU HD12 H -24.666   3.811 -18.669 1.00 . A A .  22 LEU HD12 1 1 
        2  2204 1 1  22 LEU HD13 H -23.649   4.193 -17.279 1.00 . A A .  22 LEU HD13 1 1 
        2  2205 1 1  22 LEU HD21 H -25.092   6.215 -18.948 1.00 . A A .  22 LEU HD21 1 1 
        2  2206 1 1  22 LEU HD22 H -23.772   7.324 -19.323 1.00 . A A .  22 LEU HD22 1 1 
        2  2207 1 1  22 LEU HD23 H -23.976   6.718 -17.679 1.00 . A A .  22 LEU HD23 1 1 
        2  2208 1 1  22 LEU HG   H -23.215   5.113 -20.117 1.00 . A A .  22 LEU HG   1 1 
        2  2209 1 1  22 LEU N    N -21.494   6.928 -20.702 1.00 . A A .  22 LEU N    1 1 
        2  2210 1 1  22 LEU O    O -21.046   3.924 -20.925 1.00 . A A .  22 LEU O    1 1 
        2  2211 1 1  23 TYR C    C -17.131   3.108 -20.657 1.00 . A A .  23 TYR C    1 1 
        2  2212 1 1  23 TYR CA   C -18.337   3.628 -21.431 1.00 . A A .  23 TYR CA   1 1 
        2  2213 1 1  23 TYR CB   C -17.913   4.051 -22.838 1.00 . A A .  23 TYR CB   1 1 
        2  2214 1 1  23 TYR CD1  C -16.793   6.228 -22.220 1.00 . A A .  23 TYR CD1  1 1 
        2  2215 1 1  23 TYR CD2  C -18.476   6.268 -23.907 1.00 . A A .  23 TYR CD2  1 1 
        2  2216 1 1  23 TYR CE1  C -16.618   7.593 -22.357 1.00 . A A .  23 TYR CE1  1 1 
        2  2217 1 1  23 TYR CE2  C -18.308   7.631 -24.051 1.00 . A A .  23 TYR CE2  1 1 
        2  2218 1 1  23 TYR CG   C -17.724   5.543 -22.991 1.00 . A A .  23 TYR CG   1 1 
        2  2219 1 1  23 TYR CZ   C -17.376   8.289 -23.273 1.00 . A A .  23 TYR CZ   1 1 
        2  2220 1 1  23 TYR H    H -18.397   5.477 -20.402 1.00 . A A .  23 TYR H    1 1 
        2  2221 1 1  23 TYR HA   H -19.069   2.837 -21.510 1.00 . A A .  23 TYR HA   1 1 
        2  2222 1 1  23 TYR HB2  H -16.975   3.553 -23.084 1.00 . A A .  23 TYR HB2  1 1 
        2  2223 1 1  23 TYR HB3  H -18.666   3.737 -23.545 1.00 . A A .  23 TYR HB3  1 1 
        2  2224 1 1  23 TYR HD1  H -16.200   5.679 -21.504 1.00 . A A .  23 TYR HD1  1 1 
        2  2225 1 1  23 TYR HD2  H -19.204   5.750 -24.515 1.00 . A A .  23 TYR HD2  1 1 
        2  2226 1 1  23 TYR HE1  H -15.890   8.107 -21.748 1.00 . A A .  23 TYR HE1  1 1 
        2  2227 1 1  23 TYR HE2  H -18.901   8.178 -24.768 1.00 . A A .  23 TYR HE2  1 1 
        2  2228 1 1  23 TYR HH   H -16.267   9.847 -23.465 1.00 . A A .  23 TYR HH   1 1 
        2  2229 1 1  23 TYR N    N -18.962   4.746 -20.733 1.00 . A A .  23 TYR N    1 1 
        2  2230 1 1  23 TYR O    O -16.627   3.770 -19.751 1.00 . A A .  23 TYR O    1 1 
        2  2231 1 1  23 TYR OH   O -17.205   9.648 -23.412 1.00 . A A .  23 TYR OH   1 1 
        2  2232 1 1  24 GLY C    C -14.911   0.191 -21.150 1.00 . A A .  24 GLY C    1 1 
        2  2233 1 1  24 GLY CA   C -15.526   1.324 -20.354 1.00 . A A .  24 GLY CA   1 1 
        2  2234 1 1  24 GLY H    H -17.112   1.432 -21.753 1.00 . A A .  24 GLY H    1 1 
        2  2235 1 1  24 GLY HA2  H -14.779   2.088 -20.200 1.00 . A A .  24 GLY HA2  1 1 
        2  2236 1 1  24 GLY HA3  H -15.841   0.945 -19.393 1.00 . A A .  24 GLY HA3  1 1 
        2  2237 1 1  24 GLY N    N -16.670   1.914 -21.023 1.00 . A A .  24 GLY N    1 1 
        2  2238 1 1  24 GLY O    O -13.692   0.119 -21.302 1.00 . A A .  24 GLY O    1 1 
        2  2239 1 1  25 SER C    C -14.684  -1.382 -23.762 1.00 . A A .  25 SER C    1 1 
        2  2240 1 1  25 SER CA   C -15.289  -1.841 -22.437 1.00 . A A .  25 SER CA   1 1 
        2  2241 1 1  25 SER CB   C -16.440  -2.814 -22.699 1.00 . A A .  25 SER CB   1 1 
        2  2242 1 1  25 SER H    H -16.718  -0.589 -21.502 1.00 . A A .  25 SER H    1 1 
        2  2243 1 1  25 SER HA   H -14.526  -2.345 -21.864 1.00 . A A .  25 SER HA   1 1 
        2  2244 1 1  25 SER HB2  H -16.135  -3.818 -22.406 1.00 . A A .  25 SER HB2  1 1 
        2  2245 1 1  25 SER HB3  H -17.298  -2.517 -22.113 1.00 . A A .  25 SER HB3  1 1 
        2  2246 1 1  25 SER HG   H -17.370  -3.571 -24.249 1.00 . A A .  25 SER HG   1 1 
        2  2247 1 1  25 SER N    N -15.757  -0.701 -21.658 1.00 . A A .  25 SER N    1 1 
        2  2248 1 1  25 SER O    O -15.310  -0.640 -24.518 1.00 . A A .  25 SER O    1 1 
        2  2249 1 1  25 SER OG   O -16.803  -2.817 -24.069 1.00 . A A .  25 SER OG   1 1 
        2  2250 1 1  26 CYS C    C -12.635  -2.674 -26.188 1.00 . A A .  26 CYS C    1 1 
        2  2251 1 1  26 CYS CA   C -12.772  -1.468 -25.265 1.00 . A A .  26 CYS CA   1 1 
        2  2252 1 1  26 CYS CB   C -11.390  -0.894 -24.948 1.00 . A A .  26 CYS CB   1 1 
        2  2253 1 1  26 CYS H    H -13.016  -2.420 -23.390 1.00 . A A .  26 CYS H    1 1 
        2  2254 1 1  26 CYS HA   H -13.359  -0.713 -25.765 1.00 . A A .  26 CYS HA   1 1 
        2  2255 1 1  26 CYS HB2  H -11.025  -1.353 -24.030 1.00 . A A .  26 CYS HB2  1 1 
        2  2256 1 1  26 CYS HB3  H -10.712  -1.144 -25.751 1.00 . A A .  26 CYS HB3  1 1 
        2  2257 1 1  26 CYS HG   H -11.528   1.219 -23.451 1.00 . A A .  26 CYS HG   1 1 
        2  2258 1 1  26 CYS N    N -13.464  -1.831 -24.034 1.00 . A A .  26 CYS N    1 1 
        2  2259 1 1  26 CYS O    O -12.345  -3.784 -25.739 1.00 . A A .  26 CYS O    1 1 
        2  2260 1 1  26 CYS SG   S -11.365   0.916 -24.741 1.00 . A A .  26 CYS SG   1 1 
        2  2261 1 1  27 VAL C    C -11.500  -3.351 -29.334 1.00 . A A .  27 VAL C    1 1 
        2  2262 1 1  27 VAL CA   C -12.745  -3.518 -28.468 1.00 . A A .  27 VAL CA   1 1 
        2  2263 1 1  27 VAL CB   C -13.986  -3.562 -29.378 1.00 . A A .  27 VAL CB   1 1 
        2  2264 1 1  27 VAL CG1  C -13.859  -4.677 -30.403 1.00 . A A .  27 VAL CG1  1 1 
        2  2265 1 1  27 VAL CG2  C -15.250  -3.732 -28.548 1.00 . A A .  27 VAL CG2  1 1 
        2  2266 1 1  27 VAL H    H -13.074  -1.545 -27.778 1.00 . A A .  27 VAL H    1 1 
        2  2267 1 1  27 VAL HA   H -12.680  -4.458 -27.939 1.00 . A A .  27 VAL HA   1 1 
        2  2268 1 1  27 VAL HB   H -14.053  -2.622 -29.907 1.00 . A A .  27 VAL HB   1 1 
        2  2269 1 1  27 VAL HG11 H -14.845  -5.006 -30.701 1.00 . A A .  27 VAL HG11 1 1 
        2  2270 1 1  27 VAL HG12 H -13.323  -4.315 -31.267 1.00 . A A .  27 VAL HG12 1 1 
        2  2271 1 1  27 VAL HG13 H -13.322  -5.508 -29.968 1.00 . A A .  27 VAL HG13 1 1 
        2  2272 1 1  27 VAL HG21 H -15.692  -2.765 -28.361 1.00 . A A .  27 VAL HG21 1 1 
        2  2273 1 1  27 VAL HG22 H -15.951  -4.353 -29.084 1.00 . A A .  27 VAL HG22 1 1 
        2  2274 1 1  27 VAL HG23 H -15.000  -4.200 -27.605 1.00 . A A .  27 VAL HG23 1 1 
        2  2275 1 1  27 VAL N    N -12.846  -2.450 -27.481 1.00 . A A .  27 VAL N    1 1 
        2  2276 1 1  27 VAL O    O -11.300  -2.307 -29.954 1.00 . A A .  27 VAL O    1 1 
        2  2277 1 1  28 ALA C    C  -9.703  -4.814 -31.593 1.00 . A A .  28 ALA C    1 1 
        2  2278 1 1  28 ALA CA   C  -9.444  -4.355 -30.161 1.00 . A A .  28 ALA CA   1 1 
        2  2279 1 1  28 ALA CB   C  -8.375  -5.222 -29.514 1.00 . A A .  28 ALA CB   1 1 
        2  2280 1 1  28 ALA H    H -10.883  -5.191 -28.854 1.00 . A A .  28 ALA H    1 1 
        2  2281 1 1  28 ALA HA   H  -9.085  -3.336 -30.181 1.00 . A A .  28 ALA HA   1 1 
        2  2282 1 1  28 ALA HB1  H  -8.545  -5.265 -28.448 1.00 . A A .  28 ALA HB1  1 1 
        2  2283 1 1  28 ALA HB2  H  -8.418  -6.218 -29.927 1.00 . A A .  28 ALA HB2  1 1 
        2  2284 1 1  28 ALA HB3  H  -7.402  -4.793 -29.705 1.00 . A A .  28 ALA HB3  1 1 
        2  2285 1 1  28 ALA N    N -10.668  -4.386 -29.371 1.00 . A A .  28 ALA N    1 1 
        2  2286 1 1  28 ALA O    O -10.610  -5.607 -31.844 1.00 . A A .  28 ALA O    1 1 
        2  2287 1 1  29 ASN C    C  -7.692  -4.994 -34.552 1.00 . A A .  29 ASN C    1 1 
        2  2288 1 1  29 ASN CA   C  -9.047  -4.668 -33.931 1.00 . A A .  29 ASN CA   1 1 
        2  2289 1 1  29 ASN CB   C  -9.712  -3.528 -34.704 1.00 . A A .  29 ASN CB   1 1 
        2  2290 1 1  29 ASN CG   C -10.583  -4.030 -35.840 1.00 . A A .  29 ASN CG   1 1 
        2  2291 1 1  29 ASN H    H  -8.198  -3.683 -32.262 1.00 . A A .  29 ASN H    1 1 
        2  2292 1 1  29 ASN HA   H  -9.676  -5.544 -33.988 1.00 . A A .  29 ASN HA   1 1 
        2  2293 1 1  29 ASN HB2  H -10.329  -2.948 -34.016 1.00 . A A .  29 ASN HB2  1 1 
        2  2294 1 1  29 ASN HB3  H  -8.950  -2.885 -35.116 1.00 . A A .  29 ASN HB3  1 1 
        2  2295 1 1  29 ASN HD21 H  -8.986  -4.757 -36.774 1.00 . A A .  29 ASN HD21 1 1 
        2  2296 1 1  29 ASN HD22 H -10.497  -4.989 -37.579 1.00 . A A .  29 ASN HD22 1 1 
        2  2297 1 1  29 ASN N    N  -8.902  -4.310 -32.525 1.00 . A A .  29 ASN N    1 1 
        2  2298 1 1  29 ASN ND2  N  -9.960  -4.656 -36.831 1.00 . A A .  29 ASN ND2  1 1 
        2  2299 1 1  29 ASN O    O  -7.325  -4.447 -35.591 1.00 . A A .  29 ASN O    1 1 
        2  2300 1 1  29 ASN OD1  O -11.803  -3.856 -35.827 1.00 . A A .  29 ASN OD1  1 1 
        2  2301 1 1  30 ASN C    C  -5.256  -7.668 -33.866 1.00 . A A .  30 ASN C    1 1 
        2  2302 1 1  30 ASN CA   C  -5.636  -6.289 -34.395 1.00 . A A .  30 ASN CA   1 1 
        2  2303 1 1  30 ASN CB   C  -4.582  -5.261 -33.980 1.00 . A A .  30 ASN CB   1 1 
        2  2304 1 1  30 ASN CG   C  -3.672  -4.870 -35.129 1.00 . A A .  30 ASN CG   1 1 
        2  2305 1 1  30 ASN H    H  -7.297  -6.292 -33.083 1.00 . A A .  30 ASN H    1 1 
        2  2306 1 1  30 ASN HA   H  -5.682  -6.330 -35.473 1.00 . A A .  30 ASN HA   1 1 
        2  2307 1 1  30 ASN HB2  H  -5.085  -4.368 -33.609 1.00 . A A .  30 ASN HB2  1 1 
        2  2308 1 1  30 ASN HB3  H  -3.975  -5.674 -33.190 1.00 . A A .  30 ASN HB3  1 1 
        2  2309 1 1  30 ASN HD21 H  -2.083  -4.970 -33.938 1.00 . A A .  30 ASN HD21 1 1 
        2  2310 1 1  30 ASN HD22 H  -1.766  -4.529 -35.577 1.00 . A A .  30 ASN HD22 1 1 
        2  2311 1 1  30 ASN N    N  -6.952  -5.890 -33.907 1.00 . A A .  30 ASN N    1 1 
        2  2312 1 1  30 ASN ND2  N  -2.377  -4.781 -34.853 1.00 . A A .  30 ASN ND2  1 1 
        2  2313 1 1  30 ASN O    O  -4.087  -7.938 -33.592 1.00 . A A .  30 ASN O    1 1 
        2  2314 1 1  30 ASN OD1  O  -4.129  -4.651 -36.251 1.00 . A A .  30 ASN OD1  1 1 
        2  2315 1 1  31 GLY C    C  -6.628 -10.120 -31.869 1.00 . A A .  31 GLY C    1 1 
        2  2316 1 1  31 GLY CA   C  -5.999  -9.878 -33.227 1.00 . A A .  31 GLY CA   1 1 
        2  2317 1 1  31 GLY H    H  -7.162  -8.267 -33.957 1.00 . A A .  31 GLY H    1 1 
        2  2318 1 1  31 GLY HA2  H  -6.400 -10.592 -33.931 1.00 . A A .  31 GLY HA2  1 1 
        2  2319 1 1  31 GLY HA3  H  -4.932 -10.026 -33.148 1.00 . A A .  31 GLY HA3  1 1 
        2  2320 1 1  31 GLY N    N  -6.250  -8.538 -33.723 1.00 . A A .  31 GLY N    1 1 
        2  2321 1 1  31 GLY O    O  -7.649 -10.800 -31.762 1.00 . A A .  31 GLY O    1 1 
        2  2322 1 1  32 ASP C    C  -6.499  -8.399 -28.721 1.00 . A A .  32 ASP C    1 1 
        2  2323 1 1  32 ASP CA   C  -6.521  -9.728 -29.469 1.00 . A A .  32 ASP CA   1 1 
        2  2324 1 1  32 ASP CB   C  -5.692 -10.767 -28.714 1.00 . A A .  32 ASP CB   1 1 
        2  2325 1 1  32 ASP CG   C  -5.870 -10.668 -27.212 1.00 . A A .  32 ASP CG   1 1 
        2  2326 1 1  32 ASP H    H  -5.204  -9.036 -30.977 1.00 . A A .  32 ASP H    1 1 
        2  2327 1 1  32 ASP HA   H  -7.542 -10.074 -29.535 1.00 . A A .  32 ASP HA   1 1 
        2  2328 1 1  32 ASP HB2  H  -5.991 -11.763 -29.040 1.00 . A A .  32 ASP HB2  1 1 
        2  2329 1 1  32 ASP HB3  H  -4.647 -10.621 -28.945 1.00 . A A .  32 ASP HB3  1 1 
        2  2330 1 1  32 ASP N    N  -6.016  -9.567 -30.828 1.00 . A A .  32 ASP N    1 1 
        2  2331 1 1  32 ASP O    O  -7.520  -7.954 -28.195 1.00 . A A .  32 ASP O    1 1 
        2  2332 1 1  32 ASP OD1  O  -7.011 -10.846 -26.736 1.00 . A A .  32 ASP OD1  1 1 
        2  2333 1 1  32 ASP OD2  O  -4.868 -10.414 -26.511 1.00 . A A .  32 ASP OD2  1 1 
        2  2334 1 1  33 CYS C    C  -4.451  -5.483 -28.879 1.00 . A A .  33 CYS C    1 1 
        2  2335 1 1  33 CYS CA   C  -5.173  -6.492 -27.990 1.00 . A A .  33 CYS CA   1 1 
        2  2336 1 1  33 CYS CB   C  -4.402  -6.683 -26.683 1.00 . A A .  33 CYS CB   1 1 
        2  2337 1 1  33 CYS H    H  -4.552  -8.175 -29.114 1.00 . A A .  33 CYS H    1 1 
        2  2338 1 1  33 CYS HA   H  -6.158  -6.115 -27.764 1.00 . A A .  33 CYS HA   1 1 
        2  2339 1 1  33 CYS HB2  H  -4.125  -5.702 -26.296 1.00 . A A .  33 CYS HB2  1 1 
        2  2340 1 1  33 CYS HB3  H  -5.042  -7.169 -25.963 1.00 . A A .  33 CYS HB3  1 1 
        2  2341 1 1  33 CYS HG   H  -3.201  -8.874 -27.383 1.00 . A A .  33 CYS HG   1 1 
        2  2342 1 1  33 CYS N    N  -5.330  -7.770 -28.676 1.00 . A A .  33 CYS N    1 1 
        2  2343 1 1  33 CYS O    O  -3.623  -5.853 -29.711 1.00 . A A .  33 CYS O    1 1 
        2  2344 1 1  33 CYS SG   S  -2.891  -7.688 -26.851 1.00 . A A .  33 CYS SG   1 1 
        2  2345 1 1  34 GLY C    C  -5.065  -1.984 -29.725 1.00 . A A .  34 GLY C    1 1 
        2  2346 1 1  34 GLY CA   C  -4.144  -3.164 -29.486 1.00 . A A .  34 GLY CA   1 1 
        2  2347 1 1  34 GLY H    H  -5.437  -3.971 -28.016 1.00 . A A .  34 GLY H    1 1 
        2  2348 1 1  34 GLY HA2  H  -3.260  -2.818 -28.970 1.00 . A A .  34 GLY HA2  1 1 
        2  2349 1 1  34 GLY HA3  H  -3.852  -3.577 -30.440 1.00 . A A .  34 GLY HA3  1 1 
        2  2350 1 1  34 GLY N    N  -4.771  -4.207 -28.694 1.00 . A A .  34 GLY N    1 1 
        2  2351 1 1  34 GLY O    O  -6.261  -2.055 -29.438 1.00 . A A .  34 GLY O    1 1 
        2  2352 1 1  35 GLN C    C  -6.553  -0.037 -31.307 1.00 . A A .  35 GLN C    1 1 
        2  2353 1 1  35 GLN CA   C  -5.289   0.303 -30.524 1.00 . A A .  35 GLN CA   1 1 
        2  2354 1 1  35 GLN CB   C  -4.449   1.316 -31.305 1.00 . A A .  35 GLN CB   1 1 
        2  2355 1 1  35 GLN CD   C  -5.544   3.558 -31.697 1.00 . A A .  35 GLN CD   1 1 
        2  2356 1 1  35 GLN CG   C  -4.613   2.746 -30.818 1.00 . A A .  35 GLN CG   1 1 
        2  2357 1 1  35 GLN H    H  -3.551  -0.902 -30.457 1.00 . A A .  35 GLN H    1 1 
        2  2358 1 1  35 GLN HA   H  -5.573   0.737 -29.579 1.00 . A A .  35 GLN HA   1 1 
        2  2359 1 1  35 GLN HB2  H  -3.399   1.037 -31.221 1.00 . A A .  35 GLN HB2  1 1 
        2  2360 1 1  35 GLN HB3  H  -4.735   1.278 -32.346 1.00 . A A .  35 GLN HB3  1 1 
        2  2361 1 1  35 GLN HE21 H  -4.939   5.241 -30.827 1.00 . A A .  35 GLN HE21 1 1 
        2  2362 1 1  35 GLN HE22 H  -6.129   5.423 -32.066 1.00 . A A .  35 GLN HE22 1 1 
        2  2363 1 1  35 GLN HG2  H  -5.010   2.731 -29.803 1.00 . A A .  35 GLN HG2  1 1 
        2  2364 1 1  35 GLN HG3  H  -3.644   3.223 -30.808 1.00 . A A .  35 GLN HG3  1 1 
        2  2365 1 1  35 GLN N    N  -4.509  -0.898 -30.250 1.00 . A A .  35 GLN N    1 1 
        2  2366 1 1  35 GLN NE2  N  -5.538   4.873 -31.511 1.00 . A A .  35 GLN NE2  1 1 
        2  2367 1 1  35 GLN O    O  -6.521  -0.840 -32.239 1.00 . A A .  35 GLN O    1 1 
        2  2368 1 1  35 GLN OE1  O  -6.262   3.010 -32.534 1.00 . A A .  35 GLN OE1  1 1 
        2  2369 1 1  36 GLY C    C  -9.989   1.350 -31.241 1.00 . A A .  36 GLY C    1 1 
        2  2370 1 1  36 GLY CA   C  -8.926   0.328 -31.598 1.00 . A A .  36 GLY CA   1 1 
        2  2371 1 1  36 GLY H    H  -7.631   1.210 -30.172 1.00 . A A .  36 GLY H    1 1 
        2  2372 1 1  36 GLY HA2  H  -8.760   0.353 -32.665 1.00 . A A .  36 GLY HA2  1 1 
        2  2373 1 1  36 GLY HA3  H  -9.279  -0.653 -31.322 1.00 . A A .  36 GLY HA3  1 1 
        2  2374 1 1  36 GLY N    N  -7.666   0.580 -30.922 1.00 . A A .  36 GLY N    1 1 
        2  2375 1 1  36 GLY O    O  -9.734   2.554 -31.265 1.00 . A A .  36 GLY O    1 1 
        2  2376 1 1  37 MET C    C -13.135   1.129 -29.444 1.00 . A A .  37 MET C    1 1 
        2  2377 1 1  37 MET CA   C -12.288   1.748 -30.551 1.00 . A A .  37 MET CA   1 1 
        2  2378 1 1  37 MET CB   C -13.158   2.038 -31.774 1.00 . A A .  37 MET CB   1 1 
        2  2379 1 1  37 MET CE   C -15.564  -0.589 -33.944 1.00 . A A .  37 MET CE   1 1 
        2  2380 1 1  37 MET CG   C -13.659   0.786 -32.475 1.00 . A A .  37 MET CG   1 1 
        2  2381 1 1  37 MET H    H -11.324  -0.101 -30.912 1.00 . A A .  37 MET H    1 1 
        2  2382 1 1  37 MET HA   H -11.869   2.675 -30.190 1.00 . A A .  37 MET HA   1 1 
        2  2383 1 1  37 MET HB2  H -14.017   2.631 -31.459 1.00 . A A .  37 MET HB2  1 1 
        2  2384 1 1  37 MET HB3  H -12.582   2.614 -32.484 1.00 . A A .  37 MET HB3  1 1 
        2  2385 1 1  37 MET HE1  H -15.382  -0.695 -35.003 1.00 . A A .  37 MET HE1  1 1 
        2  2386 1 1  37 MET HE2  H -14.950  -1.293 -33.401 1.00 . A A .  37 MET HE2  1 1 
        2  2387 1 1  37 MET HE3  H -16.606  -0.786 -33.737 1.00 . A A .  37 MET HE3  1 1 
        2  2388 1 1  37 MET HG2  H -12.881   0.419 -33.143 1.00 . A A .  37 MET HG2  1 1 
        2  2389 1 1  37 MET HG3  H -13.866   0.032 -31.729 1.00 . A A .  37 MET HG3  1 1 
        2  2390 1 1  37 MET N    N -11.182   0.867 -30.913 1.00 . A A .  37 MET N    1 1 
        2  2391 1 1  37 MET O    O -12.919  -0.018 -29.052 1.00 . A A .  37 MET O    1 1 
        2  2392 1 1  37 MET SD   S -15.161   1.078 -33.431 1.00 . A A .  37 MET SD   1 1 
        2  2393 1 1  38 ARG C    C -16.412   1.891 -28.114 1.00 . A A .  38 ARG C    1 1 
        2  2394 1 1  38 ARG CA   C -14.979   1.421 -27.883 1.00 . A A .  38 ARG CA   1 1 
        2  2395 1 1  38 ARG CB   C -14.482   1.914 -26.522 1.00 . A A .  38 ARG CB   1 1 
        2  2396 1 1  38 ARG CD   C -15.023   2.203 -24.085 1.00 . A A .  38 ARG CD   1 1 
        2  2397 1 1  38 ARG CG   C -15.586   2.074 -25.491 1.00 . A A .  38 ARG CG   1 1 
        2  2398 1 1  38 ARG CZ   C -13.711   3.864 -22.833 1.00 . A A .  38 ARG CZ   1 1 
        2  2399 1 1  38 ARG H    H -14.223   2.800 -29.300 1.00 . A A .  38 ARG H    1 1 
        2  2400 1 1  38 ARG HA   H -14.961   0.342 -27.894 1.00 . A A .  38 ARG HA   1 1 
        2  2401 1 1  38 ARG HB2  H -13.749   1.203 -26.140 1.00 . A A .  38 ARG HB2  1 1 
        2  2402 1 1  38 ARG HB3  H -13.999   2.871 -26.654 1.00 . A A .  38 ARG HB3  1 1 
        2  2403 1 1  38 ARG HD2  H -15.794   1.928 -23.366 1.00 . A A .  38 ARG HD2  1 1 
        2  2404 1 1  38 ARG HD3  H -14.188   1.527 -23.984 1.00 . A A .  38 ARG HD3  1 1 
        2  2405 1 1  38 ARG HE   H -14.924   4.285 -24.360 1.00 . A A .  38 ARG HE   1 1 
        2  2406 1 1  38 ARG HG2  H -16.168   2.965 -25.726 1.00 . A A .  38 ARG HG2  1 1 
        2  2407 1 1  38 ARG HG3  H -16.233   1.209 -25.533 1.00 . A A .  38 ARG HG3  1 1 
        2  2408 1 1  38 ARG HH11 H -13.488   1.957 -22.207 1.00 . A A .  38 ARG HH11 1 1 
        2  2409 1 1  38 ARG HH12 H -12.569   3.137 -21.334 1.00 . A A .  38 ARG HH12 1 1 
        2  2410 1 1  38 ARG HH21 H -13.718   5.848 -23.216 1.00 . A A .  38 ARG HH21 1 1 
        2  2411 1 1  38 ARG HH22 H -12.702   5.350 -21.909 1.00 . A A .  38 ARG HH22 1 1 
        2  2412 1 1  38 ARG N    N -14.100   1.894 -28.945 1.00 . A A .  38 ARG N    1 1 
        2  2413 1 1  38 ARG NE   N -14.570   3.563 -23.802 1.00 . A A .  38 ARG NE   1 1 
        2  2414 1 1  38 ARG NH1  N -13.216   2.907 -22.062 1.00 . A A .  38 ARG NH1  1 1 
        2  2415 1 1  38 ARG NH2  N -13.347   5.124 -22.637 1.00 . A A .  38 ARG NH2  1 1 
        2  2416 1 1  38 ARG O    O -16.642   2.991 -28.615 1.00 . A A .  38 ARG O    1 1 
        2  2417 1 1  39 GLU C    C -19.469   1.541 -26.557 1.00 . A A .  39 GLU C    1 1 
        2  2418 1 1  39 GLU CA   C -18.783   1.380 -27.911 1.00 . A A .  39 GLU CA   1 1 
        2  2419 1 1  39 GLU CB   C -19.489   0.296 -28.728 1.00 . A A .  39 GLU CB   1 1 
        2  2420 1 1  39 GLU CD   C -21.271   0.741 -30.461 1.00 . A A .  39 GLU CD   1 1 
        2  2421 1 1  39 GLU CG   C -19.785   0.708 -30.158 1.00 . A A .  39 GLU CG   1 1 
        2  2422 1 1  39 GLU H    H -17.128   0.187 -27.348 1.00 . A A .  39 GLU H    1 1 
        2  2423 1 1  39 GLU HA   H -18.844   2.316 -28.445 1.00 . A A .  39 GLU HA   1 1 
        2  2424 1 1  39 GLU HB2  H -18.861  -0.595 -28.743 1.00 . A A .  39 GLU HB2  1 1 
        2  2425 1 1  39 GLU HB3  H -20.425   0.052 -28.245 1.00 . A A .  39 GLU HB3  1 1 
        2  2426 1 1  39 GLU HG2  H -19.367   1.699 -30.334 1.00 . A A .  39 GLU HG2  1 1 
        2  2427 1 1  39 GLU HG3  H -19.312   0.004 -30.828 1.00 . A A .  39 GLU HG3  1 1 
        2  2428 1 1  39 GLU N    N -17.372   1.050 -27.742 1.00 . A A .  39 GLU N    1 1 
        2  2429 1 1  39 GLU O    O -19.558   0.593 -25.778 1.00 . A A .  39 GLU O    1 1 
        2  2430 1 1  39 GLU OE1  O -21.849  -0.338 -30.713 1.00 . A A .  39 GLU OE1  1 1 
        2  2431 1 1  39 GLU OE2  O -21.855   1.844 -30.447 1.00 . A A .  39 GLU OE2  1 1 
        2  2432 1 1  40 GLY C    C -22.133   3.035 -25.166 1.00 . A A .  40 GLY C    1 1 
        2  2433 1 1  40 GLY CA   C -20.623   3.014 -25.025 1.00 . A A .  40 GLY CA   1 1 
        2  2434 1 1  40 GLY H    H -19.852   3.468 -26.945 1.00 . A A .  40 GLY H    1 1 
        2  2435 1 1  40 GLY HA2  H -20.348   2.247 -24.317 1.00 . A A .  40 GLY HA2  1 1 
        2  2436 1 1  40 GLY HA3  H -20.295   3.971 -24.650 1.00 . A A .  40 GLY HA3  1 1 
        2  2437 1 1  40 GLY N    N -19.952   2.750 -26.285 1.00 . A A .  40 GLY N    1 1 
        2  2438 1 1  40 GLY O    O -22.662   3.444 -26.200 1.00 . A A .  40 GLY O    1 1 
        2  2439 1 1  41 THR C    C -24.863   3.369 -22.984 1.00 . A A .  41 THR C    1 1 
        2  2440 1 1  41 THR CA   C -24.286   2.557 -24.136 1.00 . A A .  41 THR CA   1 1 
        2  2441 1 1  41 THR CB   C -24.815   1.114 -24.049 1.00 . A A .  41 THR CB   1 1 
        2  2442 1 1  41 THR CG2  C -24.185   0.377 -22.876 1.00 . A A .  41 THR CG2  1 1 
        2  2443 1 1  41 THR H    H -22.349   2.277 -23.330 1.00 . A A .  41 THR H    1 1 
        2  2444 1 1  41 THR HA   H -24.620   2.985 -25.071 1.00 . A A .  41 THR HA   1 1 
        2  2445 1 1  41 THR HB   H -24.557   0.595 -24.960 1.00 . A A .  41 THR HB   1 1 
        2  2446 1 1  41 THR HG1  H -26.601   0.298 -24.239 1.00 . A A .  41 THR HG1  1 1 
        2  2447 1 1  41 THR HG21 H -24.962  -0.068 -22.273 1.00 . A A .  41 THR HG21 1 1 
        2  2448 1 1  41 THR HG22 H -23.618   1.073 -22.275 1.00 . A A .  41 THR HG22 1 1 
        2  2449 1 1  41 THR HG23 H -23.529  -0.397 -23.247 1.00 . A A .  41 THR HG23 1 1 
        2  2450 1 1  41 THR N    N -22.828   2.591 -24.124 1.00 . A A .  41 THR N    1 1 
        2  2451 1 1  41 THR O    O -24.493   3.175 -21.825 1.00 . A A .  41 THR O    1 1 
        2  2452 1 1  41 THR OG1  O -26.240   1.122 -23.903 1.00 . A A .  41 THR OG1  1 1 
        2  2453 1 1  42 CYS C    C -27.925   5.008 -22.363 1.00 . A A .  42 CYS C    1 1 
        2  2454 1 1  42 CYS CA   C -26.405   5.126 -22.299 1.00 . A A .  42 CYS CA   1 1 
        2  2455 1 1  42 CYS CB   C -25.987   6.585 -22.491 1.00 . A A .  42 CYS CB   1 1 
        2  2456 1 1  42 CYS H    H -26.029   4.392 -24.249 1.00 . A A .  42 CYS H    1 1 
        2  2457 1 1  42 CYS HA   H -26.070   4.789 -21.329 1.00 . A A .  42 CYS HA   1 1 
        2  2458 1 1  42 CYS HB2  H -24.924   6.675 -22.268 1.00 . A A .  42 CYS HB2  1 1 
        2  2459 1 1  42 CYS HB3  H -26.147   6.864 -23.521 1.00 . A A .  42 CYS HB3  1 1 
        2  2460 1 1  42 CYS HG   H -27.874   7.119 -20.793 1.00 . A A .  42 CYS HG   1 1 
        2  2461 1 1  42 CYS N    N -25.774   4.283 -23.307 1.00 . A A .  42 CYS N    1 1 
        2  2462 1 1  42 CYS O    O -28.551   5.453 -23.324 1.00 . A A .  42 CYS O    1 1 
        2  2463 1 1  42 CYS SG   S -26.903   7.764 -21.446 1.00 . A A .  42 CYS SG   1 1 
        2  2464 1 1  43 ASN C    C -30.438   3.308 -22.393 1.00 . A A .  43 ASN C    1 1 
        2  2465 1 1  43 ASN CA   C -29.956   4.226 -21.275 1.00 . A A .  43 ASN CA   1 1 
        2  2466 1 1  43 ASN CB   C -30.662   5.580 -21.371 1.00 . A A .  43 ASN CB   1 1 
        2  2467 1 1  43 ASN CG   C -31.130   6.087 -20.019 1.00 . A A .  43 ASN CG   1 1 
        2  2468 1 1  43 ASN H    H -27.956   4.070 -20.598 1.00 . A A .  43 ASN H    1 1 
        2  2469 1 1  43 ASN HA   H -30.195   3.773 -20.324 1.00 . A A .  43 ASN HA   1 1 
        2  2470 1 1  43 ASN HB2  H -29.973   6.307 -21.801 1.00 . A A .  43 ASN HB2  1 1 
        2  2471 1 1  43 ASN HB3  H -31.522   5.488 -22.017 1.00 . A A .  43 ASN HB3  1 1 
        2  2472 1 1  43 ASN HD21 H -29.356   6.927 -19.693 1.00 . A A .  43 ASN HD21 1 1 
        2  2473 1 1  43 ASN HD22 H -30.522   7.119 -18.433 1.00 . A A .  43 ASN HD22 1 1 
        2  2474 1 1  43 ASN N    N -28.510   4.404 -21.335 1.00 . A A .  43 ASN N    1 1 
        2  2475 1 1  43 ASN ND2  N -30.247   6.781 -19.310 1.00 . A A .  43 ASN ND2  1 1 
        2  2476 1 1  43 ASN O    O -30.634   2.111 -22.186 1.00 . A A .  43 ASN O    1 1 
        2  2477 1 1  43 ASN OD1  O -32.270   5.855 -19.619 1.00 . A A .  43 ASN OD1  1 1 
        2  2478 1 1  44 GLU C    C -30.451   3.628 -26.018 1.00 . A A .  44 GLU C    1 1 
        2  2479 1 1  44 GLU CA   C -31.088   3.112 -24.732 1.00 . A A .  44 GLU CA   1 1 
        2  2480 1 1  44 GLU CB   C -32.612   3.178 -24.840 1.00 . A A .  44 GLU CB   1 1 
        2  2481 1 1  44 GLU CD   C -34.759   2.609 -23.635 1.00 . A A .  44 GLU CD   1 1 
        2  2482 1 1  44 GLU CG   C -33.325   3.083 -23.501 1.00 . A A .  44 GLU CG   1 1 
        2  2483 1 1  44 GLU H    H -30.455   4.838 -23.682 1.00 . A A .  44 GLU H    1 1 
        2  2484 1 1  44 GLU HA   H -30.792   2.084 -24.584 1.00 . A A .  44 GLU HA   1 1 
        2  2485 1 1  44 GLU HB2  H -32.888   4.119 -25.315 1.00 . A A .  44 GLU HB2  1 1 
        2  2486 1 1  44 GLU HB3  H -32.953   2.363 -25.463 1.00 . A A .  44 GLU HB3  1 1 
        2  2487 1 1  44 GLU HG2  H -32.782   2.387 -22.861 1.00 . A A .  44 GLU HG2  1 1 
        2  2488 1 1  44 GLU HG3  H -33.324   4.057 -23.037 1.00 . A A .  44 GLU HG3  1 1 
        2  2489 1 1  44 GLU N    N -30.629   3.878 -23.580 1.00 . A A .  44 GLU N    1 1 
        2  2490 1 1  44 GLU O    O -31.062   3.578 -27.086 1.00 . A A .  44 GLU O    1 1 
        2  2491 1 1  44 GLU OE1  O -35.384   2.900 -24.676 1.00 . A A .  44 GLU OE1  1 1 
        2  2492 1 1  44 GLU OE2  O -35.256   1.949 -22.698 1.00 . A A .  44 GLU OE2  1 1 
        2  2493 1 1  45 GLN C    C -27.072   4.130 -27.094 1.00 . A A .  45 GLN C    1 1 
        2  2494 1 1  45 GLN CA   C -28.505   4.650 -27.061 1.00 . A A .  45 GLN CA   1 1 
        2  2495 1 1  45 GLN CB   C -28.505   6.179 -27.034 1.00 . A A .  45 GLN CB   1 1 
        2  2496 1 1  45 GLN CD   C -29.802   8.283 -26.511 1.00 . A A .  45 GLN CD   1 1 
        2  2497 1 1  45 GLN CG   C -29.864   6.783 -26.715 1.00 . A A .  45 GLN CG   1 1 
        2  2498 1 1  45 GLN H    H -28.791   4.135 -25.029 1.00 . A A .  45 GLN H    1 1 
        2  2499 1 1  45 GLN HA   H -29.017   4.315 -27.950 1.00 . A A .  45 GLN HA   1 1 
        2  2500 1 1  45 GLN HB2  H -27.790   6.515 -26.283 1.00 . A A .  45 GLN HB2  1 1 
        2  2501 1 1  45 GLN HB3  H -28.190   6.545 -28.001 1.00 . A A .  45 GLN HB3  1 1 
        2  2502 1 1  45 GLN HE21 H -30.513   8.085 -24.664 1.00 . A A .  45 GLN HE21 1 1 
        2  2503 1 1  45 GLN HE22 H -30.176   9.702 -25.168 1.00 . A A .  45 GLN HE22 1 1 
        2  2504 1 1  45 GLN HG2  H -30.547   6.567 -27.537 1.00 . A A .  45 GLN HG2  1 1 
        2  2505 1 1  45 GLN HG3  H -30.244   6.325 -25.814 1.00 . A A .  45 GLN HG3  1 1 
        2  2506 1 1  45 GLN N    N -29.224   4.124 -25.907 1.00 . A A .  45 GLN N    1 1 
        2  2507 1 1  45 GLN NE2  N -30.205   8.737 -25.329 1.00 . A A .  45 GLN NE2  1 1 
        2  2508 1 1  45 GLN O    O -26.570   3.595 -26.104 1.00 . A A .  45 GLN O    1 1 
        2  2509 1 1  45 GLN OE1  O -29.399   9.028 -27.404 1.00 . A A .  45 GLN OE1  1 1 
        2  2510 1 1  46 THR C    C -24.113   5.000 -28.736 1.00 . A A .  46 THR C    1 1 
        2  2511 1 1  46 THR CA   C -25.040   3.837 -28.402 1.00 . A A .  46 THR CA   1 1 
        2  2512 1 1  46 THR CB   C -24.928   2.771 -29.509 1.00 . A A .  46 THR CB   1 1 
        2  2513 1 1  46 THR CG2  C -25.071   1.372 -28.930 1.00 . A A .  46 THR CG2  1 1 
        2  2514 1 1  46 THR H    H -26.869   4.725 -28.992 1.00 . A A .  46 THR H    1 1 
        2  2515 1 1  46 THR HA   H -24.724   3.392 -27.470 1.00 . A A .  46 THR HA   1 1 
        2  2516 1 1  46 THR HB   H -23.955   2.856 -29.971 1.00 . A A .  46 THR HB   1 1 
        2  2517 1 1  46 THR HG1  H -25.522   3.103 -31.360 1.00 . A A .  46 THR HG1  1 1 
        2  2518 1 1  46 THR HG21 H -26.088   1.223 -28.598 1.00 . A A .  46 THR HG21 1 1 
        2  2519 1 1  46 THR HG22 H -24.398   1.258 -28.093 1.00 . A A .  46 THR HG22 1 1 
        2  2520 1 1  46 THR HG23 H -24.831   0.642 -29.688 1.00 . A A .  46 THR HG23 1 1 
        2  2521 1 1  46 THR N    N -26.415   4.291 -28.239 1.00 . A A .  46 THR N    1 1 
        2  2522 1 1  46 THR O    O -24.561   6.054 -29.184 1.00 . A A .  46 THR O    1 1 
        2  2523 1 1  46 THR OG1  O -25.937   2.988 -30.502 1.00 . A A .  46 THR OG1  1 1 
        2  2524 1 1  47 ARG C    C -20.509   5.214 -29.245 1.00 . A A .  47 ARG C    1 1 
        2  2525 1 1  47 ARG CA   C -21.826   5.833 -28.791 1.00 . A A .  47 ARG CA   1 1 
        2  2526 1 1  47 ARG CB   C -21.597   6.694 -27.549 1.00 . A A .  47 ARG CB   1 1 
        2  2527 1 1  47 ARG CD   C -21.445   8.804 -28.906 1.00 . A A .  47 ARG CD   1 1 
        2  2528 1 1  47 ARG CG   C -20.796   7.957 -27.823 1.00 . A A .  47 ARG CG   1 1 
        2  2529 1 1  47 ARG CZ   C -21.522  11.170 -29.572 1.00 . A A .  47 ARG CZ   1 1 
        2  2530 1 1  47 ARG H    H -22.521   3.937 -28.156 1.00 . A A .  47 ARG H    1 1 
        2  2531 1 1  47 ARG HA   H -22.211   6.456 -29.585 1.00 . A A .  47 ARG HA   1 1 
        2  2532 1 1  47 ARG HB2  H -22.566   6.977 -27.137 1.00 . A A .  47 ARG HB2  1 1 
        2  2533 1 1  47 ARG HB3  H -21.066   6.110 -26.813 1.00 . A A .  47 ARG HB3  1 1 
        2  2534 1 1  47 ARG HD2  H -21.005   8.546 -29.869 1.00 . A A .  47 ARG HD2  1 1 
        2  2535 1 1  47 ARG HD3  H -22.502   8.585 -28.931 1.00 . A A .  47 ARG HD3  1 1 
        2  2536 1 1  47 ARG HE   H -20.929  10.507 -27.788 1.00 . A A .  47 ARG HE   1 1 
        2  2537 1 1  47 ARG HG2  H -20.727   8.542 -26.905 1.00 . A A .  47 ARG HG2  1 1 
        2  2538 1 1  47 ARG HG3  H -19.802   7.678 -28.141 1.00 . A A .  47 ARG HG3  1 1 
        2  2539 1 1  47 ARG HH11 H -22.120   9.866 -30.994 1.00 . A A .  47 ARG HH11 1 1 
        2  2540 1 1  47 ARG HH12 H -22.171  11.537 -31.451 1.00 . A A .  47 ARG HH12 1 1 
        2  2541 1 1  47 ARG HH21 H -20.990  12.711 -28.375 1.00 . A A .  47 ARG HH21 1 1 
        2  2542 1 1  47 ARG HH22 H -21.527  13.153 -29.961 1.00 . A A .  47 ARG HH22 1 1 
        2  2543 1 1  47 ARG N    N -22.818   4.800 -28.514 1.00 . A A .  47 ARG N    1 1 
        2  2544 1 1  47 ARG NE   N -21.262  10.234 -28.667 1.00 . A A .  47 ARG NE   1 1 
        2  2545 1 1  47 ARG NH1  N -21.974  10.829 -30.771 1.00 . A A .  47 ARG NH1  1 1 
        2  2546 1 1  47 ARG NH2  N -21.330  12.449 -29.279 1.00 . A A .  47 ARG NH2  1 1 
        2  2547 1 1  47 ARG O    O -20.250   4.034 -29.011 1.00 . A A .  47 ARG O    1 1 
        2  2548 1 1  48 LYS C    C -17.253   6.420 -29.845 1.00 . A A .  48 LYS C    1 1 
        2  2549 1 1  48 LYS CA   C -18.384   5.553 -30.385 1.00 . A A .  48 LYS CA   1 1 
        2  2550 1 1  48 LYS CB   C -18.360   5.560 -31.915 1.00 . A A .  48 LYS CB   1 1 
        2  2551 1 1  48 LYS CD   C -19.180   4.509 -34.045 1.00 . A A .  48 LYS CD   1 1 
        2  2552 1 1  48 LYS CE   C -20.020   3.393 -34.646 1.00 . A A .  48 LYS CE   1 1 
        2  2553 1 1  48 LYS CG   C -19.039   4.353 -32.540 1.00 . A A .  48 LYS CG   1 1 
        2  2554 1 1  48 LYS H    H -19.939   6.951 -30.055 1.00 . A A .  48 LYS H    1 1 
        2  2555 1 1  48 LYS HA   H -18.244   4.540 -30.036 1.00 . A A .  48 LYS HA   1 1 
        2  2556 1 1  48 LYS HB2  H -18.857   6.463 -32.268 1.00 . A A .  48 LYS HB2  1 1 
        2  2557 1 1  48 LYS HB3  H -17.331   5.578 -32.247 1.00 . A A .  48 LYS HB3  1 1 
        2  2558 1 1  48 LYS HD2  H -19.652   5.468 -34.262 1.00 . A A .  48 LYS HD2  1 1 
        2  2559 1 1  48 LYS HD3  H -18.196   4.489 -34.493 1.00 . A A .  48 LYS HD3  1 1 
        2  2560 1 1  48 LYS HE2  H -19.370   2.720 -35.206 1.00 . A A .  48 LYS HE2  1 1 
        2  2561 1 1  48 LYS HE3  H -20.490   2.842 -33.843 1.00 . A A .  48 LYS HE3  1 1 
        2  2562 1 1  48 LYS HG2  H -18.450   3.461 -32.328 1.00 . A A .  48 LYS HG2  1 1 
        2  2563 1 1  48 LYS HG3  H -20.022   4.239 -32.105 1.00 . A A .  48 LYS HG3  1 1 
        2  2564 1 1  48 LYS HZ1  H -21.642   4.641 -35.063 1.00 . A A .  48 LYS HZ1  1 1 
        2  2565 1 1  48 LYS HZ2  H -21.703   3.149 -35.859 1.00 . A A .  48 LYS HZ2  1 1 
        2  2566 1 1  48 LYS HZ3  H -20.640   4.351 -36.396 1.00 . A A .  48 LYS HZ3  1 1 
        2  2567 1 1  48 LYS N    N -19.676   6.019 -29.898 1.00 . A A .  48 LYS N    1 1 
        2  2568 1 1  48 LYS NZ   N -21.075   3.920 -35.555 1.00 . A A .  48 LYS NZ   1 1 
        2  2569 1 1  48 LYS O    O -17.389   7.639 -29.736 1.00 . A A .  48 LYS O    1 1 
        2  2570 1 1  49 VAL C    C -13.681   5.786 -29.336 1.00 . A A .  49 VAL C    1 1 
        2  2571 1 1  49 VAL CA   C -14.979   6.501 -28.979 1.00 . A A .  49 VAL CA   1 1 
        2  2572 1 1  49 VAL CB   C -15.064   6.654 -27.448 1.00 . A A .  49 VAL CB   1 1 
        2  2573 1 1  49 VAL CG1  C -16.294   7.459 -27.060 1.00 . A A .  49 VAL CG1  1 1 
        2  2574 1 1  49 VAL CG2  C -15.076   5.289 -26.777 1.00 . A A .  49 VAL CG2  1 1 
        2  2575 1 1  49 VAL H    H -16.086   4.813 -29.614 1.00 . A A .  49 VAL H    1 1 
        2  2576 1 1  49 VAL HA   H -14.968   7.487 -29.418 1.00 . A A .  49 VAL HA   1 1 
        2  2577 1 1  49 VAL HB   H -14.188   7.189 -27.112 1.00 . A A .  49 VAL HB   1 1 
        2  2578 1 1  49 VAL HG11 H -16.407   8.293 -27.736 1.00 . A A .  49 VAL HG11 1 1 
        2  2579 1 1  49 VAL HG12 H -17.169   6.828 -27.114 1.00 . A A .  49 VAL HG12 1 1 
        2  2580 1 1  49 VAL HG13 H -16.178   7.828 -26.052 1.00 . A A .  49 VAL HG13 1 1 
        2  2581 1 1  49 VAL HG21 H -15.282   4.526 -27.513 1.00 . A A .  49 VAL HG21 1 1 
        2  2582 1 1  49 VAL HG22 H -14.114   5.102 -26.325 1.00 . A A .  49 VAL HG22 1 1 
        2  2583 1 1  49 VAL HG23 H -15.840   5.268 -26.014 1.00 . A A .  49 VAL HG23 1 1 
        2  2584 1 1  49 VAL N    N -16.135   5.785 -29.506 1.00 . A A .  49 VAL N    1 1 
        2  2585 1 1  49 VAL O    O -13.622   4.556 -29.364 1.00 . A A .  49 VAL O    1 1 
        2  2586 1 1  50 LYS C    C -10.546   5.637 -28.713 1.00 . A A .  50 LYS C    1 1 
        2  2587 1 1  50 LYS CA   C -11.339   6.006 -29.962 1.00 . A A .  50 LYS CA   1 1 
        2  2588 1 1  50 LYS CB   C -10.544   7.008 -30.805 1.00 . A A .  50 LYS CB   1 1 
        2  2589 1 1  50 LYS CD   C -10.324   6.203 -33.175 1.00 . A A .  50 LYS CD   1 1 
        2  2590 1 1  50 LYS CE   C -11.087   6.021 -34.478 1.00 . A A .  50 LYS CE   1 1 
        2  2591 1 1  50 LYS CG   C -11.054   7.144 -32.229 1.00 . A A .  50 LYS CG   1 1 
        2  2592 1 1  50 LYS H    H -12.747   7.538 -29.569 1.00 . A A .  50 LYS H    1 1 
        2  2593 1 1  50 LYS HA   H -11.508   5.114 -30.544 1.00 . A A .  50 LYS HA   1 1 
        2  2594 1 1  50 LYS HB2  H -10.590   7.984 -30.323 1.00 . A A .  50 LYS HB2  1 1 
        2  2595 1 1  50 LYS HB3  H  -9.513   6.689 -30.843 1.00 . A A .  50 LYS HB3  1 1 
        2  2596 1 1  50 LYS HD2  H  -9.337   6.611 -33.393 1.00 . A A .  50 LYS HD2  1 1 
        2  2597 1 1  50 LYS HD3  H -10.212   5.241 -32.696 1.00 . A A .  50 LYS HD3  1 1 
        2  2598 1 1  50 LYS HE2  H -10.468   5.461 -35.178 1.00 . A A .  50 LYS HE2  1 1 
        2  2599 1 1  50 LYS HE3  H -11.988   5.460 -34.277 1.00 . A A .  50 LYS HE3  1 1 
        2  2600 1 1  50 LYS HG2  H -12.120   6.916 -32.250 1.00 . A A .  50 LYS HG2  1 1 
        2  2601 1 1  50 LYS HG3  H -10.903   8.161 -32.560 1.00 . A A .  50 LYS HG3  1 1 
        2  2602 1 1  50 LYS HZ1  H -10.875   8.089 -34.687 1.00 . A A .  50 LYS HZ1  1 1 
        2  2603 1 1  50 LYS HZ2  H -12.458   7.535 -34.913 1.00 . A A .  50 LYS HZ2  1 1 
        2  2604 1 1  50 LYS HZ3  H -11.298   7.295 -36.120 1.00 . A A .  50 LYS HZ3  1 1 
        2  2605 1 1  50 LYS N    N -12.639   6.564 -29.608 1.00 . A A .  50 LYS N    1 1 
        2  2606 1 1  50 LYS NZ   N -11.456   7.327 -35.092 1.00 . A A .  50 LYS NZ   1 1 
        2  2607 1 1  50 LYS O    O -10.221   6.498 -27.895 1.00 . A A .  50 LYS O    1 1 
        2  2608 1 1  51 CYS C    C  -8.497   2.780 -27.839 1.00 . A A .  51 CYS C    1 1 
        2  2609 1 1  51 CYS CA   C  -9.484   3.867 -27.423 1.00 . A A .  51 CYS CA   1 1 
        2  2610 1 1  51 CYS CB   C -10.434   3.327 -26.353 1.00 . A A .  51 CYS CB   1 1 
        2  2611 1 1  51 CYS H    H -10.527   3.712 -29.258 1.00 . A A .  51 CYS H    1 1 
        2  2612 1 1  51 CYS HA   H  -8.931   4.700 -27.014 1.00 . A A .  51 CYS HA   1 1 
        2  2613 1 1  51 CYS HB2  H  -9.906   3.301 -25.399 1.00 . A A .  51 CYS HB2  1 1 
        2  2614 1 1  51 CYS HB3  H -11.278   3.995 -26.261 1.00 . A A .  51 CYS HB3  1 1 
        2  2615 1 1  51 CYS HG   H -11.154   1.482 -28.028 1.00 . A A .  51 CYS HG   1 1 
        2  2616 1 1  51 CYS N    N -10.238   4.351 -28.571 1.00 . A A .  51 CYS N    1 1 
        2  2617 1 1  51 CYS O    O  -8.514   2.316 -28.980 1.00 . A A .  51 CYS O    1 1 
        2  2618 1 1  51 CYS SG   S -11.081   1.661 -26.706 1.00 . A A .  51 CYS SG   1 1 
        2  2619 1 1  52 ARG C    C  -6.650   0.287 -26.078 1.00 . A A .  52 ARG C    1 1 
        2  2620 1 1  52 ARG CA   C  -6.646   1.346 -27.176 1.00 . A A .  52 ARG CA   1 1 
        2  2621 1 1  52 ARG CB   C  -5.253   1.968 -27.294 1.00 . A A .  52 ARG CB   1 1 
        2  2622 1 1  52 ARG CD   C  -5.344   3.188 -25.099 1.00 . A A .  52 ARG CD   1 1 
        2  2623 1 1  52 ARG CG   C  -4.573   2.196 -25.953 1.00 . A A .  52 ARG CG   1 1 
        2  2624 1 1  52 ARG CZ   C  -4.841   4.851 -23.359 1.00 . A A .  52 ARG CZ   1 1 
        2  2625 1 1  52 ARG H    H  -7.677   2.786 -26.016 1.00 . A A .  52 ARG H    1 1 
        2  2626 1 1  52 ARG HA   H  -6.902   0.877 -28.114 1.00 . A A .  52 ARG HA   1 1 
        2  2627 1 1  52 ARG HB2  H  -4.627   1.310 -27.897 1.00 . A A .  52 ARG HB2  1 1 
        2  2628 1 1  52 ARG HB3  H  -5.339   2.920 -27.795 1.00 . A A .  52 ARG HB3  1 1 
        2  2629 1 1  52 ARG HD2  H  -6.013   3.763 -25.739 1.00 . A A .  52 ARG HD2  1 1 
        2  2630 1 1  52 ARG HD3  H  -5.932   2.641 -24.376 1.00 . A A .  52 ARG HD3  1 1 
        2  2631 1 1  52 ARG HE   H  -3.530   4.170 -24.699 1.00 . A A .  52 ARG HE   1 1 
        2  2632 1 1  52 ARG HG2  H  -4.502   1.246 -25.422 1.00 . A A .  52 ARG HG2  1 1 
        2  2633 1 1  52 ARG HG3  H  -3.578   2.579 -26.126 1.00 . A A .  52 ARG HG3  1 1 
        2  2634 1 1  52 ARG HH11 H  -6.744   4.174 -23.362 1.00 . A A .  52 ARG HH11 1 1 
        2  2635 1 1  52 ARG HH12 H  -6.376   5.347 -22.141 1.00 . A A .  52 ARG HH12 1 1 
        2  2636 1 1  52 ARG HH21 H  -3.032   5.714 -23.096 1.00 . A A .  52 ARG HH21 1 1 
        2  2637 1 1  52 ARG HH22 H  -4.264   6.223 -21.990 1.00 . A A .  52 ARG HH22 1 1 
        2  2638 1 1  52 ARG N    N  -7.640   2.378 -26.906 1.00 . A A .  52 ARG N    1 1 
        2  2639 1 1  52 ARG NE   N  -4.457   4.106 -24.391 1.00 . A A .  52 ARG NE   1 1 
        2  2640 1 1  52 ARG NH1  N  -6.090   4.785 -22.918 1.00 . A A .  52 ARG NH1  1 1 
        2  2641 1 1  52 ARG NH2  N  -3.975   5.663 -22.767 1.00 . A A .  52 ARG NH2  1 1 
        2  2642 1 1  52 ARG O    O  -6.816   0.601 -24.899 1.00 . A A .  52 ARG O    1 1 
        2  2643 1 1  53 VAL C    C  -5.040  -2.624 -25.345 1.00 . A A .  53 VAL C    1 1 
        2  2644 1 1  53 VAL CA   C  -6.452  -2.075 -25.524 1.00 . A A .  53 VAL CA   1 1 
        2  2645 1 1  53 VAL CB   C  -7.383  -3.217 -25.974 1.00 . A A .  53 VAL CB   1 1 
        2  2646 1 1  53 VAL CG1  C  -7.565  -4.230 -24.855 1.00 . A A .  53 VAL CG1  1 1 
        2  2647 1 1  53 VAL CG2  C  -8.724  -2.663 -26.427 1.00 . A A .  53 VAL CG2  1 1 
        2  2648 1 1  53 VAL H    H  -6.343  -1.156 -27.428 1.00 . A A .  53 VAL H    1 1 
        2  2649 1 1  53 VAL HA   H  -6.805  -1.705 -24.572 1.00 . A A .  53 VAL HA   1 1 
        2  2650 1 1  53 VAL HB   H  -6.923  -3.719 -26.813 1.00 . A A .  53 VAL HB   1 1 
        2  2651 1 1  53 VAL HG11 H  -8.236  -5.011 -25.182 1.00 . A A .  53 VAL HG11 1 1 
        2  2652 1 1  53 VAL HG12 H  -6.608  -4.660 -24.598 1.00 . A A .  53 VAL HG12 1 1 
        2  2653 1 1  53 VAL HG13 H  -7.982  -3.737 -23.988 1.00 . A A .  53 VAL HG13 1 1 
        2  2654 1 1  53 VAL HG21 H  -9.521  -3.233 -25.974 1.00 . A A .  53 VAL HG21 1 1 
        2  2655 1 1  53 VAL HG22 H  -8.806  -1.628 -26.127 1.00 . A A .  53 VAL HG22 1 1 
        2  2656 1 1  53 VAL HG23 H  -8.798  -2.732 -27.503 1.00 . A A .  53 VAL HG23 1 1 
        2  2657 1 1  53 VAL N    N  -6.469  -0.969 -26.473 1.00 . A A .  53 VAL N    1 1 
        2  2658 1 1  53 VAL O    O  -4.597  -3.514 -26.073 1.00 . A A .  53 VAL O    1 1 
        2  2659 1 1  54 PRO C    C  -2.884  -3.911 -23.467 1.00 . A A .  54 PRO C    1 1 
        2  2660 1 1  54 PRO CA   C  -2.944  -2.505 -24.057 1.00 . A A .  54 PRO CA   1 1 
        2  2661 1 1  54 PRO CB   C  -2.471  -1.474 -23.031 1.00 . A A .  54 PRO CB   1 1 
        2  2662 1 1  54 PRO CD   C  -4.780  -1.020 -23.448 1.00 . A A .  54 PRO CD   1 1 
        2  2663 1 1  54 PRO CG   C  -3.720  -0.984 -22.384 1.00 . A A .  54 PRO CG   1 1 
        2  2664 1 1  54 PRO HA   H  -2.315  -2.458 -24.934 1.00 . A A .  54 PRO HA   1 1 
        2  2665 1 1  54 PRO HB2  H  -1.822  -1.945 -22.292 1.00 . A A .  54 PRO HB2  1 1 
        2  2666 1 1  54 PRO HB3  H  -1.946  -0.674 -23.533 1.00 . A A .  54 PRO HB3  1 1 
        2  2667 1 1  54 PRO HD2  H  -5.748  -1.277 -23.018 1.00 . A A .  54 PRO HD2  1 1 
        2  2668 1 1  54 PRO HD3  H  -4.832  -0.072 -23.963 1.00 . A A .  54 PRO HD3  1 1 
        2  2669 1 1  54 PRO HG2  H  -3.995  -1.636 -21.555 1.00 . A A .  54 PRO HG2  1 1 
        2  2670 1 1  54 PRO HG3  H  -3.577   0.028 -22.032 1.00 . A A .  54 PRO HG3  1 1 
        2  2671 1 1  54 PRO N    N  -4.316  -2.085 -24.355 1.00 . A A .  54 PRO N    1 1 
        2  2672 1 1  54 PRO O    O  -3.722  -4.286 -22.647 1.00 . A A .  54 PRO O    1 1 
        2  2673 1 1  55 CYS C    C  -0.966  -6.061 -22.075 1.00 . A A .  55 CYS C    1 1 
        2  2674 1 1  55 CYS CA   C  -1.718  -6.047 -23.403 1.00 . A A .  55 CYS CA   1 1 
        2  2675 1 1  55 CYS CB   C  -0.969  -6.889 -24.435 1.00 . A A .  55 CYS CB   1 1 
        2  2676 1 1  55 CYS H    H  -1.252  -4.327 -24.544 1.00 . A A .  55 CYS H    1 1 
        2  2677 1 1  55 CYS HA   H  -2.700  -6.469 -23.249 1.00 . A A .  55 CYS HA   1 1 
        2  2678 1 1  55 CYS HB2  H   0.099  -6.698 -24.329 1.00 . A A .  55 CYS HB2  1 1 
        2  2679 1 1  55 CYS HB3  H  -1.153  -7.935 -24.239 1.00 . A A .  55 CYS HB3  1 1 
        2  2680 1 1  55 CYS HG   H  -0.702  -5.562 -26.648 1.00 . A A .  55 CYS HG   1 1 
        2  2681 1 1  55 CYS N    N  -1.888  -4.682 -23.888 1.00 . A A .  55 CYS N    1 1 
        2  2682 1 1  55 CYS O    O  -0.114  -5.211 -21.824 1.00 . A A .  55 CYS O    1 1 
        2  2683 1 1  55 CYS SG   S  -1.451  -6.555 -26.160 1.00 . A A .  55 CYS SG   1 1 
        2  2684 1 1  56 ASN C    C  -0.951  -5.951 -19.049 1.00 . A A .  56 ASN C    1 1 
        2  2685 1 1  56 ASN CA   C  -0.642  -7.160 -19.927 1.00 . A A .  56 ASN CA   1 1 
        2  2686 1 1  56 ASN CB   C   0.871  -7.310 -20.097 1.00 . A A .  56 ASN CB   1 1 
        2  2687 1 1  56 ASN CG   C   1.235  -8.310 -21.178 1.00 . A A .  56 ASN CG   1 1 
        2  2688 1 1  56 ASN H    H  -1.975  -7.684 -21.487 1.00 . A A .  56 ASN H    1 1 
        2  2689 1 1  56 ASN HA   H  -1.032  -8.046 -19.449 1.00 . A A .  56 ASN HA   1 1 
        2  2690 1 1  56 ASN HB2  H   1.296  -6.340 -20.356 1.00 . A A .  56 ASN HB2  1 1 
        2  2691 1 1  56 ASN HB3  H   1.301  -7.643 -19.165 1.00 . A A .  56 ASN HB3  1 1 
        2  2692 1 1  56 ASN HD21 H   0.674  -9.817 -20.009 1.00 . A A .  56 ASN HD21 1 1 
        2  2693 1 1  56 ASN HD22 H   1.266 -10.258 -21.571 1.00 . A A .  56 ASN HD22 1 1 
        2  2694 1 1  56 ASN N    N  -1.288  -7.035 -21.229 1.00 . A A .  56 ASN N    1 1 
        2  2695 1 1  56 ASN ND2  N   1.038  -9.591 -20.889 1.00 . A A .  56 ASN ND2  1 1 
        2  2696 1 1  56 ASN O    O  -0.048  -5.211 -18.657 1.00 . A A .  56 ASN O    1 1 
        2  2697 1 1  56 ASN OD1  O   1.688  -7.933 -22.258 1.00 . A A .  56 ASN OD1  1 1 
        2  2698 1 1  57 TRP C    C  -1.854  -4.590 -16.615 1.00 . A A .  57 TRP C    1 1 
        2  2699 1 1  57 TRP CA   C  -2.655  -4.640 -17.911 1.00 . A A .  57 TRP CA   1 1 
        2  2700 1 1  57 TRP CB   C  -4.148  -4.750 -17.598 1.00 . A A .  57 TRP CB   1 1 
        2  2701 1 1  57 TRP CD1  C  -5.544  -3.407 -19.278 1.00 . A A .  57 TRP CD1  1 1 
        2  2702 1 1  57 TRP CD2  C  -5.475  -5.607 -19.690 1.00 . A A .  57 TRP CD2  1 1 
        2  2703 1 1  57 TRP CE2  C  -6.267  -4.990 -20.676 1.00 . A A .  57 TRP CE2  1 1 
        2  2704 1 1  57 TRP CE3  C  -5.288  -6.991 -19.744 1.00 . A A .  57 TRP CE3  1 1 
        2  2705 1 1  57 TRP CG   C  -5.021  -4.577 -18.805 1.00 . A A .  57 TRP CG   1 1 
        2  2706 1 1  57 TRP CH2  C  -6.671  -7.063 -21.733 1.00 . A A .  57 TRP CH2  1 1 
        2  2707 1 1  57 TRP CZ2  C  -6.873  -5.710 -21.703 1.00 . A A .  57 TRP CZ2  1 1 
        2  2708 1 1  57 TRP CZ3  C  -5.889  -7.704 -20.764 1.00 . A A .  57 TRP CZ3  1 1 
        2  2709 1 1  57 TRP H    H  -2.900  -6.383 -19.086 1.00 . A A .  57 TRP H    1 1 
        2  2710 1 1  57 TRP HA   H  -2.478  -3.730 -18.465 1.00 . A A .  57 TRP HA   1 1 
        2  2711 1 1  57 TRP HB2  H  -4.344  -5.729 -17.160 1.00 . A A .  57 TRP HB2  1 1 
        2  2712 1 1  57 TRP HB3  H  -4.414  -3.988 -16.881 1.00 . A A .  57 TRP HB3  1 1 
        2  2713 1 1  57 TRP HD1  H  -5.382  -2.442 -18.822 1.00 . A A .  57 TRP HD1  1 1 
        2  2714 1 1  57 TRP HE1  H  -6.771  -2.968 -20.924 1.00 . A A .  57 TRP HE1  1 1 
        2  2715 1 1  57 TRP HE3  H  -4.687  -7.504 -19.007 1.00 . A A .  57 TRP HE3  1 1 
        2  2716 1 1  57 TRP HH2  H  -7.122  -7.660 -22.511 1.00 . A A .  57 TRP HH2  1 1 
        2  2717 1 1  57 TRP HZ2  H  -7.477  -5.230 -22.458 1.00 . A A .  57 TRP HZ2  1 1 
        2  2718 1 1  57 TRP HZ3  H  -5.754  -8.774 -20.823 1.00 . A A .  57 TRP HZ3  1 1 
        2  2719 1 1  57 TRP N    N  -2.229  -5.759 -18.743 1.00 . A A .  57 TRP N    1 1 
        2  2720 1 1  57 TRP NE1  N  -6.295  -3.648 -20.402 1.00 . A A .  57 TRP NE1  1 1 
        2  2721 1 1  57 TRP O    O  -1.468  -3.516 -16.151 1.00 . A A .  57 TRP O    1 1 
        2  2722 1 1  58 LYS C    C   0.518  -5.187 -14.935 1.00 . A A .  58 LYS C    1 1 
        2  2723 1 1  58 LYS CA   C  -0.849  -5.849 -14.789 1.00 . A A .  58 LYS CA   1 1 
        2  2724 1 1  58 LYS CB   C  -0.679  -7.313 -14.377 1.00 . A A .  58 LYS CB   1 1 
        2  2725 1 1  58 LYS CD   C   0.257  -8.204 -12.224 1.00 . A A .  58 LYS CD   1 1 
        2  2726 1 1  58 LYS CE   C   0.080  -8.257 -10.713 1.00 . A A .  58 LYS CE   1 1 
        2  2727 1 1  58 LYS CG   C  -0.943  -7.565 -12.902 1.00 . A A .  58 LYS CG   1 1 
        2  2728 1 1  58 LYS H    H  -1.941  -6.580 -16.449 1.00 . A A .  58 LYS H    1 1 
        2  2729 1 1  58 LYS HA   H  -1.406  -5.331 -14.023 1.00 . A A .  58 LYS HA   1 1 
        2  2730 1 1  58 LYS HB2  H  -1.365  -7.923 -14.964 1.00 . A A .  58 LYS HB2  1 1 
        2  2731 1 1  58 LYS HB3  H   0.334  -7.620 -14.597 1.00 . A A .  58 LYS HB3  1 1 
        2  2732 1 1  58 LYS HD2  H   0.385  -9.218 -12.604 1.00 . A A .  58 LYS HD2  1 1 
        2  2733 1 1  58 LYS HD3  H   1.141  -7.626 -12.453 1.00 . A A .  58 LYS HD3  1 1 
        2  2734 1 1  58 LYS HE2  H   1.041  -8.479 -10.250 1.00 . A A .  58 LYS HE2  1 1 
        2  2735 1 1  58 LYS HE3  H  -0.262  -7.292 -10.370 1.00 . A A .  58 LYS HE3  1 1 
        2  2736 1 1  58 LYS HG2  H  -1.167  -6.617 -12.412 1.00 . A A .  58 LYS HG2  1 1 
        2  2737 1 1  58 LYS HG3  H  -1.794  -8.223 -12.806 1.00 . A A .  58 LYS HG3  1 1 
        2  2738 1 1  58 LYS HZ1  H  -0.712  -9.614  -9.336 1.00 . A A .  58 LYS HZ1  1 1 
        2  2739 1 1  58 LYS HZ2  H  -0.851 -10.113 -10.947 1.00 . A A .  58 LYS HZ2  1 1 
        2  2740 1 1  58 LYS HZ3  H  -1.871  -8.905 -10.346 1.00 . A A .  58 LYS HZ3  1 1 
        2  2741 1 1  58 LYS N    N  -1.606  -5.758 -16.031 1.00 . A A .  58 LYS N    1 1 
        2  2742 1 1  58 LYS NZ   N  -0.908  -9.296 -10.308 1.00 . A A .  58 LYS NZ   1 1 
        2  2743 1 1  58 LYS O    O   0.879  -4.717 -16.014 1.00 . A A .  58 LYS O    1 1 
        2  2744 1 1  59 LYS C    C   3.320  -4.809 -12.526 1.00 . A A .  59 LYS C    1 1 
        2  2745 1 1  59 LYS CA   C   2.602  -4.556 -13.849 1.00 . A A .  59 LYS CA   1 1 
        2  2746 1 1  59 LYS CB   C   2.504  -3.051 -14.107 1.00 . A A .  59 LYS CB   1 1 
        2  2747 1 1  59 LYS CD   C   2.234  -0.940 -12.772 1.00 . A A .  59 LYS CD   1 1 
        2  2748 1 1  59 LYS CE   C   1.472  -0.260 -11.646 1.00 . A A .  59 LYS CE   1 1 
        2  2749 1 1  59 LYS CG   C   1.658  -2.312 -13.084 1.00 . A A .  59 LYS CG   1 1 
        2  2750 1 1  59 LYS H    H   0.929  -5.548 -13.011 1.00 . A A .  59 LYS H    1 1 
        2  2751 1 1  59 LYS HA   H   3.170  -5.013 -14.645 1.00 . A A .  59 LYS HA   1 1 
        2  2752 1 1  59 LYS HB2  H   3.509  -2.629 -14.101 1.00 . A A .  59 LYS HB2  1 1 
        2  2753 1 1  59 LYS HB3  H   2.067  -2.894 -15.084 1.00 . A A .  59 LYS HB3  1 1 
        2  2754 1 1  59 LYS HD2  H   3.279  -1.048 -12.483 1.00 . A A .  59 LYS HD2  1 1 
        2  2755 1 1  59 LYS HD3  H   2.173  -0.325 -13.659 1.00 . A A .  59 LYS HD3  1 1 
        2  2756 1 1  59 LYS HE2  H   0.792  -0.980 -11.190 1.00 . A A .  59 LYS HE2  1 1 
        2  2757 1 1  59 LYS HE3  H   2.180   0.077 -10.903 1.00 . A A .  59 LYS HE3  1 1 
        2  2758 1 1  59 LYS HG2  H   0.647  -2.196 -13.474 1.00 . A A .  59 LYS HG2  1 1 
        2  2759 1 1  59 LYS HG3  H   1.623  -2.893 -12.173 1.00 . A A .  59 LYS HG3  1 1 
        2  2760 1 1  59 LYS HZ1  H  -0.320   0.778 -11.914 1.00 . A A .  59 LYS HZ1  1 1 
        2  2761 1 1  59 LYS HZ2  H   0.799   1.009 -13.161 1.00 . A A .  59 LYS HZ2  1 1 
        2  2762 1 1  59 LYS HZ3  H   1.020   1.780 -11.673 1.00 . A A .  59 LYS HZ3  1 1 
        2  2763 1 1  59 LYS N    N   1.274  -5.157 -13.843 1.00 . A A .  59 LYS N    1 1 
        2  2764 1 1  59 LYS NZ   N   0.687   0.909 -12.132 1.00 . A A .  59 LYS NZ   1 1 
        2  2765 1 1  59 LYS O    O   2.822  -5.540 -11.671 1.00 . A A .  59 LYS O    1 1 
        2  2766 1 1  60 GLU C    C   5.710  -5.809 -10.968 1.00 . A A .  60 GLU C    1 1 
        2  2767 1 1  60 GLU CA   C   5.274  -4.357 -11.148 1.00 . A A .  60 GLU CA   1 1 
        2  2768 1 1  60 GLU CB   C   4.466  -3.902  -9.931 1.00 . A A .  60 GLU CB   1 1 
        2  2769 1 1  60 GLU CD   C   5.600  -3.474  -7.716 1.00 . A A .  60 GLU CD   1 1 
        2  2770 1 1  60 GLU CG   C   5.195  -2.895  -9.058 1.00 . A A .  60 GLU CG   1 1 
        2  2771 1 1  60 GLU H    H   4.833  -3.628 -13.086 1.00 . A A .  60 GLU H    1 1 
        2  2772 1 1  60 GLU HA   H   6.153  -3.738 -11.235 1.00 . A A .  60 GLU HA   1 1 
        2  2773 1 1  60 GLU HB2  H   3.535  -3.453 -10.278 1.00 . A A .  60 GLU HB2  1 1 
        2  2774 1 1  60 GLU HB3  H   4.228  -4.765  -9.327 1.00 . A A .  60 GLU HB3  1 1 
        2  2775 1 1  60 GLU HG2  H   6.089  -2.555  -9.581 1.00 . A A .  60 GLU HG2  1 1 
        2  2776 1 1  60 GLU HG3  H   4.545  -2.049  -8.886 1.00 . A A .  60 GLU HG3  1 1 
        2  2777 1 1  60 GLU N    N   4.489  -4.198 -12.366 1.00 . A A .  60 GLU N    1 1 
        2  2778 1 1  60 GLU O    O   5.559  -6.631 -11.871 1.00 . A A .  60 GLU O    1 1 
        2  2779 1 1  60 GLU OE1  O   6.647  -4.153  -7.654 1.00 . A A .  60 GLU OE1  1 1 
        2  2780 1 1  60 GLU OE2  O   4.872  -3.248  -6.728 1.00 . A A .  60 GLU OE2  1 1 
        2  2781 1 1  61 PHE C    C   7.852  -7.872 -10.425 1.00 . A A .  61 PHE C    1 1 
        2  2782 1 1  61 PHE CA   C   6.712  -7.467  -9.495 1.00 . A A .  61 PHE CA   1 1 
        2  2783 1 1  61 PHE CB   C   5.557  -8.462  -9.622 1.00 . A A .  61 PHE CB   1 1 
        2  2784 1 1  61 PHE CD1  C   6.005  -9.916  -7.626 1.00 . A A .  61 PHE CD1  1 1 
        2  2785 1 1  61 PHE CD2  C   5.957 -10.934  -9.783 1.00 . A A .  61 PHE CD2  1 1 
        2  2786 1 1  61 PHE CE1  C   6.270 -11.145  -7.051 1.00 . A A .  61 PHE CE1  1 1 
        2  2787 1 1  61 PHE CE2  C   6.221 -12.165  -9.211 1.00 . A A .  61 PHE CE2  1 1 
        2  2788 1 1  61 PHE CG   C   5.846  -9.798  -8.997 1.00 . A A .  61 PHE CG   1 1 
        2  2789 1 1  61 PHE CZ   C   6.379 -12.270  -7.844 1.00 . A A .  61 PHE CZ   1 1 
        2  2790 1 1  61 PHE H    H   6.346  -5.417  -9.112 1.00 . A A .  61 PHE H    1 1 
        2  2791 1 1  61 PHE HA   H   7.074  -7.476  -8.478 1.00 . A A .  61 PHE HA   1 1 
        2  2792 1 1  61 PHE HB2  H   4.674  -8.036  -9.145 1.00 . A A .  61 PHE HB2  1 1 
        2  2793 1 1  61 PHE HB3  H   5.343  -8.622 -10.667 1.00 . A A .  61 PHE HB3  1 1 
        2  2794 1 1  61 PHE HD1  H   5.920  -9.036  -7.004 1.00 . A A .  61 PHE HD1  1 1 
        2  2795 1 1  61 PHE HD2  H   5.833 -10.852 -10.853 1.00 . A A .  61 PHE HD2  1 1 
        2  2796 1 1  61 PHE HE1  H   6.394 -11.223  -5.980 1.00 . A A .  61 PHE HE1  1 1 
        2  2797 1 1  61 PHE HE2  H   6.306 -13.042  -9.834 1.00 . A A .  61 PHE HE2  1 1 
        2  2798 1 1  61 PHE HZ   H   6.585 -13.229  -7.395 1.00 . A A .  61 PHE HZ   1 1 
        2  2799 1 1  61 PHE N    N   6.252  -6.116  -9.793 1.00 . A A .  61 PHE N    1 1 
        2  2800 1 1  61 PHE O    O   7.632  -8.188 -11.593 1.00 . A A .  61 PHE O    1 1 
        2  2801 1 1  62 GLY C    C  11.523  -8.145  -9.907 1.00 . A A .  62 GLY C    1 1 
        2  2802 1 1  62 GLY CA   C  10.230  -8.227 -10.693 1.00 . A A .  62 GLY CA   1 1 
        2  2803 1 1  62 GLY H    H   9.188  -7.598  -8.958 1.00 . A A .  62 GLY H    1 1 
        2  2804 1 1  62 GLY HA2  H  10.100  -9.237 -11.051 1.00 . A A .  62 GLY HA2  1 1 
        2  2805 1 1  62 GLY HA3  H  10.294  -7.560 -11.540 1.00 . A A .  62 GLY HA3  1 1 
        2  2806 1 1  62 GLY N    N   9.073  -7.859  -9.896 1.00 . A A .  62 GLY N    1 1 
        2  2807 1 1  62 GLY O    O  12.349  -7.265 -10.148 1.00 . A A .  62 GLY O    1 1 
        2  2808 1 1  63 ALA C    C  12.946  -7.899  -7.191 1.00 . A A .  63 ALA C    1 1 
        2  2809 1 1  63 ALA CA   C  12.901  -9.092  -8.140 1.00 . A A .  63 ALA CA   1 1 
        2  2810 1 1  63 ALA CB   C  14.143  -9.117  -9.019 1.00 . A A .  63 ALA CB   1 1 
        2  2811 1 1  63 ALA H    H  11.004  -9.739  -8.818 1.00 . A A .  63 ALA H    1 1 
        2  2812 1 1  63 ALA HA   H  12.885 -10.003  -7.558 1.00 . A A .  63 ALA HA   1 1 
        2  2813 1 1  63 ALA HB1  H  14.642 -10.068  -8.911 1.00 . A A .  63 ALA HB1  1 1 
        2  2814 1 1  63 ALA HB2  H  13.857  -8.975 -10.051 1.00 . A A .  63 ALA HB2  1 1 
        2  2815 1 1  63 ALA HB3  H  14.811  -8.323  -8.720 1.00 . A A .  63 ALA HB3  1 1 
        2  2816 1 1  63 ALA N    N  11.698  -9.064  -8.963 1.00 . A A .  63 ALA N    1 1 
        2  2817 1 1  63 ALA O    O  12.669  -8.033  -5.999 1.00 . A A .  63 ALA O    1 1 
        2  2818 1 1  64 ASP C    C  13.666  -4.309  -7.808 1.00 . A A .  64 ASP C    1 1 
        2  2819 1 1  64 ASP CA   C  13.375  -5.519  -6.927 1.00 . A A .  64 ASP CA   1 1 
        2  2820 1 1  64 ASP CB   C  14.458  -5.659  -5.855 1.00 . A A .  64 ASP CB   1 1 
        2  2821 1 1  64 ASP CG   C  13.877  -5.811  -4.464 1.00 . A A .  64 ASP CG   1 1 
        2  2822 1 1  64 ASP H    H  13.504  -6.693  -8.685 1.00 . A A .  64 ASP H    1 1 
        2  2823 1 1  64 ASP HA   H  12.420  -5.375  -6.445 1.00 . A A .  64 ASP HA   1 1 
        2  2824 1 1  64 ASP HB2  H  15.069  -6.532  -6.082 1.00 . A A .  64 ASP HB2  1 1 
        2  2825 1 1  64 ASP HB3  H  15.084  -4.778  -5.870 1.00 . A A .  64 ASP HB3  1 1 
        2  2826 1 1  64 ASP N    N  13.296  -6.737  -7.727 1.00 . A A .  64 ASP N    1 1 
        2  2827 1 1  64 ASP O    O  12.803  -3.454  -8.013 1.00 . A A .  64 ASP O    1 1 
        2  2828 1 1  64 ASP OD1  O  13.365  -4.810  -3.921 1.00 . A A .  64 ASP OD1  1 1 
        2  2829 1 1  64 ASP OD2  O  13.935  -6.933  -3.915 1.00 . A A .  64 ASP OD2  1 1 
        2  2830 1 1  65 CYS C    C  16.289  -3.603 -10.242 1.00 . A A .  65 CYS C    1 1 
        2  2831 1 1  65 CYS CA   C  15.296  -3.133  -9.183 1.00 . A A .  65 CYS CA   1 1 
        2  2832 1 1  65 CYS CB   C  15.918  -2.015  -8.346 1.00 . A A .  65 CYS CB   1 1 
        2  2833 1 1  65 CYS H    H  15.534  -4.952  -8.125 1.00 . A A .  65 CYS H    1 1 
        2  2834 1 1  65 CYS HA   H  14.415  -2.754  -9.677 1.00 . A A .  65 CYS HA   1 1 
        2  2835 1 1  65 CYS HB2  H  16.588  -2.462  -7.612 1.00 . A A .  65 CYS HB2  1 1 
        2  2836 1 1  65 CYS HB3  H  16.497  -1.370  -8.993 1.00 . A A .  65 CYS HB3  1 1 
        2  2837 1 1  65 CYS HG   H  13.603  -0.854  -8.216 1.00 . A A .  65 CYS HG   1 1 
        2  2838 1 1  65 CYS N    N  14.889  -4.240  -8.326 1.00 . A A .  65 CYS N    1 1 
        2  2839 1 1  65 CYS O    O  17.246  -4.317  -9.941 1.00 . A A .  65 CYS O    1 1 
        2  2840 1 1  65 CYS SG   S  14.704  -0.977  -7.470 1.00 . A A .  65 CYS SG   1 1 
        2  2841 1 1  66 LYS C    C  18.161  -2.680 -12.641 1.00 . A A .  66 LYS C    1 1 
        2  2842 1 1  66 LYS CA   C  16.927  -3.577 -12.592 1.00 . A A .  66 LYS CA   1 1 
        2  2843 1 1  66 LYS CB   C  16.168  -3.492 -13.918 1.00 . A A .  66 LYS CB   1 1 
        2  2844 1 1  66 LYS CD   C  15.198  -4.735 -15.875 1.00 . A A .  66 LYS CD   1 1 
        2  2845 1 1  66 LYS CE   C  15.962  -5.639 -16.828 1.00 . A A .  66 LYS CE   1 1 
        2  2846 1 1  66 LYS CG   C  15.729  -4.842 -14.455 1.00 . A A .  66 LYS CG   1 1 
        2  2847 1 1  66 LYS H    H  15.274  -2.631 -11.665 1.00 . A A .  66 LYS H    1 1 
        2  2848 1 1  66 LYS HA   H  17.243  -4.595 -12.432 1.00 . A A .  66 LYS HA   1 1 
        2  2849 1 1  66 LYS HB2  H  15.285  -2.869 -13.776 1.00 . A A .  66 LYS HB2  1 1 
        2  2850 1 1  66 LYS HB3  H  16.807  -3.026 -14.655 1.00 . A A .  66 LYS HB3  1 1 
        2  2851 1 1  66 LYS HD2  H  14.145  -5.015 -15.884 1.00 . A A .  66 LYS HD2  1 1 
        2  2852 1 1  66 LYS HD3  H  15.295  -3.711 -16.208 1.00 . A A .  66 LYS HD3  1 1 
        2  2853 1 1  66 LYS HE2  H  16.765  -5.067 -17.295 1.00 . A A .  66 LYS HE2  1 1 
        2  2854 1 1  66 LYS HE3  H  16.392  -6.454 -16.263 1.00 . A A .  66 LYS HE3  1 1 
        2  2855 1 1  66 LYS HG2  H  16.580  -5.524 -14.444 1.00 . A A .  66 LYS HG2  1 1 
        2  2856 1 1  66 LYS HG3  H  14.951  -5.237 -13.819 1.00 . A A .  66 LYS HG3  1 1 
        2  2857 1 1  66 LYS HZ1  H  15.512  -7.050 -18.301 1.00 . A A .  66 LYS HZ1  1 1 
        2  2858 1 1  66 LYS HZ2  H  14.943  -5.494 -18.645 1.00 . A A .  66 LYS HZ2  1 1 
        2  2859 1 1  66 LYS HZ3  H  14.154  -6.447 -17.491 1.00 . A A .  66 LYS HZ3  1 1 
        2  2860 1 1  66 LYS N    N  16.054  -3.199 -11.486 1.00 . A A .  66 LYS N    1 1 
        2  2861 1 1  66 LYS NZ   N  15.082  -6.197 -17.891 1.00 . A A .  66 LYS NZ   1 1 
        2  2862 1 1  66 LYS O    O  18.090  -1.494 -12.320 1.00 . A A .  66 LYS O    1 1 
        2  2863 1 1  67 TYR C    C  21.310  -2.891 -14.395 1.00 . A A .  67 TYR C    1 1 
        2  2864 1 1  67 TYR CA   C  20.536  -2.508 -13.137 1.00 . A A .  67 TYR CA   1 1 
        2  2865 1 1  67 TYR CB   C  21.398  -2.762 -11.899 1.00 . A A .  67 TYR CB   1 1 
        2  2866 1 1  67 TYR CD1  C  19.821  -2.435  -9.953 1.00 . A A .  67 TYR CD1  1 1 
        2  2867 1 1  67 TYR CD2  C  21.602  -0.876 -10.233 1.00 . A A .  67 TYR CD2  1 1 
        2  2868 1 1  67 TYR CE1  C  19.392  -1.752  -8.832 1.00 . A A .  67 TYR CE1  1 1 
        2  2869 1 1  67 TYR CE2  C  21.180  -0.187  -9.113 1.00 . A A .  67 TYR CE2  1 1 
        2  2870 1 1  67 TYR CG   C  20.931  -2.010 -10.673 1.00 . A A .  67 TYR CG   1 1 
        2  2871 1 1  67 TYR CZ   C  20.074  -0.627  -8.416 1.00 . A A .  67 TYR CZ   1 1 
        2  2872 1 1  67 TYR H    H  19.279  -4.205 -13.290 1.00 . A A .  67 TYR H    1 1 
        2  2873 1 1  67 TYR HA   H  20.292  -1.457 -13.185 1.00 . A A .  67 TYR HA   1 1 
        2  2874 1 1  67 TYR HB2  H  21.388  -3.830 -11.680 1.00 . A A .  67 TYR HB2  1 1 
        2  2875 1 1  67 TYR HB3  H  22.413  -2.461 -12.107 1.00 . A A .  67 TYR HB3  1 1 
        2  2876 1 1  67 TYR HD1  H  19.290  -3.318 -10.282 1.00 . A A .  67 TYR HD1  1 1 
        2  2877 1 1  67 TYR HD2  H  22.467  -0.533 -10.781 1.00 . A A .  67 TYR HD2  1 1 
        2  2878 1 1  67 TYR HE1  H  18.527  -2.097  -8.286 1.00 . A A .  67 TYR HE1  1 1 
        2  2879 1 1  67 TYR HE2  H  21.714   0.695  -8.786 1.00 . A A .  67 TYR HE2  1 1 
        2  2880 1 1  67 TYR HH   H  19.461  -0.568  -6.595 1.00 . A A .  67 TYR HH   1 1 
        2  2881 1 1  67 TYR N    N  19.288  -3.255 -13.047 1.00 . A A .  67 TYR N    1 1 
        2  2882 1 1  67 TYR O    O  20.950  -3.838 -15.096 1.00 . A A .  67 TYR O    1 1 
        2  2883 1 1  67 TYR OH   O  19.651   0.056  -7.299 1.00 . A A .  67 TYR OH   1 1 
        2  2884 1 1  68 LYS C    C  24.594  -2.883 -15.436 1.00 . A A .  68 LYS C    1 1 
        2  2885 1 1  68 LYS CA   C  23.203  -2.409 -15.847 1.00 . A A .  68 LYS CA   1 1 
        2  2886 1 1  68 LYS CB   C  23.315  -1.148 -16.708 1.00 . A A .  68 LYS CB   1 1 
        2  2887 1 1  68 LYS CD   C  23.889  -0.588 -19.087 1.00 . A A .  68 LYS CD   1 1 
        2  2888 1 1  68 LYS CE   C  23.709  -1.000 -20.542 1.00 . A A .  68 LYS CE   1 1 
        2  2889 1 1  68 LYS CG   C  22.971  -1.377 -18.169 1.00 . A A .  68 LYS CG   1 1 
        2  2890 1 1  68 LYS H    H  22.613  -1.408 -14.078 1.00 . A A .  68 LYS H    1 1 
        2  2891 1 1  68 LYS HA   H  22.726  -3.187 -16.424 1.00 . A A .  68 LYS HA   1 1 
        2  2892 1 1  68 LYS HB2  H  22.645  -0.389 -16.305 1.00 . A A .  68 LYS HB2  1 1 
        2  2893 1 1  68 LYS HB3  H  24.330  -0.779 -16.652 1.00 . A A .  68 LYS HB3  1 1 
        2  2894 1 1  68 LYS HD2  H  23.668   0.475 -18.987 1.00 . A A .  68 LYS HD2  1 1 
        2  2895 1 1  68 LYS HD3  H  24.914  -0.767 -18.798 1.00 . A A .  68 LYS HD3  1 1 
        2  2896 1 1  68 LYS HE2  H  24.658  -0.885 -21.064 1.00 . A A .  68 LYS HE2  1 1 
        2  2897 1 1  68 LYS HE3  H  23.411  -2.037 -20.575 1.00 . A A .  68 LYS HE3  1 1 
        2  2898 1 1  68 LYS HG2  H  23.065  -2.439 -18.396 1.00 . A A .  68 LYS HG2  1 1 
        2  2899 1 1  68 LYS HG3  H  21.950  -1.067 -18.341 1.00 . A A .  68 LYS HG3  1 1 
        2  2900 1 1  68 LYS HZ1  H  22.782  -0.251 -22.257 1.00 . A A .  68 LYS HZ1  1 1 
        2  2901 1 1  68 LYS HZ2  H  22.770   0.822 -20.949 1.00 . A A .  68 LYS HZ2  1 1 
        2  2902 1 1  68 LYS HZ3  H  21.723  -0.506 -20.964 1.00 . A A .  68 LYS HZ3  1 1 
        2  2903 1 1  68 LYS N    N  22.376  -2.148 -14.675 1.00 . A A .  68 LYS N    1 1 
        2  2904 1 1  68 LYS NZ   N  22.674  -0.176 -21.226 1.00 . A A .  68 LYS NZ   1 1 
        2  2905 1 1  68 LYS O    O  25.457  -2.077 -15.089 1.00 . A A .  68 LYS O    1 1 
        2  2906 1 1  69 PHE C    C  27.015  -4.857 -16.325 1.00 . A A .  69 PHE C    1 1 
        2  2907 1 1  69 PHE CA   C  26.091  -4.774 -15.114 1.00 . A A .  69 PHE CA   1 1 
        2  2908 1 1  69 PHE CB   C  25.893  -6.168 -14.515 1.00 . A A .  69 PHE CB   1 1 
        2  2909 1 1  69 PHE CD1  C  25.281  -5.423 -12.198 1.00 . A A .  69 PHE CD1  1 1 
        2  2910 1 1  69 PHE CD2  C  23.836  -6.956 -13.314 1.00 . A A .  69 PHE CD2  1 1 
        2  2911 1 1  69 PHE CE1  C  24.447  -5.434 -11.095 1.00 . A A .  69 PHE CE1  1 1 
        2  2912 1 1  69 PHE CE2  C  22.997  -6.970 -12.214 1.00 . A A .  69 PHE CE2  1 1 
        2  2913 1 1  69 PHE CG   C  24.985  -6.182 -13.317 1.00 . A A .  69 PHE CG   1 1 
        2  2914 1 1  69 PHE CZ   C  23.305  -6.209 -11.102 1.00 . A A .  69 PHE CZ   1 1 
        2  2915 1 1  69 PHE H    H  24.077  -4.786 -15.766 1.00 . A A .  69 PHE H    1 1 
        2  2916 1 1  69 PHE HA   H  26.543  -4.134 -14.373 1.00 . A A .  69 PHE HA   1 1 
        2  2917 1 1  69 PHE HB2  H  25.474  -6.822 -15.279 1.00 . A A .  69 PHE HB2  1 1 
        2  2918 1 1  69 PHE HB3  H  26.851  -6.560 -14.209 1.00 . A A .  69 PHE HB3  1 1 
        2  2919 1 1  69 PHE HD1  H  26.175  -4.816 -12.190 1.00 . A A .  69 PHE HD1  1 1 
        2  2920 1 1  69 PHE HD2  H  23.594  -7.553 -14.180 1.00 . A A .  69 PHE HD2  1 1 
        2  2921 1 1  69 PHE HE1  H  24.692  -4.837 -10.229 1.00 . A A .  69 PHE HE1  1 1 
        2  2922 1 1  69 PHE HE2  H  22.105  -7.578 -12.223 1.00 . A A .  69 PHE HE2  1 1 
        2  2923 1 1  69 PHE HZ   H  22.651  -6.219 -10.242 1.00 . A A .  69 PHE HZ   1 1 
        2  2924 1 1  69 PHE N    N  24.804  -4.195 -15.480 1.00 . A A .  69 PHE N    1 1 
        2  2925 1 1  69 PHE O    O  26.621  -5.326 -17.390 1.00 . A A .  69 PHE O    1 1 
        2  2926 1 1  70 GLY C    C  29.371  -5.807 -17.835 1.00 . A A .  70 GLY C    1 1 
        2  2927 1 1  70 GLY CA   C  29.212  -4.423 -17.237 1.00 . A A .  70 GLY CA   1 1 
        2  2928 1 1  70 GLY H    H  28.509  -4.031 -15.279 1.00 . A A .  70 GLY H    1 1 
        2  2929 1 1  70 GLY HA2  H  28.887  -3.744 -18.011 1.00 . A A .  70 GLY HA2  1 1 
        2  2930 1 1  70 GLY HA3  H  30.170  -4.094 -16.863 1.00 . A A .  70 GLY HA3  1 1 
        2  2931 1 1  70 GLY N    N  28.250  -4.395 -16.152 1.00 . A A .  70 GLY N    1 1 
        2  2932 1 1  70 GLY O    O  28.758  -6.125 -18.854 1.00 . A A .  70 GLY O    1 1 
        2  2933 1 1  71 ASN C    C  31.083  -8.842 -16.590 1.00 . A A .  71 ASN C    1 1 
        2  2934 1 1  71 ASN CA   C  30.436  -7.990 -17.678 1.00 . A A .  71 ASN CA   1 1 
        2  2935 1 1  71 ASN CB   C  31.330  -7.966 -18.920 1.00 . A A .  71 ASN CB   1 1 
        2  2936 1 1  71 ASN CG   C  31.297  -9.279 -19.680 1.00 . A A .  71 ASN CG   1 1 
        2  2937 1 1  71 ASN H    H  30.659  -6.322 -16.393 1.00 . A A .  71 ASN H    1 1 
        2  2938 1 1  71 ASN HA   H  29.483  -8.422 -17.939 1.00 . A A .  71 ASN HA   1 1 
        2  2939 1 1  71 ASN HB2  H  30.995  -7.167 -19.581 1.00 . A A .  71 ASN HB2  1 1 
        2  2940 1 1  71 ASN HB3  H  32.349  -7.770 -18.622 1.00 . A A .  71 ASN HB3  1 1 
        2  2941 1 1  71 ASN HD21 H  29.431  -8.921 -20.266 1.00 . A A .  71 ASN HD21 1 1 
        2  2942 1 1  71 ASN HD22 H  30.121 -10.406 -20.819 1.00 . A A .  71 ASN HD22 1 1 
        2  2943 1 1  71 ASN N    N  30.198  -6.633 -17.201 1.00 . A A .  71 ASN N    1 1 
        2  2944 1 1  71 ASN ND2  N  30.169  -9.564 -20.319 1.00 . A A .  71 ASN ND2  1 1 
        2  2945 1 1  71 ASN O    O  31.846  -9.765 -16.881 1.00 . A A .  71 ASN O    1 1 
        2  2946 1 1  71 ASN OD1  O  32.275 -10.026 -19.693 1.00 . A A .  71 ASN OD1  1 1 
        2  2947 1 1  72 TRP C    C  32.829  -9.064 -14.104 1.00 . A A .  72 TRP C    1 1 
        2  2948 1 1  72 TRP CA   C  31.321  -9.268 -14.206 1.00 . A A .  72 TRP CA   1 1 
        2  2949 1 1  72 TRP CB   C  31.001 -10.758 -14.339 1.00 . A A .  72 TRP CB   1 1 
        2  2950 1 1  72 TRP CD1  C  29.190 -11.230 -16.089 1.00 . A A .  72 TRP CD1  1 1 
        2  2951 1 1  72 TRP CD2  C  28.431 -11.117 -13.985 1.00 . A A .  72 TRP CD2  1 1 
        2  2952 1 1  72 TRP CE2  C  27.344 -11.379 -14.842 1.00 . A A .  72 TRP CE2  1 1 
        2  2953 1 1  72 TRP CE3  C  28.194 -11.005 -12.611 1.00 . A A .  72 TRP CE3  1 1 
        2  2954 1 1  72 TRP CG   C  29.602 -11.026 -14.803 1.00 . A A .  72 TRP CG   1 1 
        2  2955 1 1  72 TRP CH2  C  25.840 -11.414 -13.020 1.00 . A A .  72 TRP CH2  1 1 
        2  2956 1 1  72 TRP CZ2  C  26.043 -11.529 -14.369 1.00 . A A .  72 TRP CZ2  1 1 
        2  2957 1 1  72 TRP CZ3  C  26.902 -11.154 -12.144 1.00 . A A .  72 TRP CZ3  1 1 
        2  2958 1 1  72 TRP H    H  30.157  -7.784 -15.170 1.00 . A A .  72 TRP H    1 1 
        2  2959 1 1  72 TRP HA   H  30.857  -8.888 -13.308 1.00 . A A .  72 TRP HA   1 1 
        2  2960 1 1  72 TRP HB2  H  31.698 -11.204 -15.049 1.00 . A A .  72 TRP HB2  1 1 
        2  2961 1 1  72 TRP HB3  H  31.132 -11.233 -13.377 1.00 . A A .  72 TRP HB3  1 1 
        2  2962 1 1  72 TRP HD1  H  29.846 -11.220 -16.946 1.00 . A A .  72 TRP HD1  1 1 
        2  2963 1 1  72 TRP HE1  H  27.302 -11.613 -16.926 1.00 . A A .  72 TRP HE1  1 1 
        2  2964 1 1  72 TRP HE3  H  28.999 -10.804 -11.921 1.00 . A A .  72 TRP HE3  1 1 
        2  2965 1 1  72 TRP HH2  H  24.847 -11.523 -12.612 1.00 . A A .  72 TRP HH2  1 1 
        2  2966 1 1  72 TRP HZ2  H  25.213 -11.731 -15.031 1.00 . A A .  72 TRP HZ2  1 1 
        2  2967 1 1  72 TRP HZ3  H  26.700 -11.070 -11.086 1.00 . A A .  72 TRP HZ3  1 1 
        2  2968 1 1  72 TRP N    N  30.771  -8.529 -15.338 1.00 . A A .  72 TRP N    1 1 
        2  2969 1 1  72 TRP NE1  N  27.833 -11.443 -16.119 1.00 . A A .  72 TRP NE1  1 1 
        2  2970 1 1  72 TRP O    O  33.568  -9.366 -15.040 1.00 . A A .  72 TRP O    1 1 
        2  2971 1 1  73 GLY C    C  35.504  -9.603 -12.791 1.00 . A A .  73 GLY C    1 1 
        2  2972 1 1  73 GLY CA   C  34.696  -8.320 -12.760 1.00 . A A .  73 GLY CA   1 1 
        2  2973 1 1  73 GLY H    H  32.641  -8.333 -12.250 1.00 . A A .  73 GLY H    1 1 
        2  2974 1 1  73 GLY HA2  H  35.055  -7.662 -13.537 1.00 . A A .  73 GLY HA2  1 1 
        2  2975 1 1  73 GLY HA3  H  34.838  -7.842 -11.803 1.00 . A A .  73 GLY HA3  1 1 
        2  2976 1 1  73 GLY N    N  33.278  -8.554 -12.962 1.00 . A A .  73 GLY N    1 1 
        2  2977 1 1  73 GLY O    O  35.051 -10.617 -13.322 1.00 . A A .  73 GLY O    1 1 
        2  2978 1 1  74 GLU C    C  37.157 -11.688 -11.082 1.00 . A A .  74 GLU C    1 1 
        2  2979 1 1  74 GLU CA   C  37.578 -10.724 -12.187 1.00 . A A .  74 GLU CA   1 1 
        2  2980 1 1  74 GLU CB   C  39.031 -10.295 -11.979 1.00 . A A .  74 GLU CB   1 1 
        2  2981 1 1  74 GLU CD   C  39.608 -10.484  -9.527 1.00 . A A .  74 GLU CD   1 1 
        2  2982 1 1  74 GLU CG   C  39.266  -9.553 -10.674 1.00 . A A .  74 GLU CG   1 1 
        2  2983 1 1  74 GLU H    H  37.009  -8.720 -11.814 1.00 . A A .  74 GLU H    1 1 
        2  2984 1 1  74 GLU HA   H  37.494 -11.228 -13.139 1.00 . A A .  74 GLU HA   1 1 
        2  2985 1 1  74 GLU HB2  H  39.663 -11.183 -11.993 1.00 . A A .  74 GLU HB2  1 1 
        2  2986 1 1  74 GLU HB3  H  39.323  -9.649 -12.793 1.00 . A A .  74 GLU HB3  1 1 
        2  2987 1 1  74 GLU HG2  H  40.083  -8.845 -10.812 1.00 . A A .  74 GLU HG2  1 1 
        2  2988 1 1  74 GLU HG3  H  38.369  -9.007 -10.420 1.00 . A A .  74 GLU HG3  1 1 
        2  2989 1 1  74 GLU N    N  36.704  -9.557 -12.221 1.00 . A A .  74 GLU N    1 1 
        2  2990 1 1  74 GLU O    O  36.889 -11.276  -9.952 1.00 . A A .  74 GLU O    1 1 
        2  2991 1 1  74 GLU OE1  O  40.495 -11.345  -9.708 1.00 . A A .  74 GLU OE1  1 1 
        2  2992 1 1  74 GLU OE2  O  38.992 -10.351  -8.448 1.00 . A A .  74 GLU OE2  1 1 
        2  2993 1 1  75 CYS C    C  37.902 -14.420  -9.598 1.00 . A A .  75 CYS C    1 1 
        2  2994 1 1  75 CYS CA   C  36.710 -13.997 -10.452 1.00 . A A .  75 CYS CA   1 1 
        2  2995 1 1  75 CYS CB   C  36.131 -15.214 -11.177 1.00 . A A .  75 CYS CB   1 1 
        2  2996 1 1  75 CYS H    H  37.324 -13.240 -12.332 1.00 . A A .  75 CYS H    1 1 
        2  2997 1 1  75 CYS HA   H  35.952 -13.577  -9.810 1.00 . A A .  75 CYS HA   1 1 
        2  2998 1 1  75 CYS HB2  H  36.948 -15.757 -11.652 1.00 . A A .  75 CYS HB2  1 1 
        2  2999 1 1  75 CYS HB3  H  35.660 -15.863 -10.454 1.00 . A A .  75 CYS HB3  1 1 
        2  3000 1 1  75 CYS HG   H  35.051 -13.532 -12.832 1.00 . A A .  75 CYS HG   1 1 
        2  3001 1 1  75 CYS N    N  37.099 -12.973 -11.416 1.00 . A A .  75 CYS N    1 1 
        2  3002 1 1  75 CYS O    O  38.951 -14.796 -10.119 1.00 . A A .  75 CYS O    1 1 
        2  3003 1 1  75 CYS SG   S  34.890 -14.801 -12.446 1.00 . A A .  75 CYS SG   1 1 
        2  3004 1 1  76 ASP C    C  38.657 -16.196  -6.944 1.00 . A A .  76 ASP C    1 1 
        2  3005 1 1  76 ASP CA   C  38.789 -14.733  -7.353 1.00 . A A .  76 ASP CA   1 1 
        2  3006 1 1  76 ASP CB   C  38.752 -13.837  -6.113 1.00 . A A .  76 ASP CB   1 1 
        2  3007 1 1  76 ASP CG   C  39.865 -12.810  -6.106 1.00 . A A .  76 ASP CG   1 1 
        2  3008 1 1  76 ASP H    H  36.869 -14.047  -7.926 1.00 . A A .  76 ASP H    1 1 
        2  3009 1 1  76 ASP HA   H  39.735 -14.595  -7.855 1.00 . A A .  76 ASP HA   1 1 
        2  3010 1 1  76 ASP HB2  H  37.793 -13.319  -6.079 1.00 . A A .  76 ASP HB2  1 1 
        2  3011 1 1  76 ASP HB3  H  38.848 -14.454  -5.231 1.00 . A A .  76 ASP HB3  1 1 
        2  3012 1 1  76 ASP N    N  37.729 -14.355  -8.282 1.00 . A A .  76 ASP N    1 1 
        2  3013 1 1  76 ASP O    O  37.797 -16.550  -6.138 1.00 . A A .  76 ASP O    1 1 
        2  3014 1 1  76 ASP OD1  O  40.342 -12.446  -7.202 1.00 . A A .  76 ASP OD1  1 1 
        2  3015 1 1  76 ASP OD2  O  40.263 -12.370  -5.006 1.00 . A A .  76 ASP OD2  1 1 
        2  3016 1 1  77 ALA C    C  39.706 -18.711  -5.708 1.00 . A A .  77 ALA C    1 1 
        2  3017 1 1  77 ALA CA   C  39.495 -18.466  -7.199 1.00 . A A .  77 ALA CA   1 1 
        2  3018 1 1  77 ALA CB   C  40.555 -19.196  -8.011 1.00 . A A .  77 ALA CB   1 1 
        2  3019 1 1  77 ALA H    H  40.177 -16.698  -8.141 1.00 . A A .  77 ALA H    1 1 
        2  3020 1 1  77 ALA HA   H  38.527 -18.855  -7.484 1.00 . A A .  77 ALA HA   1 1 
        2  3021 1 1  77 ALA HB1  H  40.177 -20.164  -8.308 1.00 . A A .  77 ALA HB1  1 1 
        2  3022 1 1  77 ALA HB2  H  40.797 -18.617  -8.890 1.00 . A A .  77 ALA HB2  1 1 
        2  3023 1 1  77 ALA HB3  H  41.443 -19.326  -7.409 1.00 . A A .  77 ALA HB3  1 1 
        2  3024 1 1  77 ALA N    N  39.515 -17.041  -7.506 1.00 . A A .  77 ALA N    1 1 
        2  3025 1 1  77 ALA O    O  39.359 -19.770  -5.188 1.00 . A A .  77 ALA O    1 1 
        2  3026 1 1  78 ALA C    C  39.227 -17.850  -2.806 1.00 . A A .  78 ALA C    1 1 
        2  3027 1 1  78 ALA CA   C  40.532 -17.829  -3.596 1.00 . A A .  78 ALA CA   1 1 
        2  3028 1 1  78 ALA CB   C  41.415 -16.681  -3.130 1.00 . A A .  78 ALA CB   1 1 
        2  3029 1 1  78 ALA H    H  40.530 -16.902  -5.498 1.00 . A A .  78 ALA H    1 1 
        2  3030 1 1  78 ALA HA   H  41.063 -18.754  -3.419 1.00 . A A .  78 ALA HA   1 1 
        2  3031 1 1  78 ALA HB1  H  40.903 -16.123  -2.361 1.00 . A A .  78 ALA HB1  1 1 
        2  3032 1 1  78 ALA HB2  H  42.339 -17.076  -2.734 1.00 . A A .  78 ALA HB2  1 1 
        2  3033 1 1  78 ALA HB3  H  41.630 -16.031  -3.966 1.00 . A A .  78 ALA HB3  1 1 
        2  3034 1 1  78 ALA N    N  40.276 -17.723  -5.027 1.00 . A A .  78 ALA N    1 1 
        2  3035 1 1  78 ALA O    O  39.178 -18.351  -1.682 1.00 . A A .  78 ALA O    1 1 
        2  3036 1 1  79 THR C    C  35.799 -17.905  -3.618 1.00 . A A .  79 THR C    1 1 
        2  3037 1 1  79 THR CA   C  36.869 -17.254  -2.750 1.00 . A A .  79 THR CA   1 1 
        2  3038 1 1  79 THR CB   C  36.449 -15.806  -2.435 1.00 . A A .  79 THR CB   1 1 
        2  3039 1 1  79 THR CG2  C  36.368 -14.978  -3.708 1.00 . A A .  79 THR CG2  1 1 
        2  3040 1 1  79 THR H    H  38.275 -16.918  -4.295 1.00 . A A .  79 THR H    1 1 
        2  3041 1 1  79 THR HA   H  36.941 -17.797  -1.817 1.00 . A A .  79 THR HA   1 1 
        2  3042 1 1  79 THR HB   H  37.190 -15.367  -1.783 1.00 . A A .  79 THR HB   1 1 
        2  3043 1 1  79 THR HG1  H  34.990 -14.911  -1.455 1.00 . A A .  79 THR HG1  1 1 
        2  3044 1 1  79 THR HG21 H  37.233 -14.336  -3.775 1.00 . A A .  79 THR HG21 1 1 
        2  3045 1 1  79 THR HG22 H  35.473 -14.374  -3.688 1.00 . A A .  79 THR HG22 1 1 
        2  3046 1 1  79 THR HG23 H  36.341 -15.636  -4.564 1.00 . A A .  79 THR HG23 1 1 
        2  3047 1 1  79 THR N    N  38.172 -17.302  -3.399 1.00 . A A .  79 THR N    1 1 
        2  3048 1 1  79 THR O    O  34.646 -18.037  -3.206 1.00 . A A .  79 THR O    1 1 
        2  3049 1 1  79 THR OG1  O  35.179 -15.798  -1.772 1.00 . A A .  79 THR OG1  1 1 
        2  3050 1 1  80 SER C    C  34.002 -18.097  -5.928 1.00 . A A .  80 SER C    1 1 
        2  3051 1 1  80 SER CA   C  35.259 -18.944  -5.753 1.00 . A A .  80 SER CA   1 1 
        2  3052 1 1  80 SER CB   C  34.880 -20.341  -5.255 1.00 . A A .  80 SER CB   1 1 
        2  3053 1 1  80 SER H    H  37.119 -18.176  -5.095 1.00 . A A .  80 SER H    1 1 
        2  3054 1 1  80 SER HA   H  35.754 -19.033  -6.707 1.00 . A A .  80 SER HA   1 1 
        2  3055 1 1  80 SER HB2  H  33.952 -20.279  -4.687 1.00 . A A .  80 SER HB2  1 1 
        2  3056 1 1  80 SER HB3  H  34.735 -20.994  -6.103 1.00 . A A .  80 SER HB3  1 1 
        2  3057 1 1  80 SER HG   H  36.591 -21.254  -4.979 1.00 . A A .  80 SER HG   1 1 
        2  3058 1 1  80 SER N    N  36.187 -18.311  -4.823 1.00 . A A .  80 SER N    1 1 
        2  3059 1 1  80 SER O    O  32.895 -18.623  -6.055 1.00 . A A .  80 SER O    1 1 
        2  3060 1 1  80 SER OG   O  35.898 -20.880  -4.430 1.00 . A A .  80 SER OG   1 1 
        2  3061 1 1  81 THR C    C  33.498 -14.582  -6.806 1.00 . A A .  81 THR C    1 1 
        2  3062 1 1  81 THR CA   C  33.062 -15.858  -6.094 1.00 . A A .  81 THR CA   1 1 
        2  3063 1 1  81 THR CB   C  32.443 -15.486  -4.733 1.00 . A A .  81 THR CB   1 1 
        2  3064 1 1  81 THR CG2  C  31.347 -16.469  -4.351 1.00 . A A .  81 THR CG2  1 1 
        2  3065 1 1  81 THR H    H  35.086 -16.420  -5.830 1.00 . A A .  81 THR H    1 1 
        2  3066 1 1  81 THR HA   H  32.307 -16.350  -6.688 1.00 . A A .  81 THR HA   1 1 
        2  3067 1 1  81 THR HB   H  32.009 -14.498  -4.810 1.00 . A A .  81 THR HB   1 1 
        2  3068 1 1  81 THR HG1  H  33.048 -15.345  -2.862 1.00 . A A .  81 THR HG1  1 1 
        2  3069 1 1  81 THR HG21 H  30.465 -15.925  -4.051 1.00 . A A .  81 THR HG21 1 1 
        2  3070 1 1  81 THR HG22 H  31.686 -17.084  -3.530 1.00 . A A .  81 THR HG22 1 1 
        2  3071 1 1  81 THR HG23 H  31.115 -17.096  -5.199 1.00 . A A .  81 THR HG23 1 1 
        2  3072 1 1  81 THR N    N  34.180 -16.779  -5.935 1.00 . A A .  81 THR N    1 1 
        2  3073 1 1  81 THR O    O  34.589 -14.065  -6.564 1.00 . A A .  81 THR O    1 1 
        2  3074 1 1  81 THR OG1  O  33.456 -15.475  -3.721 1.00 . A A .  81 THR OG1  1 1 
        2  3075 1 1  82 LYS C    C  32.074 -11.702  -7.947 1.00 . A A .  82 LYS C    1 1 
        2  3076 1 1  82 LYS CA   C  32.935 -12.863  -8.434 1.00 . A A .  82 LYS CA   1 1 
        2  3077 1 1  82 LYS CB   C  32.703 -13.089  -9.930 1.00 . A A .  82 LYS CB   1 1 
        2  3078 1 1  82 LYS CD   C  30.878 -13.156 -11.654 1.00 . A A .  82 LYS CD   1 1 
        2  3079 1 1  82 LYS CE   C  30.395 -14.340 -12.478 1.00 . A A .  82 LYS CE   1 1 
        2  3080 1 1  82 LYS CG   C  31.307 -13.585 -10.261 1.00 . A A .  82 LYS CG   1 1 
        2  3081 1 1  82 LYS H    H  31.786 -14.537  -7.837 1.00 . A A .  82 LYS H    1 1 
        2  3082 1 1  82 LYS HA   H  33.974 -12.617  -8.273 1.00 . A A .  82 LYS HA   1 1 
        2  3083 1 1  82 LYS HB2  H  32.874 -12.150 -10.456 1.00 . A A .  82 LYS HB2  1 1 
        2  3084 1 1  82 LYS HB3  H  33.416 -13.820 -10.285 1.00 . A A .  82 LYS HB3  1 1 
        2  3085 1 1  82 LYS HD2  H  30.072 -12.426 -11.571 1.00 . A A .  82 LYS HD2  1 1 
        2  3086 1 1  82 LYS HD3  H  31.720 -12.700 -12.156 1.00 . A A .  82 LYS HD3  1 1 
        2  3087 1 1  82 LYS HE2  H  30.242 -15.194 -11.818 1.00 . A A .  82 LYS HE2  1 1 
        2  3088 1 1  82 LYS HE3  H  29.455 -14.079 -12.941 1.00 . A A .  82 LYS HE3  1 1 
        2  3089 1 1  82 LYS HG2  H  31.290 -14.673 -10.201 1.00 . A A .  82 LYS HG2  1 1 
        2  3090 1 1  82 LYS HG3  H  30.610 -13.180  -9.541 1.00 . A A .  82 LYS HG3  1 1 
        2  3091 1 1  82 LYS HZ1  H  32.314 -14.344 -13.303 1.00 . A A .  82 LYS HZ1  1 1 
        2  3092 1 1  82 LYS HZ2  H  31.072 -14.318 -14.453 1.00 . A A .  82 LYS HZ2  1 1 
        2  3093 1 1  82 LYS HZ3  H  31.428 -15.748 -13.623 1.00 . A A .  82 LYS HZ3  1 1 
        2  3094 1 1  82 LYS N    N  32.640 -14.079  -7.687 1.00 . A A .  82 LYS N    1 1 
        2  3095 1 1  82 LYS NZ   N  31.372 -14.713 -13.538 1.00 . A A .  82 LYS NZ   1 1 
        2  3096 1 1  82 LYS O    O  31.010 -11.908  -7.364 1.00 . A A .  82 LYS O    1 1 
        2  3097 1 1  83 SER C    C  31.510  -8.392  -8.968 1.00 . A A .  83 SER C    1 1 
        2  3098 1 1  83 SER CA   C  31.814  -9.288  -7.771 1.00 . A A .  83 SER CA   1 1 
        2  3099 1 1  83 SER CB   C  32.621  -8.511  -6.730 1.00 . A A .  83 SER CB   1 1 
        2  3100 1 1  83 SER H    H  33.396 -10.382  -8.657 1.00 . A A .  83 SER H    1 1 
        2  3101 1 1  83 SER HA   H  30.882  -9.605  -7.328 1.00 . A A .  83 SER HA   1 1 
        2  3102 1 1  83 SER HB2  H  33.684  -8.675  -6.906 1.00 . A A .  83 SER HB2  1 1 
        2  3103 1 1  83 SER HB3  H  32.404  -7.456  -6.823 1.00 . A A .  83 SER HB3  1 1 
        2  3104 1 1  83 SER HG   H  32.762  -8.381  -4.780 1.00 . A A .  83 SER HG   1 1 
        2  3105 1 1  83 SER N    N  32.541 -10.481  -8.189 1.00 . A A .  83 SER N    1 1 
        2  3106 1 1  83 SER O    O  32.287  -8.322  -9.919 1.00 . A A .  83 SER O    1 1 
        2  3107 1 1  83 SER OG   O  32.297  -8.931  -5.416 1.00 . A A .  83 SER OG   1 1 
        2  3108 1 1  84 ARG C    C  29.001  -5.746  -9.477 1.00 . A A .  84 ARG C    1 1 
        2  3109 1 1  84 ARG CA   C  29.963  -6.814  -9.989 1.00 . A A .  84 ARG CA   1 1 
        2  3110 1 1  84 ARG CB   C  29.304  -7.612 -11.116 1.00 . A A .  84 ARG CB   1 1 
        2  3111 1 1  84 ARG CD   C  28.971  -5.665 -12.670 1.00 . A A .  84 ARG CD   1 1 
        2  3112 1 1  84 ARG CG   C  28.299  -6.806 -11.924 1.00 . A A .  84 ARG CG   1 1 
        2  3113 1 1  84 ARG CZ   C  31.191  -5.233 -13.636 1.00 . A A .  84 ARG CZ   1 1 
        2  3114 1 1  84 ARG H    H  29.794  -7.802  -8.126 1.00 . A A .  84 ARG H    1 1 
        2  3115 1 1  84 ARG HA   H  30.849  -6.330 -10.374 1.00 . A A .  84 ARG HA   1 1 
        2  3116 1 1  84 ARG HB2  H  30.081  -7.977 -11.787 1.00 . A A .  84 ARG HB2  1 1 
        2  3117 1 1  84 ARG HB3  H  28.790  -8.458 -10.687 1.00 . A A .  84 ARG HB3  1 1 
        2  3118 1 1  84 ARG HD2  H  28.297  -5.301 -13.445 1.00 . A A .  84 ARG HD2  1 1 
        2  3119 1 1  84 ARG HD3  H  29.171  -4.864 -11.973 1.00 . A A .  84 ARG HD3  1 1 
        2  3120 1 1  84 ARG HE   H  30.358  -7.036 -13.452 1.00 . A A .  84 ARG HE   1 1 
        2  3121 1 1  84 ARG HG2  H  27.810  -7.464 -12.643 1.00 . A A .  84 ARG HG2  1 1 
        2  3122 1 1  84 ARG HG3  H  27.556  -6.399 -11.254 1.00 . A A .  84 ARG HG3  1 1 
        2  3123 1 1  84 ARG HH11 H  30.203  -3.587 -13.005 1.00 . A A .  84 ARG HH11 1 1 
        2  3124 1 1  84 ARG HH12 H  31.769  -3.298 -13.688 1.00 . A A .  84 ARG HH12 1 1 
        2  3125 1 1  84 ARG HH21 H  32.421  -6.668 -14.353 1.00 . A A .  84 ARG HH21 1 1 
        2  3126 1 1  84 ARG HH22 H  33.030  -5.051 -14.454 1.00 . A A .  84 ARG HH22 1 1 
        2  3127 1 1  84 ARG N    N  30.372  -7.705  -8.911 1.00 . A A .  84 ARG N    1 1 
        2  3128 1 1  84 ARG NE   N  30.227  -6.079 -13.288 1.00 . A A .  84 ARG NE   1 1 
        2  3129 1 1  84 ARG NH1  N  31.042  -3.932 -13.426 1.00 . A A .  84 ARG NH1  1 1 
        2  3130 1 1  84 ARG NH2  N  32.306  -5.687 -14.194 1.00 . A A .  84 ARG NH2  1 1 
        2  3131 1 1  84 ARG O    O  27.950  -6.058  -8.918 1.00 . A A .  84 ARG O    1 1 
        2  3132 1 1  85 THR C    C  27.739  -2.785 -10.384 1.00 . A A .  85 THR C    1 1 
        2  3133 1 1  85 THR CA   C  28.542  -3.368  -9.227 1.00 . A A .  85 THR CA   1 1 
        2  3134 1 1  85 THR CB   C  29.395  -2.253  -8.594 1.00 . A A .  85 THR CB   1 1 
        2  3135 1 1  85 THR CG2  C  29.501  -2.443  -7.087 1.00 . A A .  85 THR CG2  1 1 
        2  3136 1 1  85 THR H    H  30.220  -4.298 -10.122 1.00 . A A .  85 THR H    1 1 
        2  3137 1 1  85 THR HA   H  27.858  -3.739  -8.477 1.00 . A A .  85 THR HA   1 1 
        2  3138 1 1  85 THR HB   H  28.919  -1.302  -8.789 1.00 . A A .  85 THR HB   1 1 
        2  3139 1 1  85 THR HG1  H  30.658  -1.900 -10.067 1.00 . A A .  85 THR HG1  1 1 
        2  3140 1 1  85 THR HG21 H  30.541  -2.450  -6.799 1.00 . A A .  85 THR HG21 1 1 
        2  3141 1 1  85 THR HG22 H  29.044  -3.379  -6.809 1.00 . A A .  85 THR HG22 1 1 
        2  3142 1 1  85 THR HG23 H  28.994  -1.632  -6.587 1.00 . A A .  85 THR HG23 1 1 
        2  3143 1 1  85 THR N    N  29.370  -4.483  -9.670 1.00 . A A .  85 THR N    1 1 
        2  3144 1 1  85 THR O    O  28.303  -2.374 -11.397 1.00 . A A .  85 THR O    1 1 
        2  3145 1 1  85 THR OG1  O  30.705  -2.248  -9.172 1.00 . A A .  85 THR OG1  1 1 
        2  3146 1 1  86 GLY C    C  25.034  -0.833 -10.927 1.00 . A A .  86 GLY C    1 1 
        2  3147 1 1  86 GLY CA   C  25.562  -2.214 -11.265 1.00 . A A .  86 GLY CA   1 1 
        2  3148 1 1  86 GLY H    H  26.025  -3.093  -9.395 1.00 . A A .  86 GLY H    1 1 
        2  3149 1 1  86 GLY HA2  H  26.122  -2.159 -12.187 1.00 . A A .  86 GLY HA2  1 1 
        2  3150 1 1  86 GLY HA3  H  24.723  -2.882 -11.405 1.00 . A A .  86 GLY HA3  1 1 
        2  3151 1 1  86 GLY N    N  26.420  -2.751 -10.225 1.00 . A A .  86 GLY N    1 1 
        2  3152 1 1  86 GLY O    O  24.629  -0.576  -9.794 1.00 . A A .  86 GLY O    1 1 
        2  3153 1 1  87 THR C    C  23.080   1.537 -12.042 1.00 . A A .  87 THR C    1 1 
        2  3154 1 1  87 THR CA   C  24.563   1.422 -11.714 1.00 . A A .  87 THR CA   1 1 
        2  3155 1 1  87 THR CB   C  25.350   2.424 -12.580 1.00 . A A .  87 THR CB   1 1 
        2  3156 1 1  87 THR CG2  C  24.914   2.339 -14.035 1.00 . A A .  87 THR CG2  1 1 
        2  3157 1 1  87 THR H    H  25.377  -0.207 -12.794 1.00 . A A .  87 THR H    1 1 
        2  3158 1 1  87 THR HA   H  24.714   1.678 -10.676 1.00 . A A .  87 THR HA   1 1 
        2  3159 1 1  87 THR HB   H  26.401   2.183 -12.519 1.00 . A A .  87 THR HB   1 1 
        2  3160 1 1  87 THR HG1  H  25.350   4.385 -12.788 1.00 . A A .  87 THR HG1  1 1 
        2  3161 1 1  87 THR HG21 H  24.902   1.306 -14.346 1.00 . A A .  87 THR HG21 1 1 
        2  3162 1 1  87 THR HG22 H  25.609   2.892 -14.650 1.00 . A A .  87 THR HG22 1 1 
        2  3163 1 1  87 THR HG23 H  23.925   2.760 -14.141 1.00 . A A .  87 THR HG23 1 1 
        2  3164 1 1  87 THR N    N  25.041   0.058 -11.913 1.00 . A A .  87 THR N    1 1 
        2  3165 1 1  87 THR O    O  22.556   0.788 -12.868 1.00 . A A .  87 THR O    1 1 
        2  3166 1 1  87 THR OG1  O  25.147   3.755 -12.093 1.00 . A A .  87 THR OG1  1 1 
        2  3167 1 1  88 LEU C    C  20.742   3.450 -12.923 1.00 . A A .  88 LEU C    1 1 
        2  3168 1 1  88 LEU CA   C  20.981   2.695 -11.618 1.00 . A A .  88 LEU CA   1 1 
        2  3169 1 1  88 LEU CB   C  20.371   3.469 -10.449 1.00 . A A .  88 LEU CB   1 1 
        2  3170 1 1  88 LEU CD1  C  18.225   2.710  -9.401 1.00 . A A .  88 LEU CD1  1 1 
        2  3171 1 1  88 LEU CD2  C  18.445   5.059 -10.230 1.00 . A A .  88 LEU CD2  1 1 
        2  3172 1 1  88 LEU CG   C  18.849   3.609 -10.457 1.00 . A A .  88 LEU CG   1 1 
        2  3173 1 1  88 LEU H    H  22.878   3.047 -10.749 1.00 . A A .  88 LEU H    1 1 
        2  3174 1 1  88 LEU HA   H  20.507   1.728 -11.685 1.00 . A A .  88 LEU HA   1 1 
        2  3175 1 1  88 LEU HB2  H  20.665   2.977  -9.522 1.00 . A A .  88 LEU HB2  1 1 
        2  3176 1 1  88 LEU HB3  H  20.795   4.463 -10.455 1.00 . A A .  88 LEU HB3  1 1 
        2  3177 1 1  88 LEU HD11 H  17.399   2.165  -9.834 1.00 . A A .  88 LEU HD11 1 1 
        2  3178 1 1  88 LEU HD12 H  17.867   3.312  -8.579 1.00 . A A .  88 LEU HD12 1 1 
        2  3179 1 1  88 LEU HD13 H  18.966   2.011  -9.039 1.00 . A A .  88 LEU HD13 1 1 
        2  3180 1 1  88 LEU HD21 H  18.712   5.645 -11.097 1.00 . A A .  88 LEU HD21 1 1 
        2  3181 1 1  88 LEU HD22 H  18.958   5.443  -9.362 1.00 . A A .  88 LEU HD22 1 1 
        2  3182 1 1  88 LEU HD23 H  17.377   5.115 -10.073 1.00 . A A .  88 LEU HD23 1 1 
        2  3183 1 1  88 LEU HG   H  18.470   3.302 -11.422 1.00 . A A .  88 LEU HG   1 1 
        2  3184 1 1  88 LEU N    N  22.407   2.479 -11.395 1.00 . A A .  88 LEU N    1 1 
        2  3185 1 1  88 LEU O    O  21.536   4.309 -13.306 1.00 . A A .  88 LEU O    1 1 
        2  3186 1 1  89 GLN C    C  18.050   4.631 -14.703 1.00 . A A .  89 GLN C    1 1 
        2  3187 1 1  89 GLN CA   C  19.301   3.772 -14.856 1.00 . A A .  89 GLN CA   1 1 
        2  3188 1 1  89 GLN CB   C  19.085   2.726 -15.950 1.00 . A A .  89 GLN CB   1 1 
        2  3189 1 1  89 GLN CD   C  20.245   0.490 -15.747 1.00 . A A .  89 GLN CD   1 1 
        2  3190 1 1  89 GLN CG   C  20.328   1.912 -16.268 1.00 . A A .  89 GLN CG   1 1 
        2  3191 1 1  89 GLN H    H  19.051   2.430 -13.238 1.00 . A A .  89 GLN H    1 1 
        2  3192 1 1  89 GLN HA   H  20.127   4.407 -15.137 1.00 . A A .  89 GLN HA   1 1 
        2  3193 1 1  89 GLN HB2  H  18.294   2.047 -15.632 1.00 . A A .  89 GLN HB2  1 1 
        2  3194 1 1  89 GLN HB3  H  18.769   3.227 -16.854 1.00 . A A .  89 GLN HB3  1 1 
        2  3195 1 1  89 GLN HE21 H  19.026  -0.010 -17.236 1.00 . A A .  89 GLN HE21 1 1 
        2  3196 1 1  89 GLN HE22 H  19.412  -1.275 -16.124 1.00 . A A .  89 GLN HE22 1 1 
        2  3197 1 1  89 GLN HG2  H  20.466   1.884 -17.349 1.00 . A A .  89 GLN HG2  1 1 
        2  3198 1 1  89 GLN HG3  H  21.183   2.395 -15.818 1.00 . A A .  89 GLN HG3  1 1 
        2  3199 1 1  89 GLN N    N  19.644   3.124 -13.596 1.00 . A A .  89 GLN N    1 1 
        2  3200 1 1  89 GLN NE2  N  19.484  -0.350 -16.438 1.00 . A A .  89 GLN NE2  1 1 
        2  3201 1 1  89 GLN O    O  18.128   5.858 -14.661 1.00 . A A .  89 GLN O    1 1 
        2  3202 1 1  89 GLN OE1  O  20.858   0.152 -14.735 1.00 . A A .  89 GLN OE1  1 1 
        2  3203 1 1  90 LYS C    C  14.669   3.891 -13.586 1.00 . A A .  90 LYS C    1 1 
        2  3204 1 1  90 LYS CA   C  15.627   4.680 -14.472 1.00 . A A .  90 LYS CA   1 1 
        2  3205 1 1  90 LYS CB   C  14.990   4.920 -15.843 1.00 . A A .  90 LYS CB   1 1 
        2  3206 1 1  90 LYS CD   C  15.206   2.548 -16.640 1.00 . A A .  90 LYS CD   1 1 
        2  3207 1 1  90 LYS CE   C  14.817   1.765 -17.883 1.00 . A A .  90 LYS CE   1 1 
        2  3208 1 1  90 LYS CG   C  14.258   3.709 -16.393 1.00 . A A .  90 LYS CG   1 1 
        2  3209 1 1  90 LYS H    H  16.898   2.998 -14.661 1.00 . A A .  90 LYS H    1 1 
        2  3210 1 1  90 LYS HA   H  15.829   5.633 -14.006 1.00 . A A .  90 LYS HA   1 1 
        2  3211 1 1  90 LYS HB2  H  14.284   5.747 -15.760 1.00 . A A .  90 LYS HB2  1 1 
        2  3212 1 1  90 LYS HB3  H  15.764   5.195 -16.544 1.00 . A A .  90 LYS HB3  1 1 
        2  3213 1 1  90 LYS HD2  H  16.218   2.934 -16.763 1.00 . A A .  90 LYS HD2  1 1 
        2  3214 1 1  90 LYS HD3  H  15.181   1.887 -15.784 1.00 . A A .  90 LYS HD3  1 1 
        2  3215 1 1  90 LYS HE2  H  15.475   0.901 -17.979 1.00 . A A .  90 LYS HE2  1 1 
        2  3216 1 1  90 LYS HE3  H  13.799   1.421 -17.772 1.00 . A A .  90 LYS HE3  1 1 
        2  3217 1 1  90 LYS HG2  H  13.492   3.400 -15.682 1.00 . A A .  90 LYS HG2  1 1 
        2  3218 1 1  90 LYS HG3  H  13.785   3.979 -17.328 1.00 . A A .  90 LYS HG3  1 1 
        2  3219 1 1  90 LYS HZ1  H  13.977   2.920 -19.405 1.00 . A A .  90 LYS HZ1  1 1 
        2  3220 1 1  90 LYS HZ2  H  15.333   2.033 -19.889 1.00 . A A .  90 LYS HZ2  1 1 
        2  3221 1 1  90 LYS HZ3  H  15.524   3.421 -18.941 1.00 . A A .  90 LYS HZ3  1 1 
        2  3222 1 1  90 LYS N    N  16.896   3.977 -14.621 1.00 . A A .  90 LYS N    1 1 
        2  3223 1 1  90 LYS NZ   N  14.920   2.593 -19.116 1.00 . A A .  90 LYS NZ   1 1 
        2  3224 1 1  90 LYS O    O  14.560   2.672 -13.705 1.00 . A A .  90 LYS O    1 1 
        2  3225 1 1  91 ALA C    C  11.666   3.786 -12.461 1.00 . A A .  91 ALA C    1 1 
        2  3226 1 1  91 ALA CA   C  13.025   3.961 -11.793 1.00 . A A .  91 ALA CA   1 1 
        2  3227 1 1  91 ALA CB   C  12.886   4.777 -10.516 1.00 . A A .  91 ALA CB   1 1 
        2  3228 1 1  91 ALA H    H  14.106   5.566 -12.650 1.00 . A A .  91 ALA H    1 1 
        2  3229 1 1  91 ALA HA   H  13.413   2.989 -11.529 1.00 . A A .  91 ALA HA   1 1 
        2  3230 1 1  91 ALA HB1  H  12.352   5.692 -10.730 1.00 . A A .  91 ALA HB1  1 1 
        2  3231 1 1  91 ALA HB2  H  12.338   4.204  -9.781 1.00 . A A .  91 ALA HB2  1 1 
        2  3232 1 1  91 ALA HB3  H  13.867   5.013 -10.133 1.00 . A A .  91 ALA HB3  1 1 
        2  3233 1 1  91 ALA N    N  13.976   4.596 -12.697 1.00 . A A .  91 ALA N    1 1 
        2  3234 1 1  91 ALA O    O  11.004   4.764 -12.812 1.00 . A A .  91 ALA O    1 1 
        2  3235 1 1  92 LEU C    C   9.292   1.056 -12.570 1.00 . A A .  92 LEU C    1 1 
        2  3236 1 1  92 LEU CA   C   9.973   2.231 -13.262 1.00 . A A .  92 LEU CA   1 1 
        2  3237 1 1  92 LEU CB   C  10.170   1.918 -14.747 1.00 . A A .  92 LEU CB   1 1 
        2  3238 1 1  92 LEU CD1  C   9.888   4.263 -15.587 1.00 . A A .  92 LEU CD1  1 1 
        2  3239 1 1  92 LEU CD2  C   9.622   2.336 -17.157 1.00 . A A .  92 LEU CD2  1 1 
        2  3240 1 1  92 LEU CG   C   9.424   2.822 -15.729 1.00 . A A .  92 LEU CG   1 1 
        2  3241 1 1  92 LEU H    H  11.825   1.797 -12.335 1.00 . A A .  92 LEU H    1 1 
        2  3242 1 1  92 LEU HA   H   9.343   3.103 -13.168 1.00 . A A .  92 LEU HA   1 1 
        2  3243 1 1  92 LEU HB2  H  11.235   1.976 -14.971 1.00 . A A .  92 LEU HB2  1 1 
        2  3244 1 1  92 LEU HB3  H   9.843   0.903 -14.916 1.00 . A A .  92 LEU HB3  1 1 
        2  3245 1 1  92 LEU HD11 H   9.701   4.794 -16.508 1.00 . A A .  92 LEU HD11 1 1 
        2  3246 1 1  92 LEU HD12 H  10.945   4.281 -15.369 1.00 . A A .  92 LEU HD12 1 1 
        2  3247 1 1  92 LEU HD13 H   9.346   4.737 -14.780 1.00 . A A .  92 LEU HD13 1 1 
        2  3248 1 1  92 LEU HD21 H  10.399   2.916 -17.631 1.00 . A A .  92 LEU HD21 1 1 
        2  3249 1 1  92 LEU HD22 H   8.699   2.450 -17.707 1.00 . A A .  92 LEU HD22 1 1 
        2  3250 1 1  92 LEU HD23 H   9.905   1.293 -17.146 1.00 . A A .  92 LEU HD23 1 1 
        2  3251 1 1  92 LEU HG   H   8.366   2.789 -15.506 1.00 . A A .  92 LEU HG   1 1 
        2  3252 1 1  92 LEU N    N  11.254   2.535 -12.635 1.00 . A A .  92 LEU N    1 1 
        2  3253 1 1  92 LEU O    O   8.363   0.455 -13.111 1.00 . A A .  92 LEU O    1 1 
        2  3254 1 1  93 PHE C    C   8.039   0.110  -9.728 1.00 . A A .  93 PHE C    1 1 
        2  3255 1 1  93 PHE CA   C   9.194  -0.371 -10.599 1.00 . A A .  93 PHE CA   1 1 
        2  3256 1 1  93 PHE CB   C  10.273  -1.017  -9.728 1.00 . A A .  93 PHE CB   1 1 
        2  3257 1 1  93 PHE CD1  C  11.875  -2.280 -11.188 1.00 . A A .  93 PHE CD1  1 1 
        2  3258 1 1  93 PHE CD2  C  10.266  -3.518  -9.938 1.00 . A A .  93 PHE CD2  1 1 
        2  3259 1 1  93 PHE CE1  C  12.376  -3.457 -11.713 1.00 . A A .  93 PHE CE1  1 1 
        2  3260 1 1  93 PHE CE2  C  10.764  -4.697 -10.458 1.00 . A A .  93 PHE CE2  1 1 
        2  3261 1 1  93 PHE CG   C  10.815  -2.298 -10.296 1.00 . A A .  93 PHE CG   1 1 
        2  3262 1 1  93 PHE CZ   C  11.820  -4.667 -11.348 1.00 . A A .  93 PHE CZ   1 1 
        2  3263 1 1  93 PHE H    H  10.502   1.249 -10.989 1.00 . A A .  93 PHE H    1 1 
        2  3264 1 1  93 PHE HA   H   8.821  -1.104 -11.298 1.00 . A A .  93 PHE HA   1 1 
        2  3265 1 1  93 PHE HB2  H  11.095  -0.311  -9.608 1.00 . A A .  93 PHE HB2  1 1 
        2  3266 1 1  93 PHE HB3  H   9.856  -1.234  -8.755 1.00 . A A .  93 PHE HB3  1 1 
        2  3267 1 1  93 PHE HD1  H  12.312  -1.334 -11.476 1.00 . A A .  93 PHE HD1  1 1 
        2  3268 1 1  93 PHE HD2  H   9.440  -3.543  -9.242 1.00 . A A .  93 PHE HD2  1 1 
        2  3269 1 1  93 PHE HE1  H  13.203  -3.429 -12.409 1.00 . A A .  93 PHE HE1  1 1 
        2  3270 1 1  93 PHE HE2  H  10.327  -5.641 -10.171 1.00 . A A .  93 PHE HE2  1 1 
        2  3271 1 1  93 PHE HZ   H  12.211  -5.586 -11.755 1.00 . A A .  93 PHE HZ   1 1 
        2  3272 1 1  93 PHE N    N   9.759   0.733 -11.368 1.00 . A A .  93 PHE N    1 1 
        2  3273 1 1  93 PHE O    O   6.873  -0.145 -10.027 1.00 . A A .  93 PHE O    1 1 
        2  3274 1 1  94 ASN C    C   8.012   2.089  -6.580 1.00 . A A .  94 ASN C    1 1 
        2  3275 1 1  94 ASN CA   C   7.363   1.320  -7.726 1.00 . A A .  94 ASN CA   1 1 
        2  3276 1 1  94 ASN CB   C   6.515   0.174  -7.171 1.00 . A A .  94 ASN CB   1 1 
        2  3277 1 1  94 ASN CG   C   5.028   0.425  -7.329 1.00 . A A .  94 ASN CG   1 1 
        2  3278 1 1  94 ASN H    H   9.319   0.976  -8.459 1.00 . A A .  94 ASN H    1 1 
        2  3279 1 1  94 ASN HA   H   6.724   1.993  -8.278 1.00 . A A .  94 ASN HA   1 1 
        2  3280 1 1  94 ASN HB2  H   6.776  -0.744  -7.697 1.00 . A A .  94 ASN HB2  1 1 
        2  3281 1 1  94 ASN HB3  H   6.732   0.049  -6.121 1.00 . A A .  94 ASN HB3  1 1 
        2  3282 1 1  94 ASN HD21 H   4.703  -0.185  -5.464 1.00 . A A .  94 ASN HD21 1 1 
        2  3283 1 1  94 ASN HD22 H   3.303   0.308  -6.348 1.00 . A A .  94 ASN HD22 1 1 
        2  3284 1 1  94 ASN N    N   8.372   0.805  -8.645 1.00 . A A .  94 ASN N    1 1 
        2  3285 1 1  94 ASN ND2  N   4.267   0.156  -6.273 1.00 . A A .  94 ASN ND2  1 1 
        2  3286 1 1  94 ASN O    O   7.607   3.206  -6.258 1.00 . A A .  94 ASN O    1 1 
        2  3287 1 1  94 ASN OD1  O   4.569   0.857  -8.386 1.00 . A A .  94 ASN OD1  1 1 
        2  3288 1 1  95 VAL C    C  11.058   2.702  -5.314 1.00 . A A .  95 VAL C    1 1 
        2  3289 1 1  95 VAL CA   C   9.731   2.109  -4.855 1.00 . A A .  95 VAL CA   1 1 
        2  3290 1 1  95 VAL CB   C   9.995   1.103  -3.718 1.00 . A A .  95 VAL CB   1 1 
        2  3291 1 1  95 VAL CG1  C   8.708   0.792  -2.972 1.00 . A A .  95 VAL CG1  1 1 
        2  3292 1 1  95 VAL CG2  C  10.623  -0.167  -4.268 1.00 . A A .  95 VAL CG2  1 1 
        2  3293 1 1  95 VAL H    H   9.300   0.592  -6.266 1.00 . A A .  95 VAL H    1 1 
        2  3294 1 1  95 VAL HA   H   9.108   2.902  -4.468 1.00 . A A .  95 VAL HA   1 1 
        2  3295 1 1  95 VAL HB   H  10.690   1.552  -3.024 1.00 . A A .  95 VAL HB   1 1 
        2  3296 1 1  95 VAL HG11 H   8.207  -0.038  -3.446 1.00 . A A .  95 VAL HG11 1 1 
        2  3297 1 1  95 VAL HG12 H   8.939   0.537  -1.947 1.00 . A A .  95 VAL HG12 1 1 
        2  3298 1 1  95 VAL HG13 H   8.063   1.658  -2.989 1.00 . A A .  95 VAL HG13 1 1 
        2  3299 1 1  95 VAL HG21 H   9.853  -0.802  -4.682 1.00 . A A .  95 VAL HG21 1 1 
        2  3300 1 1  95 VAL HG22 H  11.334   0.087  -5.042 1.00 . A A .  95 VAL HG22 1 1 
        2  3301 1 1  95 VAL HG23 H  11.132  -0.692  -3.472 1.00 . A A .  95 VAL HG23 1 1 
        2  3302 1 1  95 VAL N    N   9.023   1.481  -5.966 1.00 . A A .  95 VAL N    1 1 
        2  3303 1 1  95 VAL O    O  11.414   2.614  -6.489 1.00 . A A .  95 VAL O    1 1 
        2  3304 1 1  96 GLU C    C  14.220   2.971  -4.329 1.00 . A A .  96 GLU C    1 1 
        2  3305 1 1  96 GLU CA   C  13.075   3.913  -4.689 1.00 . A A .  96 GLU CA   1 1 
        2  3306 1 1  96 GLU CB   C  13.232   5.236  -3.939 1.00 . A A .  96 GLU CB   1 1 
        2  3307 1 1  96 GLU CD   C  14.557   5.649  -1.828 1.00 . A A .  96 GLU CD   1 1 
        2  3308 1 1  96 GLU CG   C  13.288   5.078  -2.429 1.00 . A A .  96 GLU CG   1 1 
        2  3309 1 1  96 GLU H    H  11.448   3.342  -3.460 1.00 . A A .  96 GLU H    1 1 
        2  3310 1 1  96 GLU HA   H  13.104   4.104  -5.751 1.00 . A A .  96 GLU HA   1 1 
        2  3311 1 1  96 GLU HB2  H  14.150   5.719  -4.273 1.00 . A A .  96 GLU HB2  1 1 
        2  3312 1 1  96 GLU HB3  H  12.396   5.875  -4.182 1.00 . A A .  96 GLU HB3  1 1 
        2  3313 1 1  96 GLU HG2  H  12.430   5.585  -1.989 1.00 . A A .  96 GLU HG2  1 1 
        2  3314 1 1  96 GLU HG3  H  13.234   4.026  -2.188 1.00 . A A .  96 GLU HG3  1 1 
        2  3315 1 1  96 GLU N    N  11.786   3.304  -4.379 1.00 . A A .  96 GLU N    1 1 
        2  3316 1 1  96 GLU O    O  14.161   2.255  -3.327 1.00 . A A .  96 GLU O    1 1 
        2  3317 1 1  96 GLU OE1  O  14.840   6.842  -2.063 1.00 . A A .  96 GLU OE1  1 1 
        2  3318 1 1  96 GLU OE2  O  15.269   4.903  -1.124 1.00 . A A .  96 GLU OE2  1 1 
        2  3319 1 1  97 CYS C    C  17.703   2.949  -4.864 1.00 . A A .  97 CYS C    1 1 
        2  3320 1 1  97 CYS CA   C  16.424   2.123  -4.921 1.00 . A A .  97 CYS CA   1 1 
        2  3321 1 1  97 CYS CB   C  16.533   1.068  -6.025 1.00 . A A .  97 CYS CB   1 1 
        2  3322 1 1  97 CYS H    H  15.253   3.567  -5.933 1.00 . A A .  97 CYS H    1 1 
        2  3323 1 1  97 CYS HA   H  16.287   1.625  -3.973 1.00 . A A .  97 CYS HA   1 1 
        2  3324 1 1  97 CYS HB2  H  16.182   1.505  -6.960 1.00 . A A .  97 CYS HB2  1 1 
        2  3325 1 1  97 CYS HB3  H  17.571   0.788  -6.143 1.00 . A A .  97 CYS HB3  1 1 
        2  3326 1 1  97 CYS HG   H  15.719  -0.796  -4.415 1.00 . A A .  97 CYS HG   1 1 
        2  3327 1 1  97 CYS N    N  15.264   2.976  -5.151 1.00 . A A .  97 CYS N    1 1 
        2  3328 1 1  97 CYS O    O  17.725   4.107  -5.282 1.00 . A A .  97 CYS O    1 1 
        2  3329 1 1  97 CYS SG   S  15.582  -0.451  -5.699 1.00 . A A .  97 CYS SG   1 1 
        2  3330 1 1  98 GLN C    C  20.623   3.346  -5.610 1.00 . A A .  98 GLN C    1 1 
        2  3331 1 1  98 GLN CA   C  20.054   3.029  -4.232 1.00 . A A .  98 GLN CA   1 1 
        2  3332 1 1  98 GLN CB   C  21.043   2.169  -3.442 1.00 . A A .  98 GLN CB   1 1 
        2  3333 1 1  98 GLN CD   C  22.280   1.812  -1.269 1.00 . A A .  98 GLN CD   1 1 
        2  3334 1 1  98 GLN CG   C  21.253   2.643  -2.013 1.00 . A A .  98 GLN CG   1 1 
        2  3335 1 1  98 GLN H    H  18.688   1.423  -4.029 1.00 . A A .  98 GLN H    1 1 
        2  3336 1 1  98 GLN HA   H  19.891   3.955  -3.702 1.00 . A A .  98 GLN HA   1 1 
        2  3337 1 1  98 GLN HB2  H  20.675   1.143  -3.421 1.00 . A A .  98 GLN HB2  1 1 
        2  3338 1 1  98 GLN HB3  H  21.997   2.185  -3.947 1.00 . A A .  98 GLN HB3  1 1 
        2  3339 1 1  98 GLN HE21 H  20.981   1.475   0.198 1.00 . A A .  98 GLN HE21 1 1 
        2  3340 1 1  98 GLN HE22 H  22.538   0.754   0.393 1.00 . A A .  98 GLN HE22 1 1 
        2  3341 1 1  98 GLN HG2  H  21.582   3.682  -2.029 1.00 . A A .  98 GLN HG2  1 1 
        2  3342 1 1  98 GLN HG3  H  20.312   2.582  -1.485 1.00 . A A .  98 GLN HG3  1 1 
        2  3343 1 1  98 GLN N    N  18.769   2.348  -4.344 1.00 . A A .  98 GLN N    1 1 
        2  3344 1 1  98 GLN NE2  N  21.895   1.295  -0.108 1.00 . A A .  98 GLN NE2  1 1 
        2  3345 1 1  98 GLN O    O  20.321   2.664  -6.589 1.00 . A A .  98 GLN O    1 1 
        2  3346 1 1  98 GLN OE1  O  23.407   1.637  -1.732 1.00 . A A .  98 GLN OE1  1 1 
        2  3347 1 1  99 GLN C    C  22.750   3.613  -7.614 1.00 . A A .  99 GLN C    1 1 
        2  3348 1 1  99 GLN CA   C  22.061   4.792  -6.938 1.00 . A A .  99 GLN CA   1 1 
        2  3349 1 1  99 GLN CB   C  23.067   5.918  -6.699 1.00 . A A .  99 GLN CB   1 1 
        2  3350 1 1  99 GLN CD   C  23.017   7.640  -8.548 1.00 . A A .  99 GLN CD   1 1 
        2  3351 1 1  99 GLN CG   C  23.723   6.428  -7.972 1.00 . A A .  99 GLN CG   1 1 
        2  3352 1 1  99 GLN H    H  21.651   4.889  -4.864 1.00 . A A .  99 GLN H    1 1 
        2  3353 1 1  99 GLN HA   H  21.277   5.154  -7.586 1.00 . A A .  99 GLN HA   1 1 
        2  3354 1 1  99 GLN HB2  H  22.554   6.748  -6.213 1.00 . A A .  99 GLN HB2  1 1 
        2  3355 1 1  99 GLN HB3  H  23.844   5.558  -6.040 1.00 . A A .  99 GLN HB3  1 1 
        2  3356 1 1  99 GLN HE21 H  21.959   6.477  -9.764 1.00 . A A .  99 GLN HE21 1 1 
        2  3357 1 1  99 GLN HE22 H  21.643   8.171  -9.883 1.00 . A A .  99 GLN HE22 1 1 
        2  3358 1 1  99 GLN HG2  H  24.758   6.693  -7.755 1.00 . A A .  99 GLN HG2  1 1 
        2  3359 1 1  99 GLN HG3  H  23.711   5.639  -8.710 1.00 . A A .  99 GLN HG3  1 1 
        2  3360 1 1  99 GLN N    N  21.449   4.385  -5.679 1.00 . A A .  99 GLN N    1 1 
        2  3361 1 1  99 GLN NE2  N  22.116   7.406  -9.494 1.00 . A A .  99 GLN NE2  1 1 
        2  3362 1 1  99 GLN O    O  22.769   3.511  -8.842 1.00 . A A .  99 GLN O    1 1 
        2  3363 1 1  99 GLN OE1  O  23.278   8.774  -8.146 1.00 . A A .  99 GLN OE1  1 1 
        2  3364 1 1 100 THR C    C  23.895   0.373  -6.368 1.00 . A A . 100 THR C    1 1 
        2  3365 1 1 100 THR CA   C  24.011   1.550  -7.328 1.00 . A A . 100 THR CA   1 1 
        2  3366 1 1 100 THR CB   C  25.501   1.846  -7.584 1.00 . A A . 100 THR CB   1 1 
        2  3367 1 1 100 THR CG2  C  26.191   2.292  -6.303 1.00 . A A . 100 THR CG2  1 1 
        2  3368 1 1 100 THR H    H  23.269   2.858  -5.838 1.00 . A A . 100 THR H    1 1 
        2  3369 1 1 100 THR HA   H  23.551   1.282  -8.268 1.00 . A A . 100 THR HA   1 1 
        2  3370 1 1 100 THR HB   H  25.574   2.641  -8.310 1.00 . A A . 100 THR HB   1 1 
        2  3371 1 1 100 THR HG1  H  25.990   0.614  -9.044 1.00 . A A . 100 THR HG1  1 1 
        2  3372 1 1 100 THR HG21 H  25.828   3.268  -6.020 1.00 . A A . 100 THR HG21 1 1 
        2  3373 1 1 100 THR HG22 H  27.257   2.339  -6.466 1.00 . A A . 100 THR HG22 1 1 
        2  3374 1 1 100 THR HG23 H  25.978   1.585  -5.514 1.00 . A A . 100 THR HG23 1 1 
        2  3375 1 1 100 THR N    N  23.318   2.722  -6.807 1.00 . A A . 100 THR N    1 1 
        2  3376 1 1 100 THR O    O  23.518   0.538  -5.208 1.00 . A A . 100 THR O    1 1 
        2  3377 1 1 100 THR OG1  O  26.150   0.678  -8.099 1.00 . A A . 100 THR OG1  1 1 
        2  3378 1 1 101 VAL C    C  25.188  -3.054  -6.500 1.00 . A A . 101 VAL C    1 1 
        2  3379 1 1 101 VAL CA   C  24.160  -2.026  -6.042 1.00 . A A . 101 VAL CA   1 1 
        2  3380 1 1 101 VAL CB   C  22.757  -2.661  -6.091 1.00 . A A . 101 VAL CB   1 1 
        2  3381 1 1 101 VAL CG1  C  21.697  -1.649  -5.685 1.00 . A A . 101 VAL CG1  1 1 
        2  3382 1 1 101 VAL CG2  C  22.473  -3.217  -7.478 1.00 . A A . 101 VAL CG2  1 1 
        2  3383 1 1 101 VAL H    H  24.518  -0.888  -7.790 1.00 . A A . 101 VAL H    1 1 
        2  3384 1 1 101 VAL HA   H  24.371  -1.749  -5.019 1.00 . A A . 101 VAL HA   1 1 
        2  3385 1 1 101 VAL HB   H  22.729  -3.479  -5.385 1.00 . A A . 101 VAL HB   1 1 
        2  3386 1 1 101 VAL HG11 H  21.695  -0.829  -6.390 1.00 . A A . 101 VAL HG11 1 1 
        2  3387 1 1 101 VAL HG12 H  20.727  -2.124  -5.682 1.00 . A A . 101 VAL HG12 1 1 
        2  3388 1 1 101 VAL HG13 H  21.918  -1.273  -4.697 1.00 . A A . 101 VAL HG13 1 1 
        2  3389 1 1 101 VAL HG21 H  22.456  -4.296  -7.438 1.00 . A A . 101 VAL HG21 1 1 
        2  3390 1 1 101 VAL HG22 H  21.515  -2.854  -7.821 1.00 . A A . 101 VAL HG22 1 1 
        2  3391 1 1 101 VAL HG23 H  23.245  -2.894  -8.161 1.00 . A A . 101 VAL HG23 1 1 
        2  3392 1 1 101 VAL N    N  24.224  -0.820  -6.858 1.00 . A A . 101 VAL N    1 1 
        2  3393 1 1 101 VAL O    O  25.475  -3.173  -7.690 1.00 . A A . 101 VAL O    1 1 
        2  3394 1 1 102 SER C    C  26.093  -6.191  -5.966 1.00 . A A . 102 SER C    1 1 
        2  3395 1 1 102 SER CA   C  26.739  -4.814  -5.848 1.00 . A A . 102 SER CA   1 1 
        2  3396 1 1 102 SER CB   C  27.819  -4.837  -4.766 1.00 . A A . 102 SER CB   1 1 
        2  3397 1 1 102 SER H    H  25.468  -3.656  -4.613 1.00 . A A . 102 SER H    1 1 
        2  3398 1 1 102 SER HA   H  27.193  -4.560  -6.793 1.00 . A A . 102 SER HA   1 1 
        2  3399 1 1 102 SER HB2  H  28.435  -5.727  -4.893 1.00 . A A . 102 SER HB2  1 1 
        2  3400 1 1 102 SER HB3  H  28.440  -3.958  -4.863 1.00 . A A . 102 SER HB3  1 1 
        2  3401 1 1 102 SER HG   H  27.940  -4.893  -2.812 1.00 . A A . 102 SER HG   1 1 
        2  3402 1 1 102 SER N    N  25.739  -3.796  -5.544 1.00 . A A . 102 SER N    1 1 
        2  3403 1 1 102 SER O    O  25.016  -6.434  -5.422 1.00 . A A . 102 SER O    1 1 
        2  3404 1 1 102 SER OG   O  27.244  -4.850  -3.471 1.00 . A A . 102 SER OG   1 1 
        2  3405 1 1 103 VAL C    C  27.371  -9.473  -6.738 1.00 . A A . 103 VAL C    1 1 
        2  3406 1 1 103 VAL CA   C  26.253  -8.444  -6.876 1.00 . A A . 103 VAL CA   1 1 
        2  3407 1 1 103 VAL CB   C  25.589  -8.606  -8.256 1.00 . A A . 103 VAL CB   1 1 
        2  3408 1 1 103 VAL CG1  C  24.545  -7.522  -8.475 1.00 . A A . 103 VAL CG1  1 1 
        2  3409 1 1 103 VAL CG2  C  26.637  -8.578  -9.357 1.00 . A A . 103 VAL CG2  1 1 
        2  3410 1 1 103 VAL H    H  27.613  -6.837  -7.094 1.00 . A A . 103 VAL H    1 1 
        2  3411 1 1 103 VAL HA   H  25.509  -8.632  -6.115 1.00 . A A . 103 VAL HA   1 1 
        2  3412 1 1 103 VAL HB   H  25.092  -9.565  -8.284 1.00 . A A . 103 VAL HB   1 1 
        2  3413 1 1 103 VAL HG11 H  25.022  -6.638  -8.870 1.00 . A A . 103 VAL HG11 1 1 
        2  3414 1 1 103 VAL HG12 H  23.801  -7.875  -9.174 1.00 . A A . 103 VAL HG12 1 1 
        2  3415 1 1 103 VAL HG13 H  24.070  -7.284  -7.534 1.00 . A A . 103 VAL HG13 1 1 
        2  3416 1 1 103 VAL HG21 H  26.364  -7.841 -10.098 1.00 . A A . 103 VAL HG21 1 1 
        2  3417 1 1 103 VAL HG22 H  27.597  -8.325  -8.933 1.00 . A A . 103 VAL HG22 1 1 
        2  3418 1 1 103 VAL HG23 H  26.696  -9.550  -9.825 1.00 . A A . 103 VAL HG23 1 1 
        2  3419 1 1 103 VAL N    N  26.760  -7.090  -6.685 1.00 . A A . 103 VAL N    1 1 
        2  3420 1 1 103 VAL O    O  28.553  -9.130  -6.763 1.00 . A A . 103 VAL O    1 1 
        2  3421 1 1 104 THR C    C  27.535 -13.043  -7.255 1.00 . A A . 104 THR C    1 1 
        2  3422 1 1 104 THR CA   C  27.955 -11.818  -6.449 1.00 . A A . 104 THR CA   1 1 
        2  3423 1 1 104 THR CB   C  28.133 -12.223  -4.975 1.00 . A A . 104 THR CB   1 1 
        2  3424 1 1 104 THR CG2  C  29.506 -12.833  -4.741 1.00 . A A . 104 THR CG2  1 1 
        2  3425 1 1 104 THR H    H  26.031 -10.948  -6.580 1.00 . A A . 104 THR H    1 1 
        2  3426 1 1 104 THR HA   H  28.907 -11.464  -6.819 1.00 . A A . 104 THR HA   1 1 
        2  3427 1 1 104 THR HB   H  27.382 -12.960  -4.727 1.00 . A A . 104 THR HB   1 1 
        2  3428 1 1 104 THR HG1  H  28.522 -10.366  -4.439 1.00 . A A . 104 THR HG1  1 1 
        2  3429 1 1 104 THR HG21 H  29.956 -13.080  -5.691 1.00 . A A . 104 THR HG21 1 1 
        2  3430 1 1 104 THR HG22 H  29.407 -13.728  -4.145 1.00 . A A . 104 THR HG22 1 1 
        2  3431 1 1 104 THR HG23 H  30.132 -12.122  -4.221 1.00 . A A . 104 THR HG23 1 1 
        2  3432 1 1 104 THR N    N  26.988 -10.739  -6.592 1.00 . A A . 104 THR N    1 1 
        2  3433 1 1 104 THR O    O  26.347 -13.287  -7.458 1.00 . A A . 104 THR O    1 1 
        2  3434 1 1 104 THR OG1  O  27.961 -11.080  -4.129 1.00 . A A . 104 THR OG1  1 1 
        2  3435 1 1 105 LYS C    C  29.308 -16.081  -8.224 1.00 . A A . 105 LYS C    1 1 
        2  3436 1 1 105 LYS CA   C  28.253 -15.013  -8.493 1.00 . A A . 105 LYS CA   1 1 
        2  3437 1 1 105 LYS CB   C  28.220 -14.677  -9.986 1.00 . A A . 105 LYS CB   1 1 
        2  3438 1 1 105 LYS CD   C  26.837 -14.437 -12.069 1.00 . A A . 105 LYS CD   1 1 
        2  3439 1 1 105 LYS CE   C  27.206 -15.747 -12.748 1.00 . A A . 105 LYS CE   1 1 
        2  3440 1 1 105 LYS CG   C  26.816 -14.581 -10.557 1.00 . A A . 105 LYS CG   1 1 
        2  3441 1 1 105 LYS H    H  29.449 -13.563  -7.516 1.00 . A A . 105 LYS H    1 1 
        2  3442 1 1 105 LYS HA   H  27.287 -15.393  -8.197 1.00 . A A . 105 LYS HA   1 1 
        2  3443 1 1 105 LYS HB2  H  28.726 -13.724 -10.141 1.00 . A A . 105 LYS HB2  1 1 
        2  3444 1 1 105 LYS HB3  H  28.755 -15.445 -10.527 1.00 . A A . 105 LYS HB3  1 1 
        2  3445 1 1 105 LYS HD2  H  25.852 -14.121 -12.412 1.00 . A A . 105 LYS HD2  1 1 
        2  3446 1 1 105 LYS HD3  H  27.566 -13.685 -12.339 1.00 . A A . 105 LYS HD3  1 1 
        2  3447 1 1 105 LYS HE2  H  27.837 -15.535 -13.611 1.00 . A A . 105 LYS HE2  1 1 
        2  3448 1 1 105 LYS HE3  H  27.757 -16.358 -12.049 1.00 . A A . 105 LYS HE3  1 1 
        2  3449 1 1 105 LYS HG2  H  26.261 -15.480 -10.292 1.00 . A A . 105 LYS HG2  1 1 
        2  3450 1 1 105 LYS HG3  H  26.321 -13.720 -10.130 1.00 . A A . 105 LYS HG3  1 1 
        2  3451 1 1 105 LYS HZ1  H  25.683 -17.148 -12.453 1.00 . A A . 105 LYS HZ1  1 1 
        2  3452 1 1 105 LYS HZ2  H  26.220 -17.045 -14.056 1.00 . A A . 105 LYS HZ2  1 1 
        2  3453 1 1 105 LYS HZ3  H  25.228 -15.834 -13.415 1.00 . A A . 105 LYS HZ3  1 1 
        2  3454 1 1 105 LYS N    N  28.520 -13.810  -7.711 1.00 . A A . 105 LYS N    1 1 
        2  3455 1 1 105 LYS NZ   N  26.000 -16.495 -13.200 1.00 . A A . 105 LYS NZ   1 1 
        2  3456 1 1 105 LYS O    O  30.477 -15.785  -7.979 1.00 . A A . 105 LYS O    1 1 
        2  3457 1 1 106 PRO C    C  30.786 -18.681  -9.166 1.00 . A A . 106 PRO C    1 1 
        2  3458 1 1 106 PRO CA   C  29.779 -18.492  -8.037 1.00 . A A . 106 PRO CA   1 1 
        2  3459 1 1 106 PRO CB   C  28.823 -19.685  -7.970 1.00 . A A . 106 PRO CB   1 1 
        2  3460 1 1 106 PRO CD   C  27.505 -17.779  -8.557 1.00 . A A . 106 PRO CD   1 1 
        2  3461 1 1 106 PRO CG   C  27.634 -19.263  -8.762 1.00 . A A . 106 PRO CG   1 1 
        2  3462 1 1 106 PRO HA   H  30.306 -18.398  -7.099 1.00 . A A . 106 PRO HA   1 1 
        2  3463 1 1 106 PRO HB2  H  29.284 -20.565  -8.420 1.00 . A A . 106 PRO HB2  1 1 
        2  3464 1 1 106 PRO HB3  H  28.562 -19.884  -6.942 1.00 . A A . 106 PRO HB3  1 1 
        2  3465 1 1 106 PRO HD2  H  27.134 -17.297  -9.462 1.00 . A A . 106 PRO HD2  1 1 
        2  3466 1 1 106 PRO HD3  H  26.857 -17.568  -7.721 1.00 . A A . 106 PRO HD3  1 1 
        2  3467 1 1 106 PRO HG2  H  27.786 -19.487  -9.818 1.00 . A A . 106 PRO HG2  1 1 
        2  3468 1 1 106 PRO HG3  H  26.752 -19.769  -8.397 1.00 . A A . 106 PRO HG3  1 1 
        2  3469 1 1 106 PRO N    N  28.886 -17.353  -8.271 1.00 . A A . 106 PRO N    1 1 
        2  3470 1 1 106 PRO O    O  30.686 -19.625  -9.951 1.00 . A A . 106 PRO O    1 1 
        2  3471 1 1 107 CYS C    C  34.174 -17.949  -9.658 1.00 . A A . 107 CYS C    1 1 
        2  3472 1 1 107 CYS CA   C  32.783 -17.842 -10.278 1.00 . A A . 107 CYS CA   1 1 
        2  3473 1 1 107 CYS CB   C  32.709 -16.608 -11.180 1.00 . A A . 107 CYS CB   1 1 
        2  3474 1 1 107 CYS H    H  31.784 -17.045  -8.590 1.00 . A A . 107 CYS H    1 1 
        2  3475 1 1 107 CYS HA   H  32.599 -18.724 -10.873 1.00 . A A . 107 CYS HA   1 1 
        2  3476 1 1 107 CYS HB2  H  31.694 -16.522 -11.569 1.00 . A A . 107 CYS HB2  1 1 
        2  3477 1 1 107 CYS HB3  H  32.928 -15.729 -10.593 1.00 . A A . 107 CYS HB3  1 1 
        2  3478 1 1 107 CYS HG   H  33.723 -17.789 -13.255 1.00 . A A . 107 CYS HG   1 1 
        2  3479 1 1 107 CYS N    N  31.757 -17.777  -9.245 1.00 . A A . 107 CYS N    1 1 
        2  3480 1 1 107 CYS O    O  34.439 -17.381  -8.598 1.00 . A A . 107 CYS O    1 1 
        2  3481 1 1 107 CYS SG   S  33.869 -16.642 -12.584 1.00 . A A . 107 CYS SG   1 1 
        2  3482 1 1 108 THR C    C  37.433 -18.706 -10.972 1.00 . A A . 108 THR C    1 1 
        2  3483 1 1 108 THR CA   C  36.421 -18.866  -9.841 1.00 . A A . 108 THR CA   1 1 
        2  3484 1 1 108 THR CB   C  36.606 -20.251  -9.194 1.00 . A A . 108 THR CB   1 1 
        2  3485 1 1 108 THR CG2  C  36.004 -21.341 -10.069 1.00 . A A . 108 THR CG2  1 1 
        2  3486 1 1 108 THR H    H  34.787 -19.111 -11.165 1.00 . A A . 108 THR H    1 1 
        2  3487 1 1 108 THR HA   H  36.612 -18.113  -9.091 1.00 . A A . 108 THR HA   1 1 
        2  3488 1 1 108 THR HB   H  36.100 -20.256  -8.239 1.00 . A A . 108 THR HB   1 1 
        2  3489 1 1 108 THR HG1  H  38.398 -20.792  -9.815 1.00 . A A . 108 THR HG1  1 1 
        2  3490 1 1 108 THR HG21 H  36.103 -21.065 -11.107 1.00 . A A . 108 THR HG21 1 1 
        2  3491 1 1 108 THR HG22 H  34.958 -21.460  -9.826 1.00 . A A . 108 THR HG22 1 1 
        2  3492 1 1 108 THR HG23 H  36.521 -22.271  -9.892 1.00 . A A . 108 THR HG23 1 1 
        2  3493 1 1 108 THR N    N  35.059 -18.683 -10.327 1.00 . A A . 108 THR N    1 1 
        2  3494 1 1 108 THR O    O  37.245 -19.236 -12.067 1.00 . A A . 108 THR O    1 1 
        2  3495 1 1 108 THR OG1  O  37.998 -20.513  -8.988 1.00 . A A . 108 THR OG1  1 1 
        2  3496 1 1 109 THR C    C  40.847 -17.294 -11.033 1.00 . A A . 109 THR C    1 1 
        2  3497 1 1 109 THR CA   C  39.548 -17.742 -11.692 1.00 . A A . 109 THR CA   1 1 
        2  3498 1 1 109 THR CB   C  39.117 -16.683 -12.722 1.00 . A A . 109 THR CB   1 1 
        2  3499 1 1 109 THR CG2  C  40.217 -16.443 -13.745 1.00 . A A . 109 THR CG2  1 1 
        2  3500 1 1 109 THR H    H  38.600 -17.577  -9.806 1.00 . A A . 109 THR H    1 1 
        2  3501 1 1 109 THR HA   H  39.722 -18.672 -12.214 1.00 . A A . 109 THR HA   1 1 
        2  3502 1 1 109 THR HB   H  38.920 -15.755 -12.203 1.00 . A A . 109 THR HB   1 1 
        2  3503 1 1 109 THR HG1  H  37.702 -16.477 -14.081 1.00 . A A . 109 THR HG1  1 1 
        2  3504 1 1 109 THR HG21 H  39.774 -16.192 -14.698 1.00 . A A . 109 THR HG21 1 1 
        2  3505 1 1 109 THR HG22 H  40.813 -17.338 -13.849 1.00 . A A . 109 THR HG22 1 1 
        2  3506 1 1 109 THR HG23 H  40.844 -15.628 -13.415 1.00 . A A . 109 THR HG23 1 1 
        2  3507 1 1 109 THR N    N  38.507 -17.971 -10.698 1.00 . A A . 109 THR N    1 1 
        2  3508 1 1 109 THR O    O  40.833 -16.583 -10.027 1.00 . A A . 109 THR O    1 1 
        2  3509 1 1 109 THR OG1  O  37.922 -17.106 -13.388 1.00 . A A . 109 THR OG1  1 1 
        2  3510 1 1 110 LYS C    C  44.274 -17.100 -12.203 1.00 . A A . 110 LYS C    1 1 
        2  3511 1 1 110 LYS CA   C  43.281 -17.355 -11.074 1.00 . A A . 110 LYS CA   1 1 
        2  3512 1 1 110 LYS CB   C  43.805 -18.463 -10.159 1.00 . A A . 110 LYS CB   1 1 
        2  3513 1 1 110 LYS CD   C  44.623 -17.802  -7.876 1.00 . A A . 110 LYS CD   1 1 
        2  3514 1 1 110 LYS CE   C  43.816 -16.521  -7.723 1.00 . A A . 110 LYS CE   1 1 
        2  3515 1 1 110 LYS CG   C  45.005 -18.048  -9.325 1.00 . A A . 110 LYS CG   1 1 
        2  3516 1 1 110 LYS H    H  41.917 -18.280 -12.403 1.00 . A A . 110 LYS H    1 1 
        2  3517 1 1 110 LYS HA   H  43.168 -16.448 -10.499 1.00 . A A . 110 LYS HA   1 1 
        2  3518 1 1 110 LYS HB2  H  43.003 -18.769  -9.487 1.00 . A A . 110 LYS HB2  1 1 
        2  3519 1 1 110 LYS HB3  H  44.090 -19.310 -10.766 1.00 . A A . 110 LYS HB3  1 1 
        2  3520 1 1 110 LYS HD2  H  44.030 -18.643  -7.517 1.00 . A A . 110 LYS HD2  1 1 
        2  3521 1 1 110 LYS HD3  H  45.522 -17.724  -7.283 1.00 . A A . 110 LYS HD3  1 1 
        2  3522 1 1 110 LYS HE2  H  44.308 -15.722  -8.276 1.00 . A A . 110 LYS HE2  1 1 
        2  3523 1 1 110 LYS HE3  H  42.830 -16.679  -8.134 1.00 . A A . 110 LYS HE3  1 1 
        2  3524 1 1 110 LYS HG2  H  45.758 -18.835  -9.367 1.00 . A A . 110 LYS HG2  1 1 
        2  3525 1 1 110 LYS HG3  H  45.420 -17.139  -9.738 1.00 . A A . 110 LYS HG3  1 1 
        2  3526 1 1 110 LYS HZ1  H  42.974 -15.363  -6.201 1.00 . A A . 110 LYS HZ1  1 1 
        2  3527 1 1 110 LYS HZ2  H  44.598 -15.763  -5.941 1.00 . A A . 110 LYS HZ2  1 1 
        2  3528 1 1 110 LYS HZ3  H  43.394 -16.930  -5.718 1.00 . A A . 110 LYS HZ3  1 1 
        2  3529 1 1 110 LYS N    N  41.971 -17.714 -11.603 1.00 . A A . 110 LYS N    1 1 
        2  3530 1 1 110 LYS NZ   N  43.685 -16.116  -6.295 1.00 . A A . 110 LYS NZ   1 1 
        2  3531 1 1 110 LYS O    O  44.211 -17.739 -13.252 1.00 . A A . 110 LYS O    1 1 
        2  3532 1 1 111 VAL C    C  46.951 -17.073 -13.438 1.00 . A A . 111 VAL C    1 1 
        2  3533 1 1 111 VAL CA   C  46.200 -15.829 -12.976 1.00 . A A . 111 VAL CA   1 1 
        2  3534 1 1 111 VAL CB   C  47.213 -14.805 -12.429 1.00 . A A . 111 VAL CB   1 1 
        2  3535 1 1 111 VAL CG1  C  48.255 -14.467 -13.483 1.00 . A A . 111 VAL CG1  1 1 
        2  3536 1 1 111 VAL CG2  C  46.495 -13.550 -11.956 1.00 . A A . 111 VAL CG2  1 1 
        2  3537 1 1 111 VAL H    H  45.190 -15.690 -11.121 1.00 . A A . 111 VAL H    1 1 
        2  3538 1 1 111 VAL HA   H  45.697 -15.388 -13.824 1.00 . A A . 111 VAL HA   1 1 
        2  3539 1 1 111 VAL HB   H  47.718 -15.246 -11.583 1.00 . A A . 111 VAL HB   1 1 
        2  3540 1 1 111 VAL HG11 H  47.774 -14.367 -14.446 1.00 . A A . 111 VAL HG11 1 1 
        2  3541 1 1 111 VAL HG12 H  48.744 -13.541 -13.224 1.00 . A A . 111 VAL HG12 1 1 
        2  3542 1 1 111 VAL HG13 H  48.988 -15.260 -13.531 1.00 . A A . 111 VAL HG13 1 1 
        2  3543 1 1 111 VAL HG21 H  46.151 -13.693 -10.942 1.00 . A A . 111 VAL HG21 1 1 
        2  3544 1 1 111 VAL HG22 H  47.177 -12.712 -11.989 1.00 . A A . 111 VAL HG22 1 1 
        2  3545 1 1 111 VAL HG23 H  45.651 -13.352 -12.599 1.00 . A A . 111 VAL HG23 1 1 
        2  3546 1 1 111 VAL N    N  45.192 -16.164 -11.979 1.00 . A A . 111 VAL N    1 1 
        2  3547 1 1 111 VAL O    O  47.255 -17.960 -12.642 1.00 . A A . 111 VAL O    1 1 
        2  3548 1 1 112 LYS C    C  49.420 -17.898 -15.590 1.00 . A A . 112 LYS C    1 1 
        2  3549 1 1 112 LYS CA   C  47.968 -18.264 -15.303 1.00 . A A . 112 LYS CA   1 1 
        2  3550 1 1 112 LYS CB   C  47.284 -18.731 -16.589 1.00 . A A . 112 LYS CB   1 1 
        2  3551 1 1 112 LYS CD   C  44.955 -19.658 -16.755 1.00 . A A . 112 LYS CD   1 1 
        2  3552 1 1 112 LYS CE   C  44.015 -20.706 -16.182 1.00 . A A . 112 LYS CE   1 1 
        2  3553 1 1 112 LYS CG   C  46.402 -19.954 -16.399 1.00 . A A . 112 LYS CG   1 1 
        2  3554 1 1 112 LYS H    H  46.980 -16.391 -15.318 1.00 . A A . 112 LYS H    1 1 
        2  3555 1 1 112 LYS HA   H  47.947 -19.067 -14.581 1.00 . A A . 112 LYS HA   1 1 
        2  3556 1 1 112 LYS HB2  H  46.673 -17.916 -16.976 1.00 . A A . 112 LYS HB2  1 1 
        2  3557 1 1 112 LYS HB3  H  48.044 -18.972 -17.319 1.00 . A A . 112 LYS HB3  1 1 
        2  3558 1 1 112 LYS HD2  H  44.683 -18.680 -16.360 1.00 . A A . 112 LYS HD2  1 1 
        2  3559 1 1 112 LYS HD3  H  44.853 -19.646 -17.832 1.00 . A A . 112 LYS HD3  1 1 
        2  3560 1 1 112 LYS HE2  H  44.073 -21.608 -16.791 1.00 . A A . 112 LYS HE2  1 1 
        2  3561 1 1 112 LYS HE3  H  44.329 -20.940 -15.175 1.00 . A A . 112 LYS HE3  1 1 
        2  3562 1 1 112 LYS HG2  H  46.769 -20.760 -17.035 1.00 . A A . 112 LYS HG2  1 1 
        2  3563 1 1 112 LYS HG3  H  46.453 -20.266 -15.366 1.00 . A A . 112 LYS HG3  1 1 
        2  3564 1 1 112 LYS HZ1  H  42.353 -19.797 -17.064 1.00 . A A . 112 LYS HZ1  1 1 
        2  3565 1 1 112 LYS HZ2  H  42.483 -19.520 -15.400 1.00 . A A . 112 LYS HZ2  1 1 
        2  3566 1 1 112 LYS HZ3  H  41.961 -21.025 -15.966 1.00 . A A . 112 LYS HZ3  1 1 
        2  3567 1 1 112 LYS N    N  47.250 -17.130 -14.732 1.00 . A A . 112 LYS N    1 1 
        2  3568 1 1 112 LYS NZ   N  42.603 -20.228 -16.151 1.00 . A A . 112 LYS NZ   1 1 
        2  3569 1 1 112 LYS O    O  49.743 -16.734 -15.820 1.00 . A A . 112 LYS O    1 1 
        2  3570 1 1 113 ASN C    C  52.128 -19.340 -17.151 1.00 . A A . 113 ASN C    1 1 
        2  3571 1 1 113 ASN CA   C  51.711 -18.687 -15.838 1.00 . A A . 113 ASN CA   1 1 
        2  3572 1 1 113 ASN CB   C  52.552 -19.241 -14.688 1.00 . A A . 113 ASN CB   1 1 
        2  3573 1 1 113 ASN CG   C  52.732 -20.745 -14.777 1.00 . A A . 113 ASN CG   1 1 
        2  3574 1 1 113 ASN H    H  49.974 -19.810 -15.387 1.00 . A A . 113 ASN H    1 1 
        2  3575 1 1 113 ASN HA   H  51.876 -17.621 -15.911 1.00 . A A . 113 ASN HA   1 1 
        2  3576 1 1 113 ASN HB2  H  53.533 -18.767 -14.706 1.00 . A A . 113 ASN HB2  1 1 
        2  3577 1 1 113 ASN HB3  H  52.069 -19.010 -13.750 1.00 . A A . 113 ASN HB3  1 1 
        2  3578 1 1 113 ASN HD21 H  54.657 -20.514 -15.218 1.00 . A A . 113 ASN HD21 1 1 
        2  3579 1 1 113 ASN HD22 H  54.096 -22.145 -15.139 1.00 . A A . 113 ASN HD22 1 1 
        2  3580 1 1 113 ASN N    N  50.292 -18.901 -15.577 1.00 . A A . 113 ASN N    1 1 
        2  3581 1 1 113 ASN ND2  N  53.952 -21.179 -15.075 1.00 . A A . 113 ASN ND2  1 1 
        2  3582 1 1 113 ASN O    O  51.673 -20.435 -17.485 1.00 . A A . 113 ASN O    1 1 
        2  3583 1 1 113 ASN OD1  O  51.785 -21.507 -14.582 1.00 . A A . 113 ASN OD1  1 1 
        2  3584 1 1 114 LYS C    C  54.877 -19.771 -19.025 1.00 . A A . 114 LYS C    1 1 
        2  3585 1 1 114 LYS CA   C  53.479 -19.177 -19.169 1.00 . A A . 114 LYS CA   1 1 
        2  3586 1 1 114 LYS CB   C  53.494 -18.063 -20.219 1.00 . A A . 114 LYS CB   1 1 
        2  3587 1 1 114 LYS CD   C  52.708 -17.487 -22.534 1.00 . A A . 114 LYS CD   1 1 
        2  3588 1 1 114 LYS CE   C  52.276 -18.336 -23.719 1.00 . A A . 114 LYS CE   1 1 
        2  3589 1 1 114 LYS CG   C  52.350 -18.150 -21.214 1.00 . A A . 114 LYS CG   1 1 
        2  3590 1 1 114 LYS H    H  53.324 -17.794 -17.574 1.00 . A A . 114 LYS H    1 1 
        2  3591 1 1 114 LYS HA   H  52.802 -19.953 -19.492 1.00 . A A . 114 LYS HA   1 1 
        2  3592 1 1 114 LYS HB2  H  53.441 -17.102 -19.709 1.00 . A A . 114 LYS HB2  1 1 
        2  3593 1 1 114 LYS HB3  H  54.425 -18.113 -20.766 1.00 . A A . 114 LYS HB3  1 1 
        2  3594 1 1 114 LYS HD2  H  52.213 -16.518 -22.592 1.00 . A A . 114 LYS HD2  1 1 
        2  3595 1 1 114 LYS HD3  H  53.778 -17.341 -22.576 1.00 . A A . 114 LYS HD3  1 1 
        2  3596 1 1 114 LYS HE2  H  51.591 -19.109 -23.373 1.00 . A A . 114 LYS HE2  1 1 
        2  3597 1 1 114 LYS HE3  H  51.766 -17.705 -24.431 1.00 . A A . 114 LYS HE3  1 1 
        2  3598 1 1 114 LYS HG2  H  52.111 -19.198 -21.393 1.00 . A A . 114 LYS HG2  1 1 
        2  3599 1 1 114 LYS HG3  H  51.485 -17.655 -20.797 1.00 . A A . 114 LYS HG3  1 1 
        2  3600 1 1 114 LYS HZ1  H  53.190 -19.241 -25.366 1.00 . A A . 114 LYS HZ1  1 1 
        2  3601 1 1 114 LYS HZ2  H  53.717 -19.841 -23.875 1.00 . A A . 114 LYS HZ2  1 1 
        2  3602 1 1 114 LYS HZ3  H  54.247 -18.329 -24.413 1.00 . A A . 114 LYS HZ3  1 1 
        2  3603 1 1 114 LYS N    N  52.998 -18.661 -17.894 1.00 . A A . 114 LYS N    1 1 
        2  3604 1 1 114 LYS NZ   N  53.440 -18.982 -24.390 1.00 . A A . 114 LYS NZ   1 1 
        2  3605 1 1 114 LYS O    O  55.602 -19.485 -18.072 1.00 . A A . 114 LYS O    1 1 
        2  3606 1 1 115 PRO C    C  57.711 -20.285 -20.264 1.00 . A A . 115 PRO C    1 1 
        2  3607 1 1 115 PRO CA   C  56.578 -21.269 -19.993 1.00 . A A . 115 PRO CA   1 1 
        2  3608 1 1 115 PRO CB   C  56.468 -22.284 -21.132 1.00 . A A . 115 PRO CB   1 1 
        2  3609 1 1 115 PRO CD   C  54.450 -21.003 -21.155 1.00 . A A . 115 PRO CD   1 1 
        2  3610 1 1 115 PRO CG   C  55.429 -21.726 -22.040 1.00 . A A . 115 PRO CG   1 1 
        2  3611 1 1 115 PRO HA   H  56.766 -21.784 -19.063 1.00 . A A . 115 PRO HA   1 1 
        2  3612 1 1 115 PRO HB2  H  57.420 -22.370 -21.655 1.00 . A A . 115 PRO HB2  1 1 
        2  3613 1 1 115 PRO HB3  H  56.171 -23.244 -20.735 1.00 . A A . 115 PRO HB3  1 1 
        2  3614 1 1 115 PRO HD2  H  54.056 -20.120 -21.658 1.00 . A A . 115 PRO HD2  1 1 
        2  3615 1 1 115 PRO HD3  H  53.648 -21.664 -20.862 1.00 . A A . 115 PRO HD3  1 1 
        2  3616 1 1 115 PRO HG2  H  55.881 -21.030 -22.748 1.00 . A A . 115 PRO HG2  1 1 
        2  3617 1 1 115 PRO HG3  H  54.933 -22.526 -22.569 1.00 . A A . 115 PRO HG3  1 1 
        2  3618 1 1 115 PRO N    N  55.264 -20.617 -19.990 1.00 . A A . 115 PRO N    1 1 
        2  3619 1 1 115 PRO O    O  57.687 -19.550 -21.250 1.00 . A A . 115 PRO O    1 1 
        2  3620 1 1 116 LYS C    C  61.094 -19.988 -18.882 1.00 . A A . 116 LYS C    1 1 
        2  3621 1 1 116 LYS CA   C  59.849 -19.385 -19.525 1.00 . A A . 116 LYS CA   1 1 
        2  3622 1 1 116 LYS CB   C  59.544 -18.024 -18.894 1.00 . A A . 116 LYS CB   1 1 
        2  3623 1 1 116 LYS CD   C  58.047 -16.010 -18.802 1.00 . A A . 116 LYS CD   1 1 
        2  3624 1 1 116 LYS CE   C  58.614 -14.863 -19.626 1.00 . A A . 116 LYS CE   1 1 
        2  3625 1 1 116 LYS CG   C  58.306 -17.353 -19.463 1.00 . A A . 116 LYS CG   1 1 
        2  3626 1 1 116 LYS H    H  58.668 -20.887 -18.614 1.00 . A A . 116 LYS H    1 1 
        2  3627 1 1 116 LYS HA   H  60.034 -19.249 -20.581 1.00 . A A . 116 LYS HA   1 1 
        2  3628 1 1 116 LYS HB2  H  59.406 -18.160 -17.822 1.00 . A A . 116 LYS HB2  1 1 
        2  3629 1 1 116 LYS HB3  H  60.389 -17.370 -19.054 1.00 . A A . 116 LYS HB3  1 1 
        2  3630 1 1 116 LYS HD2  H  56.972 -15.870 -18.688 1.00 . A A . 116 LYS HD2  1 1 
        2  3631 1 1 116 LYS HD3  H  58.510 -16.003 -17.826 1.00 . A A . 116 LYS HD3  1 1 
        2  3632 1 1 116 LYS HE2  H  58.568 -15.128 -20.683 1.00 . A A . 116 LYS HE2  1 1 
        2  3633 1 1 116 LYS HE3  H  58.012 -13.984 -19.457 1.00 . A A . 116 LYS HE3  1 1 
        2  3634 1 1 116 LYS HG2  H  58.441 -17.203 -20.534 1.00 . A A . 116 LYS HG2  1 1 
        2  3635 1 1 116 LYS HG3  H  57.453 -17.996 -19.301 1.00 . A A . 116 LYS HG3  1 1 
        2  3636 1 1 116 LYS HZ1  H  60.675 -15.091 -19.879 1.00 . A A . 116 LYS HZ1  1 1 
        2  3637 1 1 116 LYS HZ2  H  60.205 -14.837 -18.274 1.00 . A A . 116 LYS HZ2  1 1 
        2  3638 1 1 116 LYS HZ3  H  60.213 -13.547 -19.366 1.00 . A A . 116 LYS HZ3  1 1 
        2  3639 1 1 116 LYS N    N  58.705 -20.276 -19.382 1.00 . A A . 116 LYS N    1 1 
        2  3640 1 1 116 LYS NZ   N  60.026 -14.563 -19.261 1.00 . A A . 116 LYS NZ   1 1 
        2  3641 1 1 116 LYS O    O  61.038 -20.506 -17.768 1.00 . A A . 116 LYS O    1 1 
        2  3642 1 1 117 GLY C    C  64.223 -21.252 -20.112 1.00 . A A . 117 GLY C    1 1 
        2  3643 1 1 117 GLY CA   C  63.458 -20.457 -19.072 1.00 . A A . 117 GLY CA   1 1 
        2  3644 1 1 117 GLY H    H  62.200 -19.490 -20.474 1.00 . A A . 117 GLY H    1 1 
        2  3645 1 1 117 GLY HA2  H  64.078 -19.643 -18.728 1.00 . A A . 117 GLY HA2  1 1 
        2  3646 1 1 117 GLY HA3  H  63.233 -21.103 -18.236 1.00 . A A . 117 GLY HA3  1 1 
        2  3647 1 1 117 GLY N    N  62.216 -19.916 -19.591 1.00 . A A . 117 GLY N    1 1 
        2  3648 1 1 117 GLY O    O  63.635 -22.019 -20.875 1.00 . A A . 117 GLY O    1 1 
        2  3649 1 1 118 LYS C    C  67.714 -22.169 -20.458 1.00 . A A . 118 LYS C    1 1 
        2  3650 1 1 118 LYS CA   C  66.387 -21.775 -21.097 1.00 . A A . 118 LYS CA   1 1 
        2  3651 1 1 118 LYS CB   C  66.641 -20.902 -22.329 1.00 . A A . 118 LYS CB   1 1 
        2  3652 1 1 118 LYS CD   C  66.064 -21.333 -24.734 1.00 . A A . 118 LYS CD   1 1 
        2  3653 1 1 118 LYS CE   C  66.789 -21.425 -26.068 1.00 . A A . 118 LYS CE   1 1 
        2  3654 1 1 118 LYS CG   C  66.980 -21.696 -23.578 1.00 . A A . 118 LYS CG   1 1 
        2  3655 1 1 118 LYS H    H  65.950 -20.446 -19.508 1.00 . A A . 118 LYS H    1 1 
        2  3656 1 1 118 LYS HA   H  65.869 -22.671 -21.402 1.00 . A A . 118 LYS HA   1 1 
        2  3657 1 1 118 LYS HB2  H  65.749 -20.307 -22.524 1.00 . A A . 118 LYS HB2  1 1 
        2  3658 1 1 118 LYS HB3  H  67.463 -20.233 -22.117 1.00 . A A . 118 LYS HB3  1 1 
        2  3659 1 1 118 LYS HD2  H  65.213 -22.014 -24.743 1.00 . A A . 118 LYS HD2  1 1 
        2  3660 1 1 118 LYS HD3  H  65.708 -20.322 -24.597 1.00 . A A . 118 LYS HD3  1 1 
        2  3661 1 1 118 LYS HE2  H  67.556 -22.196 -26.004 1.00 . A A . 118 LYS HE2  1 1 
        2  3662 1 1 118 LYS HE3  H  66.077 -21.699 -26.833 1.00 . A A . 118 LYS HE3  1 1 
        2  3663 1 1 118 LYS HG2  H  68.012 -21.492 -23.863 1.00 . A A . 118 LYS HG2  1 1 
        2  3664 1 1 118 LYS HG3  H  66.874 -22.749 -23.363 1.00 . A A . 118 LYS HG3  1 1 
        2  3665 1 1 118 LYS HZ1  H  68.034 -20.263 -27.277 1.00 . A A . 118 LYS HZ1  1 1 
        2  3666 1 1 118 LYS HZ2  H  68.010 -19.781 -25.656 1.00 . A A . 118 LYS HZ2  1 1 
        2  3667 1 1 118 LYS HZ3  H  66.700 -19.425 -26.662 1.00 . A A . 118 LYS HZ3  1 1 
        2  3668 1 1 118 LYS N    N  65.539 -21.070 -20.143 1.00 . A A . 118 LYS N    1 1 
        2  3669 1 1 118 LYS NZ   N  67.428 -20.133 -26.442 1.00 . A A . 118 LYS NZ   1 1 
        2  3670 1 1 118 LYS O    O  68.710 -21.455 -20.581 1.00 . A A . 118 LYS O    1 1 
        2  3671 1 1 119 LYS C    C  69.501 -22.744 -18.176 1.00 . A A . 119 LYS C    1 1 
        2  3672 1 1 119 LYS CA   C  68.928 -23.798 -19.117 1.00 . A A . 119 LYS CA   1 1 
        2  3673 1 1 119 LYS CB   C  69.977 -24.191 -20.159 1.00 . A A . 119 LYS CB   1 1 
        2  3674 1 1 119 LYS CD   C  72.320 -24.984 -19.720 1.00 . A A . 119 LYS CD   1 1 
        2  3675 1 1 119 LYS CE   C  73.101 -25.820 -18.719 1.00 . A A . 119 LYS CE   1 1 
        2  3676 1 1 119 LYS CG   C  70.848 -25.360 -19.734 1.00 . A A . 119 LYS CG   1 1 
        2  3677 1 1 119 LYS H    H  66.897 -23.833 -19.710 1.00 . A A . 119 LYS H    1 1 
        2  3678 1 1 119 LYS HA   H  68.660 -24.671 -18.540 1.00 . A A . 119 LYS HA   1 1 
        2  3679 1 1 119 LYS HB2  H  69.467 -24.454 -21.086 1.00 . A A . 119 LYS HB2  1 1 
        2  3680 1 1 119 LYS HB3  H  70.618 -23.341 -20.345 1.00 . A A . 119 LYS HB3  1 1 
        2  3681 1 1 119 LYS HD2  H  72.737 -25.136 -20.716 1.00 . A A . 119 LYS HD2  1 1 
        2  3682 1 1 119 LYS HD3  H  72.413 -23.940 -19.453 1.00 . A A . 119 LYS HD3  1 1 
        2  3683 1 1 119 LYS HE2  H  73.369 -25.196 -17.866 1.00 . A A . 119 LYS HE2  1 1 
        2  3684 1 1 119 LYS HE3  H  72.474 -26.632 -18.379 1.00 . A A . 119 LYS HE3  1 1 
        2  3685 1 1 119 LYS HG2  H  70.553 -25.681 -18.735 1.00 . A A . 119 LYS HG2  1 1 
        2  3686 1 1 119 LYS HG3  H  70.701 -26.177 -20.425 1.00 . A A . 119 LYS HG3  1 1 
        2  3687 1 1 119 LYS HZ1  H  74.836 -26.980 -18.621 1.00 . A A . 119 LYS HZ1  1 1 
        2  3688 1 1 119 LYS HZ2  H  74.977 -25.619 -19.615 1.00 . A A . 119 LYS HZ2  1 1 
        2  3689 1 1 119 LYS HZ3  H  74.106 -26.967 -20.147 1.00 . A A . 119 LYS HZ3  1 1 
        2  3690 1 1 119 LYS N    N  67.723 -23.307 -19.774 1.00 . A A . 119 LYS N    1 1 
        2  3691 1 1 119 LYS NZ   N  74.342 -26.386 -19.317 1.00 . A A . 119 LYS NZ   1 1 
        2  3692 1 1 119 LYS O    O  70.713 -22.663 -17.983 1.00 . A A . 119 LYS O    1 1 
        2  3693 1 1 120 GLY C    C  70.128 -20.011 -17.273 1.00 . A A . 120 GLY C    1 1 
        2  3694 1 1 120 GLY CA   C  69.059 -20.902 -16.673 1.00 . A A . 120 GLY CA   1 1 
        2  3695 1 1 120 GLY H    H  67.666 -22.049 -17.779 1.00 . A A . 120 GLY H    1 1 
        2  3696 1 1 120 GLY HA2  H  68.209 -20.293 -16.402 1.00 . A A . 120 GLY HA2  1 1 
        2  3697 1 1 120 GLY HA3  H  69.455 -21.368 -15.782 1.00 . A A . 120 GLY HA3  1 1 
        2  3698 1 1 120 GLY N    N  68.620 -21.939 -17.588 1.00 . A A . 120 GLY N    1 1 
        2  3699 1 1 120 GLY O    O  70.972 -19.473 -16.558 1.00 . A A . 120 GLY O    1 1 
        2  3700 1 1 121 LYS C    C  72.489 -19.511 -19.024 1.00 . A A . 121 LYS C    1 1 
        2  3701 1 1 121 LYS CA   C  71.067 -19.026 -19.293 1.00 . A A . 121 LYS CA   1 1 
        2  3702 1 1 121 LYS CB   C  70.927 -17.566 -18.859 1.00 . A A . 121 LYS CB   1 1 
        2  3703 1 1 121 LYS CD   C  72.474 -15.592 -18.722 1.00 . A A . 121 LYS CD   1 1 
        2  3704 1 1 121 LYS CE   C  73.800 -15.106 -19.292 1.00 . A A . 121 LYS CE   1 1 
        2  3705 1 1 121 LYS CG   C  71.817 -16.611 -19.637 1.00 . A A . 121 LYS CG   1 1 
        2  3706 1 1 121 LYS H    H  69.396 -20.313 -19.109 1.00 . A A . 121 LYS H    1 1 
        2  3707 1 1 121 LYS HA   H  70.868 -19.100 -20.351 1.00 . A A . 121 LYS HA   1 1 
        2  3708 1 1 121 LYS HB2  H  69.889 -17.261 -18.991 1.00 . A A . 121 LYS HB2  1 1 
        2  3709 1 1 121 LYS HB3  H  71.179 -17.487 -17.811 1.00 . A A . 121 LYS HB3  1 1 
        2  3710 1 1 121 LYS HD2  H  71.806 -14.741 -18.595 1.00 . A A . 121 LYS HD2  1 1 
        2  3711 1 1 121 LYS HD3  H  72.654 -16.049 -17.758 1.00 . A A . 121 LYS HD3  1 1 
        2  3712 1 1 121 LYS HE2  H  74.016 -15.655 -20.208 1.00 . A A . 121 LYS HE2  1 1 
        2  3713 1 1 121 LYS HE3  H  73.711 -14.055 -19.523 1.00 . A A . 121 LYS HE3  1 1 
        2  3714 1 1 121 LYS HG2  H  72.590 -17.182 -20.150 1.00 . A A . 121 LYS HG2  1 1 
        2  3715 1 1 121 LYS HG3  H  71.217 -16.090 -20.368 1.00 . A A . 121 LYS HG3  1 1 
        2  3716 1 1 121 LYS HZ1  H  75.527 -16.084 -18.643 1.00 . A A . 121 LYS HZ1  1 1 
        2  3717 1 1 121 LYS HZ2  H  74.546 -15.519 -17.385 1.00 . A A . 121 LYS HZ2  1 1 
        2  3718 1 1 121 LYS HZ3  H  75.493 -14.434 -18.272 1.00 . A A . 121 LYS HZ3  1 1 
        2  3719 1 1 121 LYS N    N  70.094 -19.857 -18.593 1.00 . A A . 121 LYS N    1 1 
        2  3720 1 1 121 LYS NZ   N  74.921 -15.299 -18.332 1.00 . A A . 121 LYS NZ   1 1 
        2  3721 1 1 121 LYS O    O  73.113 -19.123 -18.037 1.00 . A A . 121 LYS O    1 1 
        2  3722 1 1 122 GLY C    C  75.125 -20.871 -21.051 1.00 . A A . 122 GLY C    1 1 
        2  3723 1 1 122 GLY CA   C  74.341 -20.886 -19.754 1.00 . A A . 122 GLY CA   1 1 
        2  3724 1 1 122 GLY H    H  72.451 -20.638 -20.679 1.00 . A A . 122 GLY H    1 1 
        2  3725 1 1 122 GLY HA2  H  74.863 -20.288 -19.022 1.00 . A A . 122 GLY HA2  1 1 
        2  3726 1 1 122 GLY HA3  H  74.279 -21.902 -19.395 1.00 . A A . 122 GLY HA3  1 1 
        2  3727 1 1 122 GLY N    N  72.996 -20.363 -19.912 1.00 . A A . 122 GLY N    1 1 
        2  3728 1 1 122 GLY O    O  74.554 -20.696 -22.128 1.00 . A A . 122 GLY O    1 1 
        2  3729 1 1 123 LYS C    C  78.327 -22.187 -22.037 1.00 . A A . 123 LYS C    1 1 
        2  3730 1 1 123 LYS CA   C  77.301 -21.061 -22.123 1.00 . A A . 123 LYS CA   1 1 
        2  3731 1 1 123 LYS CB   C  78.017 -19.715 -22.263 1.00 . A A . 123 LYS CB   1 1 
        2  3732 1 1 123 LYS CD   C  80.180 -19.350 -23.486 1.00 . A A . 123 LYS CD   1 1 
        2  3733 1 1 123 LYS CE   C  80.721 -18.351 -24.496 1.00 . A A . 123 LYS CE   1 1 
        2  3734 1 1 123 LYS CG   C  78.675 -19.515 -23.617 1.00 . A A . 123 LYS CG   1 1 
        2  3735 1 1 123 LYS H    H  76.833 -21.189 -20.062 1.00 . A A . 123 LYS H    1 1 
        2  3736 1 1 123 LYS HA   H  76.681 -21.221 -22.992 1.00 . A A . 123 LYS HA   1 1 
        2  3737 1 1 123 LYS HB2  H  77.293 -18.916 -22.105 1.00 . A A . 123 LYS HB2  1 1 
        2  3738 1 1 123 LYS HB3  H  78.780 -19.646 -21.501 1.00 . A A . 123 LYS HB3  1 1 
        2  3739 1 1 123 LYS HD2  H  80.415 -19.003 -22.479 1.00 . A A . 123 LYS HD2  1 1 
        2  3740 1 1 123 LYS HD3  H  80.655 -20.307 -23.650 1.00 . A A . 123 LYS HD3  1 1 
        2  3741 1 1 123 LYS HE2  H  81.268 -18.888 -25.271 1.00 . A A . 123 LYS HE2  1 1 
        2  3742 1 1 123 LYS HE3  H  79.891 -17.828 -24.947 1.00 . A A . 123 LYS HE3  1 1 
        2  3743 1 1 123 LYS HG2  H  78.465 -20.378 -24.248 1.00 . A A . 123 LYS HG2  1 1 
        2  3744 1 1 123 LYS HG3  H  78.264 -18.629 -24.080 1.00 . A A . 123 LYS HG3  1 1 
        2  3745 1 1 123 LYS HZ1  H  82.576 -17.411 -24.288 1.00 . A A . 123 LYS HZ1  1 1 
        2  3746 1 1 123 LYS HZ2  H  81.710 -17.545 -22.841 1.00 . A A . 123 LYS HZ2  1 1 
        2  3747 1 1 123 LYS HZ3  H  81.256 -16.394 -23.994 1.00 . A A . 123 LYS HZ3  1 1 
        2  3748 1 1 123 LYS N    N  76.436 -21.054 -20.950 1.00 . A A . 123 LYS N    1 1 
        2  3749 1 1 123 LYS NZ   N  81.630 -17.356 -23.861 1.00 . A A . 123 LYS NZ   1 1 
        2  3750 1 1 123 LYS O    O  78.942 -22.400 -20.994 1.00 . A A . 123 LYS O    1 1 
        2  3751 1 1 124 GLY C    C  80.767 -23.612 -23.829 1.00 . A A . 124 GLY C    1 1 
        2  3752 1 1 124 GLY CA   C  79.459 -23.999 -23.170 1.00 . A A . 124 GLY CA   1 1 
        2  3753 1 1 124 GLY H    H  77.987 -22.688 -23.945 1.00 . A A . 124 GLY H    1 1 
        2  3754 1 1 124 GLY HA2  H  79.656 -24.315 -22.157 1.00 . A A . 124 GLY HA2  1 1 
        2  3755 1 1 124 GLY HA3  H  79.026 -24.825 -23.715 1.00 . A A . 124 GLY HA3  1 1 
        2  3756 1 1 124 GLY N    N  78.506 -22.904 -23.142 1.00 . A A . 124 GLY N    1 1 
        2  3757 1 1 124 GLY O    O  81.287 -22.521 -23.598 1.00 . A A . 124 GLY O    1 1 
        2  3758 1 1 125 ASN C    C  82.363 -24.278 -26.856 1.00 . A A . 125 ASN C    1 1 
        2  3759 1 1 125 ASN CA   C  82.560 -24.256 -25.343 1.00 . A A . 125 ASN CA   1 1 
        2  3760 1 1 125 ASN CB   C  83.607 -25.297 -24.940 1.00 . A A . 125 ASN CB   1 1 
        2  3761 1 1 125 ASN CG   C  84.969 -24.680 -24.690 1.00 . A A . 125 ASN CG   1 1 
        2  3762 1 1 125 ASN H    H  80.841 -25.361 -24.795 1.00 . A A . 125 ASN H    1 1 
        2  3763 1 1 125 ASN HA   H  82.908 -23.277 -25.051 1.00 . A A . 125 ASN HA   1 1 
        2  3764 1 1 125 ASN HB2  H  83.275 -25.800 -24.032 1.00 . A A . 125 ASN HB2  1 1 
        2  3765 1 1 125 ASN HB3  H  83.703 -26.028 -25.729 1.00 . A A . 125 ASN HB3  1 1 
        2  3766 1 1 125 ASN HD21 H  84.642 -24.687 -22.729 1.00 . A A . 125 ASN HD21 1 1 
        2  3767 1 1 125 ASN HD22 H  86.166 -24.051 -23.233 1.00 . A A . 125 ASN HD22 1 1 
        2  3768 1 1 125 ASN N    N  81.303 -24.509 -24.650 1.00 . A A . 125 ASN N    1 1 
        2  3769 1 1 125 ASN ND2  N  85.291 -24.449 -23.423 1.00 . A A . 125 ASN ND2  1 1 
        2  3770 1 1 125 ASN O    O  81.235 -24.352 -27.343 1.00 . A A . 125 ASN O    1 1 
        2  3771 1 1 125 ASN OXT  O  83.341 -24.221 -27.598 1.00 . A A . 125 ASN OXT  1 1 
        2  3772 1 1 125 ASN OD1  O  85.724 -24.413 -25.627 1.00 . A A . 125 ASN OD1  1 1 
        3  3773 1 1   1 GLY C    C  77.956  -3.709 -58.165 1.00 . A A .   1 GLY C    1 1 
        3  3774 1 1   1 GLY CA   C  78.009  -2.289 -58.692 1.00 . A A .   1 GLY CA   1 1 
        3  3775 1 1   1 GLY H1   H  79.264  -1.468 -60.005 1.00 . A A .   1 GLY H1   1 1 
        3  3776 1 1   1 GLY H2   H  77.846  -1.937 -60.657 1.00 . A A .   1 GLY H2   1 1 
        3  3777 1 1   1 GLY H3   H  79.028  -2.996 -60.409 1.00 . A A .   1 GLY H3   1 1 
        3  3778 1 1   1 GLY HA2  H  78.603  -1.688 -58.021 1.00 . A A .   1 GLY HA2  1 1 
        3  3779 1 1   1 GLY HA3  H  77.005  -1.893 -58.723 1.00 . A A .   1 GLY HA3  1 1 
        3  3780 1 1   1 GLY N    N  78.582  -2.213 -60.023 1.00 . A A .   1 GLY N    1 1 
        3  3781 1 1   1 GLY O    O  78.210  -4.663 -58.900 1.00 . A A .   1 GLY O    1 1 
        3  3782 1 1   2 SER C    C  76.504  -5.175 -55.145 1.00 . A A .   2 SER C    1 1 
        3  3783 1 1   2 SER CA   C  77.550  -5.164 -56.256 1.00 . A A .   2 SER CA   1 1 
        3  3784 1 1   2 SER CB   C  78.915  -5.567 -55.693 1.00 . A A .   2 SER CB   1 1 
        3  3785 1 1   2 SER H    H  77.438  -3.053 -56.348 1.00 . A A .   2 SER H    1 1 
        3  3786 1 1   2 SER HA   H  77.260  -5.878 -57.014 1.00 . A A .   2 SER HA   1 1 
        3  3787 1 1   2 SER HB2  H  78.780  -6.364 -54.961 1.00 . A A .   2 SER HB2  1 1 
        3  3788 1 1   2 SER HB3  H  79.542  -5.924 -56.495 1.00 . A A .   2 SER HB3  1 1 
        3  3789 1 1   2 SER HG   H  79.659  -3.755 -55.707 1.00 . A A .   2 SER HG   1 1 
        3  3790 1 1   2 SER N    N  77.629  -3.850 -56.885 1.00 . A A .   2 SER N    1 1 
        3  3791 1 1   2 SER O    O  76.802  -4.856 -53.994 1.00 . A A .   2 SER O    1 1 
        3  3792 1 1   2 SER OG   O  79.552  -4.464 -55.069 1.00 . A A .   2 SER OG   1 1 
        3  3793 1 1   3 LYS C    C  73.241  -6.752 -54.845 1.00 . A A .   3 LYS C    1 1 
        3  3794 1 1   3 LYS CA   C  74.186  -5.594 -54.535 1.00 . A A .   3 LYS CA   1 1 
        3  3795 1 1   3 LYS CB   C  73.411  -4.275 -54.536 1.00 . A A .   3 LYS CB   1 1 
        3  3796 1 1   3 LYS CD   C  72.043  -3.979 -52.451 1.00 . A A .   3 LYS CD   1 1 
        3  3797 1 1   3 LYS CE   C  71.900  -3.217 -51.142 1.00 . A A .   3 LYS CE   1 1 
        3  3798 1 1   3 LYS CG   C  73.331  -3.615 -53.171 1.00 . A A .   3 LYS CG   1 1 
        3  3799 1 1   3 LYS H    H  75.102  -5.784 -56.434 1.00 . A A .   3 LYS H    1 1 
        3  3800 1 1   3 LYS HA   H  74.616  -5.749 -53.557 1.00 . A A .   3 LYS HA   1 1 
        3  3801 1 1   3 LYS HB2  H  73.896  -3.586 -55.228 1.00 . A A .   3 LYS HB2  1 1 
        3  3802 1 1   3 LYS HB3  H  72.405  -4.463 -54.883 1.00 . A A .   3 LYS HB3  1 1 
        3  3803 1 1   3 LYS HD2  H  71.196  -3.744 -53.095 1.00 . A A .   3 LYS HD2  1 1 
        3  3804 1 1   3 LYS HD3  H  72.045  -5.039 -52.242 1.00 . A A .   3 LYS HD3  1 1 
        3  3805 1 1   3 LYS HE2  H  72.769  -2.574 -51.008 1.00 . A A .   3 LYS HE2  1 1 
        3  3806 1 1   3 LYS HE3  H  71.014  -2.604 -51.193 1.00 . A A .   3 LYS HE3  1 1 
        3  3807 1 1   3 LYS HG2  H  74.180  -3.935 -52.568 1.00 . A A .   3 LYS HG2  1 1 
        3  3808 1 1   3 LYS HG3  H  73.370  -2.543 -53.297 1.00 . A A .   3 LYS HG3  1 1 
        3  3809 1 1   3 LYS HZ1  H  71.176  -3.717 -49.248 1.00 . A A .   3 LYS HZ1  1 1 
        3  3810 1 1   3 LYS HZ2  H  72.730  -4.305 -49.564 1.00 . A A .   3 LYS HZ2  1 1 
        3  3811 1 1   3 LYS HZ3  H  71.386  -5.045 -50.273 1.00 . A A .   3 LYS HZ3  1 1 
        3  3812 1 1   3 LYS N    N  75.278  -5.541 -55.500 1.00 . A A .   3 LYS N    1 1 
        3  3813 1 1   3 LYS NZ   N  71.789  -4.134 -49.975 1.00 . A A .   3 LYS NZ   1 1 
        3  3814 1 1   3 LYS O    O  72.818  -6.931 -55.986 1.00 . A A .   3 LYS O    1 1 
        3  3815 1 1   4 ASN C    C  70.982  -8.715 -52.866 1.00 . A A .   4 ASN C    1 1 
        3  3816 1 1   4 ASN CA   C  72.017  -8.673 -53.985 1.00 . A A .   4 ASN CA   1 1 
        3  3817 1 1   4 ASN CB   C  72.817  -9.977 -54.007 1.00 . A A .   4 ASN CB   1 1 
        3  3818 1 1   4 ASN CG   C  72.378 -10.906 -55.122 1.00 . A A .   4 ASN CG   1 1 
        3  3819 1 1   4 ASN H    H  73.283  -7.340 -52.935 1.00 . A A .   4 ASN H    1 1 
        3  3820 1 1   4 ASN HA   H  71.507  -8.558 -54.929 1.00 . A A .   4 ASN HA   1 1 
        3  3821 1 1   4 ASN HB2  H  73.873  -9.742 -54.138 1.00 . A A .   4 ASN HB2  1 1 
        3  3822 1 1   4 ASN HB3  H  72.686 -10.488 -53.064 1.00 . A A .   4 ASN HB3  1 1 
        3  3823 1 1   4 ASN HD21 H  70.642 -11.227 -54.205 1.00 . A A .   4 ASN HD21 1 1 
        3  3824 1 1   4 ASN HD22 H  70.864 -12.056 -55.704 1.00 . A A .   4 ASN HD22 1 1 
        3  3825 1 1   4 ASN N    N  72.914  -7.532 -53.821 1.00 . A A .   4 ASN N    1 1 
        3  3826 1 1   4 ASN ND2  N  71.173 -11.451 -54.998 1.00 . A A .   4 ASN ND2  1 1 
        3  3827 1 1   4 ASN O    O  71.286  -9.103 -51.739 1.00 . A A .   4 ASN O    1 1 
        3  3828 1 1   4 ASN OD1  O  73.113 -11.130 -56.083 1.00 . A A .   4 ASN OD1  1 1 
        3  3829 1 1   5 LYS C    C  68.114  -9.713 -52.010 1.00 . A A .   5 LYS C    1 1 
        3  3830 1 1   5 LYS CA   C  68.673  -8.308 -52.210 1.00 . A A .   5 LYS CA   1 1 
        3  3831 1 1   5 LYS CB   C  67.558  -7.363 -52.661 1.00 . A A .   5 LYS CB   1 1 
        3  3832 1 1   5 LYS CD   C  68.143  -5.549 -54.298 1.00 . A A .   5 LYS CD   1 1 
        3  3833 1 1   5 LYS CE   C  66.898  -4.838 -54.804 1.00 . A A .   5 LYS CE   1 1 
        3  3834 1 1   5 LYS CG   C  68.013  -5.923 -52.831 1.00 . A A .   5 LYS CG   1 1 
        3  3835 1 1   5 LYS H    H  69.575  -8.017 -54.103 1.00 . A A .   5 LYS H    1 1 
        3  3836 1 1   5 LYS HA   H  69.075  -7.956 -51.272 1.00 . A A .   5 LYS HA   1 1 
        3  3837 1 1   5 LYS HB2  H  67.162  -7.718 -53.613 1.00 . A A .   5 LYS HB2  1 1 
        3  3838 1 1   5 LYS HB3  H  66.764  -7.383 -51.927 1.00 . A A .   5 LYS HB3  1 1 
        3  3839 1 1   5 LYS HD2  H  69.005  -4.892 -54.423 1.00 . A A .   5 LYS HD2  1 1 
        3  3840 1 1   5 LYS HD3  H  68.296  -6.447 -54.877 1.00 . A A .   5 LYS HD3  1 1 
        3  3841 1 1   5 LYS HE2  H  66.735  -3.937 -54.212 1.00 . A A .   5 LYS HE2  1 1 
        3  3842 1 1   5 LYS HE3  H  67.053  -4.559 -55.836 1.00 . A A .   5 LYS HE3  1 1 
        3  3843 1 1   5 LYS HG2  H  67.288  -5.261 -52.357 1.00 . A A .   5 LYS HG2  1 1 
        3  3844 1 1   5 LYS HG3  H  68.972  -5.799 -52.350 1.00 . A A .   5 LYS HG3  1 1 
        3  3845 1 1   5 LYS HZ1  H  65.896  -6.648 -55.098 1.00 . A A .   5 LYS HZ1  1 1 
        3  3846 1 1   5 LYS HZ2  H  64.907  -5.284 -55.255 1.00 . A A .   5 LYS HZ2  1 1 
        3  3847 1 1   5 LYS HZ3  H  65.394  -5.803 -53.721 1.00 . A A .   5 LYS HZ3  1 1 
        3  3848 1 1   5 LYS N    N  69.756  -8.314 -53.187 1.00 . A A .   5 LYS N    1 1 
        3  3849 1 1   5 LYS NZ   N  65.689  -5.705 -54.714 1.00 . A A .   5 LYS NZ   1 1 
        3  3850 1 1   5 LYS O    O  67.215 -10.144 -52.734 1.00 . A A .   5 LYS O    1 1 
        3  3851 1 1   6 LYS C    C  67.338 -11.801 -49.464 1.00 . A A .   6 LYS C    1 1 
        3  3852 1 1   6 LYS CA   C  68.199 -11.778 -50.723 1.00 . A A .   6 LYS CA   1 1 
        3  3853 1 1   6 LYS CB   C  69.402 -12.708 -50.549 1.00 . A A .   6 LYS CB   1 1 
        3  3854 1 1   6 LYS CD   C  70.941 -13.243 -52.461 1.00 . A A .   6 LYS CD   1 1 
        3  3855 1 1   6 LYS CE   C  72.100 -14.113 -52.001 1.00 . A A .   6 LYS CE   1 1 
        3  3856 1 1   6 LYS CG   C  69.651 -13.610 -51.746 1.00 . A A .   6 LYS CG   1 1 
        3  3857 1 1   6 LYS H    H  69.360 -10.023 -50.478 1.00 . A A .   6 LYS H    1 1 
        3  3858 1 1   6 LYS HA   H  67.606 -12.122 -51.556 1.00 . A A .   6 LYS HA   1 1 
        3  3859 1 1   6 LYS HB2  H  70.291 -12.101 -50.378 1.00 . A A .   6 LYS HB2  1 1 
        3  3860 1 1   6 LYS HB3  H  69.236 -13.331 -49.683 1.00 . A A .   6 LYS HB3  1 1 
        3  3861 1 1   6 LYS HD2  H  70.802 -13.370 -53.534 1.00 . A A .   6 LYS HD2  1 1 
        3  3862 1 1   6 LYS HD3  H  71.175 -12.208 -52.254 1.00 . A A .   6 LYS HD3  1 1 
        3  3863 1 1   6 LYS HE2  H  71.711 -15.070 -51.652 1.00 . A A .   6 LYS HE2  1 1 
        3  3864 1 1   6 LYS HE3  H  72.759 -14.285 -52.839 1.00 . A A .   6 LYS HE3  1 1 
        3  3865 1 1   6 LYS HG2  H  69.712 -14.644 -51.407 1.00 . A A .   6 LYS HG2  1 1 
        3  3866 1 1   6 LYS HG3  H  68.826 -13.511 -52.436 1.00 . A A .   6 LYS HG3  1 1 
        3  3867 1 1   6 LYS HZ1  H  73.356 -14.198 -50.333 1.00 . A A .   6 LYS HZ1  1 1 
        3  3868 1 1   6 LYS HZ2  H  72.233 -12.932 -50.283 1.00 . A A .   6 LYS HZ2  1 1 
        3  3869 1 1   6 LYS HZ3  H  73.585 -12.824 -51.294 1.00 . A A .   6 LYS HZ3  1 1 
        3  3870 1 1   6 LYS N    N  68.647 -10.423 -51.021 1.00 . A A .   6 LYS N    1 1 
        3  3871 1 1   6 LYS NZ   N  72.874 -13.472 -50.901 1.00 . A A .   6 LYS NZ   1 1 
        3  3872 1 1   6 LYS O    O  67.312 -10.836 -48.702 1.00 . A A .   6 LYS O    1 1 
        3  3873 1 1   7 GLU C    C  65.187 -14.466 -48.017 1.00 . A A .   7 GLU C    1 1 
        3  3874 1 1   7 GLU CA   C  65.776 -13.058 -48.085 1.00 . A A .   7 GLU CA   1 1 
        3  3875 1 1   7 GLU CB   C  64.649 -12.024 -48.120 1.00 . A A .   7 GLU CB   1 1 
        3  3876 1 1   7 GLU CD   C  65.129 -10.425 -46.225 1.00 . A A .   7 GLU CD   1 1 
        3  3877 1 1   7 GLU CG   C  64.232 -11.532 -46.744 1.00 . A A .   7 GLU CG   1 1 
        3  3878 1 1   7 GLU H    H  66.699 -13.646 -49.897 1.00 . A A .   7 GLU H    1 1 
        3  3879 1 1   7 GLU HA   H  66.379 -12.892 -47.205 1.00 . A A .   7 GLU HA   1 1 
        3  3880 1 1   7 GLU HB2  H  64.978 -11.170 -48.712 1.00 . A A .   7 GLU HB2  1 1 
        3  3881 1 1   7 GLU HB3  H  63.787 -12.466 -48.598 1.00 . A A .   7 GLU HB3  1 1 
        3  3882 1 1   7 GLU HG2  H  63.208 -11.162 -46.797 1.00 . A A .   7 GLU HG2  1 1 
        3  3883 1 1   7 GLU HG3  H  64.270 -12.360 -46.053 1.00 . A A .   7 GLU HG3  1 1 
        3  3884 1 1   7 GLU N    N  66.637 -12.911 -49.252 1.00 . A A .   7 GLU N    1 1 
        3  3885 1 1   7 GLU O    O  64.513 -14.914 -48.945 1.00 . A A .   7 GLU O    1 1 
        3  3886 1 1   7 GLU OE1  O  66.352 -10.656 -46.111 1.00 . A A .   7 GLU OE1  1 1 
        3  3887 1 1   7 GLU OE2  O  64.610  -9.327 -45.933 1.00 . A A .   7 GLU OE2  1 1 
        3  3888 1 1   8 LYS C    C  63.470 -16.497 -46.343 1.00 . A A .   8 LYS C    1 1 
        3  3889 1 1   8 LYS CA   C  64.947 -16.513 -46.724 1.00 . A A .   8 LYS CA   1 1 
        3  3890 1 1   8 LYS CB   C  65.755 -17.230 -45.640 1.00 . A A .   8 LYS CB   1 1 
        3  3891 1 1   8 LYS CD   C  67.650 -18.783 -45.082 1.00 . A A .   8 LYS CD   1 1 
        3  3892 1 1   8 LYS CE   C  69.136 -18.566 -45.321 1.00 . A A .   8 LYS CE   1 1 
        3  3893 1 1   8 LYS CG   C  66.811 -18.172 -46.193 1.00 . A A .   8 LYS CG   1 1 
        3  3894 1 1   8 LYS H    H  65.994 -14.746 -46.210 1.00 . A A .   8 LYS H    1 1 
        3  3895 1 1   8 LYS HA   H  65.061 -17.043 -47.656 1.00 . A A .   8 LYS HA   1 1 
        3  3896 1 1   8 LYS HB2  H  66.246 -16.482 -45.018 1.00 . A A .   8 LYS HB2  1 1 
        3  3897 1 1   8 LYS HB3  H  65.078 -17.804 -45.023 1.00 . A A .   8 LYS HB3  1 1 
        3  3898 1 1   8 LYS HD2  H  67.371 -18.327 -44.132 1.00 . A A .   8 LYS HD2  1 1 
        3  3899 1 1   8 LYS HD3  H  67.453 -19.845 -45.036 1.00 . A A .   8 LYS HD3  1 1 
        3  3900 1 1   8 LYS HE2  H  69.703 -19.163 -44.607 1.00 . A A .   8 LYS HE2  1 1 
        3  3901 1 1   8 LYS HE3  H  69.376 -18.891 -46.323 1.00 . A A .   8 LYS HE3  1 1 
        3  3902 1 1   8 LYS HG2  H  66.321 -18.970 -46.750 1.00 . A A .   8 LYS HG2  1 1 
        3  3903 1 1   8 LYS HG3  H  67.458 -17.621 -46.858 1.00 . A A .   8 LYS HG3  1 1 
        3  3904 1 1   8 LYS HZ1  H  70.524 -17.057 -44.920 1.00 . A A .   8 LYS HZ1  1 1 
        3  3905 1 1   8 LYS HZ2  H  68.949 -16.689 -44.423 1.00 . A A .   8 LYS HZ2  1 1 
        3  3906 1 1   8 LYS HZ3  H  69.355 -16.626 -46.063 1.00 . A A .   8 LYS HZ3  1 1 
        3  3907 1 1   8 LYS N    N  65.450 -15.158 -46.915 1.00 . A A .   8 LYS N    1 1 
        3  3908 1 1   8 LYS NZ   N  69.518 -17.135 -45.172 1.00 . A A .   8 LYS NZ   1 1 
        3  3909 1 1   8 LYS O    O  63.110 -16.122 -45.228 1.00 . A A .   8 LYS O    1 1 
        3  3910 1 1   9 ASN C    C  60.762 -18.273 -46.423 1.00 . A A .   9 ASN C    1 1 
        3  3911 1 1   9 ASN CA   C  61.180 -16.941 -47.040 1.00 . A A .   9 ASN CA   1 1 
        3  3912 1 1   9 ASN CB   C  60.420 -16.711 -48.348 1.00 . A A .   9 ASN CB   1 1 
        3  3913 1 1   9 ASN CG   C  59.830 -15.318 -48.436 1.00 . A A .   9 ASN CG   1 1 
        3  3914 1 1   9 ASN H    H  62.967 -17.195 -48.148 1.00 . A A .   9 ASN H    1 1 
        3  3915 1 1   9 ASN HA   H  60.941 -16.147 -46.350 1.00 . A A .   9 ASN HA   1 1 
        3  3916 1 1   9 ASN HB2  H  61.104 -16.857 -49.184 1.00 . A A .   9 ASN HB2  1 1 
        3  3917 1 1   9 ASN HB3  H  59.617 -17.429 -48.423 1.00 . A A .   9 ASN HB3  1 1 
        3  3918 1 1   9 ASN HD21 H  58.071 -15.998 -47.803 1.00 . A A .   9 ASN HD21 1 1 
        3  3919 1 1   9 ASN HD22 H  58.145 -14.304 -48.140 1.00 . A A .   9 ASN HD22 1 1 
        3  3920 1 1   9 ASN N    N  62.618 -16.908 -47.278 1.00 . A A .   9 ASN N    1 1 
        3  3921 1 1   9 ASN ND2  N  58.552 -15.193 -48.090 1.00 . A A .   9 ASN ND2  1 1 
        3  3922 1 1   9 ASN O    O  60.939 -19.332 -47.025 1.00 . A A .   9 ASN O    1 1 
        3  3923 1 1   9 ASN OD1  O  60.512 -14.364 -48.810 1.00 . A A .   9 ASN OD1  1 1 
        3  3924 1 1  10 LYS C    C  58.948 -19.045 -43.279 1.00 . A A .  10 LYS C    1 1 
        3  3925 1 1  10 LYS CA   C  59.758 -19.410 -44.519 1.00 . A A .  10 LYS CA   1 1 
        3  3926 1 1  10 LYS CB   C  60.959 -20.272 -44.122 1.00 . A A .  10 LYS CB   1 1 
        3  3927 1 1  10 LYS CD   C  61.563 -20.193 -41.686 1.00 . A A .  10 LYS CD   1 1 
        3  3928 1 1  10 LYS CE   C  62.778 -20.909 -41.115 1.00 . A A .  10 LYS CE   1 1 
        3  3929 1 1  10 LYS CG   C  61.846 -19.629 -43.068 1.00 . A A .  10 LYS CG   1 1 
        3  3930 1 1  10 LYS H    H  60.090 -17.336 -44.790 1.00 . A A .  10 LYS H    1 1 
        3  3931 1 1  10 LYS HA   H  59.129 -19.972 -45.192 1.00 . A A .  10 LYS HA   1 1 
        3  3932 1 1  10 LYS HB2  H  60.595 -21.225 -43.739 1.00 . A A .  10 LYS HB2  1 1 
        3  3933 1 1  10 LYS HB3  H  61.560 -20.457 -45.001 1.00 . A A .  10 LYS HB3  1 1 
        3  3934 1 1  10 LYS HD2  H  61.284 -19.378 -41.018 1.00 . A A .  10 LYS HD2  1 1 
        3  3935 1 1  10 LYS HD3  H  60.741 -20.893 -41.752 1.00 . A A .  10 LYS HD3  1 1 
        3  3936 1 1  10 LYS HE2  H  62.966 -21.810 -41.699 1.00 . A A .  10 LYS HE2  1 1 
        3  3937 1 1  10 LYS HE3  H  63.634 -20.254 -41.192 1.00 . A A .  10 LYS HE3  1 1 
        3  3938 1 1  10 LYS HG2  H  62.891 -19.810 -43.321 1.00 . A A .  10 LYS HG2  1 1 
        3  3939 1 1  10 LYS HG3  H  61.663 -18.564 -43.057 1.00 . A A .  10 LYS HG3  1 1 
        3  3940 1 1  10 LYS HZ1  H  63.436 -21.064 -39.139 1.00 . A A .  10 LYS HZ1  1 1 
        3  3941 1 1  10 LYS HZ2  H  62.389 -22.306 -39.614 1.00 . A A .  10 LYS HZ2  1 1 
        3  3942 1 1  10 LYS HZ3  H  61.778 -20.763 -39.288 1.00 . A A .  10 LYS HZ3  1 1 
        3  3943 1 1  10 LYS N    N  60.205 -18.210 -45.219 1.00 . A A .  10 LYS N    1 1 
        3  3944 1 1  10 LYS NZ   N  62.581 -21.287 -39.690 1.00 . A A .  10 LYS NZ   1 1 
        3  3945 1 1  10 LYS O    O  59.219 -18.043 -42.620 1.00 . A A .  10 LYS O    1 1 
        3  3946 1 1  11 GLY C    C  55.650 -19.874 -42.077 1.00 . A A .  11 GLY C    1 1 
        3  3947 1 1  11 GLY CA   C  57.119 -19.618 -41.804 1.00 . A A .  11 GLY CA   1 1 
        3  3948 1 1  11 GLY H    H  57.782 -20.654 -43.528 1.00 . A A .  11 GLY H    1 1 
        3  3949 1 1  11 GLY HA2  H  57.441 -20.260 -40.998 1.00 . A A .  11 GLY HA2  1 1 
        3  3950 1 1  11 GLY HA3  H  57.244 -18.588 -41.503 1.00 . A A .  11 GLY HA3  1 1 
        3  3951 1 1  11 GLY N    N  57.952 -19.870 -42.965 1.00 . A A .  11 GLY N    1 1 
        3  3952 1 1  11 GLY O    O  55.059 -19.257 -42.964 1.00 . A A .  11 GLY O    1 1 
        3  3953 1 1  12 GLY C    C  53.291 -22.463 -40.921 1.00 . A A .  12 GLY C    1 1 
        3  3954 1 1  12 GLY CA   C  53.654 -21.109 -41.497 1.00 . A A .  12 GLY CA   1 1 
        3  3955 1 1  12 GLY H    H  55.578 -21.248 -40.624 1.00 . A A .  12 GLY H    1 1 
        3  3956 1 1  12 GLY HA2  H  53.057 -20.350 -41.013 1.00 . A A .  12 GLY HA2  1 1 
        3  3957 1 1  12 GLY HA3  H  53.431 -21.108 -42.554 1.00 . A A .  12 GLY HA3  1 1 
        3  3958 1 1  12 GLY N    N  55.058 -20.787 -41.316 1.00 . A A .  12 GLY N    1 1 
        3  3959 1 1  12 GLY O    O  52.726 -23.310 -41.615 1.00 . A A .  12 GLY O    1 1 
        3  3960 1 1  13 LYS C    C  51.967 -23.869 -38.275 1.00 . A A .  13 LYS C    1 1 
        3  3961 1 1  13 LYS CA   C  53.318 -23.931 -38.980 1.00 . A A .  13 LYS CA   1 1 
        3  3962 1 1  13 LYS CB   C  54.418 -24.265 -37.969 1.00 . A A .  13 LYS CB   1 1 
        3  3963 1 1  13 LYS CD   C  55.828 -22.846 -36.451 1.00 . A A .  13 LYS CD   1 1 
        3  3964 1 1  13 LYS CE   C  56.547 -23.757 -35.467 1.00 . A A .  13 LYS CE   1 1 
        3  3965 1 1  13 LYS CG   C  54.427 -23.350 -36.757 1.00 . A A .  13 LYS CG   1 1 
        3  3966 1 1  13 LYS H    H  54.063 -21.957 -39.149 1.00 . A A .  13 LYS H    1 1 
        3  3967 1 1  13 LYS HA   H  53.283 -24.706 -39.731 1.00 . A A .  13 LYS HA   1 1 
        3  3968 1 1  13 LYS HB2  H  54.280 -25.292 -37.630 1.00 . A A .  13 LYS HB2  1 1 
        3  3969 1 1  13 LYS HB3  H  55.377 -24.188 -38.461 1.00 . A A .  13 LYS HB3  1 1 
        3  3970 1 1  13 LYS HD2  H  56.401 -22.798 -37.377 1.00 . A A .  13 LYS HD2  1 1 
        3  3971 1 1  13 LYS HD3  H  55.759 -21.855 -36.025 1.00 . A A .  13 LYS HD3  1 1 
        3  3972 1 1  13 LYS HE2  H  56.006 -23.756 -34.520 1.00 . A A .  13 LYS HE2  1 1 
        3  3973 1 1  13 LYS HE3  H  56.555 -24.761 -35.868 1.00 . A A .  13 LYS HE3  1 1 
        3  3974 1 1  13 LYS HG2  H  53.774 -22.498 -36.946 1.00 . A A .  13 LYS HG2  1 1 
        3  3975 1 1  13 LYS HG3  H  54.057 -23.897 -35.901 1.00 . A A .  13 LYS HG3  1 1 
        3  3976 1 1  13 LYS HZ1  H  58.087 -23.099 -34.220 1.00 . A A .  13 LYS HZ1  1 1 
        3  3977 1 1  13 LYS HZ2  H  58.159 -22.469 -35.789 1.00 . A A .  13 LYS HZ2  1 1 
        3  3978 1 1  13 LYS HZ3  H  58.611 -24.074 -35.500 1.00 . A A .  13 LYS HZ3  1 1 
        3  3979 1 1  13 LYS N    N  53.614 -22.670 -39.650 1.00 . A A .  13 LYS N    1 1 
        3  3980 1 1  13 LYS NZ   N  57.948 -23.319 -35.227 1.00 . A A .  13 LYS NZ   1 1 
        3  3981 1 1  13 LYS O    O  51.241 -22.882 -38.392 1.00 . A A .  13 LYS O    1 1 
        3  3982 1 1  14 GLY C    C  49.877 -26.390 -36.618 1.00 . A A .  14 GLY C    1 1 
        3  3983 1 1  14 GLY CA   C  50.373 -24.973 -36.830 1.00 . A A .  14 GLY CA   1 1 
        3  3984 1 1  14 GLY H    H  52.256 -25.687 -37.488 1.00 . A A .  14 GLY H    1 1 
        3  3985 1 1  14 GLY HA2  H  50.499 -24.499 -35.869 1.00 . A A .  14 GLY HA2  1 1 
        3  3986 1 1  14 GLY HA3  H  49.634 -24.427 -37.397 1.00 . A A .  14 GLY HA3  1 1 
        3  3987 1 1  14 GLY N    N  51.636 -24.929 -37.544 1.00 . A A .  14 GLY N    1 1 
        3  3988 1 1  14 GLY O    O  49.388 -27.030 -37.547 1.00 . A A .  14 GLY O    1 1 
        3  3989 1 1  15 GLY C    C  49.041 -28.356 -33.662 1.00 . A A .  15 GLY C    1 1 
        3  3990 1 1  15 GLY CA   C  49.563 -28.229 -35.080 1.00 . A A .  15 GLY CA   1 1 
        3  3991 1 1  15 GLY H    H  50.403 -26.325 -34.687 1.00 . A A .  15 GLY H    1 1 
        3  3992 1 1  15 GLY HA2  H  48.778 -28.505 -35.767 1.00 . A A .  15 GLY HA2  1 1 
        3  3993 1 1  15 GLY HA3  H  50.395 -28.907 -35.206 1.00 . A A .  15 GLY HA3  1 1 
        3  3994 1 1  15 GLY N    N  50.006 -26.882 -35.389 1.00 . A A .  15 GLY N    1 1 
        3  3995 1 1  15 GLY O    O  49.210 -29.394 -33.023 1.00 . A A .  15 GLY O    1 1 
        3  3996 1 1  16 ALA C    C  46.370 -26.961 -31.833 1.00 . A A .  16 ALA C    1 1 
        3  3997 1 1  16 ALA CA   C  47.857 -27.298 -31.820 1.00 . A A .  16 ALA CA   1 1 
        3  3998 1 1  16 ALA CB   C  48.615 -26.313 -30.942 1.00 . A A .  16 ALA CB   1 1 
        3  3999 1 1  16 ALA H    H  48.303 -26.501 -33.729 1.00 . A A .  16 ALA H    1 1 
        3  4000 1 1  16 ALA HA   H  47.989 -28.286 -31.405 1.00 . A A .  16 ALA HA   1 1 
        3  4001 1 1  16 ALA HB1  H  48.351 -25.304 -31.224 1.00 . A A .  16 ALA HB1  1 1 
        3  4002 1 1  16 ALA HB2  H  48.356 -26.479 -29.908 1.00 . A A .  16 ALA HB2  1 1 
        3  4003 1 1  16 ALA HB3  H  49.677 -26.457 -31.075 1.00 . A A .  16 ALA HB3  1 1 
        3  4004 1 1  16 ALA N    N  48.405 -27.299 -33.170 1.00 . A A .  16 ALA N    1 1 
        3  4005 1 1  16 ALA O    O  45.742 -26.914 -32.890 1.00 . A A .  16 ALA O    1 1 
        3  4006 1 1  17 ASP C    C  44.066 -25.126 -31.306 1.00 . A A .  17 ASP C    1 1 
        3  4007 1 1  17 ASP CA   C  44.396 -26.394 -30.525 1.00 . A A .  17 ASP CA   1 1 
        3  4008 1 1  17 ASP CB   C  44.022 -26.212 -29.053 1.00 . A A .  17 ASP CB   1 1 
        3  4009 1 1  17 ASP CG   C  44.544 -24.912 -28.477 1.00 . A A .  17 ASP CG   1 1 
        3  4010 1 1  17 ASP H    H  46.363 -26.780 -29.841 1.00 . A A .  17 ASP H    1 1 
        3  4011 1 1  17 ASP HA   H  43.825 -27.213 -30.935 1.00 . A A .  17 ASP HA   1 1 
        3  4012 1 1  17 ASP HB2  H  42.936 -26.228 -28.961 1.00 . A A .  17 ASP HB2  1 1 
        3  4013 1 1  17 ASP HB3  H  44.434 -27.032 -28.480 1.00 . A A .  17 ASP HB3  1 1 
        3  4014 1 1  17 ASP N    N  45.811 -26.726 -30.650 1.00 . A A .  17 ASP N    1 1 
        3  4015 1 1  17 ASP O    O  44.820 -24.154 -31.280 1.00 . A A .  17 ASP O    1 1 
        3  4016 1 1  17 ASP OD1  O  45.769 -24.675 -28.562 1.00 . A A .  17 ASP OD1  1 1 
        3  4017 1 1  17 ASP OD2  O  43.732 -24.131 -27.944 1.00 . A A .  17 ASP OD2  1 1 
        3  4018 1 1  18 CYS C    C  42.521 -22.722 -31.956 1.00 . A A .  18 CYS C    1 1 
        3  4019 1 1  18 CYS CA   C  42.503 -23.999 -32.793 1.00 . A A .  18 CYS CA   1 1 
        3  4020 1 1  18 CYS CB   C  41.098 -24.236 -33.349 1.00 . A A .  18 CYS CB   1 1 
        3  4021 1 1  18 CYS H    H  42.374 -25.951 -31.983 1.00 . A A .  18 CYS H    1 1 
        3  4022 1 1  18 CYS HA   H  43.192 -23.885 -33.616 1.00 . A A .  18 CYS HA   1 1 
        3  4023 1 1  18 CYS HB2  H  40.750 -25.212 -33.010 1.00 . A A .  18 CYS HB2  1 1 
        3  4024 1 1  18 CYS HB3  H  40.433 -23.479 -32.961 1.00 . A A .  18 CYS HB3  1 1 
        3  4025 1 1  18 CYS HG   H  42.095 -24.739 -35.691 1.00 . A A .  18 CYS HG   1 1 
        3  4026 1 1  18 CYS N    N  42.933 -25.146 -32.003 1.00 . A A .  18 CYS N    1 1 
        3  4027 1 1  18 CYS O    O  42.003 -22.692 -30.840 1.00 . A A .  18 CYS O    1 1 
        3  4028 1 1  18 CYS SG   S  40.999 -24.182 -35.168 1.00 . A A .  18 CYS SG   1 1 
        3  4029 1 1  19 ALA C    C  41.829 -19.768 -31.640 1.00 . A A .  19 ALA C    1 1 
        3  4030 1 1  19 ALA CA   C  43.210 -20.392 -31.809 1.00 . A A .  19 ALA CA   1 1 
        3  4031 1 1  19 ALA CB   C  44.132 -19.446 -32.561 1.00 . A A .  19 ALA CB   1 1 
        3  4032 1 1  19 ALA H    H  43.520 -21.759 -33.396 1.00 . A A .  19 ALA H    1 1 
        3  4033 1 1  19 ALA HA   H  43.636 -20.571 -30.833 1.00 . A A .  19 ALA HA   1 1 
        3  4034 1 1  19 ALA HB1  H  44.774 -18.936 -31.858 1.00 . A A .  19 ALA HB1  1 1 
        3  4035 1 1  19 ALA HB2  H  44.735 -20.007 -33.258 1.00 . A A .  19 ALA HB2  1 1 
        3  4036 1 1  19 ALA HB3  H  43.541 -18.720 -33.101 1.00 . A A .  19 ALA HB3  1 1 
        3  4037 1 1  19 ALA N    N  43.125 -21.672 -32.503 1.00 . A A .  19 ALA N    1 1 
        3  4038 1 1  19 ALA O    O  41.588 -19.026 -30.688 1.00 . A A .  19 ALA O    1 1 
        3  4039 1 1  20 GLU C    C  38.543 -20.659 -32.583 1.00 . A A .  20 GLU C    1 1 
        3  4040 1 1  20 GLU CA   C  39.573 -19.535 -32.522 1.00 . A A .  20 GLU CA   1 1 
        3  4041 1 1  20 GLU CB   C  39.346 -18.558 -33.678 1.00 . A A .  20 GLU CB   1 1 
        3  4042 1 1  20 GLU CD   C  40.855 -18.306 -35.688 1.00 . A A .  20 GLU CD   1 1 
        3  4043 1 1  20 GLU CG   C  39.750 -19.113 -35.033 1.00 . A A .  20 GLU CG   1 1 
        3  4044 1 1  20 GLU H    H  41.182 -20.667 -33.305 1.00 . A A .  20 GLU H    1 1 
        3  4045 1 1  20 GLU HA   H  39.457 -19.007 -31.588 1.00 . A A .  20 GLU HA   1 1 
        3  4046 1 1  20 GLU HB2  H  38.289 -18.294 -33.710 1.00 . A A .  20 GLU HB2  1 1 
        3  4047 1 1  20 GLU HB3  H  39.921 -17.662 -33.492 1.00 . A A .  20 GLU HB3  1 1 
        3  4048 1 1  20 GLU HG2  H  40.091 -20.141 -34.906 1.00 . A A .  20 GLU HG2  1 1 
        3  4049 1 1  20 GLU HG3  H  38.887 -19.108 -35.682 1.00 . A A .  20 GLU HG3  1 1 
        3  4050 1 1  20 GLU N    N  40.929 -20.071 -32.569 1.00 . A A .  20 GLU N    1 1 
        3  4051 1 1  20 GLU O    O  38.034 -20.993 -33.654 1.00 . A A .  20 GLU O    1 1 
        3  4052 1 1  20 GLU OE1  O  40.639 -17.103 -35.945 1.00 . A A .  20 GLU OE1  1 1 
        3  4053 1 1  20 GLU OE2  O  41.937 -18.879 -35.942 1.00 . A A .  20 GLU OE2  1 1 
        3  4054 1 1  21 TRP C    C  35.864 -21.823 -31.651 1.00 . A A .  21 TRP C    1 1 
        3  4055 1 1  21 TRP CA   C  37.270 -22.326 -31.347 1.00 . A A .  21 TRP CA   1 1 
        3  4056 1 1  21 TRP CB   C  37.307 -22.969 -29.961 1.00 . A A .  21 TRP CB   1 1 
        3  4057 1 1  21 TRP CD1  C  39.457 -23.802 -28.838 1.00 . A A .  21 TRP CD1  1 1 
        3  4058 1 1  21 TRP CD2  C  38.749 -25.083 -30.533 1.00 . A A .  21 TRP CD2  1 1 
        3  4059 1 1  21 TRP CE2  C  39.928 -25.644 -30.008 1.00 . A A .  21 TRP CE2  1 1 
        3  4060 1 1  21 TRP CE3  C  38.121 -25.717 -31.608 1.00 . A A .  21 TRP CE3  1 1 
        3  4061 1 1  21 TRP CG   C  38.465 -23.905 -29.770 1.00 . A A .  21 TRP CG   1 1 
        3  4062 1 1  21 TRP CH2  C  39.856 -27.411 -31.574 1.00 . A A .  21 TRP CH2  1 1 
        3  4063 1 1  21 TRP CZ2  C  40.490 -26.810 -30.522 1.00 . A A .  21 TRP CZ2  1 1 
        3  4064 1 1  21 TRP CZ3  C  38.680 -26.874 -32.117 1.00 . A A .  21 TRP CZ3  1 1 
        3  4065 1 1  21 TRP H    H  38.679 -20.930 -30.606 1.00 . A A .  21 TRP H    1 1 
        3  4066 1 1  21 TRP HA   H  37.544 -23.066 -32.086 1.00 . A A .  21 TRP HA   1 1 
        3  4067 1 1  21 TRP HB2  H  37.365 -22.182 -29.210 1.00 . A A .  21 TRP HB2  1 1 
        3  4068 1 1  21 TRP HB3  H  36.397 -23.530 -29.808 1.00 . A A .  21 TRP HB3  1 1 
        3  4069 1 1  21 TRP HD1  H  39.525 -23.010 -28.108 1.00 . A A .  21 TRP HD1  1 1 
        3  4070 1 1  21 TRP HE1  H  41.136 -24.992 -28.422 1.00 . A A .  21 TRP HE1  1 1 
        3  4071 1 1  21 TRP HE3  H  37.215 -25.318 -32.041 1.00 . A A .  21 TRP HE3  1 1 
        3  4072 1 1  21 TRP HH2  H  40.256 -28.316 -32.004 1.00 . A A .  21 TRP HH2  1 1 
        3  4073 1 1  21 TRP HZ2  H  41.394 -27.237 -30.113 1.00 . A A .  21 TRP HZ2  1 1 
        3  4074 1 1  21 TRP HZ3  H  38.209 -27.378 -32.949 1.00 . A A .  21 TRP HZ3  1 1 
        3  4075 1 1  21 TRP N    N  38.241 -21.239 -31.427 1.00 . A A .  21 TRP N    1 1 
        3  4076 1 1  21 TRP NE1  N  40.340 -24.844 -28.975 1.00 . A A .  21 TRP NE1  1 1 
        3  4077 1 1  21 TRP O    O  35.390 -20.866 -31.037 1.00 . A A .  21 TRP O    1 1 
        3  4078 1 1  22 LEU C    C  32.827 -23.103 -32.464 1.00 . A A .  22 LEU C    1 1 
        3  4079 1 1  22 LEU CA   C  33.845 -22.092 -32.984 1.00 . A A .  22 LEU CA   1 1 
        3  4080 1 1  22 LEU CB   C  33.738 -21.979 -34.505 1.00 . A A .  22 LEU CB   1 1 
        3  4081 1 1  22 LEU CD1  C  33.164 -19.540 -34.481 1.00 . A A .  22 LEU CD1  1 1 
        3  4082 1 1  22 LEU CD2  C  35.522 -20.263 -34.900 1.00 . A A .  22 LEU CD2  1 1 
        3  4083 1 1  22 LEU CG   C  34.052 -20.607 -35.101 1.00 . A A .  22 LEU CG   1 1 
        3  4084 1 1  22 LEU H    H  35.629 -23.228 -33.053 1.00 . A A .  22 LEU H    1 1 
        3  4085 1 1  22 LEU HA   H  33.634 -21.129 -32.544 1.00 . A A .  22 LEU HA   1 1 
        3  4086 1 1  22 LEU HB2  H  34.414 -22.709 -34.951 1.00 . A A .  22 LEU HB2  1 1 
        3  4087 1 1  22 LEU HB3  H  32.726 -22.238 -34.784 1.00 . A A .  22 LEU HB3  1 1 
        3  4088 1 1  22 LEU HD11 H  33.742 -18.950 -33.786 1.00 . A A .  22 LEU HD11 1 1 
        3  4089 1 1  22 LEU HD12 H  32.345 -20.011 -33.959 1.00 . A A .  22 LEU HD12 1 1 
        3  4090 1 1  22 LEU HD13 H  32.773 -18.900 -35.259 1.00 . A A .  22 LEU HD13 1 1 
        3  4091 1 1  22 LEU HD21 H  35.677 -19.214 -35.104 1.00 . A A .  22 LEU HD21 1 1 
        3  4092 1 1  22 LEU HD22 H  36.124 -20.855 -35.574 1.00 . A A .  22 LEU HD22 1 1 
        3  4093 1 1  22 LEU HD23 H  35.805 -20.478 -33.880 1.00 . A A .  22 LEU HD23 1 1 
        3  4094 1 1  22 LEU HG   H  33.856 -20.629 -36.164 1.00 . A A .  22 LEU HG   1 1 
        3  4095 1 1  22 LEU N    N  35.200 -22.473 -32.599 1.00 . A A .  22 LEU N    1 1 
        3  4096 1 1  22 LEU O    O  32.727 -24.218 -32.976 1.00 . A A .  22 LEU O    1 1 
        3  4097 1 1  23 TYR C    C  29.670 -23.225 -31.378 1.00 . A A .  23 TYR C    1 1 
        3  4098 1 1  23 TYR CA   C  31.062 -23.574 -30.857 1.00 . A A .  23 TYR CA   1 1 
        3  4099 1 1  23 TYR CB   C  31.090 -23.464 -29.332 1.00 . A A .  23 TYR CB   1 1 
        3  4100 1 1  23 TYR CD1  C  33.016 -21.960 -28.696 1.00 . A A .  23 TYR CD1  1 1 
        3  4101 1 1  23 TYR CD2  C  33.240 -24.300 -28.304 1.00 . A A .  23 TYR CD2  1 1 
        3  4102 1 1  23 TYR CE1  C  34.279 -21.747 -28.181 1.00 . A A .  23 TYR CE1  1 1 
        3  4103 1 1  23 TYR CE2  C  34.503 -24.098 -27.787 1.00 . A A .  23 TYR CE2  1 1 
        3  4104 1 1  23 TYR CG   C  32.473 -23.237 -28.767 1.00 . A A .  23 TYR CG   1 1 
        3  4105 1 1  23 TYR CZ   C  35.020 -22.819 -27.727 1.00 . A A .  23 TYR CZ   1 1 
        3  4106 1 1  23 TYR H    H  32.199 -21.804 -31.081 1.00 . A A .  23 TYR H    1 1 
        3  4107 1 1  23 TYR HA   H  31.294 -24.590 -31.139 1.00 . A A .  23 TYR HA   1 1 
        3  4108 1 1  23 TYR HB2  H  30.448 -22.638 -29.029 1.00 . A A .  23 TYR HB2  1 1 
        3  4109 1 1  23 TYR HB3  H  30.704 -24.378 -28.905 1.00 . A A .  23 TYR HB3  1 1 
        3  4110 1 1  23 TYR HD1  H  32.432 -21.122 -29.051 1.00 . A A .  23 TYR HD1  1 1 
        3  4111 1 1  23 TYR HD2  H  32.833 -25.300 -28.352 1.00 . A A .  23 TYR HD2  1 1 
        3  4112 1 1  23 TYR HE1  H  34.683 -20.747 -28.133 1.00 . A A .  23 TYR HE1  1 1 
        3  4113 1 1  23 TYR HE2  H  35.086 -24.936 -27.432 1.00 . A A .  23 TYR HE2  1 1 
        3  4114 1 1  23 TYR HH   H  36.645 -23.449 -26.917 1.00 . A A .  23 TYR HH   1 1 
        3  4115 1 1  23 TYR N    N  32.073 -22.704 -31.446 1.00 . A A .  23 TYR N    1 1 
        3  4116 1 1  23 TYR O    O  29.469 -22.174 -31.987 1.00 . A A .  23 TYR O    1 1 
        3  4117 1 1  23 TYR OH   O  36.279 -22.612 -27.212 1.00 . A A .  23 TYR OH   1 1 
        3  4118 1 1  24 GLY C    C  26.354 -23.895 -30.440 1.00 . A A .  24 GLY C    1 1 
        3  4119 1 1  24 GLY CA   C  27.352 -23.880 -31.580 1.00 . A A .  24 GLY CA   1 1 
        3  4120 1 1  24 GLY H    H  28.932 -24.933 -30.642 1.00 . A A .  24 GLY H    1 1 
        3  4121 1 1  24 GLY HA2  H  27.306 -22.922 -32.075 1.00 . A A .  24 GLY HA2  1 1 
        3  4122 1 1  24 GLY HA3  H  27.083 -24.652 -32.289 1.00 . A A .  24 GLY HA3  1 1 
        3  4123 1 1  24 GLY N    N  28.713 -24.113 -31.132 1.00 . A A .  24 GLY N    1 1 
        3  4124 1 1  24 GLY O    O  26.681 -23.515 -29.316 1.00 . A A .  24 GLY O    1 1 
        3  4125 1 1  25 SER C    C  24.391 -25.457 -28.675 1.00 . A A .  25 SER C    1 1 
        3  4126 1 1  25 SER CA   C  24.082 -24.389 -29.720 1.00 . A A .  25 SER CA   1 1 
        3  4127 1 1  25 SER CB   C  22.730 -24.675 -30.377 1.00 . A A .  25 SER CB   1 1 
        3  4128 1 1  25 SER H    H  24.934 -24.622 -31.644 1.00 . A A .  25 SER H    1 1 
        3  4129 1 1  25 SER HA   H  24.040 -23.427 -29.232 1.00 . A A .  25 SER HA   1 1 
        3  4130 1 1  25 SER HB2  H  21.955 -24.687 -29.611 1.00 . A A .  25 SER HB2  1 1 
        3  4131 1 1  25 SER HB3  H  22.510 -23.898 -31.093 1.00 . A A .  25 SER HB3  1 1 
        3  4132 1 1  25 SER HG   H  22.614 -26.631 -30.409 1.00 . A A .  25 SER HG   1 1 
        3  4133 1 1  25 SER N    N  25.134 -24.332 -30.729 1.00 . A A .  25 SER N    1 1 
        3  4134 1 1  25 SER O    O  25.164 -26.383 -28.925 1.00 . A A .  25 SER O    1 1 
        3  4135 1 1  25 SER OG   O  22.743 -25.924 -31.045 1.00 . A A .  25 SER OG   1 1 
        3  4136 1 1  26 CYS C    C  22.821 -27.259 -26.329 1.00 . A A .  26 CYS C    1 1 
        3  4137 1 1  26 CYS CA   C  23.985 -26.275 -26.419 1.00 . A A .  26 CYS CA   1 1 
        3  4138 1 1  26 CYS CB   C  24.148 -25.537 -25.088 1.00 . A A .  26 CYS CB   1 1 
        3  4139 1 1  26 CYS H    H  23.173 -24.564 -27.364 1.00 . A A .  26 CYS H    1 1 
        3  4140 1 1  26 CYS HA   H  24.889 -26.825 -26.628 1.00 . A A .  26 CYS HA   1 1 
        3  4141 1 1  26 CYS HB2  H  23.424 -24.723 -25.051 1.00 . A A .  26 CYS HB2  1 1 
        3  4142 1 1  26 CYS HB3  H  23.939 -26.220 -24.278 1.00 . A A .  26 CYS HB3  1 1 
        3  4143 1 1  26 CYS HG   H  25.924 -23.685 -25.468 1.00 . A A .  26 CYS HG   1 1 
        3  4144 1 1  26 CYS N    N  23.779 -25.323 -27.503 1.00 . A A .  26 CYS N    1 1 
        3  4145 1 1  26 CYS O    O  21.657 -26.870 -26.424 1.00 . A A .  26 CYS O    1 1 
        3  4146 1 1  26 CYS SG   S  25.813 -24.848 -24.819 1.00 . A A .  26 CYS SG   1 1 
        3  4147 1 1  27 VAL C    C  22.024 -30.098 -24.610 1.00 . A A .  27 VAL C    1 1 
        3  4148 1 1  27 VAL CA   C  22.128 -29.574 -26.038 1.00 . A A .  27 VAL CA   1 1 
        3  4149 1 1  27 VAL CB   C  22.427 -30.750 -26.986 1.00 . A A .  27 VAL CB   1 1 
        3  4150 1 1  27 VAL CG1  C  21.260 -31.723 -27.014 1.00 . A A .  27 VAL CG1  1 1 
        3  4151 1 1  27 VAL CG2  C  22.742 -30.239 -28.384 1.00 . A A .  27 VAL CG2  1 1 
        3  4152 1 1  27 VAL H    H  24.091 -28.782 -26.073 1.00 . A A .  27 VAL H    1 1 
        3  4153 1 1  27 VAL HA   H  21.180 -29.141 -26.322 1.00 . A A .  27 VAL HA   1 1 
        3  4154 1 1  27 VAL HB   H  23.295 -31.273 -26.613 1.00 . A A .  27 VAL HB   1 1 
        3  4155 1 1  27 VAL HG11 H  21.255 -32.307 -26.104 1.00 . A A .  27 VAL HG11 1 1 
        3  4156 1 1  27 VAL HG12 H  20.333 -31.173 -27.095 1.00 . A A .  27 VAL HG12 1 1 
        3  4157 1 1  27 VAL HG13 H  21.361 -32.383 -27.863 1.00 . A A .  27 VAL HG13 1 1 
        3  4158 1 1  27 VAL HG21 H  22.113 -30.747 -29.102 1.00 . A A .  27 VAL HG21 1 1 
        3  4159 1 1  27 VAL HG22 H  22.555 -29.177 -28.429 1.00 . A A .  27 VAL HG22 1 1 
        3  4160 1 1  27 VAL HG23 H  23.779 -30.432 -28.614 1.00 . A A .  27 VAL HG23 1 1 
        3  4161 1 1  27 VAL N    N  23.145 -28.534 -26.142 1.00 . A A .  27 VAL N    1 1 
        3  4162 1 1  27 VAL O    O  22.960 -30.706 -24.092 1.00 . A A .  27 VAL O    1 1 
        3  4163 1 1  28 ALA C    C  20.647 -31.834 -22.530 1.00 . A A .  28 ALA C    1 1 
        3  4164 1 1  28 ALA CA   C  20.652 -30.312 -22.612 1.00 . A A .  28 ALA CA   1 1 
        3  4165 1 1  28 ALA CB   C  19.341 -29.749 -22.082 1.00 . A A .  28 ALA CB   1 1 
        3  4166 1 1  28 ALA H    H  20.170 -29.370 -24.445 1.00 . A A .  28 ALA H    1 1 
        3  4167 1 1  28 ALA HA   H  21.454 -29.930 -21.997 1.00 . A A .  28 ALA HA   1 1 
        3  4168 1 1  28 ALA HB1  H  18.523 -30.372 -22.411 1.00 . A A .  28 ALA HB1  1 1 
        3  4169 1 1  28 ALA HB2  H  19.369 -29.730 -21.003 1.00 . A A .  28 ALA HB2  1 1 
        3  4170 1 1  28 ALA HB3  H  19.203 -28.745 -22.457 1.00 . A A .  28 ALA HB3  1 1 
        3  4171 1 1  28 ALA N    N  20.879 -29.860 -23.980 1.00 . A A .  28 ALA N    1 1 
        3  4172 1 1  28 ALA O    O  20.037 -32.507 -23.360 1.00 . A A .  28 ALA O    1 1 
        3  4173 1 1  29 ASN C    C  20.031 -34.395 -21.027 1.00 . A A .  29 ASN C    1 1 
        3  4174 1 1  29 ASN CA   C  21.406 -33.814 -21.336 1.00 . A A .  29 ASN CA   1 1 
        3  4175 1 1  29 ASN CB   C  22.380 -34.151 -20.205 1.00 . A A .  29 ASN CB   1 1 
        3  4176 1 1  29 ASN CG   C  23.076 -35.482 -20.419 1.00 . A A .  29 ASN CG   1 1 
        3  4177 1 1  29 ASN H    H  21.797 -31.781 -20.896 1.00 . A A .  29 ASN H    1 1 
        3  4178 1 1  29 ASN HA   H  21.771 -34.250 -22.254 1.00 . A A .  29 ASN HA   1 1 
        3  4179 1 1  29 ASN HB2  H  23.132 -33.365 -20.140 1.00 . A A .  29 ASN HB2  1 1 
        3  4180 1 1  29 ASN HB3  H  21.838 -34.195 -19.272 1.00 . A A .  29 ASN HB3  1 1 
        3  4181 1 1  29 ASN HD21 H  21.519 -36.449 -19.649 1.00 . A A .  29 ASN HD21 1 1 
        3  4182 1 1  29 ASN HD22 H  22.836 -37.438 -20.166 1.00 . A A .  29 ASN HD22 1 1 
        3  4183 1 1  29 ASN N    N  21.331 -32.370 -21.525 1.00 . A A .  29 ASN N    1 1 
        3  4184 1 1  29 ASN ND2  N  22.410 -36.565 -20.040 1.00 . A A .  29 ASN ND2  1 1 
        3  4185 1 1  29 ASN O    O  19.671 -35.463 -21.521 1.00 . A A .  29 ASN O    1 1 
        3  4186 1 1  29 ASN OD1  O  24.200 -35.533 -20.919 1.00 . A A .  29 ASN OD1  1 1 
        3  4187 1 1  30 ASN C    C  17.072 -34.386 -21.069 1.00 . A A .  30 ASN C    1 1 
        3  4188 1 1  30 ASN CA   C  17.926 -34.128 -19.831 1.00 . A A .  30 ASN CA   1 1 
        3  4189 1 1  30 ASN CB   C  17.251 -33.085 -18.940 1.00 . A A .  30 ASN CB   1 1 
        3  4190 1 1  30 ASN CG   C  17.717 -33.167 -17.499 1.00 . A A .  30 ASN CG   1 1 
        3  4191 1 1  30 ASN H    H  19.605 -32.839 -19.845 1.00 . A A .  30 ASN H    1 1 
        3  4192 1 1  30 ASN HA   H  18.027 -35.050 -19.280 1.00 . A A .  30 ASN HA   1 1 
        3  4193 1 1  30 ASN HB2  H  17.475 -32.091 -19.327 1.00 . A A .  30 ASN HB2  1 1 
        3  4194 1 1  30 ASN HB3  H  16.182 -33.237 -18.963 1.00 . A A .  30 ASN HB3  1 1 
        3  4195 1 1  30 ASN HD21 H  15.872 -33.608 -16.902 1.00 . A A .  30 ASN HD21 1 1 
        3  4196 1 1  30 ASN HD22 H  17.064 -33.521 -15.655 1.00 . A A .  30 ASN HD22 1 1 
        3  4197 1 1  30 ASN N    N  19.264 -33.684 -20.207 1.00 . A A .  30 ASN N    1 1 
        3  4198 1 1  30 ASN ND2  N  16.790 -33.462 -16.594 1.00 . A A .  30 ASN ND2  1 1 
        3  4199 1 1  30 ASN O    O  16.792 -35.531 -21.416 1.00 . A A .  30 ASN O    1 1 
        3  4200 1 1  30 ASN OD1  O  18.895 -32.969 -17.204 1.00 . A A .  30 ASN OD1  1 1 
        3  4201 1 1  31 GLY C    C  15.354 -32.100 -23.441 1.00 . A A .  31 GLY C    1 1 
        3  4202 1 1  31 GLY CA   C  15.843 -33.438 -22.924 1.00 . A A .  31 GLY CA   1 1 
        3  4203 1 1  31 GLY H    H  16.915 -32.418 -21.410 1.00 . A A .  31 GLY H    1 1 
        3  4204 1 1  31 GLY HA2  H  16.423 -33.920 -23.696 1.00 . A A .  31 GLY HA2  1 1 
        3  4205 1 1  31 GLY HA3  H  14.987 -34.057 -22.693 1.00 . A A .  31 GLY HA3  1 1 
        3  4206 1 1  31 GLY N    N  16.660 -33.309 -21.733 1.00 . A A .  31 GLY N    1 1 
        3  4207 1 1  31 GLY O    O  15.543 -31.773 -24.612 1.00 . A A .  31 GLY O    1 1 
        3  4208 1 1  32 ASP C    C  15.268 -28.937 -22.759 1.00 . A A .  32 ASP C    1 1 
        3  4209 1 1  32 ASP CA   C  14.204 -30.014 -22.940 1.00 . A A .  32 ASP CA   1 1 
        3  4210 1 1  32 ASP CB   C  12.969 -29.673 -22.106 1.00 . A A .  32 ASP CB   1 1 
        3  4211 1 1  32 ASP CG   C  12.031 -28.722 -22.823 1.00 . A A .  32 ASP CG   1 1 
        3  4212 1 1  32 ASP H    H  14.603 -31.640 -21.646 1.00 . A A .  32 ASP H    1 1 
        3  4213 1 1  32 ASP HA   H  13.923 -30.053 -23.982 1.00 . A A .  32 ASP HA   1 1 
        3  4214 1 1  32 ASP HB2  H  12.432 -30.593 -21.876 1.00 . A A .  32 ASP HB2  1 1 
        3  4215 1 1  32 ASP HB3  H  13.284 -29.210 -21.181 1.00 . A A .  32 ASP HB3  1 1 
        3  4216 1 1  32 ASP N    N  14.723 -31.324 -22.566 1.00 . A A .  32 ASP N    1 1 
        3  4217 1 1  32 ASP O    O  15.739 -28.343 -23.731 1.00 . A A .  32 ASP O    1 1 
        3  4218 1 1  32 ASP OD1  O  12.163 -28.576 -24.055 1.00 . A A .  32 ASP OD1  1 1 
        3  4219 1 1  32 ASP OD2  O  11.163 -28.125 -22.150 1.00 . A A .  32 ASP OD2  1 1 
        3  4220 1 1  33 CYS C    C  17.342 -27.991 -19.874 1.00 . A A .  33 CYS C    1 1 
        3  4221 1 1  33 CYS CA   C  16.654 -27.681 -21.201 1.00 . A A .  33 CYS CA   1 1 
        3  4222 1 1  33 CYS CB   C  16.015 -26.291 -21.144 1.00 . A A .  33 CYS CB   1 1 
        3  4223 1 1  33 CYS H    H  15.234 -29.194 -20.777 1.00 . A A .  33 CYS H    1 1 
        3  4224 1 1  33 CYS HA   H  17.392 -27.697 -21.988 1.00 . A A .  33 CYS HA   1 1 
        3  4225 1 1  33 CYS HB2  H  16.807 -25.543 -21.181 1.00 . A A .  33 CYS HB2  1 1 
        3  4226 1 1  33 CYS HB3  H  15.378 -26.161 -22.006 1.00 . A A .  33 CYS HB3  1 1 
        3  4227 1 1  33 CYS HG   H  15.392 -26.826 -18.684 1.00 . A A .  33 CYS HG   1 1 
        3  4228 1 1  33 CYS N    N  15.645 -28.688 -21.510 1.00 . A A .  33 CYS N    1 1 
        3  4229 1 1  33 CYS O    O  16.743 -28.576 -18.973 1.00 . A A .  33 CYS O    1 1 
        3  4230 1 1  33 CYS SG   S  15.007 -25.995 -19.657 1.00 . A A .  33 CYS SG   1 1 
        3  4231 1 1  34 GLY C    C  20.808 -28.178 -18.816 1.00 . A A .  34 GLY C    1 1 
        3  4232 1 1  34 GLY CA   C  19.357 -27.836 -18.545 1.00 . A A .  34 GLY CA   1 1 
        3  4233 1 1  34 GLY H    H  19.033 -27.131 -20.515 1.00 . A A .  34 GLY H    1 1 
        3  4234 1 1  34 GLY HA2  H  19.316 -26.952 -17.927 1.00 . A A .  34 GLY HA2  1 1 
        3  4235 1 1  34 GLY HA3  H  18.900 -28.657 -18.013 1.00 . A A .  34 GLY HA3  1 1 
        3  4236 1 1  34 GLY N    N  18.607 -27.593 -19.763 1.00 . A A .  34 GLY N    1 1 
        3  4237 1 1  34 GLY O    O  21.278 -28.062 -19.948 1.00 . A A .  34 GLY O    1 1 
        3  4238 1 1  35 GLN C    C  23.135 -29.931 -19.062 1.00 . A A .  35 GLN C    1 1 
        3  4239 1 1  35 GLN CA   C  22.927 -28.956 -17.908 1.00 . A A .  35 GLN CA   1 1 
        3  4240 1 1  35 GLN CB   C  23.444 -29.571 -16.606 1.00 . A A .  35 GLN CB   1 1 
        3  4241 1 1  35 GLN CD   C  25.917 -29.067 -16.505 1.00 . A A .  35 GLN CD   1 1 
        3  4242 1 1  35 GLN CG   C  24.544 -28.756 -15.943 1.00 . A A .  35 GLN CG   1 1 
        3  4243 1 1  35 GLN H    H  21.088 -28.672 -16.899 1.00 . A A .  35 GLN H    1 1 
        3  4244 1 1  35 GLN HA   H  23.481 -28.052 -18.112 1.00 . A A .  35 GLN HA   1 1 
        3  4245 1 1  35 GLN HB2  H  22.611 -29.665 -15.910 1.00 . A A .  35 GLN HB2  1 1 
        3  4246 1 1  35 GLN HB3  H  23.832 -30.556 -16.816 1.00 . A A .  35 GLN HB3  1 1 
        3  4247 1 1  35 GLN HE21 H  26.659 -27.422 -15.666 1.00 . A A .  35 GLN HE21 1 1 
        3  4248 1 1  35 GLN HE22 H  27.781 -28.378 -16.568 1.00 . A A .  35 GLN HE22 1 1 
        3  4249 1 1  35 GLN HG2  H  24.334 -27.696 -16.087 1.00 . A A .  35 GLN HG2  1 1 
        3  4250 1 1  35 GLN HG3  H  24.547 -28.973 -14.886 1.00 . A A .  35 GLN HG3  1 1 
        3  4251 1 1  35 GLN N    N  21.519 -28.599 -17.776 1.00 . A A .  35 GLN N    1 1 
        3  4252 1 1  35 GLN NE2  N  26.884 -28.202 -16.219 1.00 . A A .  35 GLN NE2  1 1 
        3  4253 1 1  35 GLN O    O  22.562 -31.020 -19.080 1.00 . A A .  35 GLN O    1 1 
        3  4254 1 1  35 GLN OE1  O  26.109 -30.073 -17.189 1.00 . A A .  35 GLN OE1  1 1 
        3  4255 1 1  36 GLY C    C  25.683 -30.337 -21.598 1.00 . A A .  36 GLY C    1 1 
        3  4256 1 1  36 GLY CA   C  24.229 -30.383 -21.171 1.00 . A A .  36 GLY CA   1 1 
        3  4257 1 1  36 GLY H    H  24.389 -28.653 -19.959 1.00 . A A .  36 GLY H    1 1 
        3  4258 1 1  36 GLY HA2  H  23.970 -31.400 -20.919 1.00 . A A .  36 GLY HA2  1 1 
        3  4259 1 1  36 GLY HA3  H  23.614 -30.059 -21.998 1.00 . A A .  36 GLY HA3  1 1 
        3  4260 1 1  36 GLY N    N  23.961 -29.531 -20.025 1.00 . A A .  36 GLY N    1 1 
        3  4261 1 1  36 GLY O    O  26.584 -30.400 -20.762 1.00 . A A .  36 GLY O    1 1 
        3  4262 1 1  37 MET C    C  27.279 -29.547 -24.827 1.00 . A A .  37 MET C    1 1 
        3  4263 1 1  37 MET CA   C  27.267 -30.176 -23.438 1.00 . A A .  37 MET CA   1 1 
        3  4264 1 1  37 MET CB   C  27.869 -31.582 -23.498 1.00 . A A .  37 MET CB   1 1 
        3  4265 1 1  37 MET CE   C  29.254 -33.348 -26.130 1.00 . A A .  37 MET CE   1 1 
        3  4266 1 1  37 MET CG   C  27.183 -32.495 -24.498 1.00 . A A .  37 MET CG   1 1 
        3  4267 1 1  37 MET H    H  25.153 -30.183 -23.520 1.00 . A A .  37 MET H    1 1 
        3  4268 1 1  37 MET HA   H  27.863 -29.568 -22.775 1.00 . A A .  37 MET HA   1 1 
        3  4269 1 1  37 MET HB2  H  28.923 -31.499 -23.766 1.00 . A A .  37 MET HB2  1 1 
        3  4270 1 1  37 MET HB3  H  27.797 -32.034 -22.520 1.00 . A A .  37 MET HB3  1 1 
        3  4271 1 1  37 MET HE1  H  29.159 -33.951 -27.023 1.00 . A A .  37 MET HE1  1 1 
        3  4272 1 1  37 MET HE2  H  28.997 -32.324 -26.360 1.00 . A A .  37 MET HE2  1 1 
        3  4273 1 1  37 MET HE3  H  30.272 -33.392 -25.772 1.00 . A A .  37 MET HE3  1 1 
        3  4274 1 1  37 MET HG2  H  26.217 -32.797 -24.095 1.00 . A A .  37 MET HG2  1 1 
        3  4275 1 1  37 MET HG3  H  27.023 -31.947 -25.416 1.00 . A A .  37 MET HG3  1 1 
        3  4276 1 1  37 MET N    N  25.913 -30.229 -22.902 1.00 . A A .  37 MET N    1 1 
        3  4277 1 1  37 MET O    O  26.234 -29.402 -25.462 1.00 . A A .  37 MET O    1 1 
        3  4278 1 1  37 MET SD   S  28.149 -33.972 -24.868 1.00 . A A .  37 MET SD   1 1 
        3  4279 1 1  38 ARG C    C  29.931 -28.967 -27.255 1.00 . A A .  38 ARG C    1 1 
        3  4280 1 1  38 ARG CA   C  28.612 -28.557 -26.606 1.00 . A A .  38 ARG CA   1 1 
        3  4281 1 1  38 ARG CB   C  28.540 -27.034 -26.490 1.00 . A A .  38 ARG CB   1 1 
        3  4282 1 1  38 ARG CD   C  27.959 -26.557 -28.887 1.00 . A A .  38 ARG CD   1 1 
        3  4283 1 1  38 ARG CG   C  28.947 -26.305 -27.760 1.00 . A A .  38 ARG CG   1 1 
        3  4284 1 1  38 ARG CZ   C  27.995 -27.212 -31.258 1.00 . A A .  38 ARG CZ   1 1 
        3  4285 1 1  38 ARG H    H  29.262 -29.314 -24.740 1.00 . A A .  38 ARG H    1 1 
        3  4286 1 1  38 ARG HA   H  27.798 -28.900 -27.227 1.00 . A A .  38 ARG HA   1 1 
        3  4287 1 1  38 ARG HB2  H  27.518 -26.751 -26.238 1.00 . A A .  38 ARG HB2  1 1 
        3  4288 1 1  38 ARG HB3  H  29.194 -26.715 -25.692 1.00 . A A .  38 ARG HB3  1 1 
        3  4289 1 1  38 ARG HD2  H  27.329 -27.407 -28.625 1.00 . A A .  38 ARG HD2  1 1 
        3  4290 1 1  38 ARG HD3  H  27.337 -25.682 -29.005 1.00 . A A .  38 ARG HD3  1 1 
        3  4291 1 1  38 ARG HE   H  29.605 -26.739 -30.181 1.00 . A A .  38 ARG HE   1 1 
        3  4292 1 1  38 ARG HG2  H  28.995 -25.235 -27.559 1.00 . A A .  38 ARG HG2  1 1 
        3  4293 1 1  38 ARG HG3  H  29.924 -26.651 -28.065 1.00 . A A .  38 ARG HG3  1 1 
        3  4294 1 1  38 ARG HH11 H  26.159 -27.175 -30.413 1.00 . A A .  38 ARG HH11 1 1 
        3  4295 1 1  38 ARG HH12 H  26.199 -27.634 -32.083 1.00 . A A .  38 ARG HH12 1 1 
        3  4296 1 1  38 ARG HH21 H  29.670 -27.342 -32.380 1.00 . A A .  38 ARG HH21 1 1 
        3  4297 1 1  38 ARG HH22 H  28.196 -27.729 -33.201 1.00 . A A .  38 ARG HH22 1 1 
        3  4298 1 1  38 ARG N    N  28.466 -29.173 -25.294 1.00 . A A .  38 ARG N    1 1 
        3  4299 1 1  38 ARG NE   N  28.631 -26.836 -30.154 1.00 . A A .  38 ARG NE   1 1 
        3  4300 1 1  38 ARG NH1  N  26.677 -27.352 -31.250 1.00 . A A .  38 ARG NH1  1 1 
        3  4301 1 1  38 ARG NH2  N  28.677 -27.447 -32.371 1.00 . A A .  38 ARG NH2  1 1 
        3  4302 1 1  38 ARG O    O  30.923 -29.207 -26.568 1.00 . A A .  38 ARG O    1 1 
        3  4303 1 1  39 GLU C    C  31.702 -28.233 -30.086 1.00 . A A .  39 GLU C    1 1 
        3  4304 1 1  39 GLU CA   C  31.130 -29.424 -29.323 1.00 . A A .  39 GLU CA   1 1 
        3  4305 1 1  39 GLU CB   C  30.814 -30.561 -30.297 1.00 . A A .  39 GLU CB   1 1 
        3  4306 1 1  39 GLU CD   C  32.281 -32.583 -30.673 1.00 . A A .  39 GLU CD   1 1 
        3  4307 1 1  39 GLU CG   C  31.235 -31.931 -29.790 1.00 . A A .  39 GLU CG   1 1 
        3  4308 1 1  39 GLU H    H  29.111 -28.837 -29.075 1.00 . A A .  39 GLU H    1 1 
        3  4309 1 1  39 GLU HA   H  31.865 -29.767 -28.611 1.00 . A A .  39 GLU HA   1 1 
        3  4310 1 1  39 GLU HB2  H  29.740 -30.573 -30.484 1.00 . A A .  39 GLU HB2  1 1 
        3  4311 1 1  39 GLU HB3  H  31.325 -30.374 -31.229 1.00 . A A .  39 GLU HB3  1 1 
        3  4312 1 1  39 GLU HG2  H  31.638 -31.827 -28.783 1.00 . A A .  39 GLU HG2  1 1 
        3  4313 1 1  39 GLU HG3  H  30.365 -32.570 -29.755 1.00 . A A .  39 GLU HG3  1 1 
        3  4314 1 1  39 GLU N    N  29.934 -29.042 -28.582 1.00 . A A .  39 GLU N    1 1 
        3  4315 1 1  39 GLU O    O  31.067 -27.701 -30.995 1.00 . A A .  39 GLU O    1 1 
        3  4316 1 1  39 GLU OE1  O  31.895 -33.296 -31.624 1.00 . A A .  39 GLU OE1  1 1 
        3  4317 1 1  39 GLU OE2  O  33.485 -32.380 -30.414 1.00 . A A .  39 GLU OE2  1 1 
        3  4318 1 1  40 GLY C    C  34.277 -27.094 -31.626 1.00 . A A .  40 GLY C    1 1 
        3  4319 1 1  40 GLY CA   C  33.544 -26.689 -30.362 1.00 . A A .  40 GLY CA   1 1 
        3  4320 1 1  40 GLY H    H  33.367 -28.278 -28.974 1.00 . A A .  40 GLY H    1 1 
        3  4321 1 1  40 GLY HA2  H  32.788 -25.961 -30.615 1.00 . A A .  40 GLY HA2  1 1 
        3  4322 1 1  40 GLY HA3  H  34.249 -26.241 -29.678 1.00 . A A .  40 GLY HA3  1 1 
        3  4323 1 1  40 GLY N    N  32.906 -27.816 -29.705 1.00 . A A .  40 GLY N    1 1 
        3  4324 1 1  40 GLY O    O  35.376 -27.648 -31.565 1.00 . A A .  40 GLY O    1 1 
        3  4325 1 1  41 THR C    C  34.885 -25.934 -34.721 1.00 . A A .  41 THR C    1 1 
        3  4326 1 1  41 THR CA   C  34.270 -27.161 -34.058 1.00 . A A .  41 THR CA   1 1 
        3  4327 1 1  41 THR CB   C  33.236 -27.785 -35.015 1.00 . A A .  41 THR CB   1 1 
        3  4328 1 1  41 THR CG2  C  32.259 -28.669 -34.256 1.00 . A A .  41 THR CG2  1 1 
        3  4329 1 1  41 THR H    H  32.795 -26.378 -32.758 1.00 . A A .  41 THR H    1 1 
        3  4330 1 1  41 THR HA   H  35.049 -27.890 -33.879 1.00 . A A .  41 THR HA   1 1 
        3  4331 1 1  41 THR HB   H  33.759 -28.390 -35.741 1.00 . A A .  41 THR HB   1 1 
        3  4332 1 1  41 THR HG1  H  32.308 -26.045 -35.085 1.00 . A A .  41 THR HG1  1 1 
        3  4333 1 1  41 THR HG21 H  32.805 -29.442 -33.735 1.00 . A A .  41 THR HG21 1 1 
        3  4334 1 1  41 THR HG22 H  31.569 -29.122 -34.951 1.00 . A A .  41 THR HG22 1 1 
        3  4335 1 1  41 THR HG23 H  31.713 -28.072 -33.541 1.00 . A A .  41 THR HG23 1 1 
        3  4336 1 1  41 THR N    N  33.670 -26.820 -32.775 1.00 . A A .  41 THR N    1 1 
        3  4337 1 1  41 THR O    O  34.206 -24.932 -34.948 1.00 . A A .  41 THR O    1 1 
        3  4338 1 1  41 THR OG1  O  32.518 -26.751 -35.701 1.00 . A A .  41 THR OG1  1 1 
        3  4339 1 1  42 CYS C    C  37.497 -25.356 -36.994 1.00 . A A .  42 CYS C    1 1 
        3  4340 1 1  42 CYS CA   C  36.881 -24.914 -35.670 1.00 . A A .  42 CYS CA   1 1 
        3  4341 1 1  42 CYS CB   C  37.973 -24.376 -34.741 1.00 . A A .  42 CYS CB   1 1 
        3  4342 1 1  42 CYS H    H  36.663 -26.843 -34.826 1.00 . A A .  42 CYS H    1 1 
        3  4343 1 1  42 CYS HA   H  36.167 -24.130 -35.863 1.00 . A A .  42 CYS HA   1 1 
        3  4344 1 1  42 CYS HB2  H  37.497 -23.854 -33.911 1.00 . A A .  42 CYS HB2  1 1 
        3  4345 1 1  42 CYS HB3  H  38.541 -25.206 -34.347 1.00 . A A .  42 CYS HB3  1 1 
        3  4346 1 1  42 CYS HG   H  38.469 -22.221 -36.098 1.00 . A A .  42 CYS HG   1 1 
        3  4347 1 1  42 CYS N    N  36.174 -26.018 -35.032 1.00 . A A .  42 CYS N    1 1 
        3  4348 1 1  42 CYS O    O  38.425 -26.164 -37.021 1.00 . A A .  42 CYS O    1 1 
        3  4349 1 1  42 CYS SG   S  39.142 -23.237 -35.551 1.00 . A A .  42 CYS SG   1 1 
        3  4350 1 1  43 ASN C    C  37.244 -26.636 -39.725 1.00 . A A .  43 ASN C    1 1 
        3  4351 1 1  43 ASN CA   C  37.470 -25.158 -39.420 1.00 . A A .  43 ASN CA   1 1 
        3  4352 1 1  43 ASN CB   C  38.960 -24.826 -39.530 1.00 . A A .  43 ASN CB   1 1 
        3  4353 1 1  43 ASN CG   C  39.206 -23.483 -40.189 1.00 . A A .  43 ASN CG   1 1 
        3  4354 1 1  43 ASN H    H  36.234 -24.182 -38.006 1.00 . A A .  43 ASN H    1 1 
        3  4355 1 1  43 ASN HA   H  36.925 -24.566 -40.140 1.00 . A A .  43 ASN HA   1 1 
        3  4356 1 1  43 ASN HB2  H  39.394 -24.814 -38.530 1.00 . A A .  43 ASN HB2  1 1 
        3  4357 1 1  43 ASN HB3  H  39.451 -25.590 -40.115 1.00 . A A .  43 ASN HB3  1 1 
        3  4358 1 1  43 ASN HD21 H  39.770 -24.382 -41.869 1.00 . A A .  43 ASN HD21 1 1 
        3  4359 1 1  43 ASN HD22 H  39.804 -22.655 -41.894 1.00 . A A .  43 ASN HD22 1 1 
        3  4360 1 1  43 ASN N    N  36.973 -24.820 -38.091 1.00 . A A .  43 ASN N    1 1 
        3  4361 1 1  43 ASN ND2  N  39.636 -23.509 -41.444 1.00 . A A .  43 ASN ND2  1 1 
        3  4362 1 1  43 ASN O    O  36.241 -27.006 -40.336 1.00 . A A .  43 ASN O    1 1 
        3  4363 1 1  43 ASN OD1  O  39.011 -22.433 -39.575 1.00 . A A .  43 ASN OD1  1 1 
        3  4364 1 1  44 GLU C    C  38.466 -29.689 -38.269 1.00 . A A .  44 GLU C    1 1 
        3  4365 1 1  44 GLU CA   C  38.083 -28.911 -39.524 1.00 . A A .  44 GLU CA   1 1 
        3  4366 1 1  44 GLU CB   C  38.983 -29.328 -40.690 1.00 . A A .  44 GLU CB   1 1 
        3  4367 1 1  44 GLU CD   C  39.449 -31.020 -42.508 1.00 . A A .  44 GLU CD   1 1 
        3  4368 1 1  44 GLU CG   C  38.473 -30.540 -41.451 1.00 . A A .  44 GLU CG   1 1 
        3  4369 1 1  44 GLU H    H  38.958 -27.119 -38.816 1.00 . A A .  44 GLU H    1 1 
        3  4370 1 1  44 GLU HA   H  37.058 -29.138 -39.776 1.00 . A A .  44 GLU HA   1 1 
        3  4371 1 1  44 GLU HB2  H  39.068 -28.491 -41.383 1.00 . A A .  44 GLU HB2  1 1 
        3  4372 1 1  44 GLU HB3  H  39.965 -29.559 -40.305 1.00 . A A .  44 GLU HB3  1 1 
        3  4373 1 1  44 GLU HG2  H  38.291 -31.350 -40.744 1.00 . A A .  44 GLU HG2  1 1 
        3  4374 1 1  44 GLU HG3  H  37.541 -30.280 -41.934 1.00 . A A .  44 GLU HG3  1 1 
        3  4375 1 1  44 GLU N    N  38.181 -27.474 -39.297 1.00 . A A .  44 GLU N    1 1 
        3  4376 1 1  44 GLU O    O  38.895 -30.840 -38.348 1.00 . A A .  44 GLU O    1 1 
        3  4377 1 1  44 GLU OE1  O  40.471 -30.337 -42.724 1.00 . A A .  44 GLU OE1  1 1 
        3  4378 1 1  44 GLU OE2  O  39.189 -32.079 -43.117 1.00 . A A .  44 GLU OE2  1 1 
        3  4379 1 1  45 GLN C    C  37.422 -29.720 -34.921 1.00 . A A .  45 GLN C    1 1 
        3  4380 1 1  45 GLN CA   C  38.637 -29.682 -35.842 1.00 . A A .  45 GLN CA   1 1 
        3  4381 1 1  45 GLN CB   C  39.785 -28.937 -35.160 1.00 . A A .  45 GLN CB   1 1 
        3  4382 1 1  45 GLN CD   C  42.039 -27.822 -35.421 1.00 . A A .  45 GLN CD   1 1 
        3  4383 1 1  45 GLN CG   C  40.966 -28.667 -36.079 1.00 . A A .  45 GLN CG   1 1 
        3  4384 1 1  45 GLN H    H  37.961 -28.136 -37.118 1.00 . A A .  45 GLN H    1 1 
        3  4385 1 1  45 GLN HA   H  38.950 -30.695 -36.047 1.00 . A A .  45 GLN HA   1 1 
        3  4386 1 1  45 GLN HB2  H  39.409 -27.985 -34.786 1.00 . A A .  45 GLN HB2  1 1 
        3  4387 1 1  45 GLN HB3  H  40.135 -29.524 -34.323 1.00 . A A .  45 GLN HB3  1 1 
        3  4388 1 1  45 GLN HE21 H  43.019 -27.679 -37.143 1.00 . A A .  45 GLN HE21 1 1 
        3  4389 1 1  45 GLN HE22 H  43.738 -26.866 -35.799 1.00 . A A .  45 GLN HE22 1 1 
        3  4390 1 1  45 GLN HG2  H  41.403 -29.619 -36.380 1.00 . A A .  45 GLN HG2  1 1 
        3  4391 1 1  45 GLN HG3  H  40.611 -28.152 -36.959 1.00 . A A .  45 GLN HG3  1 1 
        3  4392 1 1  45 GLN N    N  38.307 -29.052 -37.115 1.00 . A A .  45 GLN N    1 1 
        3  4393 1 1  45 GLN NE2  N  43.033 -27.414 -36.199 1.00 . A A .  45 GLN NE2  1 1 
        3  4394 1 1  45 GLN O    O  36.418 -29.052 -35.172 1.00 . A A .  45 GLN O    1 1 
        3  4395 1 1  45 GLN OE1  O  41.972 -27.538 -34.224 1.00 . A A .  45 GLN OE1  1 1 
        3  4396 1 1  46 THR C    C  36.905 -30.347 -31.477 1.00 . A A .  46 THR C    1 1 
        3  4397 1 1  46 THR CA   C  36.427 -30.632 -32.895 1.00 . A A .  46 THR CA   1 1 
        3  4398 1 1  46 THR CB   C  35.799 -32.039 -32.940 1.00 . A A .  46 THR CB   1 1 
        3  4399 1 1  46 THR CG2  C  34.709 -32.111 -33.998 1.00 . A A .  46 THR CG2  1 1 
        3  4400 1 1  46 THR H    H  38.345 -31.014 -33.708 1.00 . A A .  46 THR H    1 1 
        3  4401 1 1  46 THR HA   H  35.666 -29.913 -33.161 1.00 . A A .  46 THR HA   1 1 
        3  4402 1 1  46 THR HB   H  35.360 -32.251 -31.977 1.00 . A A .  46 THR HB   1 1 
        3  4403 1 1  46 THR HG1  H  37.314 -33.191 -32.422 1.00 . A A .  46 THR HG1  1 1 
        3  4404 1 1  46 THR HG21 H  34.023 -31.289 -33.865 1.00 . A A .  46 THR HG21 1 1 
        3  4405 1 1  46 THR HG22 H  34.176 -33.045 -33.902 1.00 . A A .  46 THR HG22 1 1 
        3  4406 1 1  46 THR HG23 H  35.155 -32.051 -34.980 1.00 . A A .  46 THR HG23 1 1 
        3  4407 1 1  46 THR N    N  37.518 -30.506 -33.854 1.00 . A A .  46 THR N    1 1 
        3  4408 1 1  46 THR O    O  38.102 -30.388 -31.195 1.00 . A A .  46 THR O    1 1 
        3  4409 1 1  46 THR OG1  O  36.808 -33.016 -33.220 1.00 . A A .  46 THR OG1  1 1 
        3  4410 1 1  47 ARG C    C  35.176 -30.239 -28.266 1.00 . A A .  47 ARG C    1 1 
        3  4411 1 1  47 ARG CA   C  36.286 -29.762 -29.196 1.00 . A A .  47 ARG CA   1 1 
        3  4412 1 1  47 ARG CB   C  36.513 -28.260 -29.010 1.00 . A A .  47 ARG CB   1 1 
        3  4413 1 1  47 ARG CD   C  38.389 -28.624 -27.377 1.00 . A A .  47 ARG CD   1 1 
        3  4414 1 1  47 ARG CG   C  37.083 -27.895 -27.648 1.00 . A A .  47 ARG CG   1 1 
        3  4415 1 1  47 ARG CZ   C  40.656 -28.093 -26.586 1.00 . A A .  47 ARG CZ   1 1 
        3  4416 1 1  47 ARG H    H  35.023 -30.037 -30.872 1.00 . A A .  47 ARG H    1 1 
        3  4417 1 1  47 ARG HA   H  37.197 -30.288 -28.950 1.00 . A A .  47 ARG HA   1 1 
        3  4418 1 1  47 ARG HB2  H  37.200 -27.912 -29.781 1.00 . A A .  47 ARG HB2  1 1 
        3  4419 1 1  47 ARG HB3  H  35.571 -27.749 -29.130 1.00 . A A .  47 ARG HB3  1 1 
        3  4420 1 1  47 ARG HD2  H  38.195 -29.469 -26.717 1.00 . A A .  47 ARG HD2  1 1 
        3  4421 1 1  47 ARG HD3  H  38.782 -28.992 -28.313 1.00 . A A .  47 ARG HD3  1 1 
        3  4422 1 1  47 ARG HE   H  39.085 -26.872 -26.448 1.00 . A A .  47 ARG HE   1 1 
        3  4423 1 1  47 ARG HG2  H  37.259 -26.820 -27.610 1.00 . A A .  47 ARG HG2  1 1 
        3  4424 1 1  47 ARG HG3  H  36.366 -28.163 -26.886 1.00 . A A .  47 ARG HG3  1 1 
        3  4425 1 1  47 ARG HH11 H  40.453 -29.920 -27.424 1.00 . A A .  47 ARG HH11 1 1 
        3  4426 1 1  47 ARG HH12 H  42.047 -29.534 -26.862 1.00 . A A .  47 ARG HH12 1 1 
        3  4427 1 1  47 ARG HH21 H  41.177 -26.350 -25.704 1.00 . A A .  47 ARG HH21 1 1 
        3  4428 1 1  47 ARG HH22 H  42.457 -27.503 -25.883 1.00 . A A .  47 ARG HH22 1 1 
        3  4429 1 1  47 ARG N    N  35.961 -30.055 -30.587 1.00 . A A .  47 ARG N    1 1 
        3  4430 1 1  47 ARG NE   N  39.382 -27.753 -26.755 1.00 . A A .  47 ARG NE   1 1 
        3  4431 1 1  47 ARG NH1  N  41.088 -29.280 -26.990 1.00 . A A .  47 ARG NH1  1 1 
        3  4432 1 1  47 ARG NH2  N  41.500 -27.247 -26.010 1.00 . A A .  47 ARG NH2  1 1 
        3  4433 1 1  47 ARG O    O  34.042 -30.452 -28.693 1.00 . A A .  47 ARG O    1 1 
        3  4434 1 1  48 LYS C    C  34.452 -29.870 -24.837 1.00 . A A .  48 LYS C    1 1 
        3  4435 1 1  48 LYS CA   C  34.542 -30.856 -25.997 1.00 . A A .  48 LYS CA   1 1 
        3  4436 1 1  48 LYS CB   C  34.927 -32.241 -25.474 1.00 . A A .  48 LYS CB   1 1 
        3  4437 1 1  48 LYS CD   C  35.292 -34.676 -25.975 1.00 . A A .  48 LYS CD   1 1 
        3  4438 1 1  48 LYS CE   C  35.162 -35.778 -27.016 1.00 . A A .  48 LYS CE   1 1 
        3  4439 1 1  48 LYS CG   C  34.815 -33.340 -26.519 1.00 . A A .  48 LYS CG   1 1 
        3  4440 1 1  48 LYS H    H  36.431 -30.218 -26.710 1.00 . A A .  48 LYS H    1 1 
        3  4441 1 1  48 LYS HA   H  33.578 -30.918 -26.478 1.00 . A A .  48 LYS HA   1 1 
        3  4442 1 1  48 LYS HB2  H  35.955 -32.206 -25.113 1.00 . A A .  48 LYS HB2  1 1 
        3  4443 1 1  48 LYS HB3  H  34.278 -32.492 -24.648 1.00 . A A .  48 LYS HB3  1 1 
        3  4444 1 1  48 LYS HD2  H  36.336 -34.587 -25.677 1.00 . A A .  48 LYS HD2  1 1 
        3  4445 1 1  48 LYS HD3  H  34.697 -34.937 -25.111 1.00 . A A .  48 LYS HD3  1 1 
        3  4446 1 1  48 LYS HE2  H  35.363 -35.361 -28.002 1.00 . A A .  48 LYS HE2  1 1 
        3  4447 1 1  48 LYS HE3  H  35.893 -36.545 -26.801 1.00 . A A .  48 LYS HE3  1 1 
        3  4448 1 1  48 LYS HG2  H  33.774 -33.432 -26.830 1.00 . A A .  48 LYS HG2  1 1 
        3  4449 1 1  48 LYS HG3  H  35.418 -33.072 -27.373 1.00 . A A .  48 LYS HG3  1 1 
        3  4450 1 1  48 LYS HZ1  H  33.877 -37.422 -26.929 1.00 . A A .  48 LYS HZ1  1 1 
        3  4451 1 1  48 LYS HZ2  H  33.306 -36.156 -27.896 1.00 . A A .  48 LYS HZ2  1 1 
        3  4452 1 1  48 LYS HZ3  H  33.251 -36.024 -26.211 1.00 . A A .  48 LYS HZ3  1 1 
        3  4453 1 1  48 LYS N    N  35.511 -30.405 -26.990 1.00 . A A .  48 LYS N    1 1 
        3  4454 1 1  48 LYS NZ   N  33.805 -36.388 -27.013 1.00 . A A .  48 LYS NZ   1 1 
        3  4455 1 1  48 LYS O    O  35.467 -29.475 -24.265 1.00 . A A .  48 LYS O    1 1 
        3  4456 1 1  49 VAL C    C  31.636 -28.745 -22.770 1.00 . A A .  49 VAL C    1 1 
        3  4457 1 1  49 VAL CA   C  33.007 -28.536 -23.403 1.00 . A A .  49 VAL CA   1 1 
        3  4458 1 1  49 VAL CB   C  33.122 -27.077 -23.884 1.00 . A A .  49 VAL CB   1 1 
        3  4459 1 1  49 VAL CG1  C  34.576 -26.716 -24.148 1.00 . A A .  49 VAL CG1  1 1 
        3  4460 1 1  49 VAL CG2  C  32.274 -26.858 -25.127 1.00 . A A .  49 VAL CG2  1 1 
        3  4461 1 1  49 VAL H    H  32.459 -29.823 -24.990 1.00 . A A .  49 VAL H    1 1 
        3  4462 1 1  49 VAL HA   H  33.768 -28.709 -22.654 1.00 . A A .  49 VAL HA   1 1 
        3  4463 1 1  49 VAL HB   H  32.752 -26.433 -23.100 1.00 . A A .  49 VAL HB   1 1 
        3  4464 1 1  49 VAL HG11 H  35.158 -26.885 -23.254 1.00 . A A .  49 VAL HG11 1 1 
        3  4465 1 1  49 VAL HG12 H  34.960 -27.329 -24.950 1.00 . A A .  49 VAL HG12 1 1 
        3  4466 1 1  49 VAL HG13 H  34.642 -25.675 -24.428 1.00 . A A .  49 VAL HG13 1 1 
        3  4467 1 1  49 VAL HG21 H  32.037 -25.809 -25.220 1.00 . A A .  49 VAL HG21 1 1 
        3  4468 1 1  49 VAL HG22 H  32.823 -27.183 -25.998 1.00 . A A .  49 VAL HG22 1 1 
        3  4469 1 1  49 VAL HG23 H  31.360 -27.428 -25.044 1.00 . A A .  49 VAL HG23 1 1 
        3  4470 1 1  49 VAL N    N  33.230 -29.475 -24.495 1.00 . A A .  49 VAL N    1 1 
        3  4471 1 1  49 VAL O    O  30.665 -29.060 -23.457 1.00 . A A .  49 VAL O    1 1 
        3  4472 1 1  50 LYS C    C  29.583 -27.399 -20.585 1.00 . A A .  50 LYS C    1 1 
        3  4473 1 1  50 LYS CA   C  30.312 -28.732 -20.728 1.00 . A A .  50 LYS CA   1 1 
        3  4474 1 1  50 LYS CB   C  30.577 -29.332 -19.345 1.00 . A A .  50 LYS CB   1 1 
        3  4475 1 1  50 LYS CD   C  29.899 -31.736 -19.075 1.00 . A A .  50 LYS CD   1 1 
        3  4476 1 1  50 LYS CE   C  30.197 -33.140 -19.579 1.00 . A A .  50 LYS CE   1 1 
        3  4477 1 1  50 LYS CG   C  31.037 -30.779 -19.388 1.00 . A A .  50 LYS CG   1 1 
        3  4478 1 1  50 LYS H    H  32.373 -28.315 -20.962 1.00 . A A .  50 LYS H    1 1 
        3  4479 1 1  50 LYS HA   H  29.688 -29.410 -21.292 1.00 . A A .  50 LYS HA   1 1 
        3  4480 1 1  50 LYS HB2  H  31.341 -28.737 -18.847 1.00 . A A .  50 LYS HB2  1 1 
        3  4481 1 1  50 LYS HB3  H  29.666 -29.284 -18.765 1.00 . A A .  50 LYS HB3  1 1 
        3  4482 1 1  50 LYS HD2  H  29.746 -31.769 -17.996 1.00 . A A .  50 LYS HD2  1 1 
        3  4483 1 1  50 LYS HD3  H  28.997 -31.376 -19.550 1.00 . A A .  50 LYS HD3  1 1 
        3  4484 1 1  50 LYS HE2  H  29.427 -33.820 -19.214 1.00 . A A .  50 LYS HE2  1 1 
        3  4485 1 1  50 LYS HE3  H  30.177 -33.131 -20.659 1.00 . A A .  50 LYS HE3  1 1 
        3  4486 1 1  50 LYS HG2  H  31.427 -31.000 -20.381 1.00 . A A .  50 LYS HG2  1 1 
        3  4487 1 1  50 LYS HG3  H  31.823 -30.918 -18.660 1.00 . A A .  50 LYS HG3  1 1 
        3  4488 1 1  50 LYS HZ1  H  32.188 -33.668 -19.924 1.00 . A A .  50 LYS HZ1  1 1 
        3  4489 1 1  50 LYS HZ2  H  31.441 -34.571 -18.705 1.00 . A A .  50 LYS HZ2  1 1 
        3  4490 1 1  50 LYS HZ3  H  31.916 -32.976 -18.405 1.00 . A A .  50 LYS HZ3  1 1 
        3  4491 1 1  50 LYS N    N  31.564 -28.566 -21.456 1.00 . A A .  50 LYS N    1 1 
        3  4492 1 1  50 LYS NZ   N  31.529 -33.622 -19.122 1.00 . A A .  50 LYS NZ   1 1 
        3  4493 1 1  50 LYS O    O  30.139 -26.430 -20.064 1.00 . A A .  50 LYS O    1 1 
        3  4494 1 1  51 CYS C    C  26.091 -26.469 -20.605 1.00 . A A .  51 CYS C    1 1 
        3  4495 1 1  51 CYS CA   C  27.536 -26.142 -20.971 1.00 . A A .  51 CYS CA   1 1 
        3  4496 1 1  51 CYS CB   C  27.578 -25.391 -22.303 1.00 . A A .  51 CYS CB   1 1 
        3  4497 1 1  51 CYS H    H  27.952 -28.161 -21.453 1.00 . A A .  51 CYS H    1 1 
        3  4498 1 1  51 CYS HA   H  27.956 -25.515 -20.200 1.00 . A A .  51 CYS HA   1 1 
        3  4499 1 1  51 CYS HB2  H  27.154 -24.398 -22.156 1.00 . A A .  51 CYS HB2  1 1 
        3  4500 1 1  51 CYS HB3  H  28.607 -25.285 -22.614 1.00 . A A .  51 CYS HB3  1 1 
        3  4501 1 1  51 CYS HG   H  26.804 -27.542 -23.530 1.00 . A A .  51 CYS HG   1 1 
        3  4502 1 1  51 CYS N    N  28.340 -27.355 -21.048 1.00 . A A .  51 CYS N    1 1 
        3  4503 1 1  51 CYS O    O  25.569 -27.521 -20.973 1.00 . A A .  51 CYS O    1 1 
        3  4504 1 1  51 CYS SG   S  26.673 -26.218 -23.650 1.00 . A A .  51 CYS SG   1 1 
        3  4505 1 1  52 ARG C    C  23.125 -24.877 -20.282 1.00 . A A .  52 ARG C    1 1 
        3  4506 1 1  52 ARG CA   C  24.067 -25.751 -19.459 1.00 . A A .  52 ARG CA   1 1 
        3  4507 1 1  52 ARG CB   C  23.911 -25.428 -17.972 1.00 . A A .  52 ARG CB   1 1 
        3  4508 1 1  52 ARG CD   C  24.892 -23.116 -18.046 1.00 . A A .  52 ARG CD   1 1 
        3  4509 1 1  52 ARG CG   C  23.673 -23.954 -17.691 1.00 . A A .  52 ARG CG   1 1 
        3  4510 1 1  52 ARG CZ   C  25.364 -22.047 -15.883 1.00 . A A .  52 ARG CZ   1 1 
        3  4511 1 1  52 ARG H    H  25.920 -24.741 -19.614 1.00 . A A .  52 ARG H    1 1 
        3  4512 1 1  52 ARG HA   H  23.812 -26.788 -19.623 1.00 . A A .  52 ARG HA   1 1 
        3  4513 1 1  52 ARG HB2  H  23.070 -25.998 -17.578 1.00 . A A .  52 ARG HB2  1 1 
        3  4514 1 1  52 ARG HB3  H  24.808 -25.733 -17.454 1.00 . A A .  52 ARG HB3  1 1 
        3  4515 1 1  52 ARG HD2  H  25.785 -23.735 -17.965 1.00 . A A .  52 ARG HD2  1 1 
        3  4516 1 1  52 ARG HD3  H  24.793 -22.773 -19.064 1.00 . A A .  52 ARG HD3  1 1 
        3  4517 1 1  52 ARG HE   H  24.877 -21.073 -17.553 1.00 . A A .  52 ARG HE   1 1 
        3  4518 1 1  52 ARG HG2  H  22.821 -23.611 -18.278 1.00 . A A .  52 ARG HG2  1 1 
        3  4519 1 1  52 ARG HG3  H  23.452 -23.828 -16.641 1.00 . A A .  52 ARG HG3  1 1 
        3  4520 1 1  52 ARG HH11 H  25.501 -24.062 -15.882 1.00 . A A .  52 ARG HH11 1 1 
        3  4521 1 1  52 ARG HH12 H  25.832 -23.296 -14.364 1.00 . A A .  52 ARG HH12 1 1 
        3  4522 1 1  52 ARG HH21 H  25.309 -20.052 -15.560 1.00 . A A .  52 ARG HH21 1 1 
        3  4523 1 1  52 ARG HH22 H  25.721 -21.014 -14.181 1.00 . A A .  52 ARG HH22 1 1 
        3  4524 1 1  52 ARG N    N  25.450 -25.560 -19.877 1.00 . A A .  52 ARG N    1 1 
        3  4525 1 1  52 ARG NE   N  25.035 -21.959 -17.166 1.00 . A A .  52 ARG NE   1 1 
        3  4526 1 1  52 ARG NH1  N  25.583 -23.232 -15.330 1.00 . A A .  52 ARG NH1  1 1 
        3  4527 1 1  52 ARG NH2  N  25.474 -20.948 -15.148 1.00 . A A .  52 ARG NH2  1 1 
        3  4528 1 1  52 ARG O    O  23.461 -23.749 -20.639 1.00 . A A .  52 ARG O    1 1 
        3  4529 1 1  53 VAL C    C  19.792 -24.217 -20.484 1.00 . A A .  53 VAL C    1 1 
        3  4530 1 1  53 VAL CA   C  20.951 -24.675 -21.361 1.00 . A A .  53 VAL CA   1 1 
        3  4531 1 1  53 VAL CB   C  20.400 -25.535 -22.514 1.00 . A A .  53 VAL CB   1 1 
        3  4532 1 1  53 VAL CG1  C  19.518 -24.698 -23.428 1.00 . A A .  53 VAL CG1  1 1 
        3  4533 1 1  53 VAL CG2  C  21.539 -26.171 -23.296 1.00 . A A .  53 VAL CG2  1 1 
        3  4534 1 1  53 VAL H    H  21.732 -26.312 -20.269 1.00 . A A .  53 VAL H    1 1 
        3  4535 1 1  53 VAL HA   H  21.435 -23.807 -21.786 1.00 . A A .  53 VAL HA   1 1 
        3  4536 1 1  53 VAL HB   H  19.797 -26.323 -22.092 1.00 . A A .  53 VAL HB   1 1 
        3  4537 1 1  53 VAL HG11 H  18.483 -24.839 -23.157 1.00 . A A .  53 VAL HG11 1 1 
        3  4538 1 1  53 VAL HG12 H  19.779 -23.655 -23.326 1.00 . A A .  53 VAL HG12 1 1 
        3  4539 1 1  53 VAL HG13 H  19.666 -25.008 -24.452 1.00 . A A .  53 VAL HG13 1 1 
        3  4540 1 1  53 VAL HG21 H  21.513 -27.243 -23.164 1.00 . A A .  53 VAL HG21 1 1 
        3  4541 1 1  53 VAL HG22 H  21.432 -25.934 -24.345 1.00 . A A .  53 VAL HG22 1 1 
        3  4542 1 1  53 VAL HG23 H  22.484 -25.788 -22.935 1.00 . A A .  53 VAL HG23 1 1 
        3  4543 1 1  53 VAL N    N  21.944 -25.408 -20.581 1.00 . A A .  53 VAL N    1 1 
        3  4544 1 1  53 VAL O    O  18.809 -24.931 -20.289 1.00 . A A .  53 VAL O    1 1 
        3  4545 1 1  54 PRO C    C  17.608 -22.059 -19.845 1.00 . A A .  54 PRO C    1 1 
        3  4546 1 1  54 PRO CA   C  18.878 -22.412 -19.078 1.00 . A A .  54 PRO CA   1 1 
        3  4547 1 1  54 PRO CB   C  19.544 -21.145 -18.537 1.00 . A A .  54 PRO CB   1 1 
        3  4548 1 1  54 PRO CD   C  21.052 -22.089 -20.133 1.00 . A A .  54 PRO CD   1 1 
        3  4549 1 1  54 PRO CG   C  20.564 -20.786 -19.560 1.00 . A A .  54 PRO CG   1 1 
        3  4550 1 1  54 PRO HA   H  18.630 -23.069 -18.257 1.00 . A A .  54 PRO HA   1 1 
        3  4551 1 1  54 PRO HB2  H  18.811 -20.345 -18.437 1.00 . A A .  54 PRO HB2  1 1 
        3  4552 1 1  54 PRO HB3  H  20.002 -21.355 -17.581 1.00 . A A .  54 PRO HB3  1 1 
        3  4553 1 1  54 PRO HD2  H  21.284 -21.980 -21.192 1.00 . A A .  54 PRO HD2  1 1 
        3  4554 1 1  54 PRO HD3  H  21.916 -22.440 -19.589 1.00 . A A .  54 PRO HD3  1 1 
        3  4555 1 1  54 PRO HG2  H  20.114 -20.176 -20.343 1.00 . A A .  54 PRO HG2  1 1 
        3  4556 1 1  54 PRO HG3  H  21.381 -20.254 -19.095 1.00 . A A .  54 PRO HG3  1 1 
        3  4557 1 1  54 PRO N    N  19.907 -22.994 -19.943 1.00 . A A .  54 PRO N    1 1 
        3  4558 1 1  54 PRO O    O  17.669 -21.536 -20.960 1.00 . A A .  54 PRO O    1 1 
        3  4559 1 1  55 CYS C    C  14.762 -20.610 -19.627 1.00 . A A .  55 CYS C    1 1 
        3  4560 1 1  55 CYS CA   C  15.175 -22.059 -19.871 1.00 . A A .  55 CYS CA   1 1 
        3  4561 1 1  55 CYS CB   C  14.099 -23.004 -19.333 1.00 . A A .  55 CYS CB   1 1 
        3  4562 1 1  55 CYS H    H  16.475 -22.762 -18.357 1.00 . A A .  55 CYS H    1 1 
        3  4563 1 1  55 CYS HA   H  15.280 -22.217 -20.933 1.00 . A A .  55 CYS HA   1 1 
        3  4564 1 1  55 CYS HB2  H  14.407 -23.357 -18.349 1.00 . A A .  55 CYS HB2  1 1 
        3  4565 1 1  55 CYS HB3  H  13.171 -22.461 -19.231 1.00 . A A .  55 CYS HB3  1 1 
        3  4566 1 1  55 CYS HG   H  12.877 -24.128 -21.325 1.00 . A A .  55 CYS HG   1 1 
        3  4567 1 1  55 CYS N    N  16.459 -22.346 -19.244 1.00 . A A .  55 CYS N    1 1 
        3  4568 1 1  55 CYS O    O  15.060 -20.037 -18.580 1.00 . A A .  55 CYS O    1 1 
        3  4569 1 1  55 CYS SG   S  13.781 -24.449 -20.395 1.00 . A A .  55 CYS SG   1 1 
        3  4570 1 1  56 ASN C    C  14.806 -17.685 -20.414 1.00 . A A .  56 ASN C    1 1 
        3  4571 1 1  56 ASN CA   C  13.620 -18.643 -20.494 1.00 . A A .  56 ASN CA   1 1 
        3  4572 1 1  56 ASN CB   C  12.729 -18.471 -19.262 1.00 . A A .  56 ASN CB   1 1 
        3  4573 1 1  56 ASN CG   C  11.848 -19.680 -19.014 1.00 . A A .  56 ASN CG   1 1 
        3  4574 1 1  56 ASN H    H  13.867 -20.533 -21.413 1.00 . A A .  56 ASN H    1 1 
        3  4575 1 1  56 ASN HA   H  13.045 -18.412 -21.378 1.00 . A A .  56 ASN HA   1 1 
        3  4576 1 1  56 ASN HB2  H  13.361 -18.309 -18.388 1.00 . A A .  56 ASN HB2  1 1 
        3  4577 1 1  56 ASN HB3  H  12.096 -17.608 -19.401 1.00 . A A .  56 ASN HB3  1 1 
        3  4578 1 1  56 ASN HD21 H  12.155 -19.533 -17.055 1.00 . A A .  56 ASN HD21 1 1 
        3  4579 1 1  56 ASN HD22 H  11.132 -20.830 -17.560 1.00 . A A .  56 ASN HD22 1 1 
        3  4580 1 1  56 ASN N    N  14.074 -20.025 -20.601 1.00 . A A .  56 ASN N    1 1 
        3  4581 1 1  56 ASN ND2  N  11.696 -20.052 -17.748 1.00 . A A .  56 ASN ND2  1 1 
        3  4582 1 1  56 ASN O    O  14.947 -16.934 -19.450 1.00 . A A .  56 ASN O    1 1 
        3  4583 1 1  56 ASN OD1  O  11.308 -20.272 -19.950 1.00 . A A .  56 ASN OD1  1 1 
        3  4584 1 1  57 TRP C    C  16.443 -15.400 -21.232 1.00 . A A .  57 TRP C    1 1 
        3  4585 1 1  57 TRP CA   C  16.829 -16.853 -21.482 1.00 . A A .  57 TRP CA   1 1 
        3  4586 1 1  57 TRP CB   C  17.530 -16.983 -22.835 1.00 . A A .  57 TRP CB   1 1 
        3  4587 1 1  57 TRP CD1  C  19.229 -18.901 -22.784 1.00 . A A .  57 TRP CD1  1 1 
        3  4588 1 1  57 TRP CD2  C  17.302 -19.407 -23.804 1.00 . A A .  57 TRP CD2  1 1 
        3  4589 1 1  57 TRP CE2  C  18.141 -20.537 -23.845 1.00 . A A .  57 TRP CE2  1 1 
        3  4590 1 1  57 TRP CE3  C  16.032 -19.490 -24.384 1.00 . A A .  57 TRP CE3  1 1 
        3  4591 1 1  57 TRP CG   C  18.017 -18.372 -23.121 1.00 . A A .  57 TRP CG   1 1 
        3  4592 1 1  57 TRP CH2  C  16.504 -21.786 -25.002 1.00 . A A .  57 TRP CH2  1 1 
        3  4593 1 1  57 TRP CZ2  C  17.752 -21.733 -24.443 1.00 . A A .  57 TRP CZ2  1 1 
        3  4594 1 1  57 TRP CZ3  C  15.648 -20.677 -24.976 1.00 . A A .  57 TRP CZ3  1 1 
        3  4595 1 1  57 TRP H    H  15.489 -18.339 -22.176 1.00 . A A .  57 TRP H    1 1 
        3  4596 1 1  57 TRP HA   H  17.506 -17.172 -20.704 1.00 . A A .  57 TRP HA   1 1 
        3  4597 1 1  57 TRP HB2  H  16.835 -16.686 -23.621 1.00 . A A .  57 TRP HB2  1 1 
        3  4598 1 1  57 TRP HB3  H  18.382 -16.319 -22.855 1.00 . A A .  57 TRP HB3  1 1 
        3  4599 1 1  57 TRP HD1  H  20.003 -18.362 -22.257 1.00 . A A .  57 TRP HD1  1 1 
        3  4600 1 1  57 TRP HE1  H  20.083 -20.794 -23.094 1.00 . A A .  57 TRP HE1  1 1 
        3  4601 1 1  57 TRP HE3  H  15.358 -18.647 -24.374 1.00 . A A .  57 TRP HE3  1 1 
        3  4602 1 1  57 TRP HH2  H  16.163 -22.693 -25.476 1.00 . A A .  57 TRP HH2  1 1 
        3  4603 1 1  57 TRP HZ2  H  18.401 -22.596 -24.469 1.00 . A A .  57 TRP HZ2  1 1 
        3  4604 1 1  57 TRP HZ3  H  14.671 -20.761 -25.430 1.00 . A A .  57 TRP HZ3  1 1 
        3  4605 1 1  57 TRP N    N  15.655 -17.718 -21.436 1.00 . A A .  57 TRP N    1 1 
        3  4606 1 1  57 TRP NE1  N  19.311 -20.203 -23.216 1.00 . A A .  57 TRP NE1  1 1 
        3  4607 1 1  57 TRP O    O  17.177 -14.655 -20.583 1.00 . A A .  57 TRP O    1 1 
        3  4608 1 1  58 LYS C    C  14.558 -13.321 -20.114 1.00 . A A .  58 LYS C    1 1 
        3  4609 1 1  58 LYS CA   C  14.803 -13.636 -21.586 1.00 . A A .  58 LYS CA   1 1 
        3  4610 1 1  58 LYS CB   C  13.513 -13.429 -22.384 1.00 . A A .  58 LYS CB   1 1 
        3  4611 1 1  58 LYS CD   C  13.745 -13.184 -24.873 1.00 . A A .  58 LYS CD   1 1 
        3  4612 1 1  58 LYS CE   C  12.503 -12.942 -25.717 1.00 . A A .  58 LYS CE   1 1 
        3  4613 1 1  58 LYS CG   C  13.663 -12.457 -23.542 1.00 . A A .  58 LYS CG   1 1 
        3  4614 1 1  58 LYS H    H  14.746 -15.641 -22.262 1.00 . A A .  58 LYS H    1 1 
        3  4615 1 1  58 LYS HA   H  15.561 -12.967 -21.964 1.00 . A A .  58 LYS HA   1 1 
        3  4616 1 1  58 LYS HB2  H  13.186 -14.392 -22.776 1.00 . A A .  58 LYS HB2  1 1 
        3  4617 1 1  58 LYS HB3  H  12.751 -13.049 -21.720 1.00 . A A .  58 LYS HB3  1 1 
        3  4618 1 1  58 LYS HD2  H  14.621 -12.835 -25.418 1.00 . A A .  58 LYS HD2  1 1 
        3  4619 1 1  58 LYS HD3  H  13.841 -14.245 -24.689 1.00 . A A .  58 LYS HD3  1 1 
        3  4620 1 1  58 LYS HE2  H  11.643 -12.821 -25.059 1.00 . A A .  58 LYS HE2  1 1 
        3  4621 1 1  58 LYS HE3  H  12.643 -12.034 -26.286 1.00 . A A .  58 LYS HE3  1 1 
        3  4622 1 1  58 LYS HG2  H  12.808 -11.782 -23.555 1.00 . A A .  58 LYS HG2  1 1 
        3  4623 1 1  58 LYS HG3  H  14.567 -11.881 -23.402 1.00 . A A .  58 LYS HG3  1 1 
        3  4624 1 1  58 LYS HZ1  H  12.880 -14.006 -27.475 1.00 . A A .  58 LYS HZ1  1 1 
        3  4625 1 1  58 LYS HZ2  H  11.259 -14.030 -26.995 1.00 . A A .  58 LYS HZ2  1 1 
        3  4626 1 1  58 LYS HZ3  H  12.396 -14.976 -26.176 1.00 . A A .  58 LYS HZ3  1 1 
        3  4627 1 1  58 LYS N    N  15.287 -15.001 -21.753 1.00 . A A .  58 LYS N    1 1 
        3  4628 1 1  58 LYS NZ   N  12.242 -14.068 -26.657 1.00 . A A .  58 LYS NZ   1 1 
        3  4629 1 1  58 LYS O    O  13.827 -14.037 -19.429 1.00 . A A .  58 LYS O    1 1 
        3  4630 1 1  59 LYS C    C  13.592 -11.382 -17.963 1.00 . A A .  59 LYS C    1 1 
        3  4631 1 1  59 LYS CA   C  15.021 -11.835 -18.243 1.00 . A A .  59 LYS CA   1 1 
        3  4632 1 1  59 LYS CB   C  15.999 -10.705 -17.913 1.00 . A A .  59 LYS CB   1 1 
        3  4633 1 1  59 LYS CD   C  16.830 -10.417 -15.560 1.00 . A A .  59 LYS CD   1 1 
        3  4634 1 1  59 LYS CE   C  17.408 -11.235 -14.415 1.00 . A A .  59 LYS CE   1 1 
        3  4635 1 1  59 LYS CG   C  17.061 -11.096 -16.900 1.00 . A A .  59 LYS CG   1 1 
        3  4636 1 1  59 LYS H    H  15.743 -11.716 -20.229 1.00 . A A .  59 LYS H    1 1 
        3  4637 1 1  59 LYS HA   H  15.243 -12.687 -17.619 1.00 . A A .  59 LYS HA   1 1 
        3  4638 1 1  59 LYS HB2  H  16.492 -10.391 -18.833 1.00 . A A .  59 LYS HB2  1 1 
        3  4639 1 1  59 LYS HB3  H  15.443  -9.868 -17.515 1.00 . A A .  59 LYS HB3  1 1 
        3  4640 1 1  59 LYS HD2  H  17.303  -9.435 -15.572 1.00 . A A .  59 LYS HD2  1 1 
        3  4641 1 1  59 LYS HD3  H  15.767 -10.296 -15.406 1.00 . A A .  59 LYS HD3  1 1 
        3  4642 1 1  59 LYS HE2  H  16.967 -10.896 -13.478 1.00 . A A .  59 LYS HE2  1 1 
        3  4643 1 1  59 LYS HE3  H  17.155 -12.273 -14.569 1.00 . A A .  59 LYS HE3  1 1 
        3  4644 1 1  59 LYS HG2  H  17.041 -12.177 -16.761 1.00 . A A .  59 LYS HG2  1 1 
        3  4645 1 1  59 LYS HG3  H  18.030 -10.806 -17.279 1.00 . A A .  59 LYS HG3  1 1 
        3  4646 1 1  59 LYS HZ1  H  19.142 -10.223 -13.839 1.00 . A A .  59 LYS HZ1  1 1 
        3  4647 1 1  59 LYS HZ2  H  19.300 -11.086 -15.286 1.00 . A A .  59 LYS HZ2  1 1 
        3  4648 1 1  59 LYS HZ3  H  19.291 -11.909 -13.808 1.00 . A A .  59 LYS HZ3  1 1 
        3  4649 1 1  59 LYS N    N  15.173 -12.245 -19.633 1.00 . A A .  59 LYS N    1 1 
        3  4650 1 1  59 LYS NZ   N  18.889 -11.104 -14.330 1.00 . A A .  59 LYS NZ   1 1 
        3  4651 1 1  59 LYS O    O  12.765 -11.308 -18.872 1.00 . A A .  59 LYS O    1 1 
        3  4652 1 1  60 GLU C    C  12.055  -9.699 -15.096 1.00 . A A .  60 GLU C    1 1 
        3  4653 1 1  60 GLU CA   C  11.978 -10.630 -16.303 1.00 . A A .  60 GLU CA   1 1 
        3  4654 1 1  60 GLU CB   C  11.088 -11.831 -15.978 1.00 . A A .  60 GLU CB   1 1 
        3  4655 1 1  60 GLU CD   C   8.674 -12.565 -16.091 1.00 . A A .  60 GLU CD   1 1 
        3  4656 1 1  60 GLU CG   C   9.824 -11.897 -16.819 1.00 . A A .  60 GLU CG   1 1 
        3  4657 1 1  60 GLU H    H  14.009 -11.155 -16.020 1.00 . A A .  60 GLU H    1 1 
        3  4658 1 1  60 GLU HA   H  11.548 -10.089 -17.133 1.00 . A A .  60 GLU HA   1 1 
        3  4659 1 1  60 GLU HB2  H  11.661 -12.744 -16.137 1.00 . A A .  60 GLU HB2  1 1 
        3  4660 1 1  60 GLU HB3  H  10.800 -11.780 -14.938 1.00 . A A .  60 GLU HB3  1 1 
        3  4661 1 1  60 GLU HG2  H   9.528 -10.885 -17.093 1.00 . A A .  60 GLU HG2  1 1 
        3  4662 1 1  60 GLU HG3  H  10.034 -12.457 -17.719 1.00 . A A .  60 GLU HG3  1 1 
        3  4663 1 1  60 GLU N    N  13.307 -11.077 -16.700 1.00 . A A .  60 GLU N    1 1 
        3  4664 1 1  60 GLU O    O  13.141  -9.309 -14.667 1.00 . A A .  60 GLU O    1 1 
        3  4665 1 1  60 GLU OE1  O   8.553 -12.368 -14.864 1.00 . A A .  60 GLU OE1  1 1 
        3  4666 1 1  60 GLU OE2  O   7.894 -13.285 -16.750 1.00 . A A .  60 GLU OE2  1 1 
        3  4667 1 1  61 PHE C    C  11.711  -8.974 -12.266 1.00 . A A .  61 PHE C    1 1 
        3  4668 1 1  61 PHE CA   C  10.829  -8.458 -13.399 1.00 . A A .  61 PHE CA   1 1 
        3  4669 1 1  61 PHE CB   C   9.384  -8.322 -12.915 1.00 . A A .  61 PHE CB   1 1 
        3  4670 1 1  61 PHE CD1  C   9.115  -5.923 -12.232 1.00 . A A .  61 PHE CD1  1 1 
        3  4671 1 1  61 PHE CD2  C   7.967  -6.682 -14.180 1.00 . A A .  61 PHE CD2  1 1 
        3  4672 1 1  61 PHE CE1  C   8.591  -4.656 -12.413 1.00 . A A .  61 PHE CE1  1 1 
        3  4673 1 1  61 PHE CE2  C   7.440  -5.418 -14.364 1.00 . A A .  61 PHE CE2  1 1 
        3  4674 1 1  61 PHE CG   C   8.811  -6.948 -13.113 1.00 . A A .  61 PHE CG   1 1 
        3  4675 1 1  61 PHE CZ   C   7.751  -4.404 -13.479 1.00 . A A .  61 PHE CZ   1 1 
        3  4676 1 1  61 PHE H    H  10.061  -9.688 -14.943 1.00 . A A .  61 PHE H    1 1 
        3  4677 1 1  61 PHE HA   H  11.189  -7.487 -13.705 1.00 . A A .  61 PHE HA   1 1 
        3  4678 1 1  61 PHE HB2  H   8.765  -9.040 -13.454 1.00 . A A .  61 PHE HB2  1 1 
        3  4679 1 1  61 PHE HB3  H   9.343  -8.552 -11.861 1.00 . A A .  61 PHE HB3  1 1 
        3  4680 1 1  61 PHE HD1  H   9.773  -6.120 -11.396 1.00 . A A .  61 PHE HD1  1 1 
        3  4681 1 1  61 PHE HD2  H   7.723  -7.473 -14.873 1.00 . A A .  61 PHE HD2  1 1 
        3  4682 1 1  61 PHE HE1  H   8.836  -3.866 -11.718 1.00 . A A .  61 PHE HE1  1 1 
        3  4683 1 1  61 PHE HE2  H   6.784  -5.223 -15.199 1.00 . A A .  61 PHE HE2  1 1 
        3  4684 1 1  61 PHE HZ   H   7.340  -3.416 -13.621 1.00 . A A .  61 PHE HZ   1 1 
        3  4685 1 1  61 PHE N    N  10.894  -9.343 -14.556 1.00 . A A .  61 PHE N    1 1 
        3  4686 1 1  61 PHE O    O  11.412  -9.996 -11.649 1.00 . A A .  61 PHE O    1 1 
        3  4687 1 1  62 GLY C    C  13.187  -8.310  -9.563 1.00 . A A .  62 GLY C    1 1 
        3  4688 1 1  62 GLY CA   C  13.709  -8.662 -10.942 1.00 . A A .  62 GLY CA   1 1 
        3  4689 1 1  62 GLY H    H  12.987  -7.454 -12.525 1.00 . A A .  62 GLY H    1 1 
        3  4690 1 1  62 GLY HA2  H  13.859  -9.729 -10.999 1.00 . A A .  62 GLY HA2  1 1 
        3  4691 1 1  62 GLY HA3  H  14.658  -8.167 -11.092 1.00 . A A .  62 GLY HA3  1 1 
        3  4692 1 1  62 GLY N    N  12.799  -8.260 -12.000 1.00 . A A .  62 GLY N    1 1 
        3  4693 1 1  62 GLY O    O  12.010  -7.988  -9.401 1.00 . A A .  62 GLY O    1 1 
        3  4694 1 1  63 ALA C    C  13.017  -6.690  -7.109 1.00 . A A .  63 ALA C    1 1 
        3  4695 1 1  63 ALA CA   C  13.684  -8.058  -7.195 1.00 . A A .  63 ALA CA   1 1 
        3  4696 1 1  63 ALA CB   C  14.903  -8.111  -6.285 1.00 . A A .  63 ALA CB   1 1 
        3  4697 1 1  63 ALA H    H  14.988  -8.637  -8.759 1.00 . A A .  63 ALA H    1 1 
        3  4698 1 1  63 ALA HA   H  12.984  -8.810  -6.862 1.00 . A A .  63 ALA HA   1 1 
        3  4699 1 1  63 ALA HB1  H  15.699  -7.522  -6.717 1.00 . A A .  63 ALA HB1  1 1 
        3  4700 1 1  63 ALA HB2  H  14.645  -7.713  -5.315 1.00 . A A .  63 ALA HB2  1 1 
        3  4701 1 1  63 ALA HB3  H  15.229  -9.135  -6.180 1.00 . A A .  63 ALA HB3  1 1 
        3  4702 1 1  63 ALA N    N  14.064  -8.373  -8.566 1.00 . A A .  63 ALA N    1 1 
        3  4703 1 1  63 ALA O    O  11.812  -6.590  -6.878 1.00 . A A .  63 ALA O    1 1 
        3  4704 1 1  64 ASP C    C  13.242  -3.657  -8.638 1.00 . A A .  64 ASP C    1 1 
        3  4705 1 1  64 ASP CA   C  13.292  -4.276  -7.244 1.00 . A A .  64 ASP CA   1 1 
        3  4706 1 1  64 ASP CB   C  14.160  -3.418  -6.323 1.00 . A A .  64 ASP CB   1 1 
        3  4707 1 1  64 ASP CG   C  14.093  -3.869  -4.877 1.00 . A A .  64 ASP CG   1 1 
        3  4708 1 1  64 ASP H    H  14.760  -5.784  -7.481 1.00 . A A .  64 ASP H    1 1 
        3  4709 1 1  64 ASP HA   H  12.290  -4.316  -6.846 1.00 . A A .  64 ASP HA   1 1 
        3  4710 1 1  64 ASP HB2  H  15.195  -3.470  -6.661 1.00 . A A .  64 ASP HB2  1 1 
        3  4711 1 1  64 ASP HB3  H  13.825  -2.392  -6.377 1.00 . A A .  64 ASP HB3  1 1 
        3  4712 1 1  64 ASP N    N  13.807  -5.639  -7.299 1.00 . A A .  64 ASP N    1 1 
        3  4713 1 1  64 ASP O    O  12.168  -3.492  -9.217 1.00 . A A .  64 ASP O    1 1 
        3  4714 1 1  64 ASP OD1  O  13.084  -4.503  -4.500 1.00 . A A .  64 ASP OD1  1 1 
        3  4715 1 1  64 ASP OD2  O  15.047  -3.589  -4.124 1.00 . A A .  64 ASP OD2  1 1 
        3  4716 1 1  65 CYS C    C  15.715  -3.245 -11.253 1.00 . A A .  65 CYS C    1 1 
        3  4717 1 1  65 CYS CA   C  14.501  -2.716 -10.496 1.00 . A A .  65 CYS CA   1 1 
        3  4718 1 1  65 CYS CB   C  14.582  -1.192 -10.382 1.00 . A A .  65 CYS CB   1 1 
        3  4719 1 1  65 CYS H    H  15.233  -3.474  -8.660 1.00 . A A .  65 CYS H    1 1 
        3  4720 1 1  65 CYS HA   H  13.608  -2.980 -11.042 1.00 . A A .  65 CYS HA   1 1 
        3  4721 1 1  65 CYS HB2  H  14.771  -0.779 -11.373 1.00 . A A .  65 CYS HB2  1 1 
        3  4722 1 1  65 CYS HB3  H  13.636  -0.814 -10.026 1.00 . A A .  65 CYS HB3  1 1 
        3  4723 1 1  65 CYS HG   H  17.076  -0.994  -9.695 1.00 . A A .  65 CYS HG   1 1 
        3  4724 1 1  65 CYS N    N  14.411  -3.317  -9.171 1.00 . A A .  65 CYS N    1 1 
        3  4725 1 1  65 CYS O    O  16.641  -3.796 -10.656 1.00 . A A .  65 CYS O    1 1 
        3  4726 1 1  65 CYS SG   S  15.880  -0.599  -9.249 1.00 . A A .  65 CYS SG   1 1 
        3  4727 1 1  66 LYS C    C  17.983  -2.570 -13.338 1.00 . A A .  66 LYS C    1 1 
        3  4728 1 1  66 LYS CA   C  16.804  -3.535 -13.411 1.00 . A A .  66 LYS CA   1 1 
        3  4729 1 1  66 LYS CB   C  16.338  -3.682 -14.860 1.00 . A A .  66 LYS CB   1 1 
        3  4730 1 1  66 LYS CD   C  15.705  -5.397 -16.583 1.00 . A A .  66 LYS CD   1 1 
        3  4731 1 1  66 LYS CE   C  16.432  -5.901 -17.820 1.00 . A A .  66 LYS CE   1 1 
        3  4732 1 1  66 LYS CG   C  16.678  -5.029 -15.476 1.00 . A A .  66 LYS CG   1 1 
        3  4733 1 1  66 LYS H    H  14.938  -2.630 -12.988 1.00 . A A .  66 LYS H    1 1 
        3  4734 1 1  66 LYS HA   H  17.121  -4.500 -13.044 1.00 . A A .  66 LYS HA   1 1 
        3  4735 1 1  66 LYS HB2  H  15.258  -3.544 -14.896 1.00 . A A .  66 LYS HB2  1 1 
        3  4736 1 1  66 LYS HB3  H  16.806  -2.910 -15.456 1.00 . A A .  66 LYS HB3  1 1 
        3  4737 1 1  66 LYS HD2  H  15.033  -6.176 -16.223 1.00 . A A .  66 LYS HD2  1 1 
        3  4738 1 1  66 LYS HD3  H  15.125  -4.524 -16.847 1.00 . A A .  66 LYS HD3  1 1 
        3  4739 1 1  66 LYS HE2  H  16.355  -5.152 -18.609 1.00 . A A .  66 LYS HE2  1 1 
        3  4740 1 1  66 LYS HE3  H  17.474  -6.047 -17.573 1.00 . A A .  66 LYS HE3  1 1 
        3  4741 1 1  66 LYS HG2  H  17.687  -4.990 -15.885 1.00 . A A .  66 LYS HG2  1 1 
        3  4742 1 1  66 LYS HG3  H  16.637  -5.786 -14.706 1.00 . A A .  66 LYS HG3  1 1 
        3  4743 1 1  66 LYS HZ1  H  16.597  -7.924 -18.309 1.00 . A A .  66 LYS HZ1  1 1 
        3  4744 1 1  66 LYS HZ2  H  15.510  -7.070 -19.284 1.00 . A A .  66 LYS HZ2  1 1 
        3  4745 1 1  66 LYS HZ3  H  15.079  -7.487 -17.703 1.00 . A A .  66 LYS HZ3  1 1 
        3  4746 1 1  66 LYS N    N  15.704  -3.076 -12.570 1.00 . A A .  66 LYS N    1 1 
        3  4747 1 1  66 LYS NZ   N  15.865  -7.185 -18.313 1.00 . A A .  66 LYS NZ   1 1 
        3  4748 1 1  66 LYS O    O  17.801  -1.364 -13.169 1.00 . A A .  66 LYS O    1 1 
        3  4749 1 1  67 TYR C    C  21.248  -2.501 -14.670 1.00 . A A .  67 TYR C    1 1 
        3  4750 1 1  67 TYR CA   C  20.400  -2.295 -13.420 1.00 . A A .  67 TYR CA   1 1 
        3  4751 1 1  67 TYR CB   C  21.217  -2.636 -12.173 1.00 . A A .  67 TYR CB   1 1 
        3  4752 1 1  67 TYR CD1  C  19.532  -2.403 -10.306 1.00 . A A .  67 TYR CD1  1 1 
        3  4753 1 1  67 TYR CD2  C  21.397  -0.919 -10.330 1.00 . A A .  67 TYR CD2  1 1 
        3  4754 1 1  67 TYR CE1  C  19.061  -1.801  -9.157 1.00 . A A .  67 TYR CE1  1 1 
        3  4755 1 1  67 TYR CE2  C  20.934  -0.312  -9.179 1.00 . A A .  67 TYR CE2  1 1 
        3  4756 1 1  67 TYR CG   C  20.706  -1.973 -10.914 1.00 . A A .  67 TYR CG   1 1 
        3  4757 1 1  67 TYR CZ   C  19.766  -0.755  -8.596 1.00 . A A .  67 TYR CZ   1 1 
        3  4758 1 1  67 TYR H    H  19.271  -4.076 -13.604 1.00 . A A .  67 TYR H    1 1 
        3  4759 1 1  67 TYR HA   H  20.100  -1.258 -13.369 1.00 . A A .  67 TYR HA   1 1 
        3  4760 1 1  67 TYR HB2  H  21.204  -3.717 -12.030 1.00 . A A .  67 TYR HB2  1 1 
        3  4761 1 1  67 TYR HB3  H  22.239  -2.319 -12.324 1.00 . A A .  67 TYR HB3  1 1 
        3  4762 1 1  67 TYR HD1  H  18.983  -3.223 -10.747 1.00 . A A .  67 TYR HD1  1 1 
        3  4763 1 1  67 TYR HD2  H  22.312  -0.574 -10.790 1.00 . A A .  67 TYR HD2  1 1 
        3  4764 1 1  67 TYR HE1  H  18.146  -2.148  -8.700 1.00 . A A .  67 TYR HE1  1 1 
        3  4765 1 1  67 TYR HE2  H  21.484   0.507  -8.739 1.00 . A A .  67 TYR HE2  1 1 
        3  4766 1 1  67 TYR HH   H  20.024   0.298  -7.010 1.00 . A A .  67 TYR HH   1 1 
        3  4767 1 1  67 TYR N    N  19.191  -3.109 -13.471 1.00 . A A .  67 TYR N    1 1 
        3  4768 1 1  67 TYR O    O  20.980  -3.392 -15.479 1.00 . A A .  67 TYR O    1 1 
        3  4769 1 1  67 TYR OH   O  19.300  -0.153  -7.451 1.00 . A A .  67 TYR OH   1 1 
        3  4770 1 1  68 LYS C    C  24.530  -2.313 -15.564 1.00 . A A .  68 LYS C    1 1 
        3  4771 1 1  68 LYS CA   C  23.167  -1.763 -15.975 1.00 . A A .  68 LYS CA   1 1 
        3  4772 1 1  68 LYS CB   C  23.336  -0.388 -16.625 1.00 . A A .  68 LYS CB   1 1 
        3  4773 1 1  68 LYS CD   C  24.859   1.555 -16.166 1.00 . A A .  68 LYS CD   1 1 
        3  4774 1 1  68 LYS CE   C  24.491   2.250 -17.467 1.00 . A A .  68 LYS CE   1 1 
        3  4775 1 1  68 LYS CG   C  23.711   0.708 -15.644 1.00 . A A .  68 LYS CG   1 1 
        3  4776 1 1  68 LYS H    H  22.438  -0.983 -14.146 1.00 . A A .  68 LYS H    1 1 
        3  4777 1 1  68 LYS HA   H  22.720  -2.438 -16.688 1.00 . A A .  68 LYS HA   1 1 
        3  4778 1 1  68 LYS HB2  H  24.111  -0.455 -17.388 1.00 . A A .  68 LYS HB2  1 1 
        3  4779 1 1  68 LYS HB3  H  22.405  -0.113 -17.101 1.00 . A A .  68 LYS HB3  1 1 
        3  4780 1 1  68 LYS HD2  H  25.117   2.307 -15.419 1.00 . A A .  68 LYS HD2  1 1 
        3  4781 1 1  68 LYS HD3  H  25.716   0.918 -16.339 1.00 . A A .  68 LYS HD3  1 1 
        3  4782 1 1  68 LYS HE2  H  24.527   1.525 -18.281 1.00 . A A .  68 LYS HE2  1 1 
        3  4783 1 1  68 LYS HE3  H  23.486   2.636 -17.382 1.00 . A A .  68 LYS HE3  1 1 
        3  4784 1 1  68 LYS HG2  H  22.845   1.347 -15.473 1.00 . A A .  68 LYS HG2  1 1 
        3  4785 1 1  68 LYS HG3  H  24.007   0.254 -14.708 1.00 . A A .  68 LYS HG3  1 1 
        3  4786 1 1  68 LYS HZ1  H  24.878   4.198 -18.118 1.00 . A A .  68 LYS HZ1  1 1 
        3  4787 1 1  68 LYS HZ2  H  26.094   3.088 -18.511 1.00 . A A .  68 LYS HZ2  1 1 
        3  4788 1 1  68 LYS HZ3  H  25.943   3.649 -16.922 1.00 . A A .  68 LYS HZ3  1 1 
        3  4789 1 1  68 LYS N    N  22.275  -1.673 -14.824 1.00 . A A .  68 LYS N    1 1 
        3  4790 1 1  68 LYS NZ   N  25.416   3.376 -17.777 1.00 . A A .  68 LYS NZ   1 1 
        3  4791 1 1  68 LYS O    O  25.364  -1.590 -15.020 1.00 . A A .  68 LYS O    1 1 
        3  4792 1 1  69 PHE C    C  27.020  -4.099 -16.627 1.00 . A A .  69 PHE C    1 1 
        3  4793 1 1  69 PHE CA   C  26.011  -4.242 -15.492 1.00 . A A .  69 PHE CA   1 1 
        3  4794 1 1  69 PHE CB   C  25.783  -5.724 -15.181 1.00 . A A .  69 PHE CB   1 1 
        3  4795 1 1  69 PHE CD1  C  25.266  -5.233 -12.776 1.00 . A A .  69 PHE CD1  1 1 
        3  4796 1 1  69 PHE CD2  C  23.985  -6.906 -13.892 1.00 . A A .  69 PHE CD2  1 1 
        3  4797 1 1  69 PHE CE1  C  24.542  -5.447 -11.617 1.00 . A A .  69 PHE CE1  1 1 
        3  4798 1 1  69 PHE CE2  C  23.258  -7.124 -12.737 1.00 . A A .  69 PHE CE2  1 1 
        3  4799 1 1  69 PHE CG   C  24.996  -5.959 -13.925 1.00 . A A .  69 PHE CG   1 1 
        3  4800 1 1  69 PHE CZ   C  23.538  -6.394 -11.598 1.00 . A A .  69 PHE CZ   1 1 
        3  4801 1 1  69 PHE H    H  24.045  -4.121 -16.268 1.00 . A A .  69 PHE H    1 1 
        3  4802 1 1  69 PHE HA   H  26.405  -3.756 -14.612 1.00 . A A .  69 PHE HA   1 1 
        3  4803 1 1  69 PHE HB2  H  25.252  -6.179 -16.017 1.00 . A A .  69 PHE HB2  1 1 
        3  4804 1 1  69 PHE HB3  H  26.740  -6.213 -15.072 1.00 . A A .  69 PHE HB3  1 1 
        3  4805 1 1  69 PHE HD1  H  26.052  -4.491 -12.790 1.00 . A A .  69 PHE HD1  1 1 
        3  4806 1 1  69 PHE HD2  H  23.765  -7.478 -14.782 1.00 . A A .  69 PHE HD2  1 1 
        3  4807 1 1  69 PHE HE1  H  24.764  -4.874 -10.730 1.00 . A A .  69 PHE HE1  1 1 
        3  4808 1 1  69 PHE HE2  H  22.473  -7.865 -12.724 1.00 . A A .  69 PHE HE2  1 1 
        3  4809 1 1  69 PHE HZ   H  22.971  -6.563 -10.695 1.00 . A A .  69 PHE HZ   1 1 
        3  4810 1 1  69 PHE N    N  24.750  -3.595 -15.832 1.00 . A A .  69 PHE N    1 1 
        3  4811 1 1  69 PHE O    O  26.706  -4.355 -17.788 1.00 . A A .  69 PHE O    1 1 
        3  4812 1 1  70 GLY C    C  29.908  -4.827 -17.692 1.00 . A A .  70 GLY C    1 1 
        3  4813 1 1  70 GLY CA   C  29.273  -3.515 -17.283 1.00 . A A .  70 GLY CA   1 1 
        3  4814 1 1  70 GLY H    H  28.431  -3.496 -15.340 1.00 . A A .  70 GLY H    1 1 
        3  4815 1 1  70 GLY HA2  H  28.841  -3.047 -18.156 1.00 . A A .  70 GLY HA2  1 1 
        3  4816 1 1  70 GLY HA3  H  30.039  -2.866 -16.883 1.00 . A A .  70 GLY HA3  1 1 
        3  4817 1 1  70 GLY N    N  28.236  -3.686 -16.283 1.00 . A A .  70 GLY N    1 1 
        3  4818 1 1  70 GLY O    O  29.832  -5.227 -18.854 1.00 . A A .  70 GLY O    1 1 
        3  4819 1 1  71 ASN C    C  31.719  -7.400 -15.712 1.00 . A A .  71 ASN C    1 1 
        3  4820 1 1  71 ASN CA   C  31.192  -6.777 -17.002 1.00 . A A .  71 ASN CA   1 1 
        3  4821 1 1  71 ASN CB   C  32.340  -6.589 -17.997 1.00 . A A .  71 ASN CB   1 1 
        3  4822 1 1  71 ASN CG   C  32.512  -7.785 -18.912 1.00 . A A .  71 ASN CG   1 1 
        3  4823 1 1  71 ASN H    H  30.565  -5.132 -15.827 1.00 . A A .  71 ASN H    1 1 
        3  4824 1 1  71 ASN HA   H  30.459  -7.441 -17.435 1.00 . A A .  71 ASN HA   1 1 
        3  4825 1 1  71 ASN HB2  H  32.139  -5.706 -18.604 1.00 . A A .  71 ASN HB2  1 1 
        3  4826 1 1  71 ASN HB3  H  33.259  -6.438 -17.453 1.00 . A A .  71 ASN HB3  1 1 
        3  4827 1 1  71 ASN HD21 H  32.834  -6.582 -20.464 1.00 . A A .  71 ASN HD21 1 1 
        3  4828 1 1  71 ASN HD22 H  32.886  -8.275 -20.803 1.00 . A A .  71 ASN HD22 1 1 
        3  4829 1 1  71 ASN N    N  30.538  -5.501 -16.735 1.00 . A A .  71 ASN N    1 1 
        3  4830 1 1  71 ASN ND2  N  32.771  -7.520 -20.189 1.00 . A A .  71 ASN ND2  1 1 
        3  4831 1 1  71 ASN O    O  32.482  -6.774 -14.977 1.00 . A A .  71 ASN O    1 1 
        3  4832 1 1  71 ASN OD1  O  32.416  -8.932 -18.479 1.00 . A A .  71 ASN OD1  1 1 
        3  4833 1 1  72 TRP C    C  33.257  -9.295 -14.103 1.00 . A A .  72 TRP C    1 1 
        3  4834 1 1  72 TRP CA   C  31.740  -9.340 -14.246 1.00 . A A .  72 TRP CA   1 1 
        3  4835 1 1  72 TRP CB   C  31.263 -10.793 -14.285 1.00 . A A .  72 TRP CB   1 1 
        3  4836 1 1  72 TRP CD1  C  29.528 -11.339 -16.090 1.00 . A A .  72 TRP CD1  1 1 
        3  4837 1 1  72 TRP CD2  C  28.649 -10.714 -14.127 1.00 . A A .  72 TRP CD2  1 1 
        3  4838 1 1  72 TRP CE2  C  27.598 -10.983 -15.025 1.00 . A A .  72 TRP CE2  1 1 
        3  4839 1 1  72 TRP CE3  C  28.337 -10.305 -12.828 1.00 . A A .  72 TRP CE3  1 1 
        3  4840 1 1  72 TRP CG   C  29.875 -10.948 -14.828 1.00 . A A .  72 TRP CG   1 1 
        3  4841 1 1  72 TRP CH2  C  25.983 -10.452 -13.385 1.00 . A A .  72 TRP CH2  1 1 
        3  4842 1 1  72 TRP CZ2  C  26.259 -10.855 -14.664 1.00 . A A .  72 TRP CZ2  1 1 
        3  4843 1 1  72 TRP CZ3  C  27.008 -10.178 -12.472 1.00 . A A .  72 TRP CZ3  1 1 
        3  4844 1 1  72 TRP H    H  30.699  -9.082 -16.072 1.00 . A A .  72 TRP H    1 1 
        3  4845 1 1  72 TRP HA   H  31.295  -8.849 -13.394 1.00 . A A .  72 TRP HA   1 1 
        3  4846 1 1  72 TRP HB2  H  31.949 -11.372 -14.905 1.00 . A A .  72 TRP HB2  1 1 
        3  4847 1 1  72 TRP HB3  H  31.277 -11.196 -13.283 1.00 . A A .  72 TRP HB3  1 1 
        3  4848 1 1  72 TRP HD1  H  30.235 -11.588 -16.866 1.00 . A A .  72 TRP HD1  1 1 
        3  4849 1 1  72 TRP HE1  H  27.668 -11.610 -17.026 1.00 . A A .  72 TRP HE1  1 1 
        3  4850 1 1  72 TRP HE3  H  29.114 -10.088 -12.109 1.00 . A A .  72 TRP HE3  1 1 
        3  4851 1 1  72 TRP HH2  H  24.959 -10.339 -13.064 1.00 . A A .  72 TRP HH2  1 1 
        3  4852 1 1  72 TRP HZ2  H  25.458 -11.063 -15.357 1.00 . A A .  72 TRP HZ2  1 1 
        3  4853 1 1  72 TRP HZ3  H  26.748  -9.863 -11.471 1.00 . A A .  72 TRP HZ3  1 1 
        3  4854 1 1  72 TRP N    N  31.308  -8.634 -15.446 1.00 . A A .  72 TRP N    1 1 
        3  4855 1 1  72 TRP NE1  N  28.160 -11.362 -16.215 1.00 . A A .  72 TRP NE1  1 1 
        3  4856 1 1  72 TRP O    O  33.989  -9.646 -15.028 1.00 . A A .  72 TRP O    1 1 
        3  4857 1 1  73 GLY C    C  35.839 -10.122 -12.800 1.00 . A A .  73 GLY C    1 1 
        3  4858 1 1  73 GLY CA   C  35.153  -8.774 -12.696 1.00 . A A .  73 GLY CA   1 1 
        3  4859 1 1  73 GLY H    H  33.095  -8.590 -12.236 1.00 . A A .  73 GLY H    1 1 
        3  4860 1 1  73 GLY HA2  H  35.591  -8.103 -13.419 1.00 . A A .  73 GLY HA2  1 1 
        3  4861 1 1  73 GLY HA3  H  35.316  -8.375 -11.705 1.00 . A A .  73 GLY HA3  1 1 
        3  4862 1 1  73 GLY N    N  33.724  -8.858 -12.938 1.00 . A A .  73 GLY N    1 1 
        3  4863 1 1  73 GLY O    O  35.259 -11.082 -13.307 1.00 . A A .  73 GLY O    1 1 
        3  4864 1 1  74 GLU C    C  37.409 -12.381 -11.250 1.00 . A A .  74 GLU C    1 1 
        3  4865 1 1  74 GLU CA   C  37.842 -11.433 -12.364 1.00 . A A .  74 GLU CA   1 1 
        3  4866 1 1  74 GLU CB   C  39.339 -11.140 -12.245 1.00 . A A .  74 GLU CB   1 1 
        3  4867 1 1  74 GLU CD   C  40.539 -11.089 -10.022 1.00 . A A .  74 GLU CD   1 1 
        3  4868 1 1  74 GLU CG   C  39.702 -10.315 -11.021 1.00 . A A .  74 GLU CG   1 1 
        3  4869 1 1  74 GLU H    H  37.484  -9.393 -11.927 1.00 . A A .  74 GLU H    1 1 
        3  4870 1 1  74 GLU HA   H  37.653 -11.906 -13.316 1.00 . A A .  74 GLU HA   1 1 
        3  4871 1 1  74 GLU HB2  H  39.878 -12.086 -12.201 1.00 . A A .  74 GLU HB2  1 1 
        3  4872 1 1  74 GLU HB3  H  39.659 -10.601 -13.124 1.00 . A A .  74 GLU HB3  1 1 
        3  4873 1 1  74 GLU HG2  H  40.259  -9.434 -11.341 1.00 . A A .  74 GLU HG2  1 1 
        3  4874 1 1  74 GLU HG3  H  38.791  -9.995 -10.536 1.00 . A A .  74 GLU HG3  1 1 
        3  4875 1 1  74 GLU N    N  37.077 -10.193 -12.320 1.00 . A A .  74 GLU N    1 1 
        3  4876 1 1  74 GLU O    O  37.307 -11.986 -10.088 1.00 . A A .  74 GLU O    1 1 
        3  4877 1 1  74 GLU OE1  O  41.440 -11.836 -10.455 1.00 . A A .  74 GLU OE1  1 1 
        3  4878 1 1  74 GLU OE2  O  40.291 -10.948  -8.806 1.00 . A A .  74 GLU OE2  1 1 
        3  4879 1 1  75 CYS C    C  37.930 -15.229  -9.912 1.00 . A A .  75 CYS C    1 1 
        3  4880 1 1  75 CYS CA   C  36.729 -14.638 -10.645 1.00 . A A .  75 CYS CA   1 1 
        3  4881 1 1  75 CYS CB   C  35.947 -15.753 -11.345 1.00 . A A .  75 CYS CB   1 1 
        3  4882 1 1  75 CYS H    H  37.252 -13.889 -12.554 1.00 . A A .  75 CYS H    1 1 
        3  4883 1 1  75 CYS HA   H  36.084 -14.156  -9.926 1.00 . A A .  75 CYS HA   1 1 
        3  4884 1 1  75 CYS HB2  H  36.580 -16.189 -12.118 1.00 . A A .  75 CYS HB2  1 1 
        3  4885 1 1  75 CYS HB3  H  35.705 -16.520 -10.624 1.00 . A A .  75 CYS HB3  1 1 
        3  4886 1 1  75 CYS HG   H  34.500 -13.915 -12.466 1.00 . A A .  75 CYS HG   1 1 
        3  4887 1 1  75 CYS N    N  37.154 -13.634 -11.612 1.00 . A A .  75 CYS N    1 1 
        3  4888 1 1  75 CYS O    O  38.862 -15.737 -10.534 1.00 . A A .  75 CYS O    1 1 
        3  4889 1 1  75 CYS SG   S  34.391 -15.199 -12.111 1.00 . A A .  75 CYS SG   1 1 
        3  4890 1 1  76 ASP C    C  38.626 -17.060  -7.212 1.00 . A A .  76 ASP C    1 1 
        3  4891 1 1  76 ASP CA   C  38.984 -15.685  -7.767 1.00 . A A .  76 ASP CA   1 1 
        3  4892 1 1  76 ASP CB   C  39.299 -14.725  -6.619 1.00 . A A .  76 ASP CB   1 1 
        3  4893 1 1  76 ASP CG   C  40.779 -14.672  -6.297 1.00 . A A .  76 ASP CG   1 1 
        3  4894 1 1  76 ASP H    H  37.128 -14.740  -8.147 1.00 . A A .  76 ASP H    1 1 
        3  4895 1 1  76 ASP HA   H  39.858 -15.779  -8.394 1.00 . A A .  76 ASP HA   1 1 
        3  4896 1 1  76 ASP HB2  H  38.961 -13.725  -6.891 1.00 . A A .  76 ASP HB2  1 1 
        3  4897 1 1  76 ASP HB3  H  38.767 -15.046  -5.734 1.00 . A A .  76 ASP HB3  1 1 
        3  4898 1 1  76 ASP N    N  37.899 -15.157  -8.585 1.00 . A A .  76 ASP N    1 1 
        3  4899 1 1  76 ASP O    O  37.768 -17.185  -6.339 1.00 . A A .  76 ASP O    1 1 
        3  4900 1 1  76 ASP OD1  O  41.583 -14.498  -7.235 1.00 . A A .  76 ASP OD1  1 1 
        3  4901 1 1  76 ASP OD2  O  41.133 -14.805  -5.106 1.00 . A A .  76 ASP OD2  1 1 
        3  4902 1 1  77 ALA C    C  39.306 -19.605  -5.786 1.00 . A A .  77 ALA C    1 1 
        3  4903 1 1  77 ALA CA   C  39.042 -19.457  -7.282 1.00 . A A .  77 ALA CA   1 1 
        3  4904 1 1  77 ALA CB   C  39.903 -20.432  -8.070 1.00 . A A .  77 ALA CB   1 1 
        3  4905 1 1  77 ALA H    H  39.962 -17.928  -8.419 1.00 . A A .  77 ALA H    1 1 
        3  4906 1 1  77 ALA HA   H  38.004 -19.691  -7.478 1.00 . A A .  77 ALA HA   1 1 
        3  4907 1 1  77 ALA HB1  H  40.938 -20.312  -7.783 1.00 . A A .  77 ALA HB1  1 1 
        3  4908 1 1  77 ALA HB2  H  39.585 -21.444  -7.861 1.00 . A A .  77 ALA HB2  1 1 
        3  4909 1 1  77 ALA HB3  H  39.796 -20.233  -9.127 1.00 . A A .  77 ALA HB3  1 1 
        3  4910 1 1  77 ALA N    N  39.289 -18.091  -7.727 1.00 . A A .  77 ALA N    1 1 
        3  4911 1 1  77 ALA O    O  38.859 -20.565  -5.160 1.00 . A A .  77 ALA O    1 1 
        3  4912 1 1  78 ALA C    C  39.108 -18.468  -2.952 1.00 . A A .  78 ALA C    1 1 
        3  4913 1 1  78 ALA CA   C  40.358 -18.672  -3.801 1.00 . A A .  78 ALA CA   1 1 
        3  4914 1 1  78 ALA CB   C  41.397 -17.608  -3.478 1.00 . A A .  78 ALA CB   1 1 
        3  4915 1 1  78 ALA H    H  40.363 -17.908  -5.775 1.00 . A A .  78 ALA H    1 1 
        3  4916 1 1  78 ALA HA   H  40.784 -19.637  -3.571 1.00 . A A .  78 ALA HA   1 1 
        3  4917 1 1  78 ALA HB1  H  41.831 -17.813  -2.510 1.00 . A A .  78 ALA HB1  1 1 
        3  4918 1 1  78 ALA HB2  H  42.170 -17.619  -4.231 1.00 . A A .  78 ALA HB2  1 1 
        3  4919 1 1  78 ALA HB3  H  40.924 -16.637  -3.461 1.00 . A A .  78 ALA HB3  1 1 
        3  4920 1 1  78 ALA N    N  40.035 -18.648  -5.222 1.00 . A A .  78 ALA N    1 1 
        3  4921 1 1  78 ALA O    O  39.031 -18.944  -1.818 1.00 . A A .  78 ALA O    1 1 
        3  4922 1 1  79 THR C    C  35.693 -18.089  -3.536 1.00 . A A .  79 THR C    1 1 
        3  4923 1 1  79 THR CA   C  36.884 -17.491  -2.798 1.00 . A A .  79 THR CA   1 1 
        3  4924 1 1  79 THR CB   C  36.655 -15.979  -2.617 1.00 . A A .  79 THR CB   1 1 
        3  4925 1 1  79 THR CG2  C  36.683 -15.262  -3.958 1.00 . A A .  79 THR CG2  1 1 
        3  4926 1 1  79 THR H    H  38.251 -17.406  -4.412 1.00 . A A .  79 THR H    1 1 
        3  4927 1 1  79 THR HA   H  36.953 -17.944  -1.820 1.00 . A A .  79 THR HA   1 1 
        3  4928 1 1  79 THR HB   H  37.445 -15.582  -1.996 1.00 . A A .  79 THR HB   1 1 
        3  4929 1 1  79 THR HG1  H  35.473 -15.949  -1.037 1.00 . A A .  79 THR HG1  1 1 
        3  4930 1 1  79 THR HG21 H  37.610 -14.717  -4.056 1.00 . A A .  79 THR HG21 1 1 
        3  4931 1 1  79 THR HG22 H  35.853 -14.575  -4.017 1.00 . A A .  79 THR HG22 1 1 
        3  4932 1 1  79 THR HG23 H  36.608 -15.988  -4.755 1.00 . A A .  79 THR HG23 1 1 
        3  4933 1 1  79 THR N    N  38.129 -17.758  -3.506 1.00 . A A .  79 THR N    1 1 
        3  4934 1 1  79 THR O    O  34.645 -18.340  -2.943 1.00 . A A .  79 THR O    1 1 
        3  4935 1 1  79 THR OG1  O  35.396 -15.747  -1.975 1.00 . A A .  79 THR OG1  1 1 
        3  4936 1 1  80 SER C    C  33.596 -17.946  -5.713 1.00 . A A .  80 SER C    1 1 
        3  4937 1 1  80 SER CA   C  34.798 -18.884  -5.657 1.00 . A A .  80 SER CA   1 1 
        3  4938 1 1  80 SER CB   C  34.370 -20.245  -5.106 1.00 . A A .  80 SER CB   1 1 
        3  4939 1 1  80 SER H    H  36.720 -18.096  -5.253 1.00 . A A .  80 SER H    1 1 
        3  4940 1 1  80 SER HA   H  35.184 -19.014  -6.656 1.00 . A A .  80 SER HA   1 1 
        3  4941 1 1  80 SER HB2  H  33.574 -20.102  -4.375 1.00 . A A .  80 SER HB2  1 1 
        3  4942 1 1  80 SER HB3  H  34.004 -20.859  -5.916 1.00 . A A .  80 SER HB3  1 1 
        3  4943 1 1  80 SER HG   H  35.138 -21.686  -4.022 1.00 . A A .  80 SER HG   1 1 
        3  4944 1 1  80 SER N    N  35.862 -18.316  -4.836 1.00 . A A .  80 SER N    1 1 
        3  4945 1 1  80 SER O    O  32.447 -18.381  -5.621 1.00 . A A .  80 SER O    1 1 
        3  4946 1 1  80 SER OG   O  35.459 -20.909  -4.487 1.00 . A A .  80 SER OG   1 1 
        3  4947 1 1  81 THR C    C  33.238 -14.457  -6.774 1.00 . A A .  81 THR C    1 1 
        3  4948 1 1  81 THR CA   C  32.811 -15.652  -5.929 1.00 . A A .  81 THR CA   1 1 
        3  4949 1 1  81 THR CB   C  32.417 -15.157  -4.524 1.00 . A A .  81 THR CB   1 1 
        3  4950 1 1  81 THR CG2  C  31.444 -16.121  -3.865 1.00 . A A .  81 THR CG2  1 1 
        3  4951 1 1  81 THR H    H  34.804 -16.367  -5.928 1.00 . A A .  81 THR H    1 1 
        3  4952 1 1  81 THR HA   H  31.945 -16.111  -6.382 1.00 . A A .  81 THR HA   1 1 
        3  4953 1 1  81 THR HB   H  31.936 -14.194  -4.621 1.00 . A A .  81 THR HB   1 1 
        3  4954 1 1  81 THR HG1  H  33.325 -14.956  -2.785 1.00 . A A .  81 THR HG1  1 1 
        3  4955 1 1  81 THR HG21 H  31.069 -15.686  -2.951 1.00 . A A .  81 THR HG21 1 1 
        3  4956 1 1  81 THR HG22 H  31.950 -17.048  -3.640 1.00 . A A .  81 THR HG22 1 1 
        3  4957 1 1  81 THR HG23 H  30.619 -16.315  -4.535 1.00 . A A .  81 THR HG23 1 1 
        3  4958 1 1  81 THR N    N  33.868 -16.653  -5.863 1.00 . A A .  81 THR N    1 1 
        3  4959 1 1  81 THR O    O  34.384 -14.011  -6.704 1.00 . A A .  81 THR O    1 1 
        3  4960 1 1  81 THR OG1  O  33.584 -15.017  -3.708 1.00 . A A .  81 THR OG1  1 1 
        3  4961 1 1  82 LYS C    C  31.855 -11.555  -7.938 1.00 . A A .  82 LYS C    1 1 
        3  4962 1 1  82 LYS CA   C  32.589 -12.797  -8.432 1.00 . A A .  82 LYS CA   1 1 
        3  4963 1 1  82 LYS CB   C  32.180 -13.102  -9.875 1.00 . A A .  82 LYS CB   1 1 
        3  4964 1 1  82 LYS CD   C  29.956 -12.476 -10.860 1.00 . A A .  82 LYS CD   1 1 
        3  4965 1 1  82 LYS CE   C  29.002 -11.654 -10.007 1.00 . A A .  82 LYS CE   1 1 
        3  4966 1 1  82 LYS CG   C  30.718 -13.489 -10.024 1.00 . A A .  82 LYS CG   1 1 
        3  4967 1 1  82 LYS H    H  31.415 -14.341  -7.585 1.00 . A A .  82 LYS H    1 1 
        3  4968 1 1  82 LYS HA   H  33.651 -12.609  -8.400 1.00 . A A .  82 LYS HA   1 1 
        3  4969 1 1  82 LYS HB2  H  32.373 -12.221 -10.487 1.00 . A A .  82 LYS HB2  1 1 
        3  4970 1 1  82 LYS HB3  H  32.785 -13.919 -10.242 1.00 . A A .  82 LYS HB3  1 1 
        3  4971 1 1  82 LYS HD2  H  30.666 -11.807 -11.346 1.00 . A A .  82 LYS HD2  1 1 
        3  4972 1 1  82 LYS HD3  H  29.389 -13.001 -11.616 1.00 . A A .  82 LYS HD3  1 1 
        3  4973 1 1  82 LYS HE2  H  28.064 -11.524 -10.547 1.00 . A A .  82 LYS HE2  1 1 
        3  4974 1 1  82 LYS HE3  H  28.808 -12.190  -9.090 1.00 . A A .  82 LYS HE3  1 1 
        3  4975 1 1  82 LYS HG2  H  30.654 -14.467 -10.502 1.00 . A A .  82 LYS HG2  1 1 
        3  4976 1 1  82 LYS HG3  H  30.268 -13.544  -9.042 1.00 . A A .  82 LYS HG3  1 1 
        3  4977 1 1  82 LYS HZ1  H  29.630 -10.198  -8.648 1.00 . A A .  82 LYS HZ1  1 1 
        3  4978 1 1  82 LYS HZ2  H  28.951  -9.567 -10.063 1.00 . A A .  82 LYS HZ2  1 1 
        3  4979 1 1  82 LYS HZ3  H  30.513 -10.216 -10.091 1.00 . A A .  82 LYS HZ3  1 1 
        3  4980 1 1  82 LYS N    N  32.310 -13.941  -7.574 1.00 . A A .  82 LYS N    1 1 
        3  4981 1 1  82 LYS NZ   N  29.564 -10.315  -9.679 1.00 . A A .  82 LYS NZ   1 1 
        3  4982 1 1  82 LYS O    O  30.821 -11.654  -7.277 1.00 . A A .  82 LYS O    1 1 
        3  4983 1 1  83 SER C    C  31.542  -8.220  -9.054 1.00 . A A .  83 SER C    1 1 
        3  4984 1 1  83 SER CA   C  31.793  -9.122  -7.849 1.00 . A A .  83 SER CA   1 1 
        3  4985 1 1  83 SER CB   C  32.696  -8.407  -6.842 1.00 . A A .  83 SER CB   1 1 
        3  4986 1 1  83 SER H    H  33.220 -10.369  -8.792 1.00 . A A .  83 SER H    1 1 
        3  4987 1 1  83 SER HA   H  30.848  -9.345  -7.378 1.00 . A A .  83 SER HA   1 1 
        3  4988 1 1  83 SER HB2  H  33.736  -8.651  -7.058 1.00 . A A .  83 SER HB2  1 1 
        3  4989 1 1  83 SER HB3  H  32.555  -7.340  -6.931 1.00 . A A .  83 SER HB3  1 1 
        3  4990 1 1  83 SER HG   H  33.053  -8.449  -4.917 1.00 . A A .  83 SER HG   1 1 
        3  4991 1 1  83 SER N    N  32.395 -10.385  -8.263 1.00 . A A .  83 SER N    1 1 
        3  4992 1 1  83 SER O    O  32.316  -8.214 -10.012 1.00 . A A .  83 SER O    1 1 
        3  4993 1 1  83 SER OG   O  32.391  -8.800  -5.515 1.00 . A A .  83 SER OG   1 1 
        3  4994 1 1  84 ARG C    C  29.236  -5.403  -9.573 1.00 . A A .  84 ARG C    1 1 
        3  4995 1 1  84 ARG CA   C  30.099  -6.553 -10.084 1.00 . A A .  84 ARG CA   1 1 
        3  4996 1 1  84 ARG CB   C  29.357  -7.310 -11.186 1.00 . A A .  84 ARG CB   1 1 
        3  4997 1 1  84 ARG CD   C  29.878  -6.291 -13.423 1.00 . A A .  84 ARG CD   1 1 
        3  4998 1 1  84 ARG CG   C  28.853  -6.415 -12.307 1.00 . A A .  84 ARG CG   1 1 
        3  4999 1 1  84 ARG CZ   C  31.161  -4.236 -12.999 1.00 . A A .  84 ARG CZ   1 1 
        3  5000 1 1  84 ARG H    H  29.876  -7.507  -8.208 1.00 . A A .  84 ARG H    1 1 
        3  5001 1 1  84 ARG HA   H  31.013  -6.148 -10.492 1.00 . A A .  84 ARG HA   1 1 
        3  5002 1 1  84 ARG HB2  H  30.028  -8.057 -11.610 1.00 . A A .  84 ARG HB2  1 1 
        3  5003 1 1  84 ARG HB3  H  28.508  -7.816 -10.749 1.00 . A A .  84 ARG HB3  1 1 
        3  5004 1 1  84 ARG HD2  H  30.171  -7.289 -13.749 1.00 . A A .  84 ARG HD2  1 1 
        3  5005 1 1  84 ARG HD3  H  29.426  -5.767 -14.252 1.00 . A A .  84 ARG HD3  1 1 
        3  5006 1 1  84 ARG HE   H  31.837  -6.086 -12.688 1.00 . A A .  84 ARG HE   1 1 
        3  5007 1 1  84 ARG HG2  H  27.933  -6.835 -12.713 1.00 . A A .  84 ARG HG2  1 1 
        3  5008 1 1  84 ARG HG3  H  28.648  -5.434 -11.907 1.00 . A A .  84 ARG HG3  1 1 
        3  5009 1 1  84 ARG HH11 H  29.294  -3.942 -13.714 1.00 . A A .  84 ARG HH11 1 1 
        3  5010 1 1  84 ARG HH12 H  30.208  -2.502 -13.411 1.00 . A A .  84 ARG HH12 1 1 
        3  5011 1 1  84 ARG HH21 H  33.050  -4.198 -12.284 1.00 . A A .  84 ARG HH21 1 1 
        3  5012 1 1  84 ARG HH22 H  32.345  -2.649 -12.598 1.00 . A A .  84 ARG HH22 1 1 
        3  5013 1 1  84 ARG N    N  30.454  -7.458  -8.999 1.00 . A A .  84 ARG N    1 1 
        3  5014 1 1  84 ARG NE   N  31.068  -5.562 -12.994 1.00 . A A .  84 ARG NE   1 1 
        3  5015 1 1  84 ARG NH1  N  30.137  -3.499 -13.409 1.00 . A A .  84 ARG NH1  1 1 
        3  5016 1 1  84 ARG NH2  N  32.278  -3.645 -12.594 1.00 . A A .  84 ARG NH2  1 1 
        3  5017 1 1  84 ARG O    O  28.304  -5.609  -8.795 1.00 . A A .  84 ARG O    1 1 
        3  5018 1 1  85 THR C    C  27.793  -2.600 -10.660 1.00 . A A .  85 THR C    1 1 
        3  5019 1 1  85 THR CA   C  28.811  -3.007  -9.600 1.00 . A A .  85 THR CA   1 1 
        3  5020 1 1  85 THR CB   C  29.752  -1.818  -9.326 1.00 . A A .  85 THR CB   1 1 
        3  5021 1 1  85 THR CG2  C  30.152  -1.773  -7.859 1.00 . A A .  85 THR CG2  1 1 
        3  5022 1 1  85 THR H    H  30.307  -4.090 -10.633 1.00 . A A .  85 THR H    1 1 
        3  5023 1 1  85 THR HA   H  28.287  -3.244  -8.685 1.00 . A A .  85 THR HA   1 1 
        3  5024 1 1  85 THR HB   H  29.232  -0.903  -9.570 1.00 . A A .  85 THR HB   1 1 
        3  5025 1 1  85 THR HG1  H  31.014  -1.129 -10.676 1.00 . A A .  85 THR HG1  1 1 
        3  5026 1 1  85 THR HG21 H  30.512  -2.745  -7.555 1.00 . A A .  85 THR HG21 1 1 
        3  5027 1 1  85 THR HG22 H  29.295  -1.504  -7.261 1.00 . A A .  85 THR HG22 1 1 
        3  5028 1 1  85 THR HG23 H  30.934  -1.041  -7.721 1.00 . A A .  85 THR HG23 1 1 
        3  5029 1 1  85 THR N    N  29.554  -4.189 -10.015 1.00 . A A .  85 THR N    1 1 
        3  5030 1 1  85 THR O    O  28.145  -2.355 -11.813 1.00 . A A .  85 THR O    1 1 
        3  5031 1 1  85 THR OG1  O  30.924  -1.923 -10.142 1.00 . A A .  85 THR OG1  1 1 
        3  5032 1 1  86 GLY C    C  24.855  -0.807 -10.845 1.00 . A A .  86 GLY C    1 1 
        3  5033 1 1  86 GLY CA   C  25.476  -2.148 -11.188 1.00 . A A .  86 GLY CA   1 1 
        3  5034 1 1  86 GLY H    H  26.303  -2.733  -9.329 1.00 . A A .  86 GLY H    1 1 
        3  5035 1 1  86 GLY HA2  H  25.891  -2.096 -12.182 1.00 . A A .  86 GLY HA2  1 1 
        3  5036 1 1  86 GLY HA3  H  24.704  -2.903 -11.168 1.00 . A A .  86 GLY HA3  1 1 
        3  5037 1 1  86 GLY N    N  26.527  -2.527 -10.259 1.00 . A A .  86 GLY N    1 1 
        3  5038 1 1  86 GLY O    O  24.357  -0.611  -9.735 1.00 . A A .  86 GLY O    1 1 
        3  5039 1 1  87 THR C    C  22.871   1.508 -12.043 1.00 . A A .  87 THR C    1 1 
        3  5040 1 1  87 THR CA   C  24.326   1.448 -11.590 1.00 . A A .  87 THR CA   1 1 
        3  5041 1 1  87 THR CB   C  25.132   2.522 -12.345 1.00 . A A .  87 THR CB   1 1 
        3  5042 1 1  87 THR CG2  C  24.530   3.902 -12.130 1.00 . A A .  87 THR CG2  1 1 
        3  5043 1 1  87 THR H    H  25.298  -0.098 -12.660 1.00 . A A .  87 THR H    1 1 
        3  5044 1 1  87 THR HA   H  24.374   1.668 -10.533 1.00 . A A .  87 THR HA   1 1 
        3  5045 1 1  87 THR HB   H  25.104   2.294 -13.401 1.00 . A A .  87 THR HB   1 1 
        3  5046 1 1  87 THR HG1  H  26.590   3.113 -11.157 1.00 . A A .  87 THR HG1  1 1 
        3  5047 1 1  87 THR HG21 H  23.522   3.919 -12.516 1.00 . A A .  87 THR HG21 1 1 
        3  5048 1 1  87 THR HG22 H  25.126   4.639 -12.644 1.00 . A A .  87 THR HG22 1 1 
        3  5049 1 1  87 THR HG23 H  24.514   4.127 -11.073 1.00 . A A .  87 THR HG23 1 1 
        3  5050 1 1  87 THR N    N  24.887   0.118 -11.798 1.00 . A A .  87 THR N    1 1 
        3  5051 1 1  87 THR O    O  22.489   0.866 -13.021 1.00 . A A .  87 THR O    1 1 
        3  5052 1 1  87 THR OG1  O  26.494   2.514 -11.902 1.00 . A A .  87 THR OG1  1 1 
        3  5053 1 1  88 LEU C    C  20.474   3.088 -13.018 1.00 . A A .  88 LEU C    1 1 
        3  5054 1 1  88 LEU CA   C  20.651   2.428 -11.655 1.00 . A A .  88 LEU CA   1 1 
        3  5055 1 1  88 LEU CB   C  19.939   3.251 -10.580 1.00 . A A .  88 LEU CB   1 1 
        3  5056 1 1  88 LEU CD1  C  17.727   2.082 -10.724 1.00 . A A .  88 LEU CD1  1 1 
        3  5057 1 1  88 LEU CD2  C  17.872   4.356  -9.691 1.00 . A A .  88 LEU CD2  1 1 
        3  5058 1 1  88 LEU CG   C  18.431   3.429 -10.760 1.00 . A A .  88 LEU CG   1 1 
        3  5059 1 1  88 LEU H    H  22.428   2.770 -10.557 1.00 . A A .  88 LEU H    1 1 
        3  5060 1 1  88 LEU HA   H  20.217   1.440 -11.688 1.00 . A A .  88 LEU HA   1 1 
        3  5061 1 1  88 LEU HB2  H  20.115   2.777  -9.614 1.00 . A A .  88 LEU HB2  1 1 
        3  5062 1 1  88 LEU HB3  H  20.390   4.233 -10.564 1.00 . A A .  88 LEU HB3  1 1 
        3  5063 1 1  88 LEU HD11 H  17.097   1.981 -11.595 1.00 . A A .  88 LEU HD11 1 1 
        3  5064 1 1  88 LEU HD12 H  17.120   2.017  -9.832 1.00 . A A .  88 LEU HD12 1 1 
        3  5065 1 1  88 LEU HD13 H  18.462   1.292 -10.717 1.00 . A A .  88 LEU HD13 1 1 
        3  5066 1 1  88 LEU HD21 H  17.666   5.323 -10.124 1.00 . A A .  88 LEU HD21 1 1 
        3  5067 1 1  88 LEU HD22 H  18.595   4.464  -8.895 1.00 . A A .  88 LEU HD22 1 1 
        3  5068 1 1  88 LEU HD23 H  16.959   3.936  -9.293 1.00 . A A .  88 LEU HD23 1 1 
        3  5069 1 1  88 LEU HG   H  18.241   3.878 -11.726 1.00 . A A .  88 LEU HG   1 1 
        3  5070 1 1  88 LEU N    N  22.066   2.283 -11.327 1.00 . A A .  88 LEU N    1 1 
        3  5071 1 1  88 LEU O    O  21.162   4.056 -13.344 1.00 . A A .  88 LEU O    1 1 
        3  5072 1 1  89 GLN C    C  17.865   3.663 -15.221 1.00 . A A .  89 GLN C    1 1 
        3  5073 1 1  89 GLN CA   C  19.280   3.100 -15.138 1.00 . A A .  89 GLN CA   1 1 
        3  5074 1 1  89 GLN CB   C  19.474   2.017 -16.201 1.00 . A A .  89 GLN CB   1 1 
        3  5075 1 1  89 GLN CD   C  19.198  -0.414 -16.830 1.00 . A A .  89 GLN CD   1 1 
        3  5076 1 1  89 GLN CG   C  18.966   0.649 -15.775 1.00 . A A .  89 GLN CG   1 1 
        3  5077 1 1  89 GLN H    H  19.033   1.790 -13.494 1.00 . A A .  89 GLN H    1 1 
        3  5078 1 1  89 GLN HA   H  19.983   3.899 -15.319 1.00 . A A .  89 GLN HA   1 1 
        3  5079 1 1  89 GLN HB2  H  18.949   2.319 -17.108 1.00 . A A .  89 GLN HB2  1 1 
        3  5080 1 1  89 GLN HB3  H  20.527   1.933 -16.422 1.00 . A A .  89 GLN HB3  1 1 
        3  5081 1 1  89 GLN HE21 H  18.446  -1.807 -15.627 1.00 . A A .  89 GLN HE21 1 1 
        3  5082 1 1  89 GLN HE22 H  18.978  -2.360 -17.176 1.00 . A A .  89 GLN HE22 1 1 
        3  5083 1 1  89 GLN HG2  H  19.473   0.353 -14.857 1.00 . A A .  89 GLN HG2  1 1 
        3  5084 1 1  89 GLN HG3  H  17.905   0.718 -15.583 1.00 . A A .  89 GLN HG3  1 1 
        3  5085 1 1  89 GLN N    N  19.547   2.560 -13.810 1.00 . A A .  89 GLN N    1 1 
        3  5086 1 1  89 GLN NE2  N  18.839  -1.652 -16.512 1.00 . A A .  89 GLN NE2  1 1 
        3  5087 1 1  89 GLN O    O  17.654   4.775 -15.708 1.00 . A A .  89 GLN O    1 1 
        3  5088 1 1  89 GLN OE1  O  19.698  -0.127 -17.918 1.00 . A A .  89 GLN OE1  1 1 
        3  5089 1 1  90 LYS C    C  14.763   2.804 -13.525 1.00 . A A .  90 LYS C    1 1 
        3  5090 1 1  90 LYS CA   C  15.500   3.310 -14.761 1.00 . A A .  90 LYS CA   1 1 
        3  5091 1 1  90 LYS CB   C  14.809   2.799 -16.027 1.00 . A A .  90 LYS CB   1 1 
        3  5092 1 1  90 LYS CD   C  14.890   0.370 -15.390 1.00 . A A .  90 LYS CD   1 1 
        3  5093 1 1  90 LYS CE   C  14.447  -0.939 -16.026 1.00 . A A .  90 LYS CE   1 1 
        3  5094 1 1  90 LYS CG   C  15.252   1.407 -16.441 1.00 . A A .  90 LYS CG   1 1 
        3  5095 1 1  90 LYS H    H  17.126   2.013 -14.366 1.00 . A A .  90 LYS H    1 1 
        3  5096 1 1  90 LYS HA   H  15.479   4.390 -14.761 1.00 . A A .  90 LYS HA   1 1 
        3  5097 1 1  90 LYS HB2  H  13.732   2.787 -15.856 1.00 . A A .  90 LYS HB2  1 1 
        3  5098 1 1  90 LYS HB3  H  15.023   3.478 -16.840 1.00 . A A .  90 LYS HB3  1 1 
        3  5099 1 1  90 LYS HD2  H  15.759   0.184 -14.759 1.00 . A A .  90 LYS HD2  1 1 
        3  5100 1 1  90 LYS HD3  H  14.086   0.754 -14.780 1.00 . A A .  90 LYS HD3  1 1 
        3  5101 1 1  90 LYS HE2  H  14.336  -1.693 -15.247 1.00 . A A .  90 LYS HE2  1 1 
        3  5102 1 1  90 LYS HE3  H  13.493  -0.784 -16.507 1.00 . A A .  90 LYS HE3  1 1 
        3  5103 1 1  90 LYS HG2  H  14.769   1.144 -17.383 1.00 . A A .  90 LYS HG2  1 1 
        3  5104 1 1  90 LYS HG3  H  16.324   1.406 -16.580 1.00 . A A .  90 LYS HG3  1 1 
        3  5105 1 1  90 LYS HZ1  H  16.384  -1.094 -16.796 1.00 . A A .  90 LYS HZ1  1 1 
        3  5106 1 1  90 LYS HZ2  H  15.176  -1.062 -17.980 1.00 . A A .  90 LYS HZ2  1 1 
        3  5107 1 1  90 LYS HZ3  H  15.426  -2.462 -17.066 1.00 . A A .  90 LYS HZ3  1 1 
        3  5108 1 1  90 LYS N    N  16.896   2.890 -14.743 1.00 . A A .  90 LYS N    1 1 
        3  5109 1 1  90 LYS NZ   N  15.427  -1.423 -17.038 1.00 . A A .  90 LYS NZ   1 1 
        3  5110 1 1  90 LYS O    O  15.195   1.849 -12.882 1.00 . A A .  90 LYS O    1 1 
        3  5111 1 1  91 ALA C    C  11.508   2.476 -12.477 1.00 . A A .  91 ALA C    1 1 
        3  5112 1 1  91 ALA CA   C  12.848   3.062 -12.047 1.00 . A A .  91 ALA CA   1 1 
        3  5113 1 1  91 ALA CB   C  12.634   4.257 -11.128 1.00 . A A .  91 ALA CB   1 1 
        3  5114 1 1  91 ALA H    H  13.354   4.205 -13.755 1.00 . A A .  91 ALA H    1 1 
        3  5115 1 1  91 ALA HA   H  13.397   2.311 -11.497 1.00 . A A .  91 ALA HA   1 1 
        3  5116 1 1  91 ALA HB1  H  13.504   4.388 -10.501 1.00 . A A .  91 ALA HB1  1 1 
        3  5117 1 1  91 ALA HB2  H  12.480   5.145 -11.723 1.00 . A A .  91 ALA HB2  1 1 
        3  5118 1 1  91 ALA HB3  H  11.766   4.083 -10.510 1.00 . A A .  91 ALA HB3  1 1 
        3  5119 1 1  91 ALA N    N  13.647   3.451 -13.203 1.00 . A A .  91 ALA N    1 1 
        3  5120 1 1  91 ALA O    O  10.771   3.088 -13.253 1.00 . A A .  91 ALA O    1 1 
        3  5121 1 1  92 LEU C    C   8.846   0.991 -11.313 1.00 . A A .  92 LEU C    1 1 
        3  5122 1 1  92 LEU CA   C   9.944   0.618 -12.304 1.00 . A A .  92 LEU CA   1 1 
        3  5123 1 1  92 LEU CB   C  10.141  -0.898 -12.318 1.00 . A A .  92 LEU CB   1 1 
        3  5124 1 1  92 LEU CD1  C  11.560  -2.913 -12.781 1.00 . A A .  92 LEU CD1  1 1 
        3  5125 1 1  92 LEU CD2  C  11.669  -0.932 -14.307 1.00 . A A .  92 LEU CD2  1 1 
        3  5126 1 1  92 LEU CG   C  11.478  -1.396 -12.870 1.00 . A A .  92 LEU CG   1 1 
        3  5127 1 1  92 LEU H    H  11.824   0.850 -11.359 1.00 . A A .  92 LEU H    1 1 
        3  5128 1 1  92 LEU HA   H   9.648   0.944 -13.291 1.00 . A A .  92 LEU HA   1 1 
        3  5129 1 1  92 LEU HB2  H  10.034  -1.266 -11.298 1.00 . A A .  92 LEU HB2  1 1 
        3  5130 1 1  92 LEU HB3  H   9.353  -1.329 -12.920 1.00 . A A .  92 LEU HB3  1 1 
        3  5131 1 1  92 LEU HD11 H  10.937  -3.351 -13.546 1.00 . A A .  92 LEU HD11 1 1 
        3  5132 1 1  92 LEU HD12 H  11.219  -3.236 -11.809 1.00 . A A .  92 LEU HD12 1 1 
        3  5133 1 1  92 LEU HD13 H  12.584  -3.226 -12.926 1.00 . A A .  92 LEU HD13 1 1 
        3  5134 1 1  92 LEU HD21 H  10.704  -0.750 -14.757 1.00 . A A .  92 LEU HD21 1 1 
        3  5135 1 1  92 LEU HD22 H  12.189  -1.696 -14.866 1.00 . A A .  92 LEU HD22 1 1 
        3  5136 1 1  92 LEU HD23 H  12.250  -0.020 -14.316 1.00 . A A .  92 LEU HD23 1 1 
        3  5137 1 1  92 LEU HG   H  12.282  -0.984 -12.275 1.00 . A A .  92 LEU HG   1 1 
        3  5138 1 1  92 LEU N    N  11.197   1.288 -11.971 1.00 . A A .  92 LEU N    1 1 
        3  5139 1 1  92 LEU O    O   7.781   0.376 -11.290 1.00 . A A .  92 LEU O    1 1 
        3  5140 1 1  93 PHE C    C   7.773   1.329  -8.550 1.00 . A A .  93 PHE C    1 1 
        3  5141 1 1  93 PHE CA   C   8.150   2.461  -9.502 1.00 . A A .  93 PHE CA   1 1 
        3  5142 1 1  93 PHE CB   C   6.895   3.002 -10.190 1.00 . A A .  93 PHE CB   1 1 
        3  5143 1 1  93 PHE CD1  C   6.983   5.342  -9.285 1.00 . A A .  93 PHE CD1  1 1 
        3  5144 1 1  93 PHE CD2  C   6.853   5.045 -11.648 1.00 . A A .  93 PHE CD2  1 1 
        3  5145 1 1  93 PHE CE1  C   6.999   6.714  -9.454 1.00 . A A .  93 PHE CE1  1 1 
        3  5146 1 1  93 PHE CE2  C   6.868   6.416 -11.823 1.00 . A A .  93 PHE CE2  1 1 
        3  5147 1 1  93 PHE CG   C   6.911   4.493 -10.378 1.00 . A A .  93 PHE CG   1 1 
        3  5148 1 1  93 PHE CZ   C   6.939   7.251 -10.725 1.00 . A A .  93 PHE CZ   1 1 
        3  5149 1 1  93 PHE H    H   9.982   2.456 -10.562 1.00 . A A .  93 PHE H    1 1 
        3  5150 1 1  93 PHE HA   H   8.609   3.254  -8.934 1.00 . A A .  93 PHE HA   1 1 
        3  5151 1 1  93 PHE HB2  H   6.798   2.527 -11.166 1.00 . A A .  93 PHE HB2  1 1 
        3  5152 1 1  93 PHE HB3  H   6.030   2.752  -9.595 1.00 . A A .  93 PHE HB3  1 1 
        3  5153 1 1  93 PHE HD1  H   7.029   4.922  -8.290 1.00 . A A .  93 PHE HD1  1 1 
        3  5154 1 1  93 PHE HD2  H   6.795   4.394 -12.506 1.00 . A A .  93 PHE HD2  1 1 
        3  5155 1 1  93 PHE HE1  H   7.054   7.363  -8.594 1.00 . A A .  93 PHE HE1  1 1 
        3  5156 1 1  93 PHE HE2  H   6.823   6.834 -12.817 1.00 . A A .  93 PHE HE2  1 1 
        3  5157 1 1  93 PHE HZ   H   6.952   8.323 -10.859 1.00 . A A .  93 PHE HZ   1 1 
        3  5158 1 1  93 PHE N    N   9.114   2.005 -10.496 1.00 . A A .  93 PHE N    1 1 
        3  5159 1 1  93 PHE O    O   8.219   0.193  -8.711 1.00 . A A .  93 PHE O    1 1 
        3  5160 1 1  94 ASN C    C   7.709  -0.028  -5.929 1.00 . A A .  94 ASN C    1 1 
        3  5161 1 1  94 ASN CA   C   6.511   0.660  -6.579 1.00 . A A .  94 ASN CA   1 1 
        3  5162 1 1  94 ASN CB   C   5.609  -0.382  -7.243 1.00 . A A .  94 ASN CB   1 1 
        3  5163 1 1  94 ASN CG   C   4.483   0.251  -8.037 1.00 . A A .  94 ASN CG   1 1 
        3  5164 1 1  94 ASN H    H   6.626   2.572  -7.482 1.00 . A A .  94 ASN H    1 1 
        3  5165 1 1  94 ASN HA   H   5.950   1.175  -5.814 1.00 . A A .  94 ASN HA   1 1 
        3  5166 1 1  94 ASN HB2  H   6.212  -0.996  -7.912 1.00 . A A .  94 ASN HB2  1 1 
        3  5167 1 1  94 ASN HB3  H   5.177  -1.014  -6.481 1.00 . A A .  94 ASN HB3  1 1 
        3  5168 1 1  94 ASN HD21 H   3.941   1.329  -6.456 1.00 . A A .  94 ASN HD21 1 1 
        3  5169 1 1  94 ASN HD22 H   2.995   1.560  -7.883 1.00 . A A .  94 ASN HD22 1 1 
        3  5170 1 1  94 ASN N    N   6.948   1.649  -7.558 1.00 . A A .  94 ASN N    1 1 
        3  5171 1 1  94 ASN ND2  N   3.730   1.137  -7.394 1.00 . A A .  94 ASN ND2  1 1 
        3  5172 1 1  94 ASN O    O   7.614  -1.172  -5.482 1.00 . A A .  94 ASN O    1 1 
        3  5173 1 1  94 ASN OD1  O   4.292  -0.052  -9.215 1.00 . A A .  94 ASN OD1  1 1 
        3  5174 1 1  95 VAL C    C  11.164   1.176  -5.264 1.00 . A A .  95 VAL C    1 1 
        3  5175 1 1  95 VAL CA   C  10.051   0.134  -5.286 1.00 . A A .  95 VAL CA   1 1 
        3  5176 1 1  95 VAL CB   C  10.543  -1.110  -6.049 1.00 . A A .  95 VAL CB   1 1 
        3  5177 1 1  95 VAL CG1  C  11.148  -0.713  -7.386 1.00 . A A .  95 VAL CG1  1 1 
        3  5178 1 1  95 VAL CG2  C  11.547  -1.886  -5.209 1.00 . A A .  95 VAL CG2  1 1 
        3  5179 1 1  95 VAL H    H   8.848   1.581  -6.256 1.00 . A A .  95 VAL H    1 1 
        3  5180 1 1  95 VAL HA   H   9.824  -0.157  -4.270 1.00 . A A .  95 VAL HA   1 1 
        3  5181 1 1  95 VAL HB   H   9.694  -1.751  -6.237 1.00 . A A .  95 VAL HB   1 1 
        3  5182 1 1  95 VAL HG11 H  10.655   0.176  -7.753 1.00 . A A .  95 VAL HG11 1 1 
        3  5183 1 1  95 VAL HG12 H  12.201  -0.516  -7.262 1.00 . A A .  95 VAL HG12 1 1 
        3  5184 1 1  95 VAL HG13 H  11.012  -1.517  -8.096 1.00 . A A .  95 VAL HG13 1 1 
        3  5185 1 1  95 VAL HG21 H  12.505  -1.386  -5.240 1.00 . A A .  95 VAL HG21 1 1 
        3  5186 1 1  95 VAL HG22 H  11.200  -1.935  -4.188 1.00 . A A .  95 VAL HG22 1 1 
        3  5187 1 1  95 VAL HG23 H  11.651  -2.886  -5.603 1.00 . A A .  95 VAL HG23 1 1 
        3  5188 1 1  95 VAL N    N   8.835   0.676  -5.882 1.00 . A A .  95 VAL N    1 1 
        3  5189 1 1  95 VAL O    O  11.338   1.932  -6.220 1.00 . A A .  95 VAL O    1 1 
        3  5190 1 1  96 GLU C    C  14.327   1.550  -4.494 1.00 . A A .  96 GLU C    1 1 
        3  5191 1 1  96 GLU CA   C  13.009   2.161  -4.020 1.00 . A A .  96 GLU CA   1 1 
        3  5192 1 1  96 GLU CB   C  13.136   2.607  -2.563 1.00 . A A .  96 GLU CB   1 1 
        3  5193 1 1  96 GLU CD   C  12.290   1.260  -0.601 1.00 . A A .  96 GLU CD   1 1 
        3  5194 1 1  96 GLU CG   C  13.413   1.466  -1.598 1.00 . A A .  96 GLU CG   1 1 
        3  5195 1 1  96 GLU H    H  11.725   0.583  -3.438 1.00 . A A .  96 GLU H    1 1 
        3  5196 1 1  96 GLU HA   H  12.785   3.022  -4.632 1.00 . A A .  96 GLU HA   1 1 
        3  5197 1 1  96 GLU HB2  H  13.947   3.332  -2.488 1.00 . A A .  96 GLU HB2  1 1 
        3  5198 1 1  96 GLU HB3  H  12.215   3.087  -2.265 1.00 . A A .  96 GLU HB3  1 1 
        3  5199 1 1  96 GLU HG2  H  13.552   0.548  -2.169 1.00 . A A .  96 GLU HG2  1 1 
        3  5200 1 1  96 GLU HG3  H  14.322   1.683  -1.055 1.00 . A A .  96 GLU HG3  1 1 
        3  5201 1 1  96 GLU N    N  11.913   1.211  -4.167 1.00 . A A .  96 GLU N    1 1 
        3  5202 1 1  96 GLU O    O  14.639   0.402  -4.178 1.00 . A A .  96 GLU O    1 1 
        3  5203 1 1  96 GLU OE1  O  11.179   0.882  -1.027 1.00 . A A .  96 GLU OE1  1 1 
        3  5204 1 1  96 GLU OE2  O  12.523   1.475   0.607 1.00 . A A .  96 GLU OE2  1 1 
        3  5205 1 1  97 CYS C    C  17.479   2.872  -5.467 1.00 . A A .  97 CYS C    1 1 
        3  5206 1 1  97 CYS CA   C  16.375   1.864  -5.769 1.00 . A A .  97 CYS CA   1 1 
        3  5207 1 1  97 CYS CB   C  16.283   1.627  -7.279 1.00 . A A .  97 CYS CB   1 1 
        3  5208 1 1  97 CYS H    H  14.789   3.233  -5.469 1.00 . A A .  97 CYS H    1 1 
        3  5209 1 1  97 CYS HA   H  16.612   0.931  -5.282 1.00 . A A .  97 CYS HA   1 1 
        3  5210 1 1  97 CYS HB2  H  16.066   2.577  -7.767 1.00 . A A .  97 CYS HB2  1 1 
        3  5211 1 1  97 CYS HB3  H  17.236   1.265  -7.637 1.00 . A A .  97 CYS HB3  1 1 
        3  5212 1 1  97 CYS HG   H  13.925   0.583  -7.005 1.00 . A A .  97 CYS HG   1 1 
        3  5213 1 1  97 CYS N    N  15.092   2.326  -5.252 1.00 . A A .  97 CYS N    1 1 
        3  5214 1 1  97 CYS O    O  17.253   4.082  -5.496 1.00 . A A .  97 CYS O    1 1 
        3  5215 1 1  97 CYS SG   S  15.011   0.419  -7.766 1.00 . A A .  97 CYS SG   1 1 
        3  5216 1 1  98 GLN C    C  20.539   3.639  -6.144 1.00 . A A .  98 GLN C    1 1 
        3  5217 1 1  98 GLN CA   C  19.812   3.219  -4.869 1.00 . A A .  98 GLN CA   1 1 
        3  5218 1 1  98 GLN CB   C  20.781   2.498  -3.931 1.00 . A A .  98 GLN CB   1 1 
        3  5219 1 1  98 GLN CD   C  21.408   2.108  -1.514 1.00 . A A .  98 GLN CD   1 1 
        3  5220 1 1  98 GLN CG   C  20.794   3.064  -2.520 1.00 . A A .  98 GLN CG   1 1 
        3  5221 1 1  98 GLN H    H  18.791   1.391  -5.171 1.00 . A A .  98 GLN H    1 1 
        3  5222 1 1  98 GLN HA   H  19.438   4.103  -4.376 1.00 . A A .  98 GLN HA   1 1 
        3  5223 1 1  98 GLN HB2  H  20.501   1.446  -3.882 1.00 . A A .  98 GLN HB2  1 1 
        3  5224 1 1  98 GLN HB3  H  21.779   2.573  -4.335 1.00 . A A .  98 GLN HB3  1 1 
        3  5225 1 1  98 GLN HE21 H  19.599   1.541  -0.916 1.00 . A A .  98 GLN HE21 1 1 
        3  5226 1 1  98 GLN HE22 H  20.928   0.779  -0.116 1.00 . A A .  98 GLN HE22 1 1 
        3  5227 1 1  98 GLN HG2  H  21.365   3.992  -2.518 1.00 . A A .  98 GLN HG2  1 1 
        3  5228 1 1  98 GLN HG3  H  19.779   3.276  -2.221 1.00 . A A .  98 GLN HG3  1 1 
        3  5229 1 1  98 GLN N    N  18.672   2.364  -5.178 1.00 . A A .  98 GLN N    1 1 
        3  5230 1 1  98 GLN NE2  N  20.560   1.405  -0.773 1.00 . A A .  98 GLN NE2  1 1 
        3  5231 1 1  98 GLN O    O  20.492   2.939  -7.155 1.00 . A A .  98 GLN O    1 1 
        3  5232 1 1  98 GLN OE1  O  22.629   2.004  -1.406 1.00 . A A .  98 GLN OE1  1 1 
        3  5233 1 1  99 GLN C    C  22.889   4.239  -7.795 1.00 . A A .  99 GLN C    1 1 
        3  5234 1 1  99 GLN CA   C  21.942   5.298  -7.238 1.00 . A A .  99 GLN CA   1 1 
        3  5235 1 1  99 GLN CB   C  22.733   6.550  -6.848 1.00 . A A .  99 GLN CB   1 1 
        3  5236 1 1  99 GLN CD   C  22.799   8.383  -8.587 1.00 . A A .  99 GLN CD   1 1 
        3  5237 1 1  99 GLN CG   C  23.499   7.169  -8.006 1.00 . A A .  99 GLN CG   1 1 
        3  5238 1 1  99 GLN H    H  21.208   5.300  -5.252 1.00 . A A .  99 GLN H    1 1 
        3  5239 1 1  99 GLN HA   H  21.225   5.559  -8.000 1.00 . A A .  99 GLN HA   1 1 
        3  5240 1 1  99 GLN HB2  H  22.039   7.292  -6.452 1.00 . A A .  99 GLN HB2  1 1 
        3  5241 1 1  99 GLN HB3  H  23.440   6.290  -6.075 1.00 . A A .  99 GLN HB3  1 1 
        3  5242 1 1  99 GLN HE21 H  24.532   9.090  -9.259 1.00 . A A .  99 GLN HE21 1 1 
        3  5243 1 1  99 GLN HE22 H  23.144  10.062  -9.594 1.00 . A A .  99 GLN HE22 1 1 
        3  5244 1 1  99 GLN HG2  H  24.488   7.466  -7.656 1.00 . A A .  99 GLN HG2  1 1 
        3  5245 1 1  99 GLN HG3  H  23.610   6.429  -8.785 1.00 . A A .  99 GLN HG3  1 1 
        3  5246 1 1  99 GLN N    N  21.208   4.785  -6.087 1.00 . A A .  99 GLN N    1 1 
        3  5247 1 1  99 GLN NE2  N  23.569   9.268  -9.209 1.00 . A A .  99 GLN NE2  1 1 
        3  5248 1 1  99 GLN O    O  23.062   4.123  -9.009 1.00 . A A .  99 GLN O    1 1 
        3  5249 1 1  99 GLN OE1  O  21.581   8.524  -8.476 1.00 . A A .  99 GLN OE1  1 1 
        3  5250 1 1 100 THR C    C  24.389   1.247  -6.330 1.00 . A A . 100 THR C    1 1 
        3  5251 1 1 100 THR CA   C  24.429   2.420  -7.303 1.00 . A A . 100 THR CA   1 1 
        3  5252 1 1 100 THR CB   C  25.872   2.952  -7.389 1.00 . A A . 100 THR CB   1 1 
        3  5253 1 1 100 THR CG2  C  26.665   2.195  -8.444 1.00 . A A . 100 THR CG2  1 1 
        3  5254 1 1 100 THR H    H  23.320   3.610  -5.948 1.00 . A A . 100 THR H    1 1 
        3  5255 1 1 100 THR HA   H  24.135   2.073  -8.283 1.00 . A A . 100 THR HA   1 1 
        3  5256 1 1 100 THR HB   H  26.349   2.810  -6.431 1.00 . A A . 100 THR HB   1 1 
        3  5257 1 1 100 THR HG1  H  25.984   4.858  -6.900 1.00 . A A . 100 THR HG1  1 1 
        3  5258 1 1 100 THR HG21 H  26.919   1.216  -8.068 1.00 . A A . 100 THR HG21 1 1 
        3  5259 1 1 100 THR HG22 H  27.569   2.738  -8.672 1.00 . A A . 100 THR HG22 1 1 
        3  5260 1 1 100 THR HG23 H  26.069   2.094  -9.338 1.00 . A A . 100 THR HG23 1 1 
        3  5261 1 1 100 THR N    N  23.500   3.468  -6.900 1.00 . A A . 100 THR N    1 1 
        3  5262 1 1 100 THR O    O  24.136   1.424  -5.138 1.00 . A A . 100 THR O    1 1 
        3  5263 1 1 100 THR OG1  O  25.862   4.348  -7.703 1.00 . A A . 100 THR OG1  1 1 
        3  5264 1 1 101 VAL C    C  25.648  -2.174  -6.529 1.00 . A A . 101 VAL C    1 1 
        3  5265 1 1 101 VAL CA   C  24.634  -1.155  -6.023 1.00 . A A . 101 VAL CA   1 1 
        3  5266 1 1 101 VAL CB   C  23.239  -1.808  -5.990 1.00 . A A . 101 VAL CB   1 1 
        3  5267 1 1 101 VAL CG1  C  22.186  -0.797  -5.566 1.00 . A A . 101 VAL CG1  1 1 
        3  5268 1 1 101 VAL CG2  C  22.901  -2.404  -7.348 1.00 . A A . 101 VAL CG2  1 1 
        3  5269 1 1 101 VAL H    H  24.834  -0.029  -7.803 1.00 . A A . 101 VAL H    1 1 
        3  5270 1 1 101 VAL HA   H  24.898  -0.870  -5.014 1.00 . A A . 101 VAL HA   1 1 
        3  5271 1 1 101 VAL HB   H  23.254  -2.606  -5.263 1.00 . A A . 101 VAL HB   1 1 
        3  5272 1 1 101 VAL HG11 H  21.216  -1.272  -5.551 1.00 . A A . 101 VAL HG11 1 1 
        3  5273 1 1 101 VAL HG12 H  22.420  -0.424  -4.580 1.00 . A A . 101 VAL HG12 1 1 
        3  5274 1 1 101 VAL HG13 H  22.173   0.025  -6.267 1.00 . A A . 101 VAL HG13 1 1 
        3  5275 1 1 101 VAL HG21 H  23.001  -3.480  -7.304 1.00 . A A . 101 VAL HG21 1 1 
        3  5276 1 1 101 VAL HG22 H  21.886  -2.147  -7.610 1.00 . A A . 101 VAL HG22 1 1 
        3  5277 1 1 101 VAL HG23 H  23.576  -2.011  -8.094 1.00 . A A . 101 VAL HG23 1 1 
        3  5278 1 1 101 VAL N    N  24.640   0.048  -6.845 1.00 . A A . 101 VAL N    1 1 
        3  5279 1 1 101 VAL O    O  26.230  -2.005  -7.602 1.00 . A A . 101 VAL O    1 1 
        3  5280 1 1 102 SER C    C  26.130  -5.646  -6.119 1.00 . A A . 102 SER C    1 1 
        3  5281 1 1 102 SER CA   C  26.803  -4.278  -6.122 1.00 . A A . 102 SER CA   1 1 
        3  5282 1 1 102 SER CB   C  27.993  -4.280  -5.160 1.00 . A A . 102 SER CB   1 1 
        3  5283 1 1 102 SER H    H  25.362  -3.311  -4.910 1.00 . A A . 102 SER H    1 1 
        3  5284 1 1 102 SER HA   H  27.158  -4.066  -7.120 1.00 . A A . 102 SER HA   1 1 
        3  5285 1 1 102 SER HB2  H  28.326  -3.255  -4.998 1.00 . A A . 102 SER HB2  1 1 
        3  5286 1 1 102 SER HB3  H  27.687  -4.709  -4.216 1.00 . A A . 102 SER HB3  1 1 
        3  5287 1 1 102 SER HG   H  29.336  -5.701  -5.037 1.00 . A A . 102 SER HG   1 1 
        3  5288 1 1 102 SER N    N  25.856  -3.233  -5.753 1.00 . A A . 102 SER N    1 1 
        3  5289 1 1 102 SER O    O  25.088  -5.838  -5.489 1.00 . A A . 102 SER O    1 1 
        3  5290 1 1 102 SER OG   O  29.068  -5.043  -5.681 1.00 . A A . 102 SER OG   1 1 
        3  5291 1 1 103 VAL C    C  27.295  -8.990  -6.770 1.00 . A A . 103 VAL C    1 1 
        3  5292 1 1 103 VAL CA   C  26.190  -7.949  -6.908 1.00 . A A . 103 VAL CA   1 1 
        3  5293 1 1 103 VAL CB   C  25.447  -8.179  -8.236 1.00 . A A . 103 VAL CB   1 1 
        3  5294 1 1 103 VAL CG1  C  24.543  -6.997  -8.554 1.00 . A A . 103 VAL CG1  1 1 
        3  5295 1 1 103 VAL CG2  C  26.436  -8.422  -9.366 1.00 . A A . 103 VAL CG2  1 1 
        3  5296 1 1 103 VAL H    H  27.557  -6.384  -7.309 1.00 . A A . 103 VAL H    1 1 
        3  5297 1 1 103 VAL HA   H  25.487  -8.076  -6.098 1.00 . A A . 103 VAL HA   1 1 
        3  5298 1 1 103 VAL HB   H  24.829  -9.059  -8.132 1.00 . A A . 103 VAL HB   1 1 
        3  5299 1 1 103 VAL HG11 H  24.314  -6.464  -7.642 1.00 . A A . 103 VAL HG11 1 1 
        3  5300 1 1 103 VAL HG12 H  25.045  -6.335  -9.243 1.00 . A A . 103 VAL HG12 1 1 
        3  5301 1 1 103 VAL HG13 H  23.627  -7.355  -9.001 1.00 . A A . 103 VAL HG13 1 1 
        3  5302 1 1 103 VAL HG21 H  26.078  -7.949 -10.267 1.00 . A A . 103 VAL HG21 1 1 
        3  5303 1 1 103 VAL HG22 H  27.396  -8.007  -9.098 1.00 . A A . 103 VAL HG22 1 1 
        3  5304 1 1 103 VAL HG23 H  26.538  -9.485  -9.533 1.00 . A A . 103 VAL HG23 1 1 
        3  5305 1 1 103 VAL N    N  26.731  -6.597  -6.828 1.00 . A A . 103 VAL N    1 1 
        3  5306 1 1 103 VAL O    O  28.462  -8.714  -7.046 1.00 . A A . 103 VAL O    1 1 
        3  5307 1 1 104 THR C    C  27.299 -12.602  -6.637 1.00 . A A . 104 THR C    1 1 
        3  5308 1 1 104 THR CA   C  27.877 -11.275  -6.163 1.00 . A A . 104 THR CA   1 1 
        3  5309 1 1 104 THR CB   C  28.306 -11.411  -4.690 1.00 . A A . 104 THR CB   1 1 
        3  5310 1 1 104 THR CG2  C  29.767 -11.824  -4.588 1.00 . A A . 104 THR CG2  1 1 
        3  5311 1 1 104 THR H    H  25.974 -10.349  -6.133 1.00 . A A . 104 THR H    1 1 
        3  5312 1 1 104 THR HA   H  28.753 -11.044  -6.751 1.00 . A A . 104 THR HA   1 1 
        3  5313 1 1 104 THR HB   H  27.699 -12.174  -4.223 1.00 . A A . 104 THR HB   1 1 
        3  5314 1 1 104 THR HG1  H  27.392 -10.267  -3.370 1.00 . A A . 104 THR HG1  1 1 
        3  5315 1 1 104 THR HG21 H  29.902 -12.789  -5.054 1.00 . A A . 104 THR HG21 1 1 
        3  5316 1 1 104 THR HG22 H  30.053 -11.883  -3.548 1.00 . A A . 104 THR HG22 1 1 
        3  5317 1 1 104 THR HG23 H  30.383 -11.092  -5.089 1.00 . A A . 104 THR HG23 1 1 
        3  5318 1 1 104 THR N    N  26.919 -10.190  -6.339 1.00 . A A . 104 THR N    1 1 
        3  5319 1 1 104 THR O    O  26.093 -12.834  -6.546 1.00 . A A . 104 THR O    1 1 
        3  5320 1 1 104 THR OG1  O  28.107 -10.171  -4.003 1.00 . A A . 104 THR OG1  1 1 
        3  5321 1 1 105 LYS C    C  28.847 -15.815  -7.447 1.00 . A A . 105 LYS C    1 1 
        3  5322 1 1 105 LYS CA   C  27.740 -14.781  -7.630 1.00 . A A . 105 LYS CA   1 1 
        3  5323 1 1 105 LYS CB   C  27.347 -14.695  -9.107 1.00 . A A . 105 LYS CB   1 1 
        3  5324 1 1 105 LYS CD   C  25.240 -13.916 -10.229 1.00 . A A . 105 LYS CD   1 1 
        3  5325 1 1 105 LYS CE   C  24.293 -14.520 -11.255 1.00 . A A . 105 LYS CE   1 1 
        3  5326 1 1 105 LYS CG   C  25.880 -14.987  -9.363 1.00 . A A . 105 LYS CG   1 1 
        3  5327 1 1 105 LYS H    H  29.114 -13.231  -7.189 1.00 . A A . 105 LYS H    1 1 
        3  5328 1 1 105 LYS HA   H  26.880 -15.086  -7.054 1.00 . A A . 105 LYS HA   1 1 
        3  5329 1 1 105 LYS HB2  H  27.572 -13.693  -9.470 1.00 . A A . 105 LYS HB2  1 1 
        3  5330 1 1 105 LYS HB3  H  27.938 -15.406  -9.665 1.00 . A A . 105 LYS HB3  1 1 
        3  5331 1 1 105 LYS HD2  H  24.685 -13.227  -9.592 1.00 . A A . 105 LYS HD2  1 1 
        3  5332 1 1 105 LYS HD3  H  26.018 -13.371 -10.746 1.00 . A A . 105 LYS HD3  1 1 
        3  5333 1 1 105 LYS HE2  H  24.324 -13.921 -12.165 1.00 . A A . 105 LYS HE2  1 1 
        3  5334 1 1 105 LYS HE3  H  24.622 -15.523 -11.482 1.00 . A A . 105 LYS HE3  1 1 
        3  5335 1 1 105 LYS HG2  H  25.791 -15.951  -9.864 1.00 . A A . 105 LYS HG2  1 1 
        3  5336 1 1 105 LYS HG3  H  25.359 -15.031  -8.417 1.00 . A A . 105 LYS HG3  1 1 
        3  5337 1 1 105 LYS HZ1  H  22.226 -14.448 -11.542 1.00 . A A . 105 LYS HZ1  1 1 
        3  5338 1 1 105 LYS HZ2  H  22.734 -13.813 -10.060 1.00 . A A . 105 LYS HZ2  1 1 
        3  5339 1 1 105 LYS HZ3  H  22.709 -15.487 -10.297 1.00 . A A . 105 LYS HZ3  1 1 
        3  5340 1 1 105 LYS N    N  28.165 -13.474  -7.142 1.00 . A A . 105 LYS N    1 1 
        3  5341 1 1 105 LYS NZ   N  22.892 -14.570 -10.753 1.00 . A A . 105 LYS NZ   1 1 
        3  5342 1 1 105 LYS O    O  30.036 -15.495  -7.454 1.00 . A A . 105 LYS O    1 1 
        3  5343 1 1 106 PRO C    C  30.179 -18.503  -8.362 1.00 . A A . 106 PRO C    1 1 
        3  5344 1 1 106 PRO CA   C  29.392 -18.192  -7.093 1.00 . A A . 106 PRO CA   1 1 
        3  5345 1 1 106 PRO CB   C  28.487 -19.369  -6.723 1.00 . A A . 106 PRO CB   1 1 
        3  5346 1 1 106 PRO CD   C  27.049 -17.538  -7.259 1.00 . A A . 106 PRO CD   1 1 
        3  5347 1 1 106 PRO CG   C  27.165 -19.036  -7.323 1.00 . A A . 106 PRO CG   1 1 
        3  5348 1 1 106 PRO HA   H  30.080 -17.995  -6.284 1.00 . A A . 106 PRO HA   1 1 
        3  5349 1 1 106 PRO HB2  H  28.875 -20.293  -7.152 1.00 . A A . 106 PRO HB2  1 1 
        3  5350 1 1 106 PRO HB3  H  28.423 -19.455  -5.649 1.00 . A A . 106 PRO HB3  1 1 
        3  5351 1 1 106 PRO HD2  H  26.509 -17.158  -8.127 1.00 . A A . 106 PRO HD2  1 1 
        3  5352 1 1 106 PRO HD3  H  26.559 -17.237  -6.344 1.00 . A A . 106 PRO HD3  1 1 
        3  5353 1 1 106 PRO HG2  H  27.127 -19.373  -8.359 1.00 . A A . 106 PRO HG2  1 1 
        3  5354 1 1 106 PRO HG3  H  26.375 -19.498  -6.751 1.00 . A A . 106 PRO HG3  1 1 
        3  5355 1 1 106 PRO N    N  28.450 -17.086  -7.279 1.00 . A A . 106 PRO N    1 1 
        3  5356 1 1 106 PRO O    O  29.870 -19.455  -9.079 1.00 . A A . 106 PRO O    1 1 
        3  5357 1 1 107 CYS C    C  33.487 -18.108  -9.425 1.00 . A A . 107 CYS C    1 1 
        3  5358 1 1 107 CYS CA   C  32.029 -17.881  -9.817 1.00 . A A . 107 CYS CA   1 1 
        3  5359 1 1 107 CYS CB   C  31.920 -16.668 -10.740 1.00 . A A . 107 CYS CB   1 1 
        3  5360 1 1 107 CYS H    H  31.394 -16.950  -8.024 1.00 . A A . 107 CYS H    1 1 
        3  5361 1 1 107 CYS HA   H  31.670 -18.755 -10.340 1.00 . A A . 107 CYS HA   1 1 
        3  5362 1 1 107 CYS HB2  H  30.901 -16.614 -11.125 1.00 . A A . 107 CYS HB2  1 1 
        3  5363 1 1 107 CYS HB3  H  32.121 -15.771 -10.171 1.00 . A A . 107 CYS HB3  1 1 
        3  5364 1 1 107 CYS HG   H  32.789 -17.745 -12.934 1.00 . A A . 107 CYS HG   1 1 
        3  5365 1 1 107 CYS N    N  31.197 -17.693  -8.634 1.00 . A A . 107 CYS N    1 1 
        3  5366 1 1 107 CYS O    O  33.978 -17.531  -8.455 1.00 . A A . 107 CYS O    1 1 
        3  5367 1 1 107 CYS SG   S  33.072 -16.700 -12.151 1.00 . A A . 107 CYS SG   1 1 
        3  5368 1 1 108 THR C    C  36.398 -19.223 -11.206 1.00 . A A . 108 THR C    1 1 
        3  5369 1 1 108 THR CA   C  35.574 -19.254  -9.923 1.00 . A A . 108 THR CA   1 1 
        3  5370 1 1 108 THR CB   C  35.734 -20.635  -9.258 1.00 . A A . 108 THR CB   1 1 
        3  5371 1 1 108 THR CG2  C  34.920 -21.688  -9.997 1.00 . A A . 108 THR CG2  1 1 
        3  5372 1 1 108 THR H    H  33.728 -19.379 -10.949 1.00 . A A . 108 THR H    1 1 
        3  5373 1 1 108 THR HA   H  35.956 -18.505  -9.244 1.00 . A A . 108 THR HA   1 1 
        3  5374 1 1 108 THR HB   H  35.374 -20.572  -8.241 1.00 . A A . 108 THR HB   1 1 
        3  5375 1 1 108 THR HG1  H  37.264 -21.648  -8.537 1.00 . A A . 108 THR HG1  1 1 
        3  5376 1 1 108 THR HG21 H  33.910 -21.692  -9.618 1.00 . A A . 108 THR HG21 1 1 
        3  5377 1 1 108 THR HG22 H  35.365 -22.661  -9.843 1.00 . A A . 108 THR HG22 1 1 
        3  5378 1 1 108 THR HG23 H  34.910 -21.460 -11.053 1.00 . A A . 108 THR HG23 1 1 
        3  5379 1 1 108 THR N    N  34.175 -18.951 -10.189 1.00 . A A . 108 THR N    1 1 
        3  5380 1 1 108 THR O    O  35.883 -19.487 -12.294 1.00 . A A . 108 THR O    1 1 
        3  5381 1 1 108 THR OG1  O  37.115 -21.016  -9.243 1.00 . A A . 108 THR OG1  1 1 
        3  5382 1 1 109 THR C    C  38.548 -20.134 -13.015 1.00 . A A . 109 THR C    1 1 
        3  5383 1 1 109 THR CA   C  38.575 -18.832 -12.223 1.00 . A A . 109 THR CA   1 1 
        3  5384 1 1 109 THR CB   C  40.024 -18.537 -11.790 1.00 . A A . 109 THR CB   1 1 
        3  5385 1 1 109 THR CG2  C  40.569 -17.321 -12.523 1.00 . A A . 109 THR CG2  1 1 
        3  5386 1 1 109 THR H    H  38.032 -18.699 -10.180 1.00 . A A . 109 THR H    1 1 
        3  5387 1 1 109 THR HA   H  38.240 -18.027 -12.859 1.00 . A A . 109 THR HA   1 1 
        3  5388 1 1 109 THR HB   H  40.637 -19.392 -12.035 1.00 . A A . 109 THR HB   1 1 
        3  5389 1 1 109 THR HG1  H  40.831 -17.756 -10.170 1.00 . A A . 109 THR HG1  1 1 
        3  5390 1 1 109 THR HG21 H  41.038 -17.636 -13.443 1.00 . A A . 109 THR HG21 1 1 
        3  5391 1 1 109 THR HG22 H  41.297 -16.822 -11.901 1.00 . A A . 109 THR HG22 1 1 
        3  5392 1 1 109 THR HG23 H  39.760 -16.642 -12.746 1.00 . A A . 109 THR HG23 1 1 
        3  5393 1 1 109 THR N    N  37.680 -18.899 -11.073 1.00 . A A . 109 THR N    1 1 
        3  5394 1 1 109 THR O    O  38.138 -20.159 -14.176 1.00 . A A . 109 THR O    1 1 
        3  5395 1 1 109 THR OG1  O  40.076 -18.313 -10.377 1.00 . A A . 109 THR OG1  1 1 
        3  5396 1 1 110 LYS C    C  39.336 -23.621 -12.019 1.00 . A A . 110 LYS C    1 1 
        3  5397 1 1 110 LYS CA   C  39.013 -22.524 -13.027 1.00 . A A . 110 LYS CA   1 1 
        3  5398 1 1 110 LYS CB   C  40.044 -22.537 -14.158 1.00 . A A . 110 LYS CB   1 1 
        3  5399 1 1 110 LYS CD   C  38.609 -23.210 -16.108 1.00 . A A . 110 LYS CD   1 1 
        3  5400 1 1 110 LYS CE   C  39.026 -22.194 -17.160 1.00 . A A . 110 LYS CE   1 1 
        3  5401 1 1 110 LYS CG   C  39.775 -23.597 -15.213 1.00 . A A . 110 LYS CG   1 1 
        3  5402 1 1 110 LYS H    H  39.302 -21.134 -11.456 1.00 . A A . 110 LYS H    1 1 
        3  5403 1 1 110 LYS HA   H  38.034 -22.708 -13.442 1.00 . A A . 110 LYS HA   1 1 
        3  5404 1 1 110 LYS HB2  H  40.048 -21.559 -14.638 1.00 . A A . 110 LYS HB2  1 1 
        3  5405 1 1 110 LYS HB3  H  41.021 -22.719 -13.735 1.00 . A A . 110 LYS HB3  1 1 
        3  5406 1 1 110 LYS HD2  H  38.229 -24.103 -16.605 1.00 . A A . 110 LYS HD2  1 1 
        3  5407 1 1 110 LYS HD3  H  37.825 -22.783 -15.498 1.00 . A A . 110 LYS HD3  1 1 
        3  5408 1 1 110 LYS HE2  H  38.142 -21.862 -17.705 1.00 . A A . 110 LYS HE2  1 1 
        3  5409 1 1 110 LYS HE3  H  39.474 -21.346 -16.664 1.00 . A A . 110 LYS HE3  1 1 
        3  5410 1 1 110 LYS HG2  H  40.667 -23.725 -15.826 1.00 . A A . 110 LYS HG2  1 1 
        3  5411 1 1 110 LYS HG3  H  39.547 -24.531 -14.721 1.00 . A A . 110 LYS HG3  1 1 
        3  5412 1 1 110 LYS HZ1  H  39.983 -23.804 -18.085 1.00 . A A . 110 LYS HZ1  1 1 
        3  5413 1 1 110 LYS HZ2  H  40.967 -22.440 -17.893 1.00 . A A . 110 LYS HZ2  1 1 
        3  5414 1 1 110 LYS HZ3  H  39.773 -22.460 -19.092 1.00 . A A . 110 LYS HZ3  1 1 
        3  5415 1 1 110 LYS N    N  38.987 -21.217 -12.382 1.00 . A A . 110 LYS N    1 1 
        3  5416 1 1 110 LYS NZ   N  40.006 -22.766 -18.124 1.00 . A A . 110 LYS NZ   1 1 
        3  5417 1 1 110 LYS O    O  39.969 -23.372 -10.994 1.00 . A A . 110 LYS O    1 1 
        3  5418 1 1 111 VAL C    C  40.630 -26.166 -11.185 1.00 . A A . 111 VAL C    1 1 
        3  5419 1 1 111 VAL CA   C  39.139 -25.978 -11.439 1.00 . A A . 111 VAL CA   1 1 
        3  5420 1 1 111 VAL CB   C  38.560 -27.278 -12.028 1.00 . A A . 111 VAL CB   1 1 
        3  5421 1 1 111 VAL CG1  C  38.769 -28.440 -11.068 1.00 . A A . 111 VAL CG1  1 1 
        3  5422 1 1 111 VAL CG2  C  37.085 -27.103 -12.356 1.00 . A A . 111 VAL CG2  1 1 
        3  5423 1 1 111 VAL H    H  38.395 -24.977 -13.150 1.00 . A A . 111 VAL H    1 1 
        3  5424 1 1 111 VAL HA   H  38.645 -25.783 -10.496 1.00 . A A . 111 VAL HA   1 1 
        3  5425 1 1 111 VAL HB   H  39.087 -27.499 -12.945 1.00 . A A . 111 VAL HB   1 1 
        3  5426 1 1 111 VAL HG11 H  39.801 -28.753 -11.102 1.00 . A A . 111 VAL HG11 1 1 
        3  5427 1 1 111 VAL HG12 H  38.518 -28.127 -10.065 1.00 . A A . 111 VAL HG12 1 1 
        3  5428 1 1 111 VAL HG13 H  38.132 -29.263 -11.358 1.00 . A A . 111 VAL HG13 1 1 
        3  5429 1 1 111 VAL HG21 H  36.617 -26.493 -11.598 1.00 . A A . 111 VAL HG21 1 1 
        3  5430 1 1 111 VAL HG22 H  36.986 -26.623 -13.318 1.00 . A A . 111 VAL HG22 1 1 
        3  5431 1 1 111 VAL HG23 H  36.606 -28.071 -12.386 1.00 . A A . 111 VAL HG23 1 1 
        3  5432 1 1 111 VAL N    N  38.895 -24.840 -12.318 1.00 . A A . 111 VAL N    1 1 
        3  5433 1 1 111 VAL O    O  41.431 -26.196 -12.119 1.00 . A A . 111 VAL O    1 1 
        3  5434 1 1 112 LYS C    C  42.503 -27.326  -8.269 1.00 . A A . 112 LYS C    1 1 
        3  5435 1 1 112 LYS CA   C  42.392 -26.485  -9.537 1.00 . A A . 112 LYS CA   1 1 
        3  5436 1 1 112 LYS CB   C  43.072 -25.131  -9.323 1.00 . A A . 112 LYS CB   1 1 
        3  5437 1 1 112 LYS CD   C  43.192 -23.980  -7.093 1.00 . A A . 112 LYS CD   1 1 
        3  5438 1 1 112 LYS CE   C  42.678 -22.783  -6.307 1.00 . A A . 112 LYS CE   1 1 
        3  5439 1 1 112 LYS CG   C  42.349 -24.237  -8.331 1.00 . A A . 112 LYS CG   1 1 
        3  5440 1 1 112 LYS H    H  40.312 -26.265  -9.214 1.00 . A A . 112 LYS H    1 1 
        3  5441 1 1 112 LYS HA   H  42.888 -27.004 -10.343 1.00 . A A . 112 LYS HA   1 1 
        3  5442 1 1 112 LYS HB2  H  44.086 -25.302  -8.963 1.00 . A A . 112 LYS HB2  1 1 
        3  5443 1 1 112 LYS HB3  H  43.123 -24.613 -10.270 1.00 . A A . 112 LYS HB3  1 1 
        3  5444 1 1 112 LYS HD2  H  43.168 -24.864  -6.455 1.00 . A A . 112 LYS HD2  1 1 
        3  5445 1 1 112 LYS HD3  H  44.213 -23.790  -7.397 1.00 . A A . 112 LYS HD3  1 1 
        3  5446 1 1 112 LYS HE2  H  43.458 -22.022  -6.266 1.00 . A A . 112 LYS HE2  1 1 
        3  5447 1 1 112 LYS HE3  H  41.817 -22.378  -6.817 1.00 . A A . 112 LYS HE3  1 1 
        3  5448 1 1 112 LYS HG2  H  42.118 -23.285  -8.810 1.00 . A A . 112 LYS HG2  1 1 
        3  5449 1 1 112 LYS HG3  H  41.427 -24.716  -8.034 1.00 . A A . 112 LYS HG3  1 1 
        3  5450 1 1 112 LYS HZ1  H  42.176 -22.302  -4.338 1.00 . A A . 112 LYS HZ1  1 1 
        3  5451 1 1 112 LYS HZ2  H  43.026 -23.757  -4.491 1.00 . A A . 112 LYS HZ2  1 1 
        3  5452 1 1 112 LYS HZ3  H  41.393 -23.680  -4.928 1.00 . A A . 112 LYS HZ3  1 1 
        3  5453 1 1 112 LYS N    N  40.997 -26.297  -9.914 1.00 . A A . 112 LYS N    1 1 
        3  5454 1 1 112 LYS NZ   N  42.291 -23.157  -4.918 1.00 . A A . 112 LYS NZ   1 1 
        3  5455 1 1 112 LYS O    O  43.421 -27.144  -7.469 1.00 . A A . 112 LYS O    1 1 
        3  5456 1 1 113 ASN C    C  41.509 -30.587  -7.337 1.00 . A A . 113 ASN C    1 1 
        3  5457 1 1 113 ASN CA   C  41.557 -29.119  -6.923 1.00 . A A . 113 ASN CA   1 1 
        3  5458 1 1 113 ASN CB   C  40.363 -28.792  -6.023 1.00 . A A . 113 ASN CB   1 1 
        3  5459 1 1 113 ASN CG   C  39.124 -28.428  -6.818 1.00 . A A . 113 ASN CG   1 1 
        3  5460 1 1 113 ASN H    H  40.857 -28.347  -8.765 1.00 . A A . 113 ASN H    1 1 
        3  5461 1 1 113 ASN HA   H  42.469 -28.943  -6.372 1.00 . A A . 113 ASN HA   1 1 
        3  5462 1 1 113 ASN HB2  H  40.142 -29.658  -5.400 1.00 . A A . 113 ASN HB2  1 1 
        3  5463 1 1 113 ASN HB3  H  40.619 -27.958  -5.386 1.00 . A A . 113 ASN HB3  1 1 
        3  5464 1 1 113 ASN HD21 H  38.340 -30.221  -6.461 1.00 . A A . 113 ASN HD21 1 1 
        3  5465 1 1 113 ASN HD22 H  37.372 -29.154  -7.415 1.00 . A A . 113 ASN HD22 1 1 
        3  5466 1 1 113 ASN N    N  41.564 -28.249  -8.092 1.00 . A A . 113 ASN N    1 1 
        3  5467 1 1 113 ASN ND2  N  38.183 -29.362  -6.907 1.00 . A A . 113 ASN ND2  1 1 
        3  5468 1 1 113 ASN O    O  40.436 -31.187  -7.412 1.00 . A A . 113 ASN O    1 1 
        3  5469 1 1 113 ASN OD1  O  39.014 -27.322  -7.345 1.00 . A A . 113 ASN OD1  1 1 
        3  5470 1 1 114 LYS C    C  43.060 -33.455  -6.807 1.00 . A A . 114 LYS C    1 1 
        3  5471 1 1 114 LYS CA   C  42.770 -32.559  -8.007 1.00 . A A . 114 LYS CA   1 1 
        3  5472 1 1 114 LYS CB   C  43.862 -32.734  -9.064 1.00 . A A . 114 LYS CB   1 1 
        3  5473 1 1 114 LYS CD   C  44.385 -33.308 -11.453 1.00 . A A . 114 LYS CD   1 1 
        3  5474 1 1 114 LYS CE   C  44.398 -32.495 -12.738 1.00 . A A . 114 LYS CE   1 1 
        3  5475 1 1 114 LYS CG   C  43.329 -32.801 -10.484 1.00 . A A . 114 LYS CG   1 1 
        3  5476 1 1 114 LYS H    H  43.498 -30.631  -7.523 1.00 . A A . 114 LYS H    1 1 
        3  5477 1 1 114 LYS HA   H  41.820 -32.845  -8.432 1.00 . A A . 114 LYS HA   1 1 
        3  5478 1 1 114 LYS HB2  H  44.556 -31.897  -8.991 1.00 . A A . 114 LYS HB2  1 1 
        3  5479 1 1 114 LYS HB3  H  44.400 -33.648  -8.860 1.00 . A A . 114 LYS HB3  1 1 
        3  5480 1 1 114 LYS HD2  H  45.365 -33.244 -10.980 1.00 . A A . 114 LYS HD2  1 1 
        3  5481 1 1 114 LYS HD3  H  44.174 -34.341 -11.693 1.00 . A A . 114 LYS HD3  1 1 
        3  5482 1 1 114 LYS HE2  H  44.155 -31.458 -12.506 1.00 . A A . 114 LYS HE2  1 1 
        3  5483 1 1 114 LYS HE3  H  45.388 -32.538 -13.166 1.00 . A A . 114 LYS HE3  1 1 
        3  5484 1 1 114 LYS HG2  H  42.469 -33.471 -10.511 1.00 . A A . 114 LYS HG2  1 1 
        3  5485 1 1 114 LYS HG3  H  43.017 -31.812 -10.790 1.00 . A A . 114 LYS HG3  1 1 
        3  5486 1 1 114 LYS HZ1  H  42.628 -33.485 -13.245 1.00 . A A . 114 LYS HZ1  1 1 
        3  5487 1 1 114 LYS HZ2  H  43.878 -33.697 -14.365 1.00 . A A . 114 LYS HZ2  1 1 
        3  5488 1 1 114 LYS HZ3  H  43.040 -32.230 -14.303 1.00 . A A . 114 LYS HZ3  1 1 
        3  5489 1 1 114 LYS N    N  42.677 -31.162  -7.602 1.00 . A A . 114 LYS N    1 1 
        3  5490 1 1 114 LYS NZ   N  43.418 -33.013 -13.732 1.00 . A A . 114 LYS NZ   1 1 
        3  5491 1 1 114 LYS O    O  43.530 -33.001  -5.762 1.00 . A A . 114 LYS O    1 1 
        3  5492 1 1 115 PRO C    C  44.486 -35.994  -5.643 1.00 . A A . 115 PRO C    1 1 
        3  5493 1 1 115 PRO CA   C  43.004 -35.743  -5.896 1.00 . A A . 115 PRO CA   1 1 
        3  5494 1 1 115 PRO CB   C  42.331 -37.007  -6.438 1.00 . A A . 115 PRO CB   1 1 
        3  5495 1 1 115 PRO CD   C  42.216 -35.367  -8.173 1.00 . A A . 115 PRO CD   1 1 
        3  5496 1 1 115 PRO CG   C  42.355 -36.843  -7.919 1.00 . A A . 115 PRO CG   1 1 
        3  5497 1 1 115 PRO HA   H  42.527 -35.448  -4.972 1.00 . A A . 115 PRO HA   1 1 
        3  5498 1 1 115 PRO HB2  H  42.898 -37.891  -6.147 1.00 . A A . 115 PRO HB2  1 1 
        3  5499 1 1 115 PRO HB3  H  41.322 -37.071  -6.064 1.00 . A A . 115 PRO HB3  1 1 
        3  5500 1 1 115 PRO HD2  H  42.792 -35.072  -9.051 1.00 . A A . 115 PRO HD2  1 1 
        3  5501 1 1 115 PRO HD3  H  41.176 -35.100  -8.293 1.00 . A A . 115 PRO HD3  1 1 
        3  5502 1 1 115 PRO HG2  H  43.298 -37.208  -8.325 1.00 . A A . 115 PRO HG2  1 1 
        3  5503 1 1 115 PRO HG3  H  41.526 -37.377  -8.360 1.00 . A A . 115 PRO HG3  1 1 
        3  5504 1 1 115 PRO N    N  42.778 -34.757  -6.957 1.00 . A A . 115 PRO N    1 1 
        3  5505 1 1 115 PRO O    O  45.241 -36.299  -6.567 1.00 . A A . 115 PRO O    1 1 
        3  5506 1 1 116 LYS C    C  46.397 -36.551  -2.565 1.00 . A A . 116 LYS C    1 1 
        3  5507 1 1 116 LYS CA   C  46.290 -36.078  -4.011 1.00 . A A . 116 LYS CA   1 1 
        3  5508 1 1 116 LYS CB   C  47.094 -34.789  -4.198 1.00 . A A . 116 LYS CB   1 1 
        3  5509 1 1 116 LYS CD   C  47.844 -32.955  -5.741 1.00 . A A . 116 LYS CD   1 1 
        3  5510 1 1 116 LYS CE   C  48.371 -32.773  -7.156 1.00 . A A . 116 LYS CE   1 1 
        3  5511 1 1 116 LYS CG   C  47.033 -34.233  -5.610 1.00 . A A . 116 LYS CG   1 1 
        3  5512 1 1 116 LYS H    H  44.247 -35.618  -3.694 1.00 . A A . 116 LYS H    1 1 
        3  5513 1 1 116 LYS HA   H  46.694 -36.841  -4.658 1.00 . A A . 116 LYS HA   1 1 
        3  5514 1 1 116 LYS HB2  H  46.711 -34.036  -3.509 1.00 . A A . 116 LYS HB2  1 1 
        3  5515 1 1 116 LYS HB3  H  48.128 -34.986  -3.955 1.00 . A A . 116 LYS HB3  1 1 
        3  5516 1 1 116 LYS HD2  H  47.213 -32.104  -5.483 1.00 . A A . 116 LYS HD2  1 1 
        3  5517 1 1 116 LYS HD3  H  48.679 -32.997  -5.056 1.00 . A A . 116 LYS HD3  1 1 
        3  5518 1 1 116 LYS HE2  H  47.830 -33.440  -7.827 1.00 . A A . 116 LYS HE2  1 1 
        3  5519 1 1 116 LYS HE3  H  48.201 -31.750  -7.460 1.00 . A A . 116 LYS HE3  1 1 
        3  5520 1 1 116 LYS HG2  H  47.424 -34.977  -6.304 1.00 . A A . 116 LYS HG2  1 1 
        3  5521 1 1 116 LYS HG3  H  46.003 -34.023  -5.859 1.00 . A A . 116 LYS HG3  1 1 
        3  5522 1 1 116 LYS HZ1  H  49.997 -34.084  -7.098 1.00 . A A . 116 LYS HZ1  1 1 
        3  5523 1 1 116 LYS HZ2  H  50.348 -32.532  -6.522 1.00 . A A . 116 LYS HZ2  1 1 
        3  5524 1 1 116 LYS HZ3  H  50.189 -32.802  -8.185 1.00 . A A . 116 LYS HZ3  1 1 
        3  5525 1 1 116 LYS N    N  44.897 -35.864  -4.387 1.00 . A A . 116 LYS N    1 1 
        3  5526 1 1 116 LYS NZ   N  49.828 -33.068  -7.246 1.00 . A A . 116 LYS NZ   1 1 
        3  5527 1 1 116 LYS O    O  46.391 -35.746  -1.636 1.00 . A A . 116 LYS O    1 1 
        3  5528 1 1 117 GLY C    C  47.915 -38.063  -0.374 1.00 . A A . 117 GLY C    1 1 
        3  5529 1 1 117 GLY CA   C  46.605 -38.422  -1.047 1.00 . A A . 117 GLY CA   1 1 
        3  5530 1 1 117 GLY H    H  46.496 -38.460  -3.161 1.00 . A A . 117 GLY H    1 1 
        3  5531 1 1 117 GLY HA2  H  45.789 -38.049  -0.446 1.00 . A A . 117 GLY HA2  1 1 
        3  5532 1 1 117 GLY HA3  H  46.530 -39.498  -1.111 1.00 . A A . 117 GLY HA3  1 1 
        3  5533 1 1 117 GLY N    N  46.497 -37.865  -2.383 1.00 . A A . 117 GLY N    1 1 
        3  5534 1 1 117 GLY O    O  48.022 -37.024   0.278 1.00 . A A . 117 GLY O    1 1 
        3  5535 1 1 118 LYS C    C  51.313 -38.672  -0.999 1.00 . A A . 118 LYS C    1 1 
        3  5536 1 1 118 LYS CA   C  50.224 -38.695   0.069 1.00 . A A . 118 LYS CA   1 1 
        3  5537 1 1 118 LYS CB   C  50.532 -39.779   1.103 1.00 . A A . 118 LYS CB   1 1 
        3  5538 1 1 118 LYS CD   C  51.250 -39.499   3.494 1.00 . A A . 118 LYS CD   1 1 
        3  5539 1 1 118 LYS CE   C  51.332 -40.871   4.147 1.00 . A A . 118 LYS CE   1 1 
        3  5540 1 1 118 LYS CG   C  50.093 -39.419   2.512 1.00 . A A . 118 LYS CG   1 1 
        3  5541 1 1 118 LYS H    H  48.767 -39.736  -1.061 1.00 . A A . 118 LYS H    1 1 
        3  5542 1 1 118 LYS HA   H  50.199 -37.736   0.563 1.00 . A A . 118 LYS HA   1 1 
        3  5543 1 1 118 LYS HB2  H  50.029 -40.699   0.805 1.00 . A A . 118 LYS HB2  1 1 
        3  5544 1 1 118 LYS HB3  H  51.598 -39.956   1.115 1.00 . A A . 118 LYS HB3  1 1 
        3  5545 1 1 118 LYS HD2  H  52.182 -39.298   2.966 1.00 . A A . 118 LYS HD2  1 1 
        3  5546 1 1 118 LYS HD3  H  51.111 -38.752   4.263 1.00 . A A . 118 LYS HD3  1 1 
        3  5547 1 1 118 LYS HE2  H  50.323 -41.249   4.311 1.00 . A A . 118 LYS HE2  1 1 
        3  5548 1 1 118 LYS HE3  H  51.856 -41.540   3.481 1.00 . A A . 118 LYS HE3  1 1 
        3  5549 1 1 118 LYS HG2  H  49.693 -38.405   2.514 1.00 . A A . 118 LYS HG2  1 1 
        3  5550 1 1 118 LYS HG3  H  49.318 -40.106   2.825 1.00 . A A . 118 LYS HG3  1 1 
        3  5551 1 1 118 LYS HZ1  H  51.375 -40.907   6.235 1.00 . A A . 118 LYS HZ1  1 1 
        3  5552 1 1 118 LYS HZ2  H  52.563 -39.922   5.542 1.00 . A A . 118 LYS HZ2  1 1 
        3  5553 1 1 118 LYS HZ3  H  52.734 -41.605   5.510 1.00 . A A . 118 LYS HZ3  1 1 
        3  5554 1 1 118 LYS N    N  48.914 -38.926  -0.530 1.00 . A A . 118 LYS N    1 1 
        3  5555 1 1 118 LYS NZ   N  52.052 -40.823   5.450 1.00 . A A . 118 LYS NZ   1 1 
        3  5556 1 1 118 LYS O    O  51.058 -38.966  -2.167 1.00 . A A . 118 LYS O    1 1 
        3  5557 1 1 119 LYS C    C  53.952 -39.637  -2.098 1.00 . A A . 119 LYS C    1 1 
        3  5558 1 1 119 LYS CA   C  53.657 -38.261  -1.511 1.00 . A A . 119 LYS CA   1 1 
        3  5559 1 1 119 LYS CB   C  54.898 -37.723  -0.794 1.00 . A A . 119 LYS CB   1 1 
        3  5560 1 1 119 LYS CD   C  56.508 -37.946   1.120 1.00 . A A . 119 LYS CD   1 1 
        3  5561 1 1 119 LYS CE   C  57.279 -38.987   1.920 1.00 . A A . 119 LYS CE   1 1 
        3  5562 1 1 119 LYS CG   C  55.324 -38.565   0.397 1.00 . A A . 119 LYS CG   1 1 
        3  5563 1 1 119 LYS H    H  52.668 -38.097   0.355 1.00 . A A . 119 LYS H    1 1 
        3  5564 1 1 119 LYS HA   H  53.396 -37.588  -2.313 1.00 . A A . 119 LYS HA   1 1 
        3  5565 1 1 119 LYS HB2  H  55.722 -37.682  -1.506 1.00 . A A . 119 LYS HB2  1 1 
        3  5566 1 1 119 LYS HB3  H  54.691 -36.722  -0.444 1.00 . A A . 119 LYS HB3  1 1 
        3  5567 1 1 119 LYS HD2  H  57.176 -37.491   0.388 1.00 . A A . 119 LYS HD2  1 1 
        3  5568 1 1 119 LYS HD3  H  56.149 -37.181   1.795 1.00 . A A . 119 LYS HD3  1 1 
        3  5569 1 1 119 LYS HE2  H  57.186 -39.955   1.428 1.00 . A A . 119 LYS HE2  1 1 
        3  5570 1 1 119 LYS HE3  H  58.321 -38.702   1.944 1.00 . A A . 119 LYS HE3  1 1 
        3  5571 1 1 119 LYS HG2  H  54.488 -38.653   1.090 1.00 . A A . 119 LYS HG2  1 1 
        3  5572 1 1 119 LYS HG3  H  55.601 -39.549   0.049 1.00 . A A . 119 LYS HG3  1 1 
        3  5573 1 1 119 LYS HZ1  H  57.287 -39.848   3.822 1.00 . A A . 119 LYS HZ1  1 1 
        3  5574 1 1 119 LYS HZ2  H  55.759 -39.331   3.311 1.00 . A A . 119 LYS HZ2  1 1 
        3  5575 1 1 119 LYS HZ3  H  56.909 -38.199   3.819 1.00 . A A . 119 LYS HZ3  1 1 
        3  5576 1 1 119 LYS N    N  52.527 -38.321  -0.590 1.00 . A A . 119 LYS N    1 1 
        3  5577 1 1 119 LYS NZ   N  56.773 -39.099   3.316 1.00 . A A . 119 LYS NZ   1 1 
        3  5578 1 1 119 LYS O    O  54.359 -39.754  -3.254 1.00 . A A . 119 LYS O    1 1 
        3  5579 1 1 120 GLY C    C  53.015 -43.029  -1.172 1.00 . A A . 120 GLY C    1 1 
        3  5580 1 1 120 GLY CA   C  53.994 -42.031  -1.754 1.00 . A A . 120 GLY CA   1 1 
        3  5581 1 1 120 GLY H    H  53.420 -40.522  -0.382 1.00 . A A . 120 GLY H    1 1 
        3  5582 1 1 120 GLY HA2  H  53.918 -42.054  -2.831 1.00 . A A . 120 GLY HA2  1 1 
        3  5583 1 1 120 GLY HA3  H  54.995 -42.317  -1.468 1.00 . A A . 120 GLY HA3  1 1 
        3  5584 1 1 120 GLY N    N  53.745 -40.677  -1.295 1.00 . A A . 120 GLY N    1 1 
        3  5585 1 1 120 GLY O    O  53.331 -44.210  -1.027 1.00 . A A . 120 GLY O    1 1 
        3  5586 1 1 121 LYS C    C  51.172 -43.863   1.145 1.00 . A A . 121 LYS C    1 1 
        3  5587 1 1 121 LYS CA   C  50.789 -43.414  -0.263 1.00 . A A . 121 LYS CA   1 1 
        3  5588 1 1 121 LYS CB   C  50.561 -44.636  -1.156 1.00 . A A . 121 LYS CB   1 1 
        3  5589 1 1 121 LYS CD   C  49.076 -43.746  -2.974 1.00 . A A . 121 LYS CD   1 1 
        3  5590 1 1 121 LYS CE   C  47.629 -43.526  -3.386 1.00 . A A . 121 LYS CE   1 1 
        3  5591 1 1 121 LYS CG   C  49.181 -44.684  -1.782 1.00 . A A . 121 LYS CG   1 1 
        3  5592 1 1 121 LYS H    H  51.626 -41.605  -0.973 1.00 . A A . 121 LYS H    1 1 
        3  5593 1 1 121 LYS HA   H  49.874 -42.844  -0.209 1.00 . A A . 121 LYS HA   1 1 
        3  5594 1 1 121 LYS HB2  H  51.306 -44.630  -1.952 1.00 . A A . 121 LYS HB2  1 1 
        3  5595 1 1 121 LYS HB3  H  50.696 -45.531  -0.563 1.00 . A A . 121 LYS HB3  1 1 
        3  5596 1 1 121 LYS HD2  H  49.523 -42.787  -2.714 1.00 . A A . 121 LYS HD2  1 1 
        3  5597 1 1 121 LYS HD3  H  49.616 -44.174  -3.806 1.00 . A A . 121 LYS HD3  1 1 
        3  5598 1 1 121 LYS HE2  H  47.082 -44.463  -3.279 1.00 . A A . 121 LYS HE2  1 1 
        3  5599 1 1 121 LYS HE3  H  47.191 -42.785  -2.732 1.00 . A A . 121 LYS HE3  1 1 
        3  5600 1 1 121 LYS HG2  H  48.972 -45.702  -2.110 1.00 . A A . 121 LYS HG2  1 1 
        3  5601 1 1 121 LYS HG3  H  48.449 -44.393  -1.042 1.00 . A A . 121 LYS HG3  1 1 
        3  5602 1 1 121 LYS HZ1  H  47.364 -43.865  -5.429 1.00 . A A . 121 LYS HZ1  1 1 
        3  5603 1 1 121 LYS HZ2  H  48.390 -42.567  -5.077 1.00 . A A . 121 LYS HZ2  1 1 
        3  5604 1 1 121 LYS HZ3  H  46.719 -42.398  -4.889 1.00 . A A . 121 LYS HZ3  1 1 
        3  5605 1 1 121 LYS N    N  51.820 -42.555  -0.834 1.00 . A A . 121 LYS N    1 1 
        3  5606 1 1 121 LYS NZ   N  47.517 -43.056  -4.794 1.00 . A A . 121 LYS NZ   1 1 
        3  5607 1 1 121 LYS O    O  50.639 -43.363   2.133 1.00 . A A . 121 LYS O    1 1 
        3  5608 1 1 122 GLY C    C  53.872 -46.033   2.435 1.00 . A A . 122 GLY C    1 1 
        3  5609 1 1 122 GLY CA   C  52.542 -45.309   2.515 1.00 . A A . 122 GLY CA   1 1 
        3  5610 1 1 122 GLY H    H  52.493 -45.174   0.402 1.00 . A A . 122 GLY H    1 1 
        3  5611 1 1 122 GLY HA2  H  52.637 -44.478   3.198 1.00 . A A . 122 GLY HA2  1 1 
        3  5612 1 1 122 GLY HA3  H  51.797 -45.992   2.898 1.00 . A A . 122 GLY HA3  1 1 
        3  5613 1 1 122 GLY N    N  52.103 -44.810   1.225 1.00 . A A . 122 GLY N    1 1 
        3  5614 1 1 122 GLY O    O  54.427 -46.208   1.350 1.00 . A A . 122 GLY O    1 1 
        3  5615 1 1 123 LYS C    C  55.493 -48.613   3.206 1.00 . A A . 123 LYS C    1 1 
        3  5616 1 1 123 LYS CA   C  55.658 -47.162   3.643 1.00 . A A . 123 LYS CA   1 1 
        3  5617 1 1 123 LYS CB   C  56.234 -47.106   5.060 1.00 . A A . 123 LYS CB   1 1 
        3  5618 1 1 123 LYS CD   C  58.243 -46.556   6.463 1.00 . A A . 123 LYS CD   1 1 
        3  5619 1 1 123 LYS CE   C  57.544 -45.929   7.659 1.00 . A A . 123 LYS CE   1 1 
        3  5620 1 1 123 LYS CG   C  57.498 -46.271   5.170 1.00 . A A . 123 LYS CG   1 1 
        3  5621 1 1 123 LYS H    H  53.895 -46.284   4.418 1.00 . A A . 123 LYS H    1 1 
        3  5622 1 1 123 LYS HA   H  56.341 -46.672   2.966 1.00 . A A . 123 LYS HA   1 1 
        3  5623 1 1 123 LYS HB2  H  55.480 -46.689   5.727 1.00 . A A . 123 LYS HB2  1 1 
        3  5624 1 1 123 LYS HB3  H  56.463 -48.112   5.382 1.00 . A A . 123 LYS HB3  1 1 
        3  5625 1 1 123 LYS HD2  H  58.304 -47.634   6.610 1.00 . A A . 123 LYS HD2  1 1 
        3  5626 1 1 123 LYS HD3  H  59.242 -46.151   6.388 1.00 . A A . 123 LYS HD3  1 1 
        3  5627 1 1 123 LYS HE2  H  56.691 -45.348   7.309 1.00 . A A . 123 LYS HE2  1 1 
        3  5628 1 1 123 LYS HE3  H  57.190 -46.718   8.307 1.00 . A A . 123 LYS HE3  1 1 
        3  5629 1 1 123 LYS HG2  H  58.149 -46.496   4.326 1.00 . A A . 123 LYS HG2  1 1 
        3  5630 1 1 123 LYS HG3  H  57.230 -45.224   5.142 1.00 . A A . 123 LYS HG3  1 1 
        3  5631 1 1 123 LYS HZ1  H  59.281 -44.788   7.855 1.00 . A A . 123 LYS HZ1  1 1 
        3  5632 1 1 123 LYS HZ2  H  58.780 -45.524   9.293 1.00 . A A . 123 LYS HZ2  1 1 
        3  5633 1 1 123 LYS HZ3  H  57.956 -44.169   8.706 1.00 . A A . 123 LYS HZ3  1 1 
        3  5634 1 1 123 LYS N    N  54.385 -46.453   3.585 1.00 . A A . 123 LYS N    1 1 
        3  5635 1 1 123 LYS NZ   N  58.454 -45.040   8.432 1.00 . A A . 123 LYS NZ   1 1 
        3  5636 1 1 123 LYS O    O  55.070 -49.463   3.990 1.00 . A A . 123 LYS O    1 1 
        3  5637 1 1 124 GLY C    C  56.757 -51.178   2.010 1.00 . A A . 124 GLY C    1 1 
        3  5638 1 1 124 GLY CA   C  55.712 -50.243   1.433 1.00 . A A . 124 GLY CA   1 1 
        3  5639 1 1 124 GLY H    H  56.162 -48.175   1.371 1.00 . A A . 124 GLY H    1 1 
        3  5640 1 1 124 GLY HA2  H  54.732 -50.626   1.674 1.00 . A A . 124 GLY HA2  1 1 
        3  5641 1 1 124 GLY HA3  H  55.824 -50.217   0.360 1.00 . A A . 124 GLY HA3  1 1 
        3  5642 1 1 124 GLY N    N  55.830 -48.893   1.951 1.00 . A A . 124 GLY N    1 1 
        3  5643 1 1 124 GLY O    O  57.225 -50.982   3.131 1.00 . A A . 124 GLY O    1 1 
        3  5644 1 1 125 ASN C    C  59.463 -52.495   1.936 1.00 . A A . 125 ASN C    1 1 
        3  5645 1 1 125 ASN CA   C  58.118 -53.170   1.686 1.00 . A A . 125 ASN CA   1 1 
        3  5646 1 1 125 ASN CB   C  58.278 -54.278   0.643 1.00 . A A . 125 ASN CB   1 1 
        3  5647 1 1 125 ASN CG   C  56.950 -54.879   0.229 1.00 . A A . 125 ASN CG   1 1 
        3  5648 1 1 125 ASN H    H  56.715 -52.304   0.358 1.00 . A A . 125 ASN H    1 1 
        3  5649 1 1 125 ASN HA   H  57.769 -53.605   2.609 1.00 . A A . 125 ASN HA   1 1 
        3  5650 1 1 125 ASN HB2  H  58.769 -53.866  -0.239 1.00 . A A . 125 ASN HB2  1 1 
        3  5651 1 1 125 ASN HB3  H  58.896 -55.063   1.053 1.00 . A A . 125 ASN HB3  1 1 
        3  5652 1 1 125 ASN HD21 H  57.086 -56.238   1.674 1.00 . A A . 125 ASN HD21 1 1 
        3  5653 1 1 125 ASN HD22 H  55.669 -56.330   0.689 1.00 . A A . 125 ASN HD22 1 1 
        3  5654 1 1 125 ASN N    N  57.123 -52.200   1.243 1.00 . A A . 125 ASN N    1 1 
        3  5655 1 1 125 ASN ND2  N  56.525 -55.922   0.936 1.00 . A A . 125 ASN ND2  1 1 
        3  5656 1 1 125 ASN O    O  60.386 -52.609   1.131 1.00 . A A . 125 ASN O    1 1 
        3  5657 1 1 125 ASN OXT  O  59.627 -51.828   2.956 1.00 . A A . 125 ASN OXT  1 1 
        3  5658 1 1 125 ASN OD1  O  56.312 -54.413  -0.715 1.00 . A A . 125 ASN OD1  1 1 
        4  5659 1 1   1 GLY C    C -85.072  -6.501 -15.310 1.00 . A A .   1 GLY C    1 1 
        4  5660 1 1   1 GLY CA   C -85.524  -5.056 -15.363 1.00 . A A .   1 GLY CA   1 1 
        4  5661 1 1   1 GLY H1   H -87.200  -4.715 -14.338 1.00 . A A .   1 GLY H1   1 1 
        4  5662 1 1   1 GLY H2   H -87.227  -4.121 -15.855 1.00 . A A .   1 GLY H2   1 1 
        4  5663 1 1   1 GLY H3   H -87.539  -5.670 -15.573 1.00 . A A .   1 GLY H3   1 1 
        4  5664 1 1   1 GLY HA2  H -85.174  -4.612 -16.282 1.00 . A A .   1 GLY HA2  1 1 
        4  5665 1 1   1 GLY HA3  H -85.088  -4.523 -14.529 1.00 . A A .   1 GLY HA3  1 1 
        4  5666 1 1   1 GLY N    N -86.968  -4.923 -15.299 1.00 . A A .   1 GLY N    1 1 
        4  5667 1 1   1 GLY O    O -85.292  -7.192 -14.316 1.00 . A A .   1 GLY O    1 1 
        4  5668 1 1   2 SER C    C -82.640  -8.410 -17.223 1.00 . A A .   2 SER C    1 1 
        4  5669 1 1   2 SER CA   C -83.957  -8.335 -16.459 1.00 . A A .   2 SER CA   1 1 
        4  5670 1 1   2 SER CB   C -85.003  -9.227 -17.131 1.00 . A A .   2 SER CB   1 1 
        4  5671 1 1   2 SER H    H -84.291  -6.361 -17.145 1.00 . A A .   2 SER H    1 1 
        4  5672 1 1   2 SER HA   H -83.794  -8.685 -15.450 1.00 . A A .   2 SER HA   1 1 
        4  5673 1 1   2 SER HB2  H -84.698  -9.425 -18.159 1.00 . A A .   2 SER HB2  1 1 
        4  5674 1 1   2 SER HB3  H -85.073 -10.163 -16.595 1.00 . A A .   2 SER HB3  1 1 
        4  5675 1 1   2 SER HG   H -86.957  -9.270 -16.999 1.00 . A A .   2 SER HG   1 1 
        4  5676 1 1   2 SER N    N -84.438  -6.961 -16.384 1.00 . A A .   2 SER N    1 1 
        4  5677 1 1   2 SER O    O -82.590  -8.141 -18.424 1.00 . A A .   2 SER O    1 1 
        4  5678 1 1   2 SER OG   O -86.277  -8.606 -17.134 1.00 . A A .   2 SER OG   1 1 
        4  5679 1 1   3 LYS C    C -79.526 -10.131 -16.628 1.00 . A A .   3 LYS C    1 1 
        4  5680 1 1   3 LYS CA   C -80.255  -8.889 -17.131 1.00 . A A .   3 LYS CA   1 1 
        4  5681 1 1   3 LYS CB   C -79.423  -7.640 -16.832 1.00 . A A .   3 LYS CB   1 1 
        4  5682 1 1   3 LYS CD   C -80.103  -6.033 -15.025 1.00 . A A .   3 LYS CD   1 1 
        4  5683 1 1   3 LYS CE   C -79.367  -4.798 -15.526 1.00 . A A .   3 LYS CE   1 1 
        4  5684 1 1   3 LYS CG   C -79.340  -7.305 -15.352 1.00 . A A .   3 LYS CG   1 1 
        4  5685 1 1   3 LYS H    H -81.677  -8.979 -15.566 1.00 . A A .   3 LYS H    1 1 
        4  5686 1 1   3 LYS HA   H -80.390  -8.974 -18.199 1.00 . A A .   3 LYS HA   1 1 
        4  5687 1 1   3 LYS HB2  H -78.413  -7.793 -17.213 1.00 . A A .   3 LYS HB2  1 1 
        4  5688 1 1   3 LYS HB3  H -79.863  -6.798 -17.346 1.00 . A A .   3 LYS HB3  1 1 
        4  5689 1 1   3 LYS HD2  H -81.087  -6.076 -15.491 1.00 . A A .   3 LYS HD2  1 1 
        4  5690 1 1   3 LYS HD3  H -80.222  -5.959 -13.953 1.00 . A A .   3 LYS HD3  1 1 
        4  5691 1 1   3 LYS HE2  H -79.280  -4.079 -14.711 1.00 . A A .   3 LYS HE2  1 1 
        4  5692 1 1   3 LYS HE3  H -78.377  -5.091 -15.846 1.00 . A A .   3 LYS HE3  1 1 
        4  5693 1 1   3 LYS HG2  H -79.759  -8.130 -14.775 1.00 . A A .   3 LYS HG2  1 1 
        4  5694 1 1   3 LYS HG3  H -78.303  -7.173 -15.079 1.00 . A A .   3 LYS HG3  1 1 
        4  5695 1 1   3 LYS HZ1  H -79.415  -3.569 -17.214 1.00 . A A .   3 LYS HZ1  1 1 
        4  5696 1 1   3 LYS HZ2  H -80.847  -3.554 -16.315 1.00 . A A .   3 LYS HZ2  1 1 
        4  5697 1 1   3 LYS HZ3  H -80.477  -4.882 -17.294 1.00 . A A .   3 LYS HZ3  1 1 
        4  5698 1 1   3 LYS N    N -81.574  -8.777 -16.521 1.00 . A A .   3 LYS N    1 1 
        4  5699 1 1   3 LYS NZ   N -80.075  -4.156 -16.667 1.00 . A A .   3 LYS NZ   1 1 
        4  5700 1 1   3 LYS O    O -80.053 -10.883 -15.810 1.00 . A A .   3 LYS O    1 1 
        4  5701 1 1   4 ASN C    C -76.027 -11.126 -16.663 1.00 . A A .   4 ASN C    1 1 
        4  5702 1 1   4 ASN CA   C -77.507 -11.489 -16.720 1.00 . A A .   4 ASN CA   1 1 
        4  5703 1 1   4 ASN CB   C -77.723 -12.650 -17.691 1.00 . A A .   4 ASN CB   1 1 
        4  5704 1 1   4 ASN CG   C -77.822 -13.987 -16.983 1.00 . A A .   4 ASN CG   1 1 
        4  5705 1 1   4 ASN H    H -77.941  -9.702 -17.769 1.00 . A A .   4 ASN H    1 1 
        4  5706 1 1   4 ASN HA   H -77.831 -11.790 -15.735 1.00 . A A .   4 ASN HA   1 1 
        4  5707 1 1   4 ASN HB2  H -78.643 -12.477 -18.249 1.00 . A A .   4 ASN HB2  1 1 
        4  5708 1 1   4 ASN HB3  H -76.896 -12.691 -18.385 1.00 . A A .   4 ASN HB3  1 1 
        4  5709 1 1   4 ASN HD21 H -79.234 -14.582 -18.249 1.00 . A A .   4 ASN HD21 1 1 
        4  5710 1 1   4 ASN HD22 H -78.789 -15.723 -17.030 1.00 . A A .   4 ASN HD22 1 1 
        4  5711 1 1   4 ASN N    N -78.310 -10.338 -17.121 1.00 . A A .   4 ASN N    1 1 
        4  5712 1 1   4 ASN ND2  N -78.704 -14.851 -17.470 1.00 . A A .   4 ASN ND2  1 1 
        4  5713 1 1   4 ASN O    O -75.572 -10.211 -17.350 1.00 . A A .   4 ASN O    1 1 
        4  5714 1 1   4 ASN OD1  O -77.113 -14.239 -16.009 1.00 . A A .   4 ASN OD1  1 1 
        4  5715 1 1   5 LYS C    C -73.051 -12.887 -15.937 1.00 . A A .   5 LYS C    1 1 
        4  5716 1 1   5 LYS CA   C -73.847 -11.610 -15.694 1.00 . A A .   5 LYS CA   1 1 
        4  5717 1 1   5 LYS CB   C -73.541 -11.064 -14.297 1.00 . A A .   5 LYS CB   1 1 
        4  5718 1 1   5 LYS CD   C -75.105 -11.557 -12.395 1.00 . A A .   5 LYS CD   1 1 
        4  5719 1 1   5 LYS CE   C -75.026 -11.979 -10.936 1.00 . A A .   5 LYS CE   1 1 
        4  5720 1 1   5 LYS CG   C -73.892 -12.029 -13.177 1.00 . A A .   5 LYS CG   1 1 
        4  5721 1 1   5 LYS H    H -75.697 -12.568 -15.319 1.00 . A A .   5 LYS H    1 1 
        4  5722 1 1   5 LYS HA   H -73.557 -10.874 -16.429 1.00 . A A .   5 LYS HA   1 1 
        4  5723 1 1   5 LYS HB2  H -72.478 -10.831 -14.237 1.00 . A A .   5 LYS HB2  1 1 
        4  5724 1 1   5 LYS HB3  H -74.104 -10.154 -14.148 1.00 . A A .   5 LYS HB3  1 1 
        4  5725 1 1   5 LYS HD2  H -75.164 -10.470 -12.449 1.00 . A A .   5 LYS HD2  1 1 
        4  5726 1 1   5 LYS HD3  H -75.995 -11.982 -12.835 1.00 . A A .   5 LYS HD3  1 1 
        4  5727 1 1   5 LYS HE2  H -73.982 -12.152 -10.672 1.00 . A A .   5 LYS HE2  1 1 
        4  5728 1 1   5 LYS HE3  H -75.417 -11.182 -10.321 1.00 . A A .   5 LYS HE3  1 1 
        4  5729 1 1   5 LYS HG2  H -74.102 -13.010 -13.603 1.00 . A A .   5 LYS HG2  1 1 
        4  5730 1 1   5 LYS HG3  H -73.049 -12.107 -12.505 1.00 . A A .   5 LYS HG3  1 1 
        4  5731 1 1   5 LYS HZ1  H -75.171 -13.985 -10.369 1.00 . A A .   5 LYS HZ1  1 1 
        4  5732 1 1   5 LYS HZ2  H -76.301 -13.519 -11.539 1.00 . A A .   5 LYS HZ2  1 1 
        4  5733 1 1   5 LYS HZ3  H -76.509 -13.050  -9.928 1.00 . A A .   5 LYS HZ3  1 1 
        4  5734 1 1   5 LYS N    N -75.277 -11.851 -15.840 1.00 . A A .   5 LYS N    1 1 
        4  5735 1 1   5 LYS NZ   N -75.805 -13.220 -10.674 1.00 . A A .   5 LYS NZ   1 1 
        4  5736 1 1   5 LYS O    O -73.603 -13.988 -15.923 1.00 . A A .   5 LYS O    1 1 
        4  5737 1 1   6 LYS C    C -69.411 -13.490 -16.226 1.00 . A A .   6 LYS C    1 1 
        4  5738 1 1   6 LYS CA   C -70.877 -13.878 -16.402 1.00 . A A .   6 LYS CA   1 1 
        4  5739 1 1   6 LYS CB   C -71.103 -14.429 -17.812 1.00 . A A .   6 LYS CB   1 1 
        4  5740 1 1   6 LYS CD   C -72.487 -13.119 -19.450 1.00 . A A .   6 LYS CD   1 1 
        4  5741 1 1   6 LYS CE   C -72.442 -12.273 -20.712 1.00 . A A .   6 LYS CE   1 1 
        4  5742 1 1   6 LYS CG   C -71.095 -13.360 -18.891 1.00 . A A .   6 LYS CG   1 1 
        4  5743 1 1   6 LYS H    H -71.367 -11.833 -16.158 1.00 . A A .   6 LYS H    1 1 
        4  5744 1 1   6 LYS HA   H -71.122 -14.643 -15.681 1.00 . A A .   6 LYS HA   1 1 
        4  5745 1 1   6 LYS HB2  H -70.322 -15.155 -18.033 1.00 . A A .   6 LYS HB2  1 1 
        4  5746 1 1   6 LYS HB3  H -72.060 -14.930 -17.839 1.00 . A A .   6 LYS HB3  1 1 
        4  5747 1 1   6 LYS HD2  H -72.950 -14.079 -19.680 1.00 . A A .   6 LYS HD2  1 1 
        4  5748 1 1   6 LYS HD3  H -73.080 -12.609 -18.705 1.00 . A A .   6 LYS HD3  1 1 
        4  5749 1 1   6 LYS HE2  H -71.700 -12.688 -21.394 1.00 . A A .   6 LYS HE2  1 1 
        4  5750 1 1   6 LYS HE3  H -73.413 -12.306 -21.186 1.00 . A A .   6 LYS HE3  1 1 
        4  5751 1 1   6 LYS HG2  H -70.714 -12.430 -18.469 1.00 . A A .   6 LYS HG2  1 1 
        4  5752 1 1   6 LYS HG3  H -70.444 -13.676 -19.694 1.00 . A A .   6 LYS HG3  1 1 
        4  5753 1 1   6 LYS HZ1  H -72.634 -10.219 -21.039 1.00 . A A .   6 LYS HZ1  1 1 
        4  5754 1 1   6 LYS HZ2  H -71.078 -10.698 -20.576 1.00 . A A .   6 LYS HZ2  1 1 
        4  5755 1 1   6 LYS HZ3  H -72.321 -10.630 -19.430 1.00 . A A .   6 LYS HZ3  1 1 
        4  5756 1 1   6 LYS N    N -71.749 -12.736 -16.159 1.00 . A A .   6 LYS N    1 1 
        4  5757 1 1   6 LYS NZ   N -72.094 -10.855 -20.419 1.00 . A A .   6 LYS NZ   1 1 
        4  5758 1 1   6 LYS O    O -68.871 -12.704 -17.005 1.00 . A A .   6 LYS O    1 1 
        4  5759 1 1   7 GLU C    C -66.551 -15.044 -14.880 1.00 . A A .   7 GLU C    1 1 
        4  5760 1 1   7 GLU CA   C -67.372 -13.758 -14.925 1.00 . A A .   7 GLU CA   1 1 
        4  5761 1 1   7 GLU CB   C -67.235 -13.006 -13.601 1.00 . A A .   7 GLU CB   1 1 
        4  5762 1 1   7 GLU CD   C -68.999 -11.218 -13.325 1.00 . A A .   7 GLU CD   1 1 
        4  5763 1 1   7 GLU CG   C -67.562 -11.525 -13.704 1.00 . A A .   7 GLU CG   1 1 
        4  5764 1 1   7 GLU H    H -69.261 -14.666 -14.616 1.00 . A A .   7 GLU H    1 1 
        4  5765 1 1   7 GLU HA   H -66.999 -13.135 -15.724 1.00 . A A .   7 GLU HA   1 1 
        4  5766 1 1   7 GLU HB2  H -67.903 -13.461 -12.870 1.00 . A A .   7 GLU HB2  1 1 
        4  5767 1 1   7 GLU HB3  H -66.219 -13.104 -13.249 1.00 . A A .   7 GLU HB3  1 1 
        4  5768 1 1   7 GLU HG2  H -66.895 -10.969 -13.046 1.00 . A A .   7 GLU HG2  1 1 
        4  5769 1 1   7 GLU HG3  H -67.398 -11.204 -14.722 1.00 . A A .   7 GLU HG3  1 1 
        4  5770 1 1   7 GLU N    N -68.775 -14.046 -15.201 1.00 . A A .   7 GLU N    1 1 
        4  5771 1 1   7 GLU O    O -66.922 -16.009 -14.212 1.00 . A A .   7 GLU O    1 1 
        4  5772 1 1   7 GLU OE1  O -69.489 -11.806 -12.338 1.00 . A A .   7 GLU OE1  1 1 
        4  5773 1 1   7 GLU OE2  O -69.631 -10.391 -14.015 1.00 . A A .   7 GLU OE2  1 1 
        4  5774 1 1   8 LYS C    C -63.260 -15.893 -16.376 1.00 . A A .   8 LYS C    1 1 
        4  5775 1 1   8 LYS CA   C -64.557 -16.214 -15.640 1.00 . A A .   8 LYS CA   1 1 
        4  5776 1 1   8 LYS CB   C -65.265 -17.387 -16.322 1.00 . A A .   8 LYS CB   1 1 
        4  5777 1 1   8 LYS CD   C -66.501 -18.183 -18.359 1.00 . A A .   8 LYS CD   1 1 
        4  5778 1 1   8 LYS CE   C -66.081 -18.667 -19.738 1.00 . A A .   8 LYS CE   1 1 
        4  5779 1 1   8 LYS CG   C -65.518 -17.166 -17.803 1.00 . A A .   8 LYS CG   1 1 
        4  5780 1 1   8 LYS H    H -65.189 -14.249 -16.109 1.00 . A A .   8 LYS H    1 1 
        4  5781 1 1   8 LYS HA   H -64.321 -16.489 -14.623 1.00 . A A .   8 LYS HA   1 1 
        4  5782 1 1   8 LYS HB2  H -64.655 -18.282 -16.200 1.00 . A A .   8 LYS HB2  1 1 
        4  5783 1 1   8 LYS HB3  H -66.218 -17.547 -15.836 1.00 . A A .   8 LYS HB3  1 1 
        4  5784 1 1   8 LYS HD2  H -66.554 -19.035 -17.681 1.00 . A A .   8 LYS HD2  1 1 
        4  5785 1 1   8 LYS HD3  H -67.478 -17.725 -18.428 1.00 . A A .   8 LYS HD3  1 1 
        4  5786 1 1   8 LYS HE2  H -66.837 -19.355 -20.118 1.00 . A A .   8 LYS HE2  1 1 
        4  5787 1 1   8 LYS HE3  H -66.016 -17.816 -20.399 1.00 . A A .   8 LYS HE3  1 1 
        4  5788 1 1   8 LYS HG2  H -65.918 -16.163 -17.952 1.00 . A A .   8 LYS HG2  1 1 
        4  5789 1 1   8 LYS HG3  H -64.581 -17.256 -18.335 1.00 . A A .   8 LYS HG3  1 1 
        4  5790 1 1   8 LYS HZ1  H -64.864 -20.333 -20.064 1.00 . A A .   8 LYS HZ1  1 1 
        4  5791 1 1   8 LYS HZ2  H -64.403 -19.396 -18.731 1.00 . A A .   8 LYS HZ2  1 1 
        4  5792 1 1   8 LYS HZ3  H -64.079 -18.852 -20.300 1.00 . A A .   8 LYS HZ3  1 1 
        4  5793 1 1   8 LYS N    N -65.432 -15.050 -15.597 1.00 . A A .   8 LYS N    1 1 
        4  5794 1 1   8 LYS NZ   N -64.764 -19.361 -19.706 1.00 . A A .   8 LYS NZ   1 1 
        4  5795 1 1   8 LYS O    O -63.277 -15.294 -17.450 1.00 . A A .   8 LYS O    1 1 
        4  5796 1 1   9 ASN C    C -59.739 -16.814 -15.649 1.00 . A A .   9 ASN C    1 1 
        4  5797 1 1   9 ASN CA   C -60.831 -16.053 -16.393 1.00 . A A .   9 ASN CA   1 1 
        4  5798 1 1   9 ASN CB   C -60.517 -14.556 -16.392 1.00 . A A .   9 ASN CB   1 1 
        4  5799 1 1   9 ASN CG   C -60.984 -13.868 -15.124 1.00 . A A .   9 ASN CG   1 1 
        4  5800 1 1   9 ASN H    H -62.187 -16.772 -14.935 1.00 . A A .   9 ASN H    1 1 
        4  5801 1 1   9 ASN HA   H -60.866 -16.404 -17.414 1.00 . A A .   9 ASN HA   1 1 
        4  5802 1 1   9 ASN HB2  H -59.440 -14.421 -16.491 1.00 . A A .   9 ASN HB2  1 1 
        4  5803 1 1   9 ASN HB3  H -61.008 -14.090 -17.233 1.00 . A A .   9 ASN HB3  1 1 
        4  5804 1 1   9 ASN HD21 H -61.300 -12.179 -16.125 1.00 . A A .   9 ASN HD21 1 1 
        4  5805 1 1   9 ASN HD22 H -61.657 -12.129 -14.435 1.00 . A A .   9 ASN HD22 1 1 
        4  5806 1 1   9 ASN N    N -62.137 -16.298 -15.791 1.00 . A A .   9 ASN N    1 1 
        4  5807 1 1   9 ASN ND2  N -61.351 -12.597 -15.240 1.00 . A A .   9 ASN ND2  1 1 
        4  5808 1 1   9 ASN O    O -59.996 -17.451 -14.627 1.00 . A A .   9 ASN O    1 1 
        4  5809 1 1   9 ASN OD1  O -61.016 -14.473 -14.052 1.00 . A A .   9 ASN OD1  1 1 
        4  5810 1 1  10 LYS C    C -56.082 -17.060 -16.261 1.00 . A A .  10 LYS C    1 1 
        4  5811 1 1  10 LYS CA   C -57.382 -17.419 -15.551 1.00 . A A .  10 LYS CA   1 1 
        4  5812 1 1  10 LYS CB   C -57.591 -18.935 -15.581 1.00 . A A .  10 LYS CB   1 1 
        4  5813 1 1  10 LYS CD   C -59.269 -20.339 -14.347 1.00 . A A .  10 LYS CD   1 1 
        4  5814 1 1  10 LYS CE   C -60.003 -20.403 -13.016 1.00 . A A .  10 LYS CE   1 1 
        4  5815 1 1  10 LYS CG   C -57.993 -19.522 -14.238 1.00 . A A .  10 LYS CG   1 1 
        4  5816 1 1  10 LYS H    H -58.374 -16.216 -16.983 1.00 . A A .  10 LYS H    1 1 
        4  5817 1 1  10 LYS HA   H -57.318 -17.095 -14.523 1.00 . A A .  10 LYS HA   1 1 
        4  5818 1 1  10 LYS HB2  H -58.368 -19.166 -16.309 1.00 . A A .  10 LYS HB2  1 1 
        4  5819 1 1  10 LYS HB3  H -56.671 -19.408 -15.895 1.00 . A A .  10 LYS HB3  1 1 
        4  5820 1 1  10 LYS HD2  H -59.921 -19.886 -15.093 1.00 . A A .  10 LYS HD2  1 1 
        4  5821 1 1  10 LYS HD3  H -59.017 -21.342 -14.658 1.00 . A A .  10 LYS HD3  1 1 
        4  5822 1 1  10 LYS HE2  H -59.347 -20.848 -12.269 1.00 . A A .  10 LYS HE2  1 1 
        4  5823 1 1  10 LYS HE3  H -60.256 -19.399 -12.711 1.00 . A A .  10 LYS HE3  1 1 
        4  5824 1 1  10 LYS HG2  H -57.189 -20.162 -13.873 1.00 . A A .  10 LYS HG2  1 1 
        4  5825 1 1  10 LYS HG3  H -58.150 -18.715 -13.536 1.00 . A A .  10 LYS HG3  1 1 
        4  5826 1 1  10 LYS HZ1  H -61.455 -21.662 -12.197 1.00 . A A .  10 LYS HZ1  1 1 
        4  5827 1 1  10 LYS HZ2  H -61.147 -21.946 -13.837 1.00 . A A .  10 LYS HZ2  1 1 
        4  5828 1 1  10 LYS HZ3  H -62.053 -20.598 -13.367 1.00 . A A .  10 LYS HZ3  1 1 
        4  5829 1 1  10 LYS N    N -58.516 -16.741 -16.166 1.00 . A A .  10 LYS N    1 1 
        4  5830 1 1  10 LYS NZ   N -61.253 -21.209 -13.111 1.00 . A A .  10 LYS NZ   1 1 
        4  5831 1 1  10 LYS O    O -56.077 -16.761 -17.455 1.00 . A A .  10 LYS O    1 1 
        4  5832 1 1  11 GLY C    C -52.554 -16.904 -15.099 1.00 . A A .  11 GLY C    1 1 
        4  5833 1 1  11 GLY CA   C -53.686 -16.770 -16.099 1.00 . A A .  11 GLY CA   1 1 
        4  5834 1 1  11 GLY H    H -55.042 -17.338 -14.574 1.00 . A A .  11 GLY H    1 1 
        4  5835 1 1  11 GLY HA2  H -53.500 -17.434 -16.929 1.00 . A A .  11 GLY HA2  1 1 
        4  5836 1 1  11 GLY HA3  H -53.712 -15.754 -16.463 1.00 . A A .  11 GLY HA3  1 1 
        4  5837 1 1  11 GLY N    N -54.978 -17.093 -15.520 1.00 . A A .  11 GLY N    1 1 
        4  5838 1 1  11 GLY O    O -52.773 -17.296 -13.954 1.00 . A A .  11 GLY O    1 1 
        4  5839 1 1  12 GLY C    C -48.894 -16.872 -15.420 1.00 . A A .  12 GLY C    1 1 
        4  5840 1 1  12 GLY CA   C -50.189 -16.672 -14.658 1.00 . A A .  12 GLY CA   1 1 
        4  5841 1 1  12 GLY H    H -51.227 -16.271 -16.458 1.00 . A A .  12 GLY H    1 1 
        4  5842 1 1  12 GLY HA2  H -50.116 -15.764 -14.078 1.00 . A A .  12 GLY HA2  1 1 
        4  5843 1 1  12 GLY HA3  H -50.330 -17.506 -13.986 1.00 . A A .  12 GLY HA3  1 1 
        4  5844 1 1  12 GLY N    N -51.342 -16.579 -15.534 1.00 . A A .  12 GLY N    1 1 
        4  5845 1 1  12 GLY O    O -48.898 -16.975 -16.647 1.00 . A A .  12 GLY O    1 1 
        4  5846 1 1  13 LYS C    C -45.408 -17.374 -14.250 1.00 . A A .  13 LYS C    1 1 
        4  5847 1 1  13 LYS CA   C -46.475 -17.114 -15.309 1.00 . A A .  13 LYS CA   1 1 
        4  5848 1 1  13 LYS CB   C -46.096 -15.884 -16.138 1.00 . A A .  13 LYS CB   1 1 
        4  5849 1 1  13 LYS CD   C -46.377 -16.279 -18.602 1.00 . A A .  13 LYS CD   1 1 
        4  5850 1 1  13 LYS CE   C -46.830 -17.705 -18.880 1.00 . A A .  13 LYS CE   1 1 
        4  5851 1 1  13 LYS CG   C -45.397 -16.223 -17.443 1.00 . A A .  13 LYS CG   1 1 
        4  5852 1 1  13 LYS H    H -47.845 -16.837 -13.719 1.00 . A A .  13 LYS H    1 1 
        4  5853 1 1  13 LYS HA   H -46.534 -17.972 -15.961 1.00 . A A .  13 LYS HA   1 1 
        4  5854 1 1  13 LYS HB2  H -47.003 -15.322 -16.363 1.00 . A A .  13 LYS HB2  1 1 
        4  5855 1 1  13 LYS HB3  H -45.437 -15.258 -15.553 1.00 . A A .  13 LYS HB3  1 1 
        4  5856 1 1  13 LYS HD2  H -47.248 -15.668 -18.364 1.00 . A A .  13 LYS HD2  1 1 
        4  5857 1 1  13 LYS HD3  H -45.898 -15.884 -19.487 1.00 . A A .  13 LYS HD3  1 1 
        4  5858 1 1  13 LYS HE2  H -46.492 -18.350 -18.069 1.00 . A A .  13 LYS HE2  1 1 
        4  5859 1 1  13 LYS HE3  H -47.909 -17.725 -18.921 1.00 . A A .  13 LYS HE3  1 1 
        4  5860 1 1  13 LYS HG2  H -44.642 -15.464 -17.650 1.00 . A A .  13 LYS HG2  1 1 
        4  5861 1 1  13 LYS HG3  H -44.915 -17.184 -17.344 1.00 . A A .  13 LYS HG3  1 1 
        4  5862 1 1  13 LYS HZ1  H -45.269 -18.012 -20.234 1.00 . A A .  13 LYS HZ1  1 1 
        4  5863 1 1  13 LYS HZ2  H -46.773 -17.764 -20.967 1.00 . A A .  13 LYS HZ2  1 1 
        4  5864 1 1  13 LYS HZ3  H -46.426 -19.246 -20.232 1.00 . A A .  13 LYS HZ3  1 1 
        4  5865 1 1  13 LYS N    N -47.783 -16.925 -14.694 1.00 . A A .  13 LYS N    1 1 
        4  5866 1 1  13 LYS NZ   N -46.286 -18.218 -20.169 1.00 . A A .  13 LYS NZ   1 1 
        4  5867 1 1  13 LYS O    O -45.683 -17.317 -13.052 1.00 . A A .  13 LYS O    1 1 
        4  5868 1 1  14 GLY C    C -41.750 -17.544 -14.354 1.00 . A A .  14 GLY C    1 1 
        4  5869 1 1  14 GLY CA   C -43.100 -17.920 -13.778 1.00 . A A .  14 GLY CA   1 1 
        4  5870 1 1  14 GLY H    H -44.029 -17.688 -15.667 1.00 . A A .  14 GLY H    1 1 
        4  5871 1 1  14 GLY HA2  H -43.264 -17.355 -12.873 1.00 . A A .  14 GLY HA2  1 1 
        4  5872 1 1  14 GLY HA3  H -43.095 -18.973 -13.537 1.00 . A A .  14 GLY HA3  1 1 
        4  5873 1 1  14 GLY N    N -44.190 -17.657 -14.701 1.00 . A A .  14 GLY N    1 1 
        4  5874 1 1  14 GLY O    O -41.579 -17.490 -15.571 1.00 . A A .  14 GLY O    1 1 
        4  5875 1 1  15 GLY C    C -38.493 -18.078 -13.912 1.00 . A A .  15 GLY C    1 1 
        4  5876 1 1  15 GLY CA   C -39.457 -16.908 -13.924 1.00 . A A .  15 GLY CA   1 1 
        4  5877 1 1  15 GLY H    H -40.979 -17.339 -12.517 1.00 . A A .  15 GLY H    1 1 
        4  5878 1 1  15 GLY HA2  H -39.522 -16.519 -14.928 1.00 . A A .  15 GLY HA2  1 1 
        4  5879 1 1  15 GLY HA3  H -39.074 -16.136 -13.273 1.00 . A A .  15 GLY HA3  1 1 
        4  5880 1 1  15 GLY N    N -40.786 -17.280 -13.477 1.00 . A A .  15 GLY N    1 1 
        4  5881 1 1  15 GLY O    O -38.788 -19.129 -13.344 1.00 . A A .  15 GLY O    1 1 
        4  5882 1 1  16 ALA C    C -35.019 -18.417 -15.184 1.00 . A A .  16 ALA C    1 1 
        4  5883 1 1  16 ALA CA   C -36.327 -18.945 -14.604 1.00 . A A .  16 ALA CA   1 1 
        4  5884 1 1  16 ALA CB   C -36.834 -20.121 -15.426 1.00 . A A .  16 ALA CB   1 1 
        4  5885 1 1  16 ALA H    H -37.159 -17.037 -14.977 1.00 . A A .  16 ALA H    1 1 
        4  5886 1 1  16 ALA HA   H -36.147 -19.294 -13.596 1.00 . A A .  16 ALA HA   1 1 
        4  5887 1 1  16 ALA HB1  H -37.906 -20.043 -15.539 1.00 . A A .  16 ALA HB1  1 1 
        4  5888 1 1  16 ALA HB2  H -36.367 -20.108 -16.399 1.00 . A A .  16 ALA HB2  1 1 
        4  5889 1 1  16 ALA HB3  H -36.591 -21.044 -14.920 1.00 . A A .  16 ALA HB3  1 1 
        4  5890 1 1  16 ALA N    N -37.337 -17.897 -14.543 1.00 . A A .  16 ALA N    1 1 
        4  5891 1 1  16 ALA O    O -35.015 -17.451 -15.948 1.00 . A A .  16 ALA O    1 1 
        4  5892 1 1  17 ASP C    C -32.271 -17.226 -14.852 1.00 . A A .  17 ASP C    1 1 
        4  5893 1 1  17 ASP CA   C -32.600 -18.646 -15.301 1.00 . A A .  17 ASP CA   1 1 
        4  5894 1 1  17 ASP CB   C -32.545 -18.738 -16.826 1.00 . A A .  17 ASP CB   1 1 
        4  5895 1 1  17 ASP CG   C -31.165 -18.436 -17.375 1.00 . A A .  17 ASP CG   1 1 
        4  5896 1 1  17 ASP H    H -33.982 -19.816 -14.203 1.00 . A A .  17 ASP H    1 1 
        4  5897 1 1  17 ASP HA   H -31.868 -19.319 -14.882 1.00 . A A .  17 ASP HA   1 1 
        4  5898 1 1  17 ASP HB2  H -32.832 -19.745 -17.130 1.00 . A A .  17 ASP HB2  1 1 
        4  5899 1 1  17 ASP HB3  H -33.244 -18.032 -17.248 1.00 . A A .  17 ASP HB3  1 1 
        4  5900 1 1  17 ASP N    N -33.914 -19.052 -14.815 1.00 . A A .  17 ASP N    1 1 
        4  5901 1 1  17 ASP O    O -33.158 -16.465 -14.462 1.00 . A A .  17 ASP O    1 1 
        4  5902 1 1  17 ASP OD1  O -30.223 -19.197 -17.069 1.00 . A A .  17 ASP OD1  1 1 
        4  5903 1 1  17 ASP OD2  O -31.026 -17.436 -18.111 1.00 . A A .  17 ASP OD2  1 1 
        4  5904 1 1  18 CYS C    C -29.626 -14.938 -15.566 1.00 . A A .  18 CYS C    1 1 
        4  5905 1 1  18 CYS CA   C -30.543 -15.546 -14.509 1.00 . A A .  18 CYS CA   1 1 
        4  5906 1 1  18 CYS CB   C -29.816 -15.613 -13.163 1.00 . A A .  18 CYS CB   1 1 
        4  5907 1 1  18 CYS H    H -30.330 -17.524 -15.229 1.00 . A A .  18 CYS H    1 1 
        4  5908 1 1  18 CYS HA   H -31.416 -14.919 -14.405 1.00 . A A .  18 CYS HA   1 1 
        4  5909 1 1  18 CYS HB2  H -29.760 -16.656 -12.850 1.00 . A A .  18 CYS HB2  1 1 
        4  5910 1 1  18 CYS HB3  H -28.812 -15.237 -13.287 1.00 . A A .  18 CYS HB3  1 1 
        4  5911 1 1  18 CYS HG   H -31.940 -14.764 -11.941 1.00 . A A .  18 CYS HG   1 1 
        4  5912 1 1  18 CYS N    N -30.990 -16.874 -14.909 1.00 . A A .  18 CYS N    1 1 
        4  5913 1 1  18 CYS O    O -28.712 -15.598 -16.061 1.00 . A A .  18 CYS O    1 1 
        4  5914 1 1  18 CYS SG   S -30.613 -14.650 -11.838 1.00 . A A .  18 CYS SG   1 1 
        4  5915 1 1  19 ALA C    C -27.583 -13.092 -16.580 1.00 . A A .  19 ALA C    1 1 
        4  5916 1 1  19 ALA CA   C -29.071 -12.981 -16.901 1.00 . A A .  19 ALA CA   1 1 
        4  5917 1 1  19 ALA CB   C -29.486 -11.520 -16.986 1.00 . A A .  19 ALA CB   1 1 
        4  5918 1 1  19 ALA H    H -30.617 -13.205 -15.474 1.00 . A A .  19 ALA H    1 1 
        4  5919 1 1  19 ALA HA   H -29.257 -13.440 -17.860 1.00 . A A .  19 ALA HA   1 1 
        4  5920 1 1  19 ALA HB1  H -29.621 -11.125 -15.988 1.00 . A A .  19 ALA HB1  1 1 
        4  5921 1 1  19 ALA HB2  H -28.718 -10.957 -17.494 1.00 . A A .  19 ALA HB2  1 1 
        4  5922 1 1  19 ALA HB3  H -30.413 -11.441 -17.533 1.00 . A A .  19 ALA HB3  1 1 
        4  5923 1 1  19 ALA N    N -29.875 -13.678 -15.904 1.00 . A A .  19 ALA N    1 1 
        4  5924 1 1  19 ALA O    O -26.858 -13.858 -17.215 1.00 . A A .  19 ALA O    1 1 
        4  5925 1 1  20 GLU C    C -25.525 -13.239 -13.978 1.00 . A A .  20 GLU C    1 1 
        4  5926 1 1  20 GLU CA   C -25.735 -12.336 -15.190 1.00 . A A .  20 GLU CA   1 1 
        4  5927 1 1  20 GLU CB   C -25.260 -10.917 -14.870 1.00 . A A .  20 GLU CB   1 1 
        4  5928 1 1  20 GLU CD   C -23.302  -9.759 -15.968 1.00 . A A .  20 GLU CD   1 1 
        4  5929 1 1  20 GLU CG   C -23.750 -10.755 -14.916 1.00 . A A .  20 GLU CG   1 1 
        4  5930 1 1  20 GLU H    H -27.763 -11.734 -15.122 1.00 . A A .  20 GLU H    1 1 
        4  5931 1 1  20 GLU HA   H -25.156 -12.722 -16.015 1.00 . A A .  20 GLU HA   1 1 
        4  5932 1 1  20 GLU HB2  H -25.707 -10.229 -15.588 1.00 . A A .  20 GLU HB2  1 1 
        4  5933 1 1  20 GLU HB3  H -25.598 -10.652 -13.880 1.00 . A A .  20 GLU HB3  1 1 
        4  5934 1 1  20 GLU HG2  H -23.401 -10.420 -13.940 1.00 . A A .  20 GLU HG2  1 1 
        4  5935 1 1  20 GLU HG3  H -23.304 -11.715 -15.137 1.00 . A A .  20 GLU HG3  1 1 
        4  5936 1 1  20 GLU N    N -27.136 -12.324 -15.591 1.00 . A A .  20 GLU N    1 1 
        4  5937 1 1  20 GLU O    O -25.732 -12.824 -12.837 1.00 . A A .  20 GLU O    1 1 
        4  5938 1 1  20 GLU OE1  O -23.636  -8.564 -15.833 1.00 . A A .  20 GLU OE1  1 1 
        4  5939 1 1  20 GLU OE2  O -22.619 -10.175 -16.927 1.00 . A A .  20 GLU OE2  1 1 
        4  5940 1 1  21 TRP C    C -23.698 -15.009 -12.298 1.00 . A A .  21 TRP C    1 1 
        4  5941 1 1  21 TRP CA   C -24.876 -15.438 -13.163 1.00 . A A .  21 TRP CA   1 1 
        4  5942 1 1  21 TRP CB   C -24.615 -16.827 -13.748 1.00 . A A .  21 TRP CB   1 1 
        4  5943 1 1  21 TRP CD1  C -26.215 -17.664 -15.568 1.00 . A A .  21 TRP CD1  1 1 
        4  5944 1 1  21 TRP CD2  C -26.895 -18.090 -13.477 1.00 . A A .  21 TRP CD2  1 1 
        4  5945 1 1  21 TRP CE2  C -27.855 -18.597 -14.374 1.00 . A A .  21 TRP CE2  1 1 
        4  5946 1 1  21 TRP CE3  C -27.109 -18.244 -12.105 1.00 . A A .  21 TRP CE3  1 1 
        4  5947 1 1  21 TRP CG   C -25.854 -17.499 -14.261 1.00 . A A .  21 TRP CG   1 1 
        4  5948 1 1  21 TRP CH2  C -29.193 -19.380 -12.592 1.00 . A A .  21 TRP CH2  1 1 
        4  5949 1 1  21 TRP CZ2  C -29.010 -19.244 -13.941 1.00 . A A .  21 TRP CZ2  1 1 
        4  5950 1 1  21 TRP CZ3  C -28.255 -18.887 -11.676 1.00 . A A .  21 TRP CZ3  1 1 
        4  5951 1 1  21 TRP H    H -24.967 -14.748 -15.163 1.00 . A A .  21 TRP H    1 1 
        4  5952 1 1  21 TRP HA   H -25.764 -15.477 -12.551 1.00 . A A .  21 TRP HA   1 1 
        4  5953 1 1  21 TRP HB2  H -23.902 -16.736 -14.567 1.00 . A A .  21 TRP HB2  1 1 
        4  5954 1 1  21 TRP HB3  H -24.188 -17.458 -12.982 1.00 . A A .  21 TRP HB3  1 1 
        4  5955 1 1  21 TRP HD1  H -25.632 -17.319 -16.408 1.00 . A A .  21 TRP HD1  1 1 
        4  5956 1 1  21 TRP HE1  H -27.886 -18.560 -16.471 1.00 . A A .  21 TRP HE1  1 1 
        4  5957 1 1  21 TRP HE3  H -26.396 -17.871 -11.383 1.00 . A A .  21 TRP HE3  1 1 
        4  5958 1 1  21 TRP HH2  H -30.075 -19.874 -12.213 1.00 . A A .  21 TRP HH2  1 1 
        4  5959 1 1  21 TRP HZ2  H -29.743 -19.631 -14.635 1.00 . A A .  21 TRP HZ2  1 1 
        4  5960 1 1  21 TRP HZ3  H -28.438 -19.014 -10.620 1.00 . A A .  21 TRP HZ3  1 1 
        4  5961 1 1  21 TRP N    N -25.113 -14.476 -14.234 1.00 . A A .  21 TRP N    1 1 
        4  5962 1 1  21 TRP NE1  N -27.419 -18.324 -15.643 1.00 . A A .  21 TRP NE1  1 1 
        4  5963 1 1  21 TRP O    O -22.584 -14.829 -12.791 1.00 . A A .  21 TRP O    1 1 
        4  5964 1 1  22 LEU C    C -22.476 -15.608  -9.187 1.00 . A A .  22 LEU C    1 1 
        4  5965 1 1  22 LEU CA   C -22.908 -14.439 -10.066 1.00 . A A .  22 LEU CA   1 1 
        4  5966 1 1  22 LEU CB   C -23.403 -13.286  -9.192 1.00 . A A .  22 LEU CB   1 1 
        4  5967 1 1  22 LEU CD1  C -24.960 -13.044  -7.243 1.00 . A A .  22 LEU CD1  1 1 
        4  5968 1 1  22 LEU CD2  C -25.739 -12.446  -9.543 1.00 . A A .  22 LEU CD2  1 1 
        4  5969 1 1  22 LEU CG   C -24.856 -13.375  -8.723 1.00 . A A .  22 LEU CG   1 1 
        4  5970 1 1  22 LEU H    H -24.856 -15.006 -10.669 1.00 . A A .  22 LEU H    1 1 
        4  5971 1 1  22 LEU HA   H -22.057 -14.104 -10.642 1.00 . A A .  22 LEU HA   1 1 
        4  5972 1 1  22 LEU HB2  H -22.763 -13.223  -8.312 1.00 . A A .  22 LEU HB2  1 1 
        4  5973 1 1  22 LEU HB3  H -23.293 -12.372  -9.759 1.00 . A A .  22 LEU HB3  1 1 
        4  5974 1 1  22 LEU HD11 H -25.999 -12.927  -6.972 1.00 . A A .  22 LEU HD11 1 1 
        4  5975 1 1  22 LEU HD12 H -24.430 -12.124  -7.042 1.00 . A A .  22 LEU HD12 1 1 
        4  5976 1 1  22 LEU HD13 H -24.525 -13.844  -6.663 1.00 . A A .  22 LEU HD13 1 1 
        4  5977 1 1  22 LEU HD21 H -26.065 -12.955 -10.438 1.00 . A A .  22 LEU HD21 1 1 
        4  5978 1 1  22 LEU HD22 H -25.177 -11.564  -9.816 1.00 . A A .  22 LEU HD22 1 1 
        4  5979 1 1  22 LEU HD23 H -26.600 -12.159  -8.958 1.00 . A A .  22 LEU HD23 1 1 
        4  5980 1 1  22 LEU HG   H -25.211 -14.387  -8.864 1.00 . A A .  22 LEU HG   1 1 
        4  5981 1 1  22 LEU N    N -23.949 -14.848 -11.003 1.00 . A A .  22 LEU N    1 1 
        4  5982 1 1  22 LEU O    O -23.218 -16.042  -8.305 1.00 . A A .  22 LEU O    1 1 
        4  5983 1 1  23 TYR C    C -19.755 -16.751  -7.606 1.00 . A A .  23 TYR C    1 1 
        4  5984 1 1  23 TYR CA   C -20.743 -17.235  -8.664 1.00 . A A .  23 TYR CA   1 1 
        4  5985 1 1  23 TYR CB   C -20.060 -18.239  -9.592 1.00 . A A .  23 TYR CB   1 1 
        4  5986 1 1  23 TYR CD1  C -20.373 -17.408 -11.956 1.00 . A A .  23 TYR CD1  1 1 
        4  5987 1 1  23 TYR CD2  C -21.610 -19.325 -11.264 1.00 . A A .  23 TYR CD2  1 1 
        4  5988 1 1  23 TYR CE1  C -20.950 -17.482 -13.209 1.00 . A A .  23 TYR CE1  1 1 
        4  5989 1 1  23 TYR CE2  C -22.190 -19.408 -12.515 1.00 . A A .  23 TYR CE2  1 1 
        4  5990 1 1  23 TYR CG   C -20.692 -18.325 -10.963 1.00 . A A .  23 TYR CG   1 1 
        4  5991 1 1  23 TYR CZ   C -21.857 -18.483 -13.483 1.00 . A A .  23 TYR CZ   1 1 
        4  5992 1 1  23 TYR H    H -20.728 -15.727 -10.149 1.00 . A A .  23 TYR H    1 1 
        4  5993 1 1  23 TYR HA   H -21.572 -17.720  -8.171 1.00 . A A .  23 TYR HA   1 1 
        4  5994 1 1  23 TYR HB2  H -19.014 -17.954  -9.707 1.00 . A A .  23 TYR HB2  1 1 
        4  5995 1 1  23 TYR HB3  H -20.105 -19.222  -9.144 1.00 . A A .  23 TYR HB3  1 1 
        4  5996 1 1  23 TYR HD1  H -19.660 -16.625 -11.737 1.00 . A A .  23 TYR HD1  1 1 
        4  5997 1 1  23 TYR HD2  H -21.869 -20.047 -10.504 1.00 . A A .  23 TYR HD2  1 1 
        4  5998 1 1  23 TYR HE1  H -20.688 -16.759 -13.967 1.00 . A A .  23 TYR HE1  1 1 
        4  5999 1 1  23 TYR HE2  H -22.902 -20.191 -12.732 1.00 . A A .  23 TYR HE2  1 1 
        4  6000 1 1  23 TYR HH   H -22.623 -19.479 -14.938 1.00 . A A .  23 TYR HH   1 1 
        4  6001 1 1  23 TYR N    N -21.272 -16.115  -9.432 1.00 . A A .  23 TYR N    1 1 
        4  6002 1 1  23 TYR O    O -18.847 -15.973  -7.897 1.00 . A A .  23 TYR O    1 1 
        4  6003 1 1  23 TYR OH   O -22.432 -18.561 -14.732 1.00 . A A .  23 TYR OH   1 1 
        4  6004 1 1  24 GLY C    C -17.709 -17.502  -5.366 1.00 . A A .  24 GLY C    1 1 
        4  6005 1 1  24 GLY CA   C -19.061 -16.821  -5.291 1.00 . A A .  24 GLY CA   1 1 
        4  6006 1 1  24 GLY H    H -20.683 -17.833  -6.201 1.00 . A A .  24 GLY H    1 1 
        4  6007 1 1  24 GLY HA2  H -18.917 -15.752  -5.330 1.00 . A A .  24 GLY HA2  1 1 
        4  6008 1 1  24 GLY HA3  H -19.529 -17.078  -4.351 1.00 . A A .  24 GLY HA3  1 1 
        4  6009 1 1  24 GLY N    N -19.942 -17.217  -6.375 1.00 . A A .  24 GLY N    1 1 
        4  6010 1 1  24 GLY O    O -17.230 -17.828  -6.452 1.00 . A A .  24 GLY O    1 1 
        4  6011 1 1  25 SER C    C -15.867 -19.808  -4.609 1.00 . A A .  25 SER C    1 1 
        4  6012 1 1  25 SER CA   C -15.782 -18.357  -4.148 1.00 . A A .  25 SER CA   1 1 
        4  6013 1 1  25 SER CB   C -15.225 -18.293  -2.725 1.00 . A A .  25 SER CB   1 1 
        4  6014 1 1  25 SER H    H -17.523 -17.433  -3.375 1.00 . A A .  25 SER H    1 1 
        4  6015 1 1  25 SER HA   H -15.119 -17.820  -4.809 1.00 . A A .  25 SER HA   1 1 
        4  6016 1 1  25 SER HB2  H -14.210 -18.691  -2.719 1.00 . A A .  25 SER HB2  1 1 
        4  6017 1 1  25 SER HB3  H -15.205 -17.265  -2.395 1.00 . A A .  25 SER HB3  1 1 
        4  6018 1 1  25 SER HG   H -15.914 -18.706  -0.938 1.00 . A A .  25 SER HG   1 1 
        4  6019 1 1  25 SER N    N -17.090 -17.715  -4.209 1.00 . A A .  25 SER N    1 1 
        4  6020 1 1  25 SER O    O -16.948 -20.393  -4.661 1.00 . A A .  25 SER O    1 1 
        4  6021 1 1  25 SER OG   O -16.027 -19.046  -1.829 1.00 . A A .  25 SER OG   1 1 
        4  6022 1 1  26 CYS C    C -14.210 -22.695  -4.275 1.00 . A A .  26 CYS C    1 1 
        4  6023 1 1  26 CYS CA   C -14.658 -21.767  -5.402 1.00 . A A .  26 CYS CA   1 1 
        4  6024 1 1  26 CYS CB   C -13.701 -21.893  -6.589 1.00 . A A .  26 CYS CB   1 1 
        4  6025 1 1  26 CYS H    H -13.887 -19.865  -4.882 1.00 . A A .  26 CYS H    1 1 
        4  6026 1 1  26 CYS HA   H -15.649 -22.056  -5.716 1.00 . A A .  26 CYS HA   1 1 
        4  6027 1 1  26 CYS HB2  H -12.979 -21.078  -6.542 1.00 . A A .  26 CYS HB2  1 1 
        4  6028 1 1  26 CYS HB3  H -13.169 -22.830  -6.516 1.00 . A A .  26 CYS HB3  1 1 
        4  6029 1 1  26 CYS HG   H -14.778 -20.580  -8.550 1.00 . A A .  26 CYS HG   1 1 
        4  6030 1 1  26 CYS N    N -14.716 -20.384  -4.944 1.00 . A A .  26 CYS N    1 1 
        4  6031 1 1  26 CYS O    O -13.299 -22.371  -3.514 1.00 . A A .  26 CYS O    1 1 
        4  6032 1 1  26 CYS SG   S -14.525 -21.848  -8.214 1.00 . A A .  26 CYS SG   1 1 
        4  6033 1 1  27 VAL C    C -13.853 -26.051  -3.741 1.00 . A A .  27 VAL C    1 1 
        4  6034 1 1  27 VAL CA   C -14.531 -24.826  -3.142 1.00 . A A .  27 VAL CA   1 1 
        4  6035 1 1  27 VAL CB   C -15.786 -25.272  -2.369 1.00 . A A .  27 VAL CB   1 1 
        4  6036 1 1  27 VAL CG1  C -15.399 -26.111  -1.161 1.00 . A A .  27 VAL CG1  1 1 
        4  6037 1 1  27 VAL CG2  C -16.611 -24.064  -1.949 1.00 . A A .  27 VAL CG2  1 1 
        4  6038 1 1  27 VAL H    H -15.580 -24.051  -4.810 1.00 . A A .  27 VAL H    1 1 
        4  6039 1 1  27 VAL HA   H -13.853 -24.356  -2.444 1.00 . A A .  27 VAL HA   1 1 
        4  6040 1 1  27 VAL HB   H -16.389 -25.883  -3.026 1.00 . A A .  27 VAL HB   1 1 
        4  6041 1 1  27 VAL HG11 H -16.287 -26.362  -0.599 1.00 . A A .  27 VAL HG11 1 1 
        4  6042 1 1  27 VAL HG12 H -14.914 -27.016  -1.492 1.00 . A A .  27 VAL HG12 1 1 
        4  6043 1 1  27 VAL HG13 H -14.724 -25.548  -0.534 1.00 . A A .  27 VAL HG13 1 1 
        4  6044 1 1  27 VAL HG21 H -16.057 -23.161  -2.155 1.00 . A A .  27 VAL HG21 1 1 
        4  6045 1 1  27 VAL HG22 H -17.538 -24.053  -2.501 1.00 . A A .  27 VAL HG22 1 1 
        4  6046 1 1  27 VAL HG23 H -16.823 -24.124  -0.892 1.00 . A A .  27 VAL HG23 1 1 
        4  6047 1 1  27 VAL N    N -14.861 -23.850  -4.175 1.00 . A A .  27 VAL N    1 1 
        4  6048 1 1  27 VAL O    O -14.350 -26.641  -4.701 1.00 . A A .  27 VAL O    1 1 
        4  6049 1 1  28 ALA C    C -12.529 -28.882  -3.056 1.00 . A A .  28 ALA C    1 1 
        4  6050 1 1  28 ALA CA   C -11.970 -27.591  -3.645 1.00 . A A .  28 ALA CA   1 1 
        4  6051 1 1  28 ALA CB   C -10.495 -27.447  -3.301 1.00 . A A .  28 ALA CB   1 1 
        4  6052 1 1  28 ALA H    H -12.371 -25.922  -2.406 1.00 . A A .  28 ALA H    1 1 
        4  6053 1 1  28 ALA HA   H -12.062 -27.627  -4.720 1.00 . A A .  28 ALA HA   1 1 
        4  6054 1 1  28 ALA HB1  H  -9.900 -27.915  -4.072 1.00 . A A .  28 ALA HB1  1 1 
        4  6055 1 1  28 ALA HB2  H -10.241 -26.400  -3.236 1.00 . A A .  28 ALA HB2  1 1 
        4  6056 1 1  28 ALA HB3  H -10.299 -27.926  -2.354 1.00 . A A .  28 ALA HB3  1 1 
        4  6057 1 1  28 ALA N    N -12.715 -26.431  -3.168 1.00 . A A .  28 ALA N    1 1 
        4  6058 1 1  28 ALA O    O -13.029 -28.898  -1.933 1.00 . A A .  28 ALA O    1 1 
        4  6059 1 1  29 ASN C    C -11.949 -31.925  -2.426 1.00 . A A .  29 ASN C    1 1 
        4  6060 1 1  29 ASN CA   C -12.937 -31.260  -3.380 1.00 . A A .  29 ASN CA   1 1 
        4  6061 1 1  29 ASN CB   C -13.194 -32.170  -4.582 1.00 . A A .  29 ASN CB   1 1 
        4  6062 1 1  29 ASN CG   C -13.931 -33.440  -4.198 1.00 . A A .  29 ASN CG   1 1 
        4  6063 1 1  29 ASN H    H -12.029 -29.888  -4.711 1.00 . A A .  29 ASN H    1 1 
        4  6064 1 1  29 ASN HA   H -13.869 -31.097  -2.859 1.00 . A A .  29 ASN HA   1 1 
        4  6065 1 1  29 ASN HB2  H -13.786 -31.626  -5.318 1.00 . A A .  29 ASN HB2  1 1 
        4  6066 1 1  29 ASN HB3  H -12.250 -32.446  -5.026 1.00 . A A .  29 ASN HB3  1 1 
        4  6067 1 1  29 ASN HD21 H -12.455 -34.549  -4.936 1.00 . A A .  29 ASN HD21 1 1 
        4  6068 1 1  29 ASN HD22 H -13.785 -35.421  -4.258 1.00 . A A .  29 ASN HD22 1 1 
        4  6069 1 1  29 ASN N    N -12.440 -29.964  -3.825 1.00 . A A .  29 ASN N    1 1 
        4  6070 1 1  29 ASN ND2  N -13.329 -34.587  -4.493 1.00 . A A .  29 ASN ND2  1 1 
        4  6071 1 1  29 ASN O    O -12.336 -32.450  -1.383 1.00 . A A .  29 ASN O    1 1 
        4  6072 1 1  29 ASN OD1  O -15.031 -33.390  -3.645 1.00 . A A .  29 ASN OD1  1 1 
        4  6073 1 1  30 ASN C    C  -9.642 -31.906  -0.559 1.00 . A A .  30 ASN C    1 1 
        4  6074 1 1  30 ASN CA   C  -9.627 -32.494  -1.968 1.00 . A A .  30 ASN CA   1 1 
        4  6075 1 1  30 ASN CB   C  -8.256 -32.275  -2.609 1.00 . A A .  30 ASN CB   1 1 
        4  6076 1 1  30 ASN CG   C  -7.652 -33.563  -3.135 1.00 . A A .  30 ASN CG   1 1 
        4  6077 1 1  30 ASN H    H -10.425 -31.459  -3.633 1.00 . A A .  30 ASN H    1 1 
        4  6078 1 1  30 ASN HA   H  -9.822 -33.553  -1.906 1.00 . A A .  30 ASN HA   1 1 
        4  6079 1 1  30 ASN HB2  H  -8.359 -31.570  -3.434 1.00 . A A .  30 ASN HB2  1 1 
        4  6080 1 1  30 ASN HB3  H  -7.583 -31.858  -1.874 1.00 . A A .  30 ASN HB3  1 1 
        4  6081 1 1  30 ASN HD21 H  -7.861 -32.925  -5.008 1.00 . A A .  30 ASN HD21 1 1 
        4  6082 1 1  30 ASN HD22 H  -7.162 -34.494  -4.823 1.00 . A A .  30 ASN HD22 1 1 
        4  6083 1 1  30 ASN N    N -10.672 -31.894  -2.792 1.00 . A A .  30 ASN N    1 1 
        4  6084 1 1  30 ASN ND2  N  -7.548 -33.672  -4.455 1.00 . A A .  30 ASN ND2  1 1 
        4  6085 1 1  30 ASN O    O  -9.200 -32.546   0.394 1.00 . A A .  30 ASN O    1 1 
        4  6086 1 1  30 ASN OD1  O  -7.285 -34.450  -2.365 1.00 . A A .  30 ASN OD1  1 1 
        4  6087 1 1  31 GLY C    C  -9.546 -28.673   0.855 1.00 . A A .  31 GLY C    1 1 
        4  6088 1 1  31 GLY CA   C -10.215 -30.033   0.857 1.00 . A A .  31 GLY CA   1 1 
        4  6089 1 1  31 GLY H    H -10.491 -30.223  -1.234 1.00 . A A .  31 GLY H    1 1 
        4  6090 1 1  31 GLY HA2  H -11.252 -29.912   1.137 1.00 . A A .  31 GLY HA2  1 1 
        4  6091 1 1  31 GLY HA3  H  -9.726 -30.661   1.589 1.00 . A A .  31 GLY HA3  1 1 
        4  6092 1 1  31 GLY N    N -10.153 -30.686  -0.438 1.00 . A A .  31 GLY N    1 1 
        4  6093 1 1  31 GLY O    O -10.218 -27.642   0.904 1.00 . A A .  31 GLY O    1 1 
        4  6094 1 1  32 ASP C    C  -7.522 -26.758  -0.579 1.00 . A A .  32 ASP C    1 1 
        4  6095 1 1  32 ASP CA   C  -7.457 -27.426   0.791 1.00 . A A .  32 ASP CA   1 1 
        4  6096 1 1  32 ASP CB   C  -6.001 -27.693   1.173 1.00 . A A .  32 ASP CB   1 1 
        4  6097 1 1  32 ASP CG   C  -5.332 -26.481   1.794 1.00 . A A .  32 ASP CG   1 1 
        4  6098 1 1  32 ASP H    H  -7.740 -29.525   0.761 1.00 . A A .  32 ASP H    1 1 
        4  6099 1 1  32 ASP HA   H  -7.895 -26.764   1.522 1.00 . A A .  32 ASP HA   1 1 
        4  6100 1 1  32 ASP HB2  H  -5.967 -28.517   1.885 1.00 . A A .  32 ASP HB2  1 1 
        4  6101 1 1  32 ASP HB3  H  -5.448 -27.972   0.288 1.00 . A A .  32 ASP HB3  1 1 
        4  6102 1 1  32 ASP N    N  -8.218 -28.670   0.799 1.00 . A A .  32 ASP N    1 1 
        4  6103 1 1  32 ASP O    O  -8.048 -25.654  -0.718 1.00 . A A .  32 ASP O    1 1 
        4  6104 1 1  32 ASP OD1  O  -5.499 -25.369   1.249 1.00 . A A .  32 ASP OD1  1 1 
        4  6105 1 1  32 ASP OD2  O  -4.645 -26.643   2.823 1.00 . A A .  32 ASP OD2  1 1 
        4  6106 1 1  33 CYS C    C  -6.953 -28.038  -3.971 1.00 . A A .  33 CYS C    1 1 
        4  6107 1 1  33 CYS CA   C  -6.979 -26.906  -2.947 1.00 . A A .  33 CYS CA   1 1 
        4  6108 1 1  33 CYS CB   C  -5.773 -25.988  -3.155 1.00 . A A .  33 CYS CB   1 1 
        4  6109 1 1  33 CYS H    H  -6.580 -28.310  -1.414 1.00 . A A .  33 CYS H    1 1 
        4  6110 1 1  33 CYS HA   H  -7.884 -26.334  -3.083 1.00 . A A .  33 CYS HA   1 1 
        4  6111 1 1  33 CYS HB2  H  -5.586 -25.896  -4.225 1.00 . A A .  33 CYS HB2  1 1 
        4  6112 1 1  33 CYS HB3  H  -6.003 -25.010  -2.760 1.00 . A A .  33 CYS HB3  1 1 
        4  6113 1 1  33 CYS HG   H  -4.202 -27.903  -2.384 1.00 . A A .  33 CYS HG   1 1 
        4  6114 1 1  33 CYS N    N  -6.984 -27.435  -1.588 1.00 . A A .  33 CYS N    1 1 
        4  6115 1 1  33 CYS O    O  -6.408 -29.110  -3.711 1.00 . A A .  33 CYS O    1 1 
        4  6116 1 1  33 CYS SG   S  -4.247 -26.569  -2.346 1.00 . A A .  33 CYS SG   1 1 
        4  6117 1 1  34 GLY C    C  -8.911 -28.836  -6.902 1.00 . A A .  34 GLY C    1 1 
        4  6118 1 1  34 GLY CA   C  -7.580 -28.797  -6.179 1.00 . A A .  34 GLY CA   1 1 
        4  6119 1 1  34 GLY H    H  -7.964 -26.916  -5.284 1.00 . A A .  34 GLY H    1 1 
        4  6120 1 1  34 GLY HA2  H  -6.799 -28.583  -6.894 1.00 . A A .  34 GLY HA2  1 1 
        4  6121 1 1  34 GLY HA3  H  -7.394 -29.764  -5.736 1.00 . A A .  34 GLY HA3  1 1 
        4  6122 1 1  34 GLY N    N  -7.546 -27.789  -5.134 1.00 . A A .  34 GLY N    1 1 
        4  6123 1 1  34 GLY O    O  -9.748 -27.953  -6.722 1.00 . A A .  34 GLY O    1 1 
        4  6124 1 1  35 GLN C    C -11.554 -29.995  -7.550 1.00 . A A .  35 GLN C    1 1 
        4  6125 1 1  35 GLN CA   C -10.344 -30.012  -8.479 1.00 . A A .  35 GLN CA   1 1 
        4  6126 1 1  35 GLN CB   C -10.322 -31.313  -9.284 1.00 . A A .  35 GLN CB   1 1 
        4  6127 1 1  35 GLN CD   C  -9.662 -31.404 -11.721 1.00 . A A .  35 GLN CD   1 1 
        4  6128 1 1  35 GLN CG   C -10.775 -31.145 -10.725 1.00 . A A .  35 GLN CG   1 1 
        4  6129 1 1  35 GLN H    H  -8.400 -30.535  -7.825 1.00 . A A .  35 GLN H    1 1 
        4  6130 1 1  35 GLN HA   H -10.418 -29.179  -9.161 1.00 . A A .  35 GLN HA   1 1 
        4  6131 1 1  35 GLN HB2  H  -9.306 -31.709  -9.281 1.00 . A A .  35 GLN HB2  1 1 
        4  6132 1 1  35 GLN HB3  H -10.973 -32.029  -8.806 1.00 . A A .  35 GLN HB3  1 1 
        4  6133 1 1  35 GLN HE21 H  -8.402 -30.316 -10.635 1.00 . A A .  35 GLN HE21 1 1 
        4  6134 1 1  35 GLN HE22 H  -7.748 -31.005 -12.078 1.00 . A A .  35 GLN HE22 1 1 
        4  6135 1 1  35 GLN HG2  H -11.594 -31.837 -10.921 1.00 . A A .  35 GLN HG2  1 1 
        4  6136 1 1  35 GLN HG3  H -11.131 -30.134 -10.861 1.00 . A A .  35 GLN HG3  1 1 
        4  6137 1 1  35 GLN N    N  -9.105 -29.862  -7.724 1.00 . A A .  35 GLN N    1 1 
        4  6138 1 1  35 GLN NE2  N  -8.485 -30.852 -11.452 1.00 . A A .  35 GLN NE2  1 1 
        4  6139 1 1  35 GLN O    O -11.686 -30.847  -6.672 1.00 . A A .  35 GLN O    1 1 
        4  6140 1 1  35 GLN OE1  O  -9.858 -32.094 -12.722 1.00 . A A .  35 GLN OE1  1 1 
        4  6141 1 1  36 GLY C    C -14.855 -28.542  -7.724 1.00 . A A .  36 GLY C    1 1 
        4  6142 1 1  36 GLY CA   C -13.621 -28.910  -6.923 1.00 . A A .  36 GLY CA   1 1 
        4  6143 1 1  36 GLY H    H -12.276 -28.368  -8.466 1.00 . A A .  36 GLY H    1 1 
        4  6144 1 1  36 GLY HA2  H -13.793 -29.855  -6.431 1.00 . A A .  36 GLY HA2  1 1 
        4  6145 1 1  36 GLY HA3  H -13.454 -28.152  -6.172 1.00 . A A .  36 GLY HA3  1 1 
        4  6146 1 1  36 GLY N    N -12.434 -29.019  -7.751 1.00 . A A .  36 GLY N    1 1 
        4  6147 1 1  36 GLY O    O -15.007 -28.964  -8.869 1.00 . A A .  36 GLY O    1 1 
        4  6148 1 1  37 MET C    C -17.389 -25.943  -7.306 1.00 . A A .  37 MET C    1 1 
        4  6149 1 1  37 MET CA   C -16.963 -27.328  -7.784 1.00 . A A .  37 MET CA   1 1 
        4  6150 1 1  37 MET CB   C -18.083 -28.337  -7.526 1.00 . A A .  37 MET CB   1 1 
        4  6151 1 1  37 MET CE   C -21.000 -27.363  -6.549 1.00 . A A .  37 MET CE   1 1 
        4  6152 1 1  37 MET CG   C -18.490 -28.433  -6.065 1.00 . A A .  37 MET CG   1 1 
        4  6153 1 1  37 MET H    H -15.558 -27.448  -6.205 1.00 . A A .  37 MET H    1 1 
        4  6154 1 1  37 MET HA   H -16.767 -27.284  -8.845 1.00 . A A .  37 MET HA   1 1 
        4  6155 1 1  37 MET HB2  H -18.955 -28.048  -8.113 1.00 . A A .  37 MET HB2  1 1 
        4  6156 1 1  37 MET HB3  H -17.755 -29.313  -7.850 1.00 . A A .  37 MET HB3  1 1 
        4  6157 1 1  37 MET HE1  H -22.075 -27.449  -6.476 1.00 . A A .  37 MET HE1  1 1 
        4  6158 1 1  37 MET HE2  H -20.670 -26.492  -6.003 1.00 . A A .  37 MET HE2  1 1 
        4  6159 1 1  37 MET HE3  H -20.717 -27.268  -7.586 1.00 . A A .  37 MET HE3  1 1 
        4  6160 1 1  37 MET HG2  H -17.893 -29.207  -5.582 1.00 . A A .  37 MET HG2  1 1 
        4  6161 1 1  37 MET HG3  H -18.288 -27.487  -5.587 1.00 . A A .  37 MET HG3  1 1 
        4  6162 1 1  37 MET N    N -15.737 -27.753  -7.119 1.00 . A A .  37 MET N    1 1 
        4  6163 1 1  37 MET O    O -16.840 -25.414  -6.339 1.00 . A A .  37 MET O    1 1 
        4  6164 1 1  37 MET SD   S -20.237 -28.827  -5.854 1.00 . A A .  37 MET SD   1 1 
        4  6165 1 1  38 ARG C    C -20.360 -23.921  -7.935 1.00 . A A .  38 ARG C    1 1 
        4  6166 1 1  38 ARG CA   C -18.868 -24.040  -7.634 1.00 . A A .  38 ARG CA   1 1 
        4  6167 1 1  38 ARG CB   C -18.096 -22.959  -8.395 1.00 . A A .  38 ARG CB   1 1 
        4  6168 1 1  38 ARG CD   C -18.161 -20.734  -7.230 1.00 . A A .  38 ARG CD   1 1 
        4  6169 1 1  38 ARG CG   C -18.751 -21.589  -8.340 1.00 . A A .  38 ARG CG   1 1 
        4  6170 1 1  38 ARG CZ   C -19.692 -20.684  -5.307 1.00 . A A .  38 ARG CZ   1 1 
        4  6171 1 1  38 ARG H    H -18.768 -25.835  -8.750 1.00 . A A .  38 ARG H    1 1 
        4  6172 1 1  38 ARG HA   H -18.715 -23.900  -6.574 1.00 . A A .  38 ARG HA   1 1 
        4  6173 1 1  38 ARG HB2  H -17.093 -22.884  -7.973 1.00 . A A .  38 ARG HB2  1 1 
        4  6174 1 1  38 ARG HB3  H -18.014 -23.254  -9.430 1.00 . A A .  38 ARG HB3  1 1 
        4  6175 1 1  38 ARG HD2  H -17.526 -21.357  -6.600 1.00 . A A .  38 ARG HD2  1 1 
        4  6176 1 1  38 ARG HD3  H -17.561 -19.955  -7.675 1.00 . A A .  38 ARG HD3  1 1 
        4  6177 1 1  38 ARG HE   H -19.539 -19.244  -6.680 1.00 . A A .  38 ARG HE   1 1 
        4  6178 1 1  38 ARG HG2  H -18.606 -21.085  -9.296 1.00 . A A .  38 ARG HG2  1 1 
        4  6179 1 1  38 ARG HG3  H -19.810 -21.713  -8.164 1.00 . A A .  38 ARG HG3  1 1 
        4  6180 1 1  38 ARG HH11 H -18.540 -22.337  -5.433 1.00 . A A .  38 ARG HH11 1 1 
        4  6181 1 1  38 ARG HH12 H -19.624 -22.289  -4.083 1.00 . A A .  38 ARG HH12 1 1 
        4  6182 1 1  38 ARG HH21 H -20.970 -19.169  -4.905 1.00 . A A .  38 ARG HH21 1 1 
        4  6183 1 1  38 ARG HH22 H -21.006 -20.487  -3.783 1.00 . A A .  38 ARG HH22 1 1 
        4  6184 1 1  38 ARG N    N -18.371 -25.362  -7.989 1.00 . A A .  38 ARG N    1 1 
        4  6185 1 1  38 ARG NE   N -19.197 -20.119  -6.404 1.00 . A A .  38 ARG NE   1 1 
        4  6186 1 1  38 ARG NH1  N -19.250 -21.868  -4.909 1.00 . A A .  38 ARG NH1  1 1 
        4  6187 1 1  38 ARG NH2  N -20.633 -20.061  -4.608 1.00 . A A .  38 ARG NH2  1 1 
        4  6188 1 1  38 ARG O    O -20.803 -24.222  -9.044 1.00 . A A .  38 ARG O    1 1 
        4  6189 1 1  39 GLU C    C -22.926 -21.872  -7.401 1.00 . A A .  39 GLU C    1 1 
        4  6190 1 1  39 GLU CA   C -22.567 -23.324  -7.103 1.00 . A A .  39 GLU CA   1 1 
        4  6191 1 1  39 GLU CB   C -23.297 -23.795  -5.842 1.00 . A A .  39 GLU CB   1 1 
        4  6192 1 1  39 GLU CD   C -23.177 -26.055  -4.723 1.00 . A A .  39 GLU CD   1 1 
        4  6193 1 1  39 GLU CG   C -23.717 -25.253  -5.890 1.00 . A A .  39 GLU CG   1 1 
        4  6194 1 1  39 GLU H    H -20.712 -23.258  -6.083 1.00 . A A .  39 GLU H    1 1 
        4  6195 1 1  39 GLU HA   H -22.877 -23.938  -7.937 1.00 . A A .  39 GLU HA   1 1 
        4  6196 1 1  39 GLU HB2  H -22.640 -23.649  -4.984 1.00 . A A .  39 GLU HB2  1 1 
        4  6197 1 1  39 GLU HB3  H -24.181 -23.190  -5.707 1.00 . A A .  39 GLU HB3  1 1 
        4  6198 1 1  39 GLU HG2  H -24.806 -25.307  -5.882 1.00 . A A .  39 GLU HG2  1 1 
        4  6199 1 1  39 GLU HG3  H -23.352 -25.690  -6.809 1.00 . A A .  39 GLU HG3  1 1 
        4  6200 1 1  39 GLU N    N -21.127 -23.481  -6.943 1.00 . A A .  39 GLU N    1 1 
        4  6201 1 1  39 GLU O    O -22.722 -20.987  -6.570 1.00 . A A .  39 GLU O    1 1 
        4  6202 1 1  39 GLU OE1  O -22.050 -25.765  -4.273 1.00 . A A .  39 GLU OE1  1 1 
        4  6203 1 1  39 GLU OE2  O -23.884 -26.975  -4.260 1.00 . A A .  39 GLU OE2  1 1 
        4  6204 1 1  40 GLY C    C -25.175 -19.868  -8.391 1.00 . A A .  40 GLY C    1 1 
        4  6205 1 1  40 GLY CA   C -23.843 -20.287  -8.981 1.00 . A A .  40 GLY CA   1 1 
        4  6206 1 1  40 GLY H    H -23.605 -22.378  -9.216 1.00 . A A .  40 GLY H    1 1 
        4  6207 1 1  40 GLY HA2  H -23.081 -19.600  -8.647 1.00 . A A .  40 GLY HA2  1 1 
        4  6208 1 1  40 GLY HA3  H -23.910 -20.240 -10.059 1.00 . A A .  40 GLY HA3  1 1 
        4  6209 1 1  40 GLY N    N -23.463 -21.633  -8.594 1.00 . A A .  40 GLY N    1 1 
        4  6210 1 1  40 GLY O    O -26.192 -20.529  -8.601 1.00 . A A .  40 GLY O    1 1 
        4  6211 1 1  41 THR C    C -26.679 -16.832  -7.466 1.00 . A A .  41 THR C    1 1 
        4  6212 1 1  41 THR CA   C -26.386 -18.259  -7.022 1.00 . A A .  41 THR CA   1 1 
        4  6213 1 1  41 THR CB   C -26.284 -18.297  -5.485 1.00 . A A .  41 THR CB   1 1 
        4  6214 1 1  41 THR CG2  C -25.046 -17.554  -5.006 1.00 . A A .  41 THR CG2  1 1 
        4  6215 1 1  41 THR H    H -24.327 -18.283  -7.516 1.00 . A A .  41 THR H    1 1 
        4  6216 1 1  41 THR HA   H -27.205 -18.897  -7.323 1.00 . A A .  41 THR HA   1 1 
        4  6217 1 1  41 THR HB   H -26.210 -19.329  -5.170 1.00 . A A .  41 THR HB   1 1 
        4  6218 1 1  41 THR HG1  H -27.918 -18.373  -4.383 1.00 . A A .  41 THR HG1  1 1 
        4  6219 1 1  41 THR HG21 H -24.455 -17.255  -5.858 1.00 . A A .  41 THR HG21 1 1 
        4  6220 1 1  41 THR HG22 H -24.461 -18.201  -4.370 1.00 . A A .  41 THR HG22 1 1 
        4  6221 1 1  41 THR HG23 H -25.346 -16.678  -4.450 1.00 . A A .  41 THR HG23 1 1 
        4  6222 1 1  41 THR N    N -25.170 -18.766  -7.647 1.00 . A A .  41 THR N    1 1 
        4  6223 1 1  41 THR O    O -25.847 -15.938  -7.307 1.00 . A A .  41 THR O    1 1 
        4  6224 1 1  41 THR OG1  O -27.454 -17.712  -4.903 1.00 . A A .  41 THR OG1  1 1 
        4  6225 1 1  42 CYS C    C -29.670 -14.953  -7.992 1.00 . A A .  42 CYS C    1 1 
        4  6226 1 1  42 CYS CA   C -28.271 -15.301  -8.490 1.00 . A A .  42 CYS CA   1 1 
        4  6227 1 1  42 CYS CB   C -28.233 -15.245 -10.018 1.00 . A A .  42 CYS CB   1 1 
        4  6228 1 1  42 CYS H    H -28.488 -17.375  -8.122 1.00 . A A .  42 CYS H    1 1 
        4  6229 1 1  42 CYS HA   H -27.572 -14.581  -8.094 1.00 . A A .  42 CYS HA   1 1 
        4  6230 1 1  42 CYS HB2  H -27.192 -15.252 -10.340 1.00 . A A .  42 CYS HB2  1 1 
        4  6231 1 1  42 CYS HB3  H -28.722 -16.121 -10.416 1.00 . A A .  42 CYS HB3  1 1 
        4  6232 1 1  42 CYS HG   H -28.417 -12.676 -10.327 1.00 . A A .  42 CYS HG   1 1 
        4  6233 1 1  42 CYS N    N -27.866 -16.622  -8.022 1.00 . A A .  42 CYS N    1 1 
        4  6234 1 1  42 CYS O    O -30.657 -15.560  -8.405 1.00 . A A .  42 CYS O    1 1 
        4  6235 1 1  42 CYS SG   S -29.052 -13.780 -10.728 1.00 . A A .  42 CYS SG   1 1 
        4  6236 1 1  43 ASN C    C -31.678 -14.665  -5.747 1.00 . A A .  43 ASN C    1 1 
        4  6237 1 1  43 ASN CA   C -31.026 -13.539  -6.545 1.00 . A A .  43 ASN CA   1 1 
        4  6238 1 1  43 ASN CB   C -31.964 -13.083  -7.664 1.00 . A A .  43 ASN CB   1 1 
        4  6239 1 1  43 ASN CG   C -31.476 -11.820  -8.348 1.00 . A A .  43 ASN CG   1 1 
        4  6240 1 1  43 ASN H    H -28.925 -13.523  -6.809 1.00 . A A .  43 ASN H    1 1 
        4  6241 1 1  43 ASN HA   H -30.836 -12.708  -5.884 1.00 . A A .  43 ASN HA   1 1 
        4  6242 1 1  43 ASN HB2  H -32.043 -13.878  -8.405 1.00 . A A .  43 ASN HB2  1 1 
        4  6243 1 1  43 ASN HB3  H -32.942 -12.891  -7.251 1.00 . A A .  43 ASN HB3  1 1 
        4  6244 1 1  43 ASN HD21 H -32.968 -11.923  -9.658 1.00 . A A .  43 ASN HD21 1 1 
        4  6245 1 1  43 ASN HD22 H -31.890 -10.589  -9.852 1.00 . A A .  43 ASN HD22 1 1 
        4  6246 1 1  43 ASN N    N -29.747 -13.969  -7.100 1.00 . A A .  43 ASN N    1 1 
        4  6247 1 1  43 ASN ND2  N -32.183 -11.401  -9.392 1.00 . A A .  43 ASN ND2  1 1 
        4  6248 1 1  43 ASN O    O -31.568 -14.714  -4.522 1.00 . A A .  43 ASN O    1 1 
        4  6249 1 1  43 ASN OD1  O -30.476 -11.228  -7.942 1.00 . A A .  43 ASN OD1  1 1 
        4  6250 1 1  44 GLU C    C -32.954 -17.939  -6.681 1.00 . A A .  44 GLU C    1 1 
        4  6251 1 1  44 GLU CA   C -33.025 -16.690  -5.807 1.00 . A A .  44 GLU CA   1 1 
        4  6252 1 1  44 GLU CB   C -34.486 -16.342  -5.514 1.00 . A A .  44 GLU CB   1 1 
        4  6253 1 1  44 GLU CD   C -35.014 -14.195  -6.737 1.00 . A A .  44 GLU CD   1 1 
        4  6254 1 1  44 GLU CG   C -35.206 -15.699  -6.688 1.00 . A A .  44 GLU CG   1 1 
        4  6255 1 1  44 GLU H    H -32.407 -15.472  -7.424 1.00 . A A .  44 GLU H    1 1 
        4  6256 1 1  44 GLU HA   H -32.519 -16.889  -4.875 1.00 . A A .  44 GLU HA   1 1 
        4  6257 1 1  44 GLU HB2  H -35.014 -17.255  -5.239 1.00 . A A .  44 GLU HB2  1 1 
        4  6258 1 1  44 GLU HB3  H -34.520 -15.658  -4.680 1.00 . A A .  44 GLU HB3  1 1 
        4  6259 1 1  44 GLU HG2  H -34.829 -16.133  -7.614 1.00 . A A .  44 GLU HG2  1 1 
        4  6260 1 1  44 GLU HG3  H -36.261 -15.909  -6.607 1.00 . A A .  44 GLU HG3  1 1 
        4  6261 1 1  44 GLU N    N -32.356 -15.566  -6.451 1.00 . A A .  44 GLU N    1 1 
        4  6262 1 1  44 GLU O    O -33.927 -18.683  -6.799 1.00 . A A .  44 GLU O    1 1 
        4  6263 1 1  44 GLU OE1  O -34.823 -13.586  -5.664 1.00 . A A .  44 GLU OE1  1 1 
        4  6264 1 1  44 GLU OE2  O -35.055 -13.629  -7.849 1.00 . A A .  44 GLU OE2  1 1 
        4  6265 1 1  45 GLN C    C -30.268 -20.006  -7.848 1.00 . A A .  45 GLN C    1 1 
        4  6266 1 1  45 GLN CA   C -31.595 -19.318  -8.156 1.00 . A A .  45 GLN CA   1 1 
        4  6267 1 1  45 GLN CB   C -31.635 -18.898  -9.626 1.00 . A A .  45 GLN CB   1 1 
        4  6268 1 1  45 GLN CD   C -32.878 -17.650 -11.437 1.00 . A A .  45 GLN CD   1 1 
        4  6269 1 1  45 GLN CG   C -32.774 -17.946  -9.954 1.00 . A A .  45 GLN CG   1 1 
        4  6270 1 1  45 GLN H    H -31.055 -17.532  -7.156 1.00 . A A .  45 GLN H    1 1 
        4  6271 1 1  45 GLN HA   H -32.398 -20.015  -7.967 1.00 . A A .  45 GLN HA   1 1 
        4  6272 1 1  45 GLN HB2  H -30.692 -18.414  -9.877 1.00 . A A .  45 GLN HB2  1 1 
        4  6273 1 1  45 GLN HB3  H -31.746 -19.781 -10.237 1.00 . A A .  45 GLN HB3  1 1 
        4  6274 1 1  45 GLN HE21 H -34.264 -16.268 -11.090 1.00 . A A .  45 GLN HE21 1 1 
        4  6275 1 1  45 GLN HE22 H -33.834 -16.501 -12.746 1.00 . A A .  45 GLN HE22 1 1 
        4  6276 1 1  45 GLN HG2  H -33.712 -18.386  -9.614 1.00 . A A .  45 GLN HG2  1 1 
        4  6277 1 1  45 GLN HG3  H -32.612 -17.017  -9.426 1.00 . A A .  45 GLN HG3  1 1 
        4  6278 1 1  45 GLN N    N -31.794 -18.162  -7.291 1.00 . A A .  45 GLN N    1 1 
        4  6279 1 1  45 GLN NE2  N -33.748 -16.712 -11.794 1.00 . A A .  45 GLN NE2  1 1 
        4  6280 1 1  45 GLN O    O -29.411 -19.447  -7.165 1.00 . A A .  45 GLN O    1 1 
        4  6281 1 1  45 GLN OE1  O -32.184 -18.259 -12.253 1.00 . A A .  45 GLN OE1  1 1 
        4  6282 1 1  46 THR C    C -28.348 -22.555  -9.441 1.00 . A A .  46 THR C    1 1 
        4  6283 1 1  46 THR CA   C -28.887 -21.991  -8.134 1.00 . A A .  46 THR CA   1 1 
        4  6284 1 1  46 THR CB   C -29.122 -23.147  -7.145 1.00 . A A .  46 THR CB   1 1 
        4  6285 1 1  46 THR CG2  C -28.856 -22.701  -5.715 1.00 . A A .  46 THR CG2  1 1 
        4  6286 1 1  46 THR H    H -30.828 -21.618  -8.890 1.00 . A A .  46 THR H    1 1 
        4  6287 1 1  46 THR HA   H -28.150 -21.325  -7.709 1.00 . A A .  46 THR HA   1 1 
        4  6288 1 1  46 THR HB   H -28.442 -23.951  -7.388 1.00 . A A .  46 THR HB   1 1 
        4  6289 1 1  46 THR HG1  H -30.467 -24.485  -7.683 1.00 . A A .  46 THR HG1  1 1 
        4  6290 1 1  46 THR HG21 H -28.824 -23.565  -5.068 1.00 . A A .  46 THR HG21 1 1 
        4  6291 1 1  46 THR HG22 H -29.645 -22.038  -5.392 1.00 . A A .  46 THR HG22 1 1 
        4  6292 1 1  46 THR HG23 H -27.909 -22.182  -5.671 1.00 . A A .  46 THR HG23 1 1 
        4  6293 1 1  46 THR N    N -30.108 -21.225  -8.355 1.00 . A A .  46 THR N    1 1 
        4  6294 1 1  46 THR O    O -29.091 -22.726 -10.408 1.00 . A A .  46 THR O    1 1 
        4  6295 1 1  46 THR OG1  O -30.467 -23.624  -7.259 1.00 . A A .  46 THR OG1  1 1 
        4  6296 1 1  47 ARG C    C -25.284 -24.347 -10.278 1.00 . A A .  47 ARG C    1 1 
        4  6297 1 1  47 ARG CA   C -26.412 -23.393 -10.656 1.00 . A A .  47 ARG CA   1 1 
        4  6298 1 1  47 ARG CB   C -25.868 -22.265 -11.533 1.00 . A A .  47 ARG CB   1 1 
        4  6299 1 1  47 ARG CD   C -26.469 -23.484 -13.646 1.00 . A A .  47 ARG CD   1 1 
        4  6300 1 1  47 ARG CG   C -25.382 -22.731 -12.896 1.00 . A A .  47 ARG CG   1 1 
        4  6301 1 1  47 ARG CZ   C -27.667 -23.312 -15.786 1.00 . A A .  47 ARG CZ   1 1 
        4  6302 1 1  47 ARG H    H -26.511 -22.689  -8.663 1.00 . A A .  47 ARG H    1 1 
        4  6303 1 1  47 ARG HA   H -27.159 -23.940 -11.212 1.00 . A A .  47 ARG HA   1 1 
        4  6304 1 1  47 ARG HB2  H -26.655 -21.525 -11.678 1.00 . A A .  47 ARG HB2  1 1 
        4  6305 1 1  47 ARG HB3  H -25.042 -21.795 -11.022 1.00 . A A .  47 ARG HB3  1 1 
        4  6306 1 1  47 ARG HD2  H -26.206 -24.541 -13.687 1.00 . A A .  47 ARG HD2  1 1 
        4  6307 1 1  47 ARG HD3  H -27.400 -23.374 -13.111 1.00 . A A .  47 ARG HD3  1 1 
        4  6308 1 1  47 ARG HE   H -25.961 -22.372 -15.356 1.00 . A A .  47 ARG HE   1 1 
        4  6309 1 1  47 ARG HG2  H -25.078 -21.864 -13.482 1.00 . A A .  47 ARG HG2  1 1 
        4  6310 1 1  47 ARG HG3  H -24.532 -23.382 -12.760 1.00 . A A .  47 ARG HG3  1 1 
        4  6311 1 1  47 ARG HH11 H -28.542 -24.513 -14.418 1.00 . A A .  47 ARG HH11 1 1 
        4  6312 1 1  47 ARG HH12 H -29.375 -24.382 -15.930 1.00 . A A .  47 ARG HH12 1 1 
        4  6313 1 1  47 ARG HH21 H -27.050 -22.192 -17.353 1.00 . A A .  47 ARG HH21 1 1 
        4  6314 1 1  47 ARG HH22 H -28.525 -23.063 -17.600 1.00 . A A .  47 ARG HH22 1 1 
        4  6315 1 1  47 ARG N    N -27.052 -22.846  -9.465 1.00 . A A .  47 ARG N    1 1 
        4  6316 1 1  47 ARG NE   N -26.643 -22.983 -15.007 1.00 . A A .  47 ARG NE   1 1 
        4  6317 1 1  47 ARG NH1  N -28.604 -24.137 -15.341 1.00 . A A .  47 ARG NH1  1 1 
        4  6318 1 1  47 ARG NH2  N -27.755 -22.815 -17.014 1.00 . A A .  47 ARG NH2  1 1 
        4  6319 1 1  47 ARG O    O -24.771 -24.308  -9.160 1.00 . A A .  47 ARG O    1 1 
        4  6320 1 1  48 LYS C    C -22.731 -26.025 -12.032 1.00 . A A .  48 LYS C    1 1 
        4  6321 1 1  48 LYS CA   C -23.833 -26.170 -10.986 1.00 . A A .  48 LYS CA   1 1 
        4  6322 1 1  48 LYS CB   C -24.390 -27.595 -11.010 1.00 . A A .  48 LYS CB   1 1 
        4  6323 1 1  48 LYS CD   C -25.953 -29.280  -9.999 1.00 . A A .  48 LYS CD   1 1 
        4  6324 1 1  48 LYS CE   C -26.916 -29.576  -8.858 1.00 . A A .  48 LYS CE   1 1 
        4  6325 1 1  48 LYS CG   C -25.346 -27.894  -9.870 1.00 . A A .  48 LYS CG   1 1 
        4  6326 1 1  48 LYS H    H -25.348 -25.189 -12.091 1.00 . A A .  48 LYS H    1 1 
        4  6327 1 1  48 LYS HA   H -23.414 -25.972 -10.010 1.00 . A A .  48 LYS HA   1 1 
        4  6328 1 1  48 LYS HB2  H -24.914 -27.749 -11.953 1.00 . A A .  48 LYS HB2  1 1 
        4  6329 1 1  48 LYS HB3  H -23.566 -28.292 -10.953 1.00 . A A .  48 LYS HB3  1 1 
        4  6330 1 1  48 LYS HD2  H -26.488 -29.349 -10.946 1.00 . A A .  48 LYS HD2  1 1 
        4  6331 1 1  48 LYS HD3  H -25.159 -30.013  -9.987 1.00 . A A .  48 LYS HD3  1 1 
        4  6332 1 1  48 LYS HE2  H -27.047 -28.674  -8.260 1.00 . A A .  48 LYS HE2  1 1 
        4  6333 1 1  48 LYS HE3  H -27.870 -29.863  -9.275 1.00 . A A .  48 LYS HE3  1 1 
        4  6334 1 1  48 LYS HG2  H -24.806 -27.827  -8.925 1.00 . A A .  48 LYS HG2  1 1 
        4  6335 1 1  48 LYS HG3  H -26.140 -27.160  -9.876 1.00 . A A .  48 LYS HG3  1 1 
        4  6336 1 1  48 LYS HZ1  H -26.847 -30.598  -7.038 1.00 . A A .  48 LYS HZ1  1 1 
        4  6337 1 1  48 LYS HZ2  H -25.385 -30.614  -7.890 1.00 . A A .  48 LYS HZ2  1 1 
        4  6338 1 1  48 LYS HZ3  H -26.666 -31.596  -8.392 1.00 . A A .  48 LYS HZ3  1 1 
        4  6339 1 1  48 LYS N    N -24.900 -25.205 -11.218 1.00 . A A .  48 LYS N    1 1 
        4  6340 1 1  48 LYS NZ   N -26.420 -30.673  -7.983 1.00 . A A .  48 LYS NZ   1 1 
        4  6341 1 1  48 LYS O    O -22.997 -26.045 -13.233 1.00 . A A .  48 LYS O    1 1 
        4  6342 1 1  49 VAL C    C -19.075 -26.250 -11.811 1.00 . A A .  49 VAL C    1 1 
        4  6343 1 1  49 VAL CA   C -20.353 -25.736 -12.463 1.00 . A A .  49 VAL CA   1 1 
        4  6344 1 1  49 VAL CB   C -20.149 -24.266 -12.878 1.00 . A A .  49 VAL CB   1 1 
        4  6345 1 1  49 VAL CG1  C -21.330 -23.776 -13.703 1.00 . A A .  49 VAL CG1  1 1 
        4  6346 1 1  49 VAL CG2  C -19.943 -23.391 -11.653 1.00 . A A .  49 VAL CG2  1 1 
        4  6347 1 1  49 VAL H    H -21.346 -25.873 -10.598 1.00 . A A .  49 VAL H    1 1 
        4  6348 1 1  49 VAL HA   H -20.551 -26.316 -13.352 1.00 . A A .  49 VAL HA   1 1 
        4  6349 1 1  49 VAL HB   H -19.261 -24.207 -13.490 1.00 . A A .  49 VAL HB   1 1 
        4  6350 1 1  49 VAL HG11 H -21.104 -22.800 -14.108 1.00 . A A .  49 VAL HG11 1 1 
        4  6351 1 1  49 VAL HG12 H -21.517 -24.468 -14.511 1.00 . A A .  49 VAL HG12 1 1 
        4  6352 1 1  49 VAL HG13 H -22.206 -23.711 -13.073 1.00 . A A .  49 VAL HG13 1 1 
        4  6353 1 1  49 VAL HG21 H -20.884 -23.268 -11.134 1.00 . A A .  49 VAL HG21 1 1 
        4  6354 1 1  49 VAL HG22 H -19.226 -23.856 -10.993 1.00 . A A .  49 VAL HG22 1 1 
        4  6355 1 1  49 VAL HG23 H -19.574 -22.422 -11.959 1.00 . A A .  49 VAL HG23 1 1 
        4  6356 1 1  49 VAL N    N -21.495 -25.881 -11.567 1.00 . A A .  49 VAL N    1 1 
        4  6357 1 1  49 VAL O    O -18.870 -26.094 -10.607 1.00 . A A .  49 VAL O    1 1 
        4  6358 1 1  50 LYS C    C -15.830 -26.385 -12.274 1.00 . A A .  50 LYS C    1 1 
        4  6359 1 1  50 LYS CA   C -16.953 -27.404 -12.119 1.00 . A A .  50 LYS CA   1 1 
        4  6360 1 1  50 LYS CB   C -16.594 -28.691 -12.865 1.00 . A A .  50 LYS CB   1 1 
        4  6361 1 1  50 LYS CD   C -16.839 -30.797 -11.518 1.00 . A A .  50 LYS CD   1 1 
        4  6362 1 1  50 LYS CE   C -17.864 -31.676 -10.818 1.00 . A A .  50 LYS CE   1 1 
        4  6363 1 1  50 LYS CG   C -17.496 -29.864 -12.522 1.00 . A A .  50 LYS CG   1 1 
        4  6364 1 1  50 LYS H    H -18.433 -26.962 -13.566 1.00 . A A .  50 LYS H    1 1 
        4  6365 1 1  50 LYS HA   H -17.077 -27.628 -11.071 1.00 . A A .  50 LYS HA   1 1 
        4  6366 1 1  50 LYS HB2  H -16.659 -28.503 -13.937 1.00 . A A .  50 LYS HB2  1 1 
        4  6367 1 1  50 LYS HB3  H -15.578 -28.962 -12.622 1.00 . A A .  50 LYS HB3  1 1 
        4  6368 1 1  50 LYS HD2  H -16.120 -31.430 -12.038 1.00 . A A .  50 LYS HD2  1 1 
        4  6369 1 1  50 LYS HD3  H -16.319 -30.205 -10.776 1.00 . A A .  50 LYS HD3  1 1 
        4  6370 1 1  50 LYS HE2  H -17.343 -32.419 -10.214 1.00 . A A .  50 LYS HE2  1 1 
        4  6371 1 1  50 LYS HE3  H -18.469 -31.057 -10.173 1.00 . A A .  50 LYS HE3  1 1 
        4  6372 1 1  50 LYS HG2  H -18.428 -29.486 -12.101 1.00 . A A .  50 LYS HG2  1 1 
        4  6373 1 1  50 LYS HG3  H -17.713 -30.418 -13.424 1.00 . A A .  50 LYS HG3  1 1 
        4  6374 1 1  50 LYS HZ1  H -19.492 -31.725 -12.128 1.00 . A A .  50 LYS HZ1  1 1 
        4  6375 1 1  50 LYS HZ2  H -19.203 -33.193 -11.338 1.00 . A A .  50 LYS HZ2  1 1 
        4  6376 1 1  50 LYS HZ3  H -18.199 -32.704 -12.607 1.00 . A A .  50 LYS HZ3  1 1 
        4  6377 1 1  50 LYS N    N -18.215 -26.866 -12.615 1.00 . A A .  50 LYS N    1 1 
        4  6378 1 1  50 LYS NZ   N -18.751 -32.373 -11.791 1.00 . A A .  50 LYS NZ   1 1 
        4  6379 1 1  50 LYS O    O -15.544 -25.920 -13.378 1.00 . A A .  50 LYS O    1 1 
        4  6380 1 1  51 CYS C    C -12.854 -25.656 -10.502 1.00 . A A .  51 CYS C    1 1 
        4  6381 1 1  51 CYS CA   C -14.097 -25.076 -11.170 1.00 . A A .  51 CYS CA   1 1 
        4  6382 1 1  51 CYS CB   C -14.518 -23.788 -10.460 1.00 . A A .  51 CYS CB   1 1 
        4  6383 1 1  51 CYS H    H -15.464 -26.444 -10.309 1.00 . A A .  51 CYS H    1 1 
        4  6384 1 1  51 CYS HA   H -13.864 -24.850 -12.200 1.00 . A A .  51 CYS HA   1 1 
        4  6385 1 1  51 CYS HB2  H -13.803 -23.004 -10.710 1.00 . A A .  51 CYS HB2  1 1 
        4  6386 1 1  51 CYS HB3  H -15.492 -23.492 -10.817 1.00 . A A .  51 CYS HB3  1 1 
        4  6387 1 1  51 CYS HG   H -14.688 -25.224  -8.307 1.00 . A A .  51 CYS HG   1 1 
        4  6388 1 1  51 CYS N    N -15.191 -26.041 -11.160 1.00 . A A .  51 CYS N    1 1 
        4  6389 1 1  51 CYS O    O -12.904 -26.731  -9.902 1.00 . A A .  51 CYS O    1 1 
        4  6390 1 1  51 CYS SG   S -14.608 -23.934  -8.647 1.00 . A A .  51 CYS SG   1 1 
        4  6391 1 1  52 ARG C    C -10.039 -24.427  -8.914 1.00 . A A .  52 ARG C    1 1 
        4  6392 1 1  52 ARG CA   C -10.485 -25.382 -10.017 1.00 . A A .  52 ARG CA   1 1 
        4  6393 1 1  52 ARG CB   C  -9.400 -25.485 -11.089 1.00 . A A .  52 ARG CB   1 1 
        4  6394 1 1  52 ARG CD   C  -9.743 -27.915 -11.633 1.00 . A A .  52 ARG CD   1 1 
        4  6395 1 1  52 ARG CG   C  -8.752 -26.859 -11.170 1.00 . A A .  52 ARG CG   1 1 
        4  6396 1 1  52 ARG CZ   C -10.364 -28.979 -13.761 1.00 . A A .  52 ARG CZ   1 1 
        4  6397 1 1  52 ARG H    H -11.766 -24.091 -11.101 1.00 . A A .  52 ARG H    1 1 
        4  6398 1 1  52 ARG HA   H -10.649 -26.359  -9.587 1.00 . A A .  52 ARG HA   1 1 
        4  6399 1 1  52 ARG HB2  H  -9.841 -25.250 -12.057 1.00 . A A .  52 ARG HB2  1 1 
        4  6400 1 1  52 ARG HB3  H  -8.629 -24.761 -10.875 1.00 . A A .  52 ARG HB3  1 1 
        4  6401 1 1  52 ARG HD2  H  -9.688 -28.772 -10.963 1.00 . A A .  52 ARG HD2  1 1 
        4  6402 1 1  52 ARG HD3  H -10.738 -27.498 -11.592 1.00 . A A .  52 ARG HD3  1 1 
        4  6403 1 1  52 ARG HE   H  -8.577 -28.188 -13.362 1.00 . A A .  52 ARG HE   1 1 
        4  6404 1 1  52 ARG HG2  H  -7.917 -26.820 -11.870 1.00 . A A .  52 ARG HG2  1 1 
        4  6405 1 1  52 ARG HG3  H  -8.381 -27.129 -10.193 1.00 . A A .  52 ARG HG3  1 1 
        4  6406 1 1  52 ARG HH11 H -11.827 -28.943 -12.369 1.00 . A A .  52 ARG HH11 1 1 
        4  6407 1 1  52 ARG HH12 H -12.253 -29.690 -13.873 1.00 . A A .  52 ARG HH12 1 1 
        4  6408 1 1  52 ARG HH21 H  -9.125 -29.167 -15.347 1.00 . A A .  52 ARG HH21 1 1 
        4  6409 1 1  52 ARG HH22 H -10.715 -29.817 -15.566 1.00 . A A .  52 ARG HH22 1 1 
        4  6410 1 1  52 ARG N    N -11.741 -24.939 -10.609 1.00 . A A .  52 ARG N    1 1 
        4  6411 1 1  52 ARG NE   N  -9.471 -28.360 -12.999 1.00 . A A .  52 ARG NE   1 1 
        4  6412 1 1  52 ARG NH1  N -11.581 -29.224 -13.296 1.00 . A A .  52 ARG NH1  1 1 
        4  6413 1 1  52 ARG NH2  N -10.042 -29.351 -14.992 1.00 . A A .  52 ARG NH2  1 1 
        4  6414 1 1  52 ARG O    O -10.052 -23.209  -9.090 1.00 . A A .  52 ARG O    1 1 
        4  6415 1 1  53 VAL C    C  -7.703 -24.405  -6.379 1.00 . A A .  53 VAL C    1 1 
        4  6416 1 1  53 VAL CA   C  -9.188 -24.189  -6.646 1.00 . A A .  53 VAL CA   1 1 
        4  6417 1 1  53 VAL CB   C  -9.982 -24.522  -5.368 1.00 . A A .  53 VAL CB   1 1 
        4  6418 1 1  53 VAL CG1  C  -9.701 -23.496  -4.282 1.00 . A A .  53 VAL CG1  1 1 
        4  6419 1 1  53 VAL CG2  C -11.471 -24.594  -5.672 1.00 . A A .  53 VAL CG2  1 1 
        4  6420 1 1  53 VAL H    H  -9.651 -25.966  -7.697 1.00 . A A .  53 VAL H    1 1 
        4  6421 1 1  53 VAL HA   H  -9.354 -23.148  -6.886 1.00 . A A .  53 VAL HA   1 1 
        4  6422 1 1  53 VAL HB   H  -9.662 -25.490  -5.012 1.00 . A A .  53 VAL HB   1 1 
        4  6423 1 1  53 VAL HG11 H -10.337 -22.636  -4.426 1.00 . A A .  53 VAL HG11 1 1 
        4  6424 1 1  53 VAL HG12 H  -9.898 -23.934  -3.314 1.00 . A A .  53 VAL HG12 1 1 
        4  6425 1 1  53 VAL HG13 H  -8.666 -23.191  -4.335 1.00 . A A .  53 VAL HG13 1 1 
        4  6426 1 1  53 VAL HG21 H -11.793 -25.625  -5.654 1.00 . A A .  53 VAL HG21 1 1 
        4  6427 1 1  53 VAL HG22 H -12.016 -24.033  -4.928 1.00 . A A .  53 VAL HG22 1 1 
        4  6428 1 1  53 VAL HG23 H -11.661 -24.176  -6.649 1.00 . A A .  53 VAL HG23 1 1 
        4  6429 1 1  53 VAL N    N  -9.641 -24.990  -7.778 1.00 . A A .  53 VAL N    1 1 
        4  6430 1 1  53 VAL O    O  -7.310 -25.096  -5.438 1.00 . A A .  53 VAL O    1 1 
        4  6431 1 1  54 PRO C    C  -4.863 -23.171  -5.879 1.00 . A A .  54 PRO C    1 1 
        4  6432 1 1  54 PRO CA   C  -5.399 -23.911  -7.100 1.00 . A A .  54 PRO CA   1 1 
        4  6433 1 1  54 PRO CB   C  -4.881 -23.264  -8.387 1.00 . A A .  54 PRO CB   1 1 
        4  6434 1 1  54 PRO CD   C  -7.254 -22.962  -8.367 1.00 . A A .  54 PRO CD   1 1 
        4  6435 1 1  54 PRO CG   C  -5.962 -22.324  -8.798 1.00 . A A .  54 PRO CG   1 1 
        4  6436 1 1  54 PRO HA   H  -5.081 -24.943  -7.060 1.00 . A A .  54 PRO HA   1 1 
        4  6437 1 1  54 PRO HB2  H  -3.958 -22.718  -8.191 1.00 . A A .  54 PRO HB2  1 1 
        4  6438 1 1  54 PRO HB3  H  -4.716 -24.025  -9.135 1.00 . A A .  54 PRO HB3  1 1 
        4  6439 1 1  54 PRO HD2  H  -7.972 -22.204  -8.056 1.00 . A A .  54 PRO HD2  1 1 
        4  6440 1 1  54 PRO HD3  H  -7.660 -23.568  -9.165 1.00 . A A .  54 PRO HD3  1 1 
        4  6441 1 1  54 PRO HG2  H  -5.833 -21.362  -8.301 1.00 . A A .  54 PRO HG2  1 1 
        4  6442 1 1  54 PRO HG3  H  -5.946 -22.195  -9.870 1.00 . A A .  54 PRO HG3  1 1 
        4  6443 1 1  54 PRO N    N  -6.855 -23.800  -7.224 1.00 . A A .  54 PRO N    1 1 
        4  6444 1 1  54 PRO O    O  -5.400 -22.134  -5.485 1.00 . A A .  54 PRO O    1 1 
        4  6445 1 1  55 CYS C    C  -2.212 -22.002  -4.510 1.00 . A A .  55 CYS C    1 1 
        4  6446 1 1  55 CYS CA   C  -3.195 -23.097  -4.108 1.00 . A A .  55 CYS CA   1 1 
        4  6447 1 1  55 CYS CB   C  -2.479 -24.159  -3.270 1.00 . A A .  55 CYS CB   1 1 
        4  6448 1 1  55 CYS H    H  -3.421 -24.536  -5.646 1.00 . A A .  55 CYS H    1 1 
        4  6449 1 1  55 CYS HA   H  -3.984 -22.657  -3.518 1.00 . A A .  55 CYS HA   1 1 
        4  6450 1 1  55 CYS HB2  H  -2.289 -25.028  -3.899 1.00 . A A .  55 CYS HB2  1 1 
        4  6451 1 1  55 CYS HB3  H  -1.533 -23.763  -2.934 1.00 . A A .  55 CYS HB3  1 1 
        4  6452 1 1  55 CYS HG   H  -3.291 -23.779  -0.836 1.00 . A A .  55 CYS HG   1 1 
        4  6453 1 1  55 CYS N    N  -3.804 -23.707  -5.285 1.00 . A A .  55 CYS N    1 1 
        4  6454 1 1  55 CYS O    O  -1.657 -22.025  -5.608 1.00 . A A .  55 CYS O    1 1 
        4  6455 1 1  55 CYS SG   S  -3.409 -24.697  -1.799 1.00 . A A .  55 CYS SG   1 1 
        4  6456 1 1  56 ASN C    C  -1.535 -19.137  -5.091 1.00 . A A .  56 ASN C    1 1 
        4  6457 1 1  56 ASN CA   C  -1.087 -19.940  -3.875 1.00 . A A .  56 ASN CA   1 1 
        4  6458 1 1  56 ASN CB   C   0.333 -20.467  -4.094 1.00 . A A .  56 ASN CB   1 1 
        4  6459 1 1  56 ASN CG   C   0.749 -21.464  -3.028 1.00 . A A .  56 ASN CG   1 1 
        4  6460 1 1  56 ASN H    H  -2.475 -21.080  -2.755 1.00 . A A .  56 ASN H    1 1 
        4  6461 1 1  56 ASN HA   H  -1.092 -19.294  -3.010 1.00 . A A .  56 ASN HA   1 1 
        4  6462 1 1  56 ASN HB2  H   0.384 -20.951  -5.069 1.00 . A A .  56 ASN HB2  1 1 
        4  6463 1 1  56 ASN HB3  H   1.025 -19.640  -4.077 1.00 . A A .  56 ASN HB3  1 1 
        4  6464 1 1  56 ASN HD21 H   0.108 -20.240  -1.598 1.00 . A A .  56 ASN HD21 1 1 
        4  6465 1 1  56 ASN HD22 H   0.784 -21.735  -1.060 1.00 . A A .  56 ASN HD22 1 1 
        4  6466 1 1  56 ASN N    N  -2.003 -21.044  -3.614 1.00 . A A .  56 ASN N    1 1 
        4  6467 1 1  56 ASN ND2  N   0.525 -21.111  -1.768 1.00 . A A .  56 ASN ND2  1 1 
        4  6468 1 1  56 ASN O    O  -1.014 -19.317  -6.193 1.00 . A A .  56 ASN O    1 1 
        4  6469 1 1  56 ASN OD1  O   1.266 -22.539  -3.335 1.00 . A A .  56 ASN OD1  1 1 
        4  6470 1 1  57 TRP C    C  -1.997 -16.374  -6.389 1.00 . A A .  57 TRP C    1 1 
        4  6471 1 1  57 TRP CA   C  -3.022 -17.420  -5.966 1.00 . A A .  57 TRP CA   1 1 
        4  6472 1 1  57 TRP CB   C  -4.320 -16.737  -5.533 1.00 . A A .  57 TRP CB   1 1 
        4  6473 1 1  57 TRP CD1  C  -6.016 -18.656  -5.593 1.00 . A A .  57 TRP CD1  1 1 
        4  6474 1 1  57 TRP CD2  C  -6.475 -16.979  -7.004 1.00 . A A .  57 TRP CD2  1 1 
        4  6475 1 1  57 TRP CE2  C  -7.476 -17.963  -7.134 1.00 . A A .  57 TRP CE2  1 1 
        4  6476 1 1  57 TRP CE3  C  -6.555 -15.829  -7.794 1.00 . A A .  57 TRP CE3  1 1 
        4  6477 1 1  57 TRP CG   C  -5.552 -17.443  -6.012 1.00 . A A .  57 TRP CG   1 1 
        4  6478 1 1  57 TRP CH2  C  -8.593 -16.692  -8.782 1.00 . A A .  57 TRP CH2  1 1 
        4  6479 1 1  57 TRP CZ2  C  -8.541 -17.828  -8.022 1.00 . A A .  57 TRP CZ2  1 1 
        4  6480 1 1  57 TRP CZ3  C  -7.610 -15.697  -8.674 1.00 . A A .  57 TRP CZ3  1 1 
        4  6481 1 1  57 TRP H    H  -2.878 -18.155  -3.985 1.00 . A A .  57 TRP H    1 1 
        4  6482 1 1  57 TRP HA   H  -3.229 -18.064  -6.808 1.00 . A A .  57 TRP HA   1 1 
        4  6483 1 1  57 TRP HB2  H  -4.344 -16.687  -4.445 1.00 . A A .  57 TRP HB2  1 1 
        4  6484 1 1  57 TRP HB3  H  -4.337 -15.732  -5.928 1.00 . A A .  57 TRP HB3  1 1 
        4  6485 1 1  57 TRP HD1  H  -5.535 -19.267  -4.844 1.00 . A A .  57 TRP HD1  1 1 
        4  6486 1 1  57 TRP HE1  H  -7.697 -19.794  -6.136 1.00 . A A .  57 TRP HE1  1 1 
        4  6487 1 1  57 TRP HE3  H  -5.809 -15.052  -7.724 1.00 . A A .  57 TRP HE3  1 1 
        4  6488 1 1  57 TRP HH2  H  -9.400 -16.545  -9.483 1.00 . A A .  57 TRP HH2  1 1 
        4  6489 1 1  57 TRP HZ2  H  -9.305 -18.585  -8.116 1.00 . A A .  57 TRP HZ2  1 1 
        4  6490 1 1  57 TRP HZ3  H  -7.689 -14.815  -9.292 1.00 . A A .  57 TRP HZ3  1 1 
        4  6491 1 1  57 TRP N    N  -2.504 -18.252  -4.886 1.00 . A A .  57 TRP N    1 1 
        4  6492 1 1  57 TRP NE1  N  -7.173 -18.975  -6.263 1.00 . A A .  57 TRP NE1  1 1 
        4  6493 1 1  57 TRP O    O  -1.001 -16.152  -5.698 1.00 . A A .  57 TRP O    1 1 
        4  6494 1 1  58 LYS C    C   0.050 -15.273  -8.265 1.00 . A A .  58 LYS C    1 1 
        4  6495 1 1  58 LYS CA   C  -1.347 -14.705  -8.037 1.00 . A A .  58 LYS CA   1 1 
        4  6496 1 1  58 LYS CB   C  -1.278 -13.526  -7.065 1.00 . A A .  58 LYS CB   1 1 
        4  6497 1 1  58 LYS CD   C  -3.000 -11.758  -7.532 1.00 . A A .  58 LYS CD   1 1 
        4  6498 1 1  58 LYS CE   C  -3.401 -10.685  -8.534 1.00 . A A .  58 LYS CE   1 1 
        4  6499 1 1  58 LYS CG   C  -1.554 -12.182  -7.719 1.00 . A A .  58 LYS CG   1 1 
        4  6500 1 1  58 LYS H    H  -3.058 -15.952  -8.029 1.00 . A A .  58 LYS H    1 1 
        4  6501 1 1  58 LYS HA   H  -1.741 -14.361  -8.982 1.00 . A A .  58 LYS HA   1 1 
        4  6502 1 1  58 LYS HB2  H  -2.008 -13.684  -6.272 1.00 . A A .  58 LYS HB2  1 1 
        4  6503 1 1  58 LYS HB3  H  -0.291 -13.493  -6.626 1.00 . A A .  58 LYS HB3  1 1 
        4  6504 1 1  58 LYS HD2  H  -3.647 -12.626  -7.659 1.00 . A A .  58 LYS HD2  1 1 
        4  6505 1 1  58 LYS HD3  H  -3.125 -11.366  -6.531 1.00 . A A .  58 LYS HD3  1 1 
        4  6506 1 1  58 LYS HE2  H  -3.262  -9.704  -8.080 1.00 . A A .  58 LYS HE2  1 1 
        4  6507 1 1  58 LYS HE3  H  -2.762 -10.766  -9.402 1.00 . A A .  58 LYS HE3  1 1 
        4  6508 1 1  58 LYS HG2  H  -0.901 -11.430  -7.277 1.00 . A A .  58 LYS HG2  1 1 
        4  6509 1 1  58 LYS HG3  H  -1.344 -12.257  -8.777 1.00 . A A .  58 LYS HG3  1 1 
        4  6510 1 1  58 LYS HZ1  H  -5.125 -11.817  -8.866 1.00 . A A .  58 LYS HZ1  1 1 
        4  6511 1 1  58 LYS HZ2  H  -4.924 -10.539  -9.956 1.00 . A A .  58 LYS HZ2  1 1 
        4  6512 1 1  58 LYS HZ3  H  -5.432 -10.228  -8.372 1.00 . A A .  58 LYS HZ3  1 1 
        4  6513 1 1  58 LYS N    N  -2.247 -15.731  -7.523 1.00 . A A .  58 LYS N    1 1 
        4  6514 1 1  58 LYS NZ   N  -4.820 -10.827  -8.962 1.00 . A A .  58 LYS NZ   1 1 
        4  6515 1 1  58 LYS O    O   0.312 -16.440  -7.975 1.00 . A A .  58 LYS O    1 1 
        4  6516 1 1  59 LYS C    C   3.238 -14.451  -7.900 1.00 . A A .  59 LYS C    1 1 
        4  6517 1 1  59 LYS CA   C   2.318 -14.854  -9.046 1.00 . A A .  59 LYS CA   1 1 
        4  6518 1 1  59 LYS CB   C   2.816 -14.239 -10.356 1.00 . A A .  59 LYS CB   1 1 
        4  6519 1 1  59 LYS CD   C   3.041 -15.086 -12.710 1.00 . A A .  59 LYS CD   1 1 
        4  6520 1 1  59 LYS CE   C   4.070 -15.628 -13.689 1.00 . A A .  59 LYS CE   1 1 
        4  6521 1 1  59 LYS CG   C   3.507 -15.234 -11.272 1.00 . A A .  59 LYS CG   1 1 
        4  6522 1 1  59 LYS H    H   0.676 -13.518  -8.992 1.00 . A A .  59 LYS H    1 1 
        4  6523 1 1  59 LYS HA   H   2.326 -15.929  -9.137 1.00 . A A .  59 LYS HA   1 1 
        4  6524 1 1  59 LYS HB2  H   1.966 -13.808 -10.885 1.00 . A A .  59 LYS HB2  1 1 
        4  6525 1 1  59 LYS HB3  H   3.516 -13.449 -10.124 1.00 . A A .  59 LYS HB3  1 1 
        4  6526 1 1  59 LYS HD2  H   2.105 -15.631 -12.839 1.00 . A A .  59 LYS HD2  1 1 
        4  6527 1 1  59 LYS HD3  H   2.872 -14.039 -12.919 1.00 . A A .  59 LYS HD3  1 1 
        4  6528 1 1  59 LYS HE2  H   4.309 -14.853 -14.417 1.00 . A A .  59 LYS HE2  1 1 
        4  6529 1 1  59 LYS HE3  H   4.966 -15.887 -13.142 1.00 . A A .  59 LYS HE3  1 1 
        4  6530 1 1  59 LYS HG2  H   4.584 -15.073 -11.227 1.00 . A A .  59 LYS HG2  1 1 
        4  6531 1 1  59 LYS HG3  H   3.285 -16.236 -10.932 1.00 . A A .  59 LYS HG3  1 1 
        4  6532 1 1  59 LYS HZ1  H   3.430 -16.617 -15.413 1.00 . A A .  59 LYS HZ1  1 1 
        4  6533 1 1  59 LYS HZ2  H   2.668 -17.144 -13.999 1.00 . A A .  59 LYS HZ2  1 1 
        4  6534 1 1  59 LYS HZ3  H   4.261 -17.608 -14.324 1.00 . A A .  59 LYS HZ3  1 1 
        4  6535 1 1  59 LYS N    N   0.945 -14.438  -8.782 1.00 . A A .  59 LYS N    1 1 
        4  6536 1 1  59 LYS NZ   N   3.573 -16.834 -14.406 1.00 . A A .  59 LYS NZ   1 1 
        4  6537 1 1  59 LYS O    O   2.916 -13.556  -7.119 1.00 . A A .  59 LYS O    1 1 
        4  6538 1 1  60 GLU C    C   6.335 -13.747  -7.202 1.00 . A A .  60 GLU C    1 1 
        4  6539 1 1  60 GLU CA   C   5.353 -14.824  -6.753 1.00 . A A .  60 GLU CA   1 1 
        4  6540 1 1  60 GLU CB   C   6.113 -16.094  -6.365 1.00 . A A .  60 GLU CB   1 1 
        4  6541 1 1  60 GLU CD   C   7.662 -17.935  -7.138 1.00 . A A .  60 GLU CD   1 1 
        4  6542 1 1  60 GLU CG   C   7.125 -16.542  -7.406 1.00 . A A .  60 GLU CG   1 1 
        4  6543 1 1  60 GLU H    H   4.586 -15.819  -8.458 1.00 . A A .  60 GLU H    1 1 
        4  6544 1 1  60 GLU HA   H   4.808 -14.464  -5.894 1.00 . A A .  60 GLU HA   1 1 
        4  6545 1 1  60 GLU HB2  H   6.636 -15.914  -5.425 1.00 . A A .  60 GLU HB2  1 1 
        4  6546 1 1  60 GLU HB3  H   5.403 -16.894  -6.217 1.00 . A A .  60 GLU HB3  1 1 
        4  6547 1 1  60 GLU HG2  H   6.652 -16.529  -8.387 1.00 . A A .  60 GLU HG2  1 1 
        4  6548 1 1  60 GLU HG3  H   7.952 -15.847  -7.406 1.00 . A A .  60 GLU HG3  1 1 
        4  6549 1 1  60 GLU N    N   4.386 -15.116  -7.804 1.00 . A A .  60 GLU N    1 1 
        4  6550 1 1  60 GLU O    O   6.236 -13.221  -8.311 1.00 . A A .  60 GLU O    1 1 
        4  6551 1 1  60 GLU OE1  O   6.901 -18.908  -7.319 1.00 . A A .  60 GLU OE1  1 1 
        4  6552 1 1  60 GLU OE2  O   8.842 -18.050  -6.747 1.00 . A A .  60 GLU OE2  1 1 
        4  6553 1 1  61 PHE C    C   8.970 -12.697  -7.968 1.00 . A A .  61 PHE C    1 1 
        4  6554 1 1  61 PHE CA   C   8.286 -12.405  -6.634 1.00 . A A .  61 PHE CA   1 1 
        4  6555 1 1  61 PHE CB   C   9.329 -12.335  -5.517 1.00 . A A .  61 PHE CB   1 1 
        4  6556 1 1  61 PHE CD1  C  11.290 -13.797  -6.079 1.00 . A A .  61 PHE CD1  1 1 
        4  6557 1 1  61 PHE CD2  C   9.701 -14.595  -4.490 1.00 . A A .  61 PHE CD2  1 1 
        4  6558 1 1  61 PHE CE1  C  12.023 -14.960  -5.936 1.00 . A A .  61 PHE CE1  1 1 
        4  6559 1 1  61 PHE CE2  C  10.430 -15.759  -4.342 1.00 . A A .  61 PHE CE2  1 1 
        4  6560 1 1  61 PHE CG   C  10.123 -13.600  -5.358 1.00 . A A .  61 PHE CG   1 1 
        4  6561 1 1  61 PHE CZ   C  11.591 -15.942  -5.067 1.00 . A A .  61 PHE CZ   1 1 
        4  6562 1 1  61 PHE H    H   7.313 -13.875  -5.462 1.00 . A A .  61 PHE H    1 1 
        4  6563 1 1  61 PHE HA   H   7.781 -11.454  -6.704 1.00 . A A .  61 PHE HA   1 1 
        4  6564 1 1  61 PHE HB2  H  10.015 -11.516  -5.730 1.00 . A A .  61 PHE HB2  1 1 
        4  6565 1 1  61 PHE HB3  H   8.830 -12.136  -4.581 1.00 . A A .  61 PHE HB3  1 1 
        4  6566 1 1  61 PHE HD1  H  11.628 -13.028  -6.761 1.00 . A A .  61 PHE HD1  1 1 
        4  6567 1 1  61 PHE HD2  H   8.793 -14.452  -3.923 1.00 . A A .  61 PHE HD2  1 1 
        4  6568 1 1  61 PHE HE1  H  12.930 -15.100  -6.504 1.00 . A A .  61 PHE HE1  1 1 
        4  6569 1 1  61 PHE HE2  H  10.091 -16.526  -3.662 1.00 . A A .  61 PHE HE2  1 1 
        4  6570 1 1  61 PHE HZ   H  12.163 -16.851  -4.952 1.00 . A A .  61 PHE HZ   1 1 
        4  6571 1 1  61 PHE N    N   7.285 -13.421  -6.331 1.00 . A A .  61 PHE N    1 1 
        4  6572 1 1  61 PHE O    O   9.003 -13.839  -8.424 1.00 . A A .  61 PHE O    1 1 
        4  6573 1 1  62 GLY C    C  11.241 -10.754 -10.101 1.00 . A A .  62 GLY C    1 1 
        4  6574 1 1  62 GLY CA   C  10.189 -11.818  -9.862 1.00 . A A .  62 GLY CA   1 1 
        4  6575 1 1  62 GLY H    H   9.456 -10.766  -8.175 1.00 . A A .  62 GLY H    1 1 
        4  6576 1 1  62 GLY HA2  H  10.663 -12.788  -9.883 1.00 . A A .  62 GLY HA2  1 1 
        4  6577 1 1  62 GLY HA3  H   9.457 -11.768 -10.653 1.00 . A A .  62 GLY HA3  1 1 
        4  6578 1 1  62 GLY N    N   9.514 -11.654  -8.587 1.00 . A A .  62 GLY N    1 1 
        4  6579 1 1  62 GLY O    O  12.344 -11.053 -10.559 1.00 . A A .  62 GLY O    1 1 
        4  6580 1 1  63 ALA C    C  11.402  -7.187  -9.146 1.00 . A A .  63 ALA C    1 1 
        4  6581 1 1  63 ALA CA   C  11.823  -8.394  -9.978 1.00 . A A .  63 ALA CA   1 1 
        4  6582 1 1  63 ALA CB   C  11.909  -8.019 -11.450 1.00 . A A .  63 ALA CB   1 1 
        4  6583 1 1  63 ALA H    H  10.007  -9.332  -9.432 1.00 . A A .  63 ALA H    1 1 
        4  6584 1 1  63 ALA HA   H  12.803  -8.717  -9.657 1.00 . A A .  63 ALA HA   1 1 
        4  6585 1 1  63 ALA HB1  H  12.032  -8.912 -12.042 1.00 . A A .  63 ALA HB1  1 1 
        4  6586 1 1  63 ALA HB2  H  11.002  -7.512 -11.745 1.00 . A A .  63 ALA HB2  1 1 
        4  6587 1 1  63 ALA HB3  H  12.753  -7.363 -11.605 1.00 . A A .  63 ALA HB3  1 1 
        4  6588 1 1  63 ALA N    N  10.900  -9.506  -9.793 1.00 . A A .  63 ALA N    1 1 
        4  6589 1 1  63 ALA O    O  10.220  -6.999  -8.863 1.00 . A A .  63 ALA O    1 1 
        4  6590 1 1  64 ASP C    C  12.649  -3.935  -8.643 1.00 . A A .  64 ASP C    1 1 
        4  6591 1 1  64 ASP CA   C  12.109  -5.185  -7.956 1.00 . A A .  64 ASP CA   1 1 
        4  6592 1 1  64 ASP CB   C  12.731  -5.328  -6.566 1.00 . A A .  64 ASP CB   1 1 
        4  6593 1 1  64 ASP CG   C  12.120  -6.465  -5.772 1.00 . A A .  64 ASP CG   1 1 
        4  6594 1 1  64 ASP H    H  13.302  -6.577  -9.013 1.00 . A A .  64 ASP H    1 1 
        4  6595 1 1  64 ASP HA   H  11.039  -5.090  -7.853 1.00 . A A .  64 ASP HA   1 1 
        4  6596 1 1  64 ASP HB2  H  13.801  -5.508  -6.675 1.00 . A A .  64 ASP HB2  1 1 
        4  6597 1 1  64 ASP HB3  H  12.585  -4.410  -6.017 1.00 . A A .  64 ASP HB3  1 1 
        4  6598 1 1  64 ASP N    N  12.378  -6.374  -8.756 1.00 . A A .  64 ASP N    1 1 
        4  6599 1 1  64 ASP O    O  11.909  -2.983  -8.895 1.00 . A A .  64 ASP O    1 1 
        4  6600 1 1  64 ASP OD1  O  12.398  -7.638  -6.102 1.00 . A A .  64 ASP OD1  1 1 
        4  6601 1 1  64 ASP OD2  O  11.364  -6.184  -4.819 1.00 . A A .  64 ASP OD2  1 1 
        4  6602 1 1  65 CYS C    C  15.674  -3.279 -10.556 1.00 . A A .  65 CYS C    1 1 
        4  6603 1 1  65 CYS CA   C  14.583  -2.808  -9.598 1.00 . A A .  65 CYS CA   1 1 
        4  6604 1 1  65 CYS CB   C  15.178  -1.859  -8.557 1.00 . A A .  65 CYS CB   1 1 
        4  6605 1 1  65 CYS H    H  14.481  -4.730  -8.716 1.00 . A A .  65 CYS H    1 1 
        4  6606 1 1  65 CYS HA   H  13.828  -2.281 -10.162 1.00 . A A .  65 CYS HA   1 1 
        4  6607 1 1  65 CYS HB2  H  14.890  -2.206  -7.564 1.00 . A A .  65 CYS HB2  1 1 
        4  6608 1 1  65 CYS HB3  H  16.254  -1.884  -8.632 1.00 . A A .  65 CYS HB3  1 1 
        4  6609 1 1  65 CYS HG   H  14.439   0.141 -10.034 1.00 . A A .  65 CYS HG   1 1 
        4  6610 1 1  65 CYS N    N  13.943  -3.941  -8.942 1.00 . A A .  65 CYS N    1 1 
        4  6611 1 1  65 CYS O    O  16.486  -4.139 -10.216 1.00 . A A .  65 CYS O    1 1 
        4  6612 1 1  65 CYS SG   S  14.648  -0.126  -8.741 1.00 . A A .  65 CYS SG   1 1 
        4  6613 1 1  66 LYS C    C  17.906  -2.169 -12.662 1.00 . A A .  66 LYS C    1 1 
        4  6614 1 1  66 LYS CA   C  16.677  -3.067 -12.764 1.00 . A A .  66 LYS CA   1 1 
        4  6615 1 1  66 LYS CB   C  16.071  -2.962 -14.165 1.00 . A A .  66 LYS CB   1 1 
        4  6616 1 1  66 LYS CD   C  15.770  -5.376 -14.792 1.00 . A A .  66 LYS CD   1 1 
        4  6617 1 1  66 LYS CE   C  15.054  -5.917 -16.019 1.00 . A A .  66 LYS CE   1 1 
        4  6618 1 1  66 LYS CG   C  16.501  -4.080 -15.098 1.00 . A A .  66 LYS CG   1 1 
        4  6619 1 1  66 LYS H    H  15.012  -2.030 -11.969 1.00 . A A .  66 LYS H    1 1 
        4  6620 1 1  66 LYS HA   H  16.977  -4.088 -12.586 1.00 . A A .  66 LYS HA   1 1 
        4  6621 1 1  66 LYS HB2  H  14.985  -2.980 -14.077 1.00 . A A .  66 LYS HB2  1 1 
        4  6622 1 1  66 LYS HB3  H  16.368  -2.021 -14.603 1.00 . A A .  66 LYS HB3  1 1 
        4  6623 1 1  66 LYS HD2  H  16.489  -6.117 -14.443 1.00 . A A .  66 LYS HD2  1 1 
        4  6624 1 1  66 LYS HD3  H  15.043  -5.194 -14.013 1.00 . A A .  66 LYS HD3  1 1 
        4  6625 1 1  66 LYS HE2  H  14.417  -5.135 -16.433 1.00 . A A .  66 LYS HE2  1 1 
        4  6626 1 1  66 LYS HE3  H  15.793  -6.197 -16.756 1.00 . A A .  66 LYS HE3  1 1 
        4  6627 1 1  66 LYS HG2  H  16.292  -3.787 -16.127 1.00 . A A .  66 LYS HG2  1 1 
        4  6628 1 1  66 LYS HG3  H  17.563  -4.241 -14.985 1.00 . A A .  66 LYS HG3  1 1 
        4  6629 1 1  66 LYS HZ1  H  13.210  -6.875 -15.808 1.00 . A A .  66 LYS HZ1  1 1 
        4  6630 1 1  66 LYS HZ2  H  14.387  -7.405 -14.714 1.00 . A A .  66 LYS HZ2  1 1 
        4  6631 1 1  66 LYS HZ3  H  14.455  -7.893 -16.331 1.00 . A A .  66 LYS HZ3  1 1 
        4  6632 1 1  66 LYS N    N  15.687  -2.708 -11.756 1.00 . A A .  66 LYS N    1 1 
        4  6633 1 1  66 LYS NZ   N  14.218  -7.106 -15.696 1.00 . A A .  66 LYS NZ   1 1 
        4  6634 1 1  66 LYS O    O  17.793  -0.974 -12.387 1.00 . A A .  66 LYS O    1 1 
        4  6635 1 1  67 TYR C    C  21.138  -2.177 -14.102 1.00 . A A .  67 TYR C    1 1 
        4  6636 1 1  67 TYR CA   C  20.328  -2.003 -12.819 1.00 . A A .  67 TYR CA   1 1 
        4  6637 1 1  67 TYR CB   C  21.156  -2.459 -11.615 1.00 . A A .  67 TYR CB   1 1 
        4  6638 1 1  67 TYR CD1  C  19.774  -2.056  -9.540 1.00 . A A .  67 TYR CD1  1 1 
        4  6639 1 1  67 TYR CD2  C  21.631  -0.618  -9.952 1.00 . A A .  67 TYR CD2  1 1 
        4  6640 1 1  67 TYR CE1  C  19.489  -1.361  -8.381 1.00 . A A .  67 TYR CE1  1 1 
        4  6641 1 1  67 TYR CE2  C  21.355   0.080  -8.793 1.00 . A A .  67 TYR CE2  1 1 
        4  6642 1 1  67 TYR CG   C  20.848  -1.697 -10.347 1.00 . A A .  67 TYR CG   1 1 
        4  6643 1 1  67 TYR CZ   C  20.281  -0.295  -8.012 1.00 . A A .  67 TYR CZ   1 1 
        4  6644 1 1  67 TYR H    H  19.104  -3.707 -13.102 1.00 . A A .  67 TYR H    1 1 
        4  6645 1 1  67 TYR HA   H  20.084  -0.957 -12.701 1.00 . A A .  67 TYR HA   1 1 
        4  6646 1 1  67 TYR HB2  H  20.968  -3.518 -11.442 1.00 . A A .  67 TYR HB2  1 1 
        4  6647 1 1  67 TYR HB3  H  22.204  -2.324 -11.838 1.00 . A A .  67 TYR HB3  1 1 
        4  6648 1 1  67 TYR HD1  H  19.156  -2.892  -9.833 1.00 . A A .  67 TYR HD1  1 1 
        4  6649 1 1  67 TYR HD2  H  22.470  -0.328 -10.568 1.00 . A A .  67 TYR HD2  1 1 
        4  6650 1 1  67 TYR HE1  H  18.650  -1.656  -7.767 1.00 . A A .  67 TYR HE1  1 1 
        4  6651 1 1  67 TYR HE2  H  21.974   0.915  -8.504 1.00 . A A .  67 TYR HE2  1 1 
        4  6652 1 1  67 TYR HH   H  19.052   0.425  -6.722 1.00 . A A .  67 TYR HH   1 1 
        4  6653 1 1  67 TYR N    N  19.078  -2.750 -12.886 1.00 . A A .  67 TYR N    1 1 
        4  6654 1 1  67 TYR O    O  20.814  -3.014 -14.945 1.00 . A A .  67 TYR O    1 1 
        4  6655 1 1  67 TYR OH   O  20.001   0.397  -6.855 1.00 . A A .  67 TYR OH   1 1 
        4  6656 1 1  68 LYS C    C  24.377  -2.116 -15.087 1.00 . A A .  68 LYS C    1 1 
        4  6657 1 1  68 LYS CA   C  23.048  -1.444 -15.418 1.00 . A A .  68 LYS CA   1 1 
        4  6658 1 1  68 LYS CB   C  23.300  -0.039 -15.970 1.00 . A A .  68 LYS CB   1 1 
        4  6659 1 1  68 LYS CD   C  25.349   0.520 -17.311 1.00 . A A .  68 LYS CD   1 1 
        4  6660 1 1  68 LYS CE   C  26.179   0.009 -18.478 1.00 . A A .  68 LYS CE   1 1 
        4  6661 1 1  68 LYS CG   C  23.934  -0.031 -17.350 1.00 . A A .  68 LYS CG   1 1 
        4  6662 1 1  68 LYS H    H  22.398  -0.732 -13.535 1.00 . A A .  68 LYS H    1 1 
        4  6663 1 1  68 LYS HA   H  22.540  -2.030 -16.169 1.00 . A A .  68 LYS HA   1 1 
        4  6664 1 1  68 LYS HB2  H  22.349   0.491 -16.020 1.00 . A A .  68 LYS HB2  1 1 
        4  6665 1 1  68 LYS HB3  H  23.955   0.489 -15.292 1.00 . A A .  68 LYS HB3  1 1 
        4  6666 1 1  68 LYS HD2  H  25.309   1.609 -17.351 1.00 . A A .  68 LYS HD2  1 1 
        4  6667 1 1  68 LYS HD3  H  25.819   0.217 -16.385 1.00 . A A .  68 LYS HD3  1 1 
        4  6668 1 1  68 LYS HE2  H  27.235   0.066 -18.215 1.00 . A A .  68 LYS HE2  1 1 
        4  6669 1 1  68 LYS HE3  H  25.917  -1.023 -18.664 1.00 . A A .  68 LYS HE3  1 1 
        4  6670 1 1  68 LYS HG2  H  23.958  -1.050 -17.737 1.00 . A A .  68 LYS HG2  1 1 
        4  6671 1 1  68 LYS HG3  H  23.335   0.583 -18.007 1.00 . A A .  68 LYS HG3  1 1 
        4  6672 1 1  68 LYS HZ1  H  24.923   0.865 -19.910 1.00 . A A .  68 LYS HZ1  1 1 
        4  6673 1 1  68 LYS HZ2  H  26.409   0.345 -20.526 1.00 . A A .  68 LYS HZ2  1 1 
        4  6674 1 1  68 LYS HZ3  H  26.325   1.761 -19.606 1.00 . A A .  68 LYS HZ3  1 1 
        4  6675 1 1  68 LYS N    N  22.191  -1.379 -14.241 1.00 . A A .  68 LYS N    1 1 
        4  6676 1 1  68 LYS NZ   N  25.943   0.801 -19.716 1.00 . A A .  68 LYS NZ   1 1 
        4  6677 1 1  68 LYS O    O  25.295  -1.478 -14.571 1.00 . A A .  68 LYS O    1 1 
        4  6678 1 1  69 PHE C    C  26.650  -4.087 -16.306 1.00 . A A .  69 PHE C    1 1 
        4  6679 1 1  69 PHE CA   C  25.691  -4.165 -15.122 1.00 . A A .  69 PHE CA   1 1 
        4  6680 1 1  69 PHE CB   C  25.351  -5.627 -14.821 1.00 . A A .  69 PHE CB   1 1 
        4  6681 1 1  69 PHE CD1  C  25.009  -5.149 -12.382 1.00 . A A .  69 PHE CD1  1 1 
        4  6682 1 1  69 PHE CD2  C  23.517  -6.663 -13.460 1.00 . A A .  69 PHE CD2  1 1 
        4  6683 1 1  69 PHE CE1  C  24.329  -5.321 -11.191 1.00 . A A .  69 PHE CE1  1 1 
        4  6684 1 1  69 PHE CE2  C  22.833  -6.840 -12.272 1.00 . A A .  69 PHE CE2  1 1 
        4  6685 1 1  69 PHE CG   C  24.610  -5.816 -13.529 1.00 . A A .  69 PHE CG   1 1 
        4  6686 1 1  69 PHE CZ   C  23.240  -6.168 -11.135 1.00 . A A .  69 PHE CZ   1 1 
        4  6687 1 1  69 PHE H    H  23.707  -3.861 -15.797 1.00 . A A .  69 PHE H    1 1 
        4  6688 1 1  69 PHE HA   H  26.169  -3.731 -14.257 1.00 . A A .  69 PHE HA   1 1 
        4  6689 1 1  69 PHE HB2  H  24.741  -6.018 -15.635 1.00 . A A .  69 PHE HB2  1 1 
        4  6690 1 1  69 PHE HB3  H  26.266  -6.197 -14.769 1.00 . A A .  69 PHE HB3  1 1 
        4  6691 1 1  69 PHE HD1  H  25.861  -4.485 -12.425 1.00 . A A .  69 PHE HD1  1 1 
        4  6692 1 1  69 PHE HD2  H  23.196  -7.190 -14.348 1.00 . A A .  69 PHE HD2  1 1 
        4  6693 1 1  69 PHE HE1  H  24.651  -4.795 -10.305 1.00 . A A .  69 PHE HE1  1 1 
        4  6694 1 1  69 PHE HE2  H  21.982  -7.504 -12.231 1.00 . A A .  69 PHE HE2  1 1 
        4  6695 1 1  69 PHE HZ   H  22.708  -6.305 -10.206 1.00 . A A .  69 PHE HZ   1 1 
        4  6696 1 1  69 PHE N    N  24.474  -3.407 -15.387 1.00 . A A .  69 PHE N    1 1 
        4  6697 1 1  69 PHE O    O  26.227  -3.949 -17.453 1.00 . A A .  69 PHE O    1 1 
        4  6698 1 1  70 GLY C    C  29.950  -5.242 -16.981 1.00 . A A .  70 GLY C    1 1 
        4  6699 1 1  70 GLY CA   C  28.945  -4.113 -17.068 1.00 . A A .  70 GLY CA   1 1 
        4  6700 1 1  70 GLY H    H  28.223  -4.284 -15.084 1.00 . A A .  70 GLY H    1 1 
        4  6701 1 1  70 GLY HA2  H  28.448  -4.159 -18.026 1.00 . A A .  70 GLY HA2  1 1 
        4  6702 1 1  70 GLY HA3  H  29.471  -3.172 -16.992 1.00 . A A .  70 GLY HA3  1 1 
        4  6703 1 1  70 GLY N    N  27.945  -4.176 -16.017 1.00 . A A .  70 GLY N    1 1 
        4  6704 1 1  70 GLY O    O  31.126  -5.016 -16.698 1.00 . A A .  70 GLY O    1 1 
        4  6705 1 1  71 ASN C    C  30.849  -7.880 -15.744 1.00 . A A .  71 ASN C    1 1 
        4  6706 1 1  71 ASN CA   C  30.354  -7.635 -17.165 1.00 . A A .  71 ASN CA   1 1 
        4  6707 1 1  71 ASN CB   C  31.547  -7.458 -18.109 1.00 . A A .  71 ASN CB   1 1 
        4  6708 1 1  71 ASN CG   C  32.036  -8.777 -18.675 1.00 . A A .  71 ASN CG   1 1 
        4  6709 1 1  71 ASN H    H  28.540  -6.583 -17.441 1.00 . A A .  71 ASN H    1 1 
        4  6710 1 1  71 ASN HA   H  29.778  -8.491 -17.486 1.00 . A A .  71 ASN HA   1 1 
        4  6711 1 1  71 ASN HB2  H  31.252  -6.808 -18.932 1.00 . A A .  71 ASN HB2  1 1 
        4  6712 1 1  71 ASN HB3  H  32.358  -6.995 -17.570 1.00 . A A .  71 ASN HB3  1 1 
        4  6713 1 1  71 ASN HD21 H  31.396  -8.265 -20.487 1.00 . A A .  71 ASN HD21 1 1 
        4  6714 1 1  71 ASN HD22 H  32.146  -9.817 -20.366 1.00 . A A .  71 ASN HD22 1 1 
        4  6715 1 1  71 ASN N    N  29.487  -6.464 -17.220 1.00 . A A .  71 ASN N    1 1 
        4  6716 1 1  71 ASN ND2  N  31.840  -8.973 -19.973 1.00 . A A .  71 ASN ND2  1 1 
        4  6717 1 1  71 ASN O    O  31.050  -6.939 -14.976 1.00 . A A .  71 ASN O    1 1 
        4  6718 1 1  71 ASN OD1  O  32.586  -9.609 -17.953 1.00 . A A .  71 ASN OD1  1 1 
        4  6719 1 1  72 TRP C    C  33.010  -9.253 -13.930 1.00 . A A .  72 TRP C    1 1 
        4  6720 1 1  72 TRP CA   C  31.514  -9.516 -14.069 1.00 . A A .  72 TRP CA   1 1 
        4  6721 1 1  72 TRP CB   C  31.213 -10.988 -13.788 1.00 . A A .  72 TRP CB   1 1 
        4  6722 1 1  72 TRP CD1  C  29.412 -11.830 -15.406 1.00 . A A .  72 TRP CD1  1 1 
        4  6723 1 1  72 TRP CD2  C  28.667 -11.405 -13.337 1.00 . A A .  72 TRP CD2  1 1 
        4  6724 1 1  72 TRP CE2  C  27.586 -11.857 -14.120 1.00 . A A .  72 TRP CE2  1 1 
        4  6725 1 1  72 TRP CE3  C  28.436 -11.076 -11.999 1.00 . A A .  72 TRP CE3  1 1 
        4  6726 1 1  72 TRP CG   C  29.824 -11.396 -14.178 1.00 . A A .  72 TRP CG   1 1 
        4  6727 1 1  72 TRP CH2  C  26.101 -11.658 -12.294 1.00 . A A .  72 TRP CH2  1 1 
        4  6728 1 1  72 TRP CZ2  C  26.298 -11.987 -13.607 1.00 . A A .  72 TRP CZ2  1 1 
        4  6729 1 1  72 TRP CZ3  C  27.157 -11.206 -11.492 1.00 . A A .  72 TRP CZ3  1 1 
        4  6730 1 1  72 TRP H    H  30.864  -9.854 -16.055 1.00 . A A .  72 TRP H    1 1 
        4  6731 1 1  72 TRP HA   H  30.986  -8.906 -13.350 1.00 . A A .  72 TRP HA   1 1 
        4  6732 1 1  72 TRP HB2  H  31.926 -11.603 -14.336 1.00 . A A .  72 TRP HB2  1 1 
        4  6733 1 1  72 TRP HB3  H  31.332 -11.176 -12.731 1.00 . A A .  72 TRP HB3  1 1 
        4  6734 1 1  72 TRP HD1  H  30.061 -11.933 -16.263 1.00 . A A .  72 TRP HD1  1 1 
        4  6735 1 1  72 TRP HE1  H  27.539 -12.437 -16.136 1.00 . A A .  72 TRP HE1  1 1 
        4  6736 1 1  72 TRP HE3  H  29.236 -10.726 -11.363 1.00 . A A .  72 TRP HE3  1 1 
        4  6737 1 1  72 TRP HH2  H  25.119 -11.744 -11.855 1.00 . A A .  72 TRP HH2  1 1 
        4  6738 1 1  72 TRP HZ2  H  25.474 -12.335 -14.214 1.00 . A A .  72 TRP HZ2  1 1 
        4  6739 1 1  72 TRP HZ3  H  26.960 -10.956 -10.458 1.00 . A A .  72 TRP HZ3  1 1 
        4  6740 1 1  72 TRP N    N  31.043  -9.148 -15.399 1.00 . A A .  72 TRP N    1 1 
        4  6741 1 1  72 TRP NE1  N  28.067 -12.109 -15.378 1.00 . A A .  72 TRP NE1  1 1 
        4  6742 1 1  72 TRP O    O  33.754  -9.321 -14.907 1.00 . A A .  72 TRP O    1 1 
        4  6743 1 1  73 GLY C    C  35.696  -9.943 -12.523 1.00 . A A .  73 GLY C    1 1 
        4  6744 1 1  73 GLY CA   C  34.848  -8.688 -12.466 1.00 . A A .  73 GLY CA   1 1 
        4  6745 1 1  73 GLY H    H  32.803  -8.914 -11.967 1.00 . A A .  73 GLY H    1 1 
        4  6746 1 1  73 GLY HA2  H  35.206  -7.990 -13.210 1.00 . A A .  73 GLY HA2  1 1 
        4  6747 1 1  73 GLY HA3  H  34.954  -8.240 -11.488 1.00 . A A .  73 GLY HA3  1 1 
        4  6748 1 1  73 GLY N    N  33.444  -8.954 -12.709 1.00 . A A .  73 GLY N    1 1 
        4  6749 1 1  73 GLY O    O  35.298 -10.941 -13.123 1.00 . A A .  73 GLY O    1 1 
        4  6750 1 1  74 GLU C    C  37.444 -11.977 -10.728 1.00 . A A .  74 GLU C    1 1 
        4  6751 1 1  74 GLU CA   C  37.775 -11.035 -11.883 1.00 . A A .  74 GLU CA   1 1 
        4  6752 1 1  74 GLU CB   C  39.225 -10.562 -11.771 1.00 . A A .  74 GLU CB   1 1 
        4  6753 1 1  74 GLU CD   C  40.480 -10.848  -9.597 1.00 . A A .  74 GLU CD   1 1 
        4  6754 1 1  74 GLU CG   C  39.566  -9.959 -10.418 1.00 . A A .  74 GLU CG   1 1 
        4  6755 1 1  74 GLU H    H  37.131  -9.068 -11.437 1.00 . A A .  74 GLU H    1 1 
        4  6756 1 1  74 GLU HA   H  37.652 -11.569 -12.813 1.00 . A A .  74 GLU HA   1 1 
        4  6757 1 1  74 GLU HB2  H  39.884 -11.411 -11.951 1.00 . A A .  74 GLU HB2  1 1 
        4  6758 1 1  74 GLU HB3  H  39.408  -9.816 -12.531 1.00 . A A .  74 GLU HB3  1 1 
        4  6759 1 1  74 GLU HG2  H  40.054  -8.997 -10.573 1.00 . A A .  74 GLU HG2  1 1 
        4  6760 1 1  74 GLU HG3  H  38.651  -9.803  -9.867 1.00 . A A .  74 GLU HG3  1 1 
        4  6761 1 1  74 GLU N    N  36.869  -9.894 -11.898 1.00 . A A .  74 GLU N    1 1 
        4  6762 1 1  74 GLU O    O  37.079 -11.536  -9.639 1.00 . A A .  74 GLU O    1 1 
        4  6763 1 1  74 GLU OE1  O  41.673 -10.958  -9.948 1.00 . A A .  74 GLU OE1  1 1 
        4  6764 1 1  74 GLU OE2  O  40.001 -11.433  -8.603 1.00 . A A .  74 GLU OE2  1 1 
        4  6765 1 1  75 CYS C    C  38.487 -15.204  -9.756 1.00 . A A .  75 CYS C    1 1 
        4  6766 1 1  75 CYS CA   C  37.290 -14.280  -9.960 1.00 . A A .  75 CYS CA   1 1 
        4  6767 1 1  75 CYS CB   C  36.061 -15.102 -10.355 1.00 . A A .  75 CYS CB   1 1 
        4  6768 1 1  75 CYS H    H  37.870 -13.566 -11.865 1.00 . A A .  75 CYS H    1 1 
        4  6769 1 1  75 CYS HA   H  37.087 -13.767  -9.032 1.00 . A A .  75 CYS HA   1 1 
        4  6770 1 1  75 CYS HB2  H  36.330 -16.158 -10.345 1.00 . A A .  75 CYS HB2  1 1 
        4  6771 1 1  75 CYS HB3  H  35.280 -14.939  -9.626 1.00 . A A .  75 CYS HB3  1 1 
        4  6772 1 1  75 CYS HG   H  35.874 -13.510 -12.394 1.00 . A A .  75 CYS HG   1 1 
        4  6773 1 1  75 CYS N    N  37.575 -13.276 -10.976 1.00 . A A .  75 CYS N    1 1 
        4  6774 1 1  75 CYS O    O  38.992 -15.802 -10.707 1.00 . A A .  75 CYS O    1 1 
        4  6775 1 1  75 CYS SG   S  35.386 -14.688 -11.995 1.00 . A A .  75 CYS SG   1 1 
        4  6776 1 1  76 ASP C    C  39.610 -17.557  -7.760 1.00 . A A .  76 ASP C    1 1 
        4  6777 1 1  76 ASP CA   C  40.075 -16.167  -8.183 1.00 . A A .  76 ASP CA   1 1 
        4  6778 1 1  76 ASP CB   C  40.909 -15.534  -7.067 1.00 . A A .  76 ASP CB   1 1 
        4  6779 1 1  76 ASP CG   C  42.331 -15.241  -7.502 1.00 . A A .  76 ASP CG   1 1 
        4  6780 1 1  76 ASP H    H  38.493 -14.813  -7.796 1.00 . A A .  76 ASP H    1 1 
        4  6781 1 1  76 ASP HA   H  40.686 -16.260  -9.068 1.00 . A A .  76 ASP HA   1 1 
        4  6782 1 1  76 ASP HB2  H  40.435 -14.602  -6.758 1.00 . A A .  76 ASP HB2  1 1 
        4  6783 1 1  76 ASP HB3  H  40.940 -16.207  -6.224 1.00 . A A .  76 ASP HB3  1 1 
        4  6784 1 1  76 ASP N    N  38.938 -15.315  -8.512 1.00 . A A .  76 ASP N    1 1 
        4  6785 1 1  76 ASP O    O  38.798 -17.699  -6.845 1.00 . A A .  76 ASP O    1 1 
        4  6786 1 1  76 ASP OD1  O  42.872 -16.015  -8.320 1.00 . A A .  76 ASP OD1  1 1 
        4  6787 1 1  76 ASP OD2  O  42.902 -14.237  -7.028 1.00 . A A .  76 ASP OD2  1 1 
        4  6788 1 1  77 ALA C    C  40.020 -20.278  -6.659 1.00 . A A .  77 ALA C    1 1 
        4  6789 1 1  77 ALA CA   C  39.765 -19.957  -8.127 1.00 . A A .  77 ALA CA   1 1 
        4  6790 1 1  77 ALA CB   C  40.537 -20.916  -9.021 1.00 . A A .  77 ALA CB   1 1 
        4  6791 1 1  77 ALA H    H  40.768 -18.402  -9.153 1.00 . A A .  77 ALA H    1 1 
        4  6792 1 1  77 ALA HA   H  38.712 -20.079  -8.335 1.00 . A A .  77 ALA HA   1 1 
        4  6793 1 1  77 ALA HB1  H  40.295 -20.716 -10.055 1.00 . A A .  77 ALA HB1  1 1 
        4  6794 1 1  77 ALA HB2  H  41.597 -20.781  -8.864 1.00 . A A .  77 ALA HB2  1 1 
        4  6795 1 1  77 ALA HB3  H  40.263 -21.932  -8.778 1.00 . A A .  77 ALA HB3  1 1 
        4  6796 1 1  77 ALA N    N  40.128 -18.579  -8.434 1.00 . A A .  77 ALA N    1 1 
        4  6797 1 1  77 ALA O    O  39.431 -21.206  -6.105 1.00 . A A .  77 ALA O    1 1 
        4  6798 1 1  78 ALA C    C  40.051 -19.366  -3.731 1.00 . A A .  78 ALA C    1 1 
        4  6799 1 1  78 ALA CA   C  41.234 -19.707  -4.629 1.00 . A A .  78 ALA CA   1 1 
        4  6800 1 1  78 ALA CB   C  42.446 -18.872  -4.248 1.00 . A A .  78 ALA CB   1 1 
        4  6801 1 1  78 ALA H    H  41.340 -18.782  -6.529 1.00 . A A .  78 ALA H    1 1 
        4  6802 1 1  78 ALA HA   H  41.488 -20.749  -4.492 1.00 . A A .  78 ALA HA   1 1 
        4  6803 1 1  78 ALA HB1  H  42.194 -17.823  -4.310 1.00 . A A .  78 ALA HB1  1 1 
        4  6804 1 1  78 ALA HB2  H  42.745 -19.110  -3.238 1.00 . A A .  78 ALA HB2  1 1 
        4  6805 1 1  78 ALA HB3  H  43.260 -19.087  -4.925 1.00 . A A .  78 ALA HB3  1 1 
        4  6806 1 1  78 ALA N    N  40.903 -19.506  -6.034 1.00 . A A .  78 ALA N    1 1 
        4  6807 1 1  78 ALA O    O  39.920 -19.898  -2.627 1.00 . A A .  78 ALA O    1 1 
        4  6808 1 1  79 THR C    C  36.734 -18.598  -4.078 1.00 . A A .  79 THR C    1 1 
        4  6809 1 1  79 THR CA   C  38.015 -18.061  -3.448 1.00 . A A .  79 THR CA   1 1 
        4  6810 1 1  79 THR CB   C  37.922 -16.527  -3.351 1.00 . A A .  79 THR CB   1 1 
        4  6811 1 1  79 THR CG2  C  37.984 -15.891  -4.732 1.00 . A A .  79 THR CG2  1 1 
        4  6812 1 1  79 THR H    H  39.345 -18.087  -5.095 1.00 . A A .  79 THR H    1 1 
        4  6813 1 1  79 THR HA   H  38.108 -18.459  -2.449 1.00 . A A .  79 THR HA   1 1 
        4  6814 1 1  79 THR HB   H  38.758 -16.167  -2.768 1.00 . A A .  79 THR HB   1 1 
        4  6815 1 1  79 THR HG1  H  36.903 -15.688  -1.886 1.00 . A A .  79 THR HG1  1 1 
        4  6816 1 1  79 THR HG21 H  38.997 -15.935  -5.102 1.00 . A A .  79 THR HG21 1 1 
        4  6817 1 1  79 THR HG22 H  37.669 -14.860  -4.669 1.00 . A A .  79 THR HG22 1 1 
        4  6818 1 1  79 THR HG23 H  37.331 -16.428  -5.404 1.00 . A A .  79 THR HG23 1 1 
        4  6819 1 1  79 THR N    N  39.188 -18.475  -4.210 1.00 . A A .  79 THR N    1 1 
        4  6820 1 1  79 THR O    O  35.741 -18.825  -3.388 1.00 . A A .  79 THR O    1 1 
        4  6821 1 1  79 THR OG1  O  36.702 -16.151  -2.702 1.00 . A A .  79 THR OG1  1 1 
        4  6822 1 1  80 SER C    C  34.434 -18.333  -6.014 1.00 . A A .  80 SER C    1 1 
        4  6823 1 1  80 SER CA   C  35.604 -19.307  -6.114 1.00 . A A .  80 SER CA   1 1 
        4  6824 1 1  80 SER CB   C  35.194 -20.674  -5.565 1.00 . A A .  80 SER CB   1 1 
        4  6825 1 1  80 SER H    H  37.587 -18.598  -5.886 1.00 . A A .  80 SER H    1 1 
        4  6826 1 1  80 SER HA   H  35.882 -19.413  -7.152 1.00 . A A .  80 SER HA   1 1 
        4  6827 1 1  80 SER HB2  H  36.069 -21.322  -5.525 1.00 . A A .  80 SER HB2  1 1 
        4  6828 1 1  80 SER HB3  H  34.794 -20.553  -4.568 1.00 . A A .  80 SER HB3  1 1 
        4  6829 1 1  80 SER HG   H  34.613 -21.942  -6.940 1.00 . A A .  80 SER HG   1 1 
        4  6830 1 1  80 SER N    N  36.765 -18.800  -5.391 1.00 . A A .  80 SER N    1 1 
        4  6831 1 1  80 SER O    O  33.289 -18.736  -5.804 1.00 . A A .  80 SER O    1 1 
        4  6832 1 1  80 SER OG   O  34.205 -21.276  -6.382 1.00 . A A .  80 SER OG   1 1 
        4  6833 1 1  81 THR C    C  34.069 -14.811  -6.959 1.00 . A A .  81 THR C    1 1 
        4  6834 1 1  81 THR CA   C  33.703 -16.012  -6.095 1.00 . A A .  81 THR CA   1 1 
        4  6835 1 1  81 THR CB   C  33.485 -15.539  -4.644 1.00 . A A .  81 THR CB   1 1 
        4  6836 1 1  81 THR CG2  C  32.854 -16.641  -3.806 1.00 . A A .  81 THR CG2  1 1 
        4  6837 1 1  81 THR H    H  35.659 -16.786  -6.332 1.00 . A A .  81 THR H    1 1 
        4  6838 1 1  81 THR HA   H  32.777 -16.436  -6.455 1.00 . A A .  81 THR HA   1 1 
        4  6839 1 1  81 THR HB   H  32.819 -14.689  -4.655 1.00 . A A .  81 THR HB   1 1 
        4  6840 1 1  81 THR HG1  H  35.266 -15.927  -3.894 1.00 . A A .  81 THR HG1  1 1 
        4  6841 1 1  81 THR HG21 H  33.593 -17.397  -3.589 1.00 . A A .  81 THR HG21 1 1 
        4  6842 1 1  81 THR HG22 H  32.034 -17.085  -4.351 1.00 . A A .  81 THR HG22 1 1 
        4  6843 1 1  81 THR HG23 H  32.486 -16.222  -2.880 1.00 . A A .  81 THR HG23 1 1 
        4  6844 1 1  81 THR N    N  34.729 -17.046  -6.167 1.00 . A A .  81 THR N    1 1 
        4  6845 1 1  81 THR O    O  35.224 -14.646  -7.351 1.00 . A A .  81 THR O    1 1 
        4  6846 1 1  81 THR OG1  O  34.734 -15.147  -4.065 1.00 . A A .  81 THR OG1  1 1 
        4  6847 1 1  82 LYS C    C  32.447 -11.623  -7.571 1.00 . A A .  82 LYS C    1 1 
        4  6848 1 1  82 LYS CA   C  33.296 -12.788  -8.068 1.00 . A A .  82 LYS CA   1 1 
        4  6849 1 1  82 LYS CB   C  32.966 -13.083  -9.533 1.00 . A A .  82 LYS CB   1 1 
        4  6850 1 1  82 LYS CD   C  30.940 -13.087 -11.019 1.00 . A A .  82 LYS CD   1 1 
        4  6851 1 1  82 LYS CE   C  29.847 -14.008 -11.539 1.00 . A A .  82 LYS CE   1 1 
        4  6852 1 1  82 LYS CG   C  31.563 -13.627  -9.743 1.00 . A A .  82 LYS CG   1 1 
        4  6853 1 1  82 LYS H    H  32.179 -14.162  -6.910 1.00 . A A .  82 LYS H    1 1 
        4  6854 1 1  82 LYS HA   H  34.338 -12.518  -7.991 1.00 . A A .  82 LYS HA   1 1 
        4  6855 1 1  82 LYS HB2  H  33.073 -12.163 -10.108 1.00 . A A .  82 LYS HB2  1 1 
        4  6856 1 1  82 LYS HB3  H  33.672 -13.811  -9.909 1.00 . A A .  82 LYS HB3  1 1 
        4  6857 1 1  82 LYS HD2  H  30.514 -12.104 -10.819 1.00 . A A .  82 LYS HD2  1 1 
        4  6858 1 1  82 LYS HD3  H  31.709 -12.993 -11.773 1.00 . A A .  82 LYS HD3  1 1 
        4  6859 1 1  82 LYS HE2  H  29.900 -14.959 -11.008 1.00 . A A .  82 LYS HE2  1 1 
        4  6860 1 1  82 LYS HE3  H  28.887 -13.550 -11.348 1.00 . A A .  82 LYS HE3  1 1 
        4  6861 1 1  82 LYS HG2  H  31.607 -14.715  -9.800 1.00 . A A .  82 LYS HG2  1 1 
        4  6862 1 1  82 LYS HG3  H  30.946 -13.342  -8.902 1.00 . A A .  82 LYS HG3  1 1 
        4  6863 1 1  82 LYS HZ1  H  29.099 -14.005 -13.489 1.00 . A A .  82 LYS HZ1  1 1 
        4  6864 1 1  82 LYS HZ2  H  30.186 -15.263 -13.173 1.00 . A A .  82 LYS HZ2  1 1 
        4  6865 1 1  82 LYS HZ3  H  30.758 -13.687 -13.391 1.00 . A A .  82 LYS HZ3  1 1 
        4  6866 1 1  82 LYS N    N  33.079 -13.976  -7.251 1.00 . A A .  82 LYS N    1 1 
        4  6867 1 1  82 LYS NZ   N  29.981 -14.258 -13.001 1.00 . A A .  82 LYS NZ   1 1 
        4  6868 1 1  82 LYS O    O  31.396 -11.823  -6.962 1.00 . A A .  82 LYS O    1 1 
        4  6869 1 1  83 SER C    C  31.906  -8.297  -8.599 1.00 . A A .  83 SER C    1 1 
        4  6870 1 1  83 SER CA   C  32.194  -9.207  -7.410 1.00 . A A .  83 SER CA   1 1 
        4  6871 1 1  83 SER CB   C  33.006  -8.448  -6.358 1.00 . A A .  83 SER CB   1 1 
        4  6872 1 1  83 SER H    H  33.755 -10.310  -8.323 1.00 . A A .  83 SER H    1 1 
        4  6873 1 1  83 SER HA   H  31.257  -9.518  -6.974 1.00 . A A .  83 SER HA   1 1 
        4  6874 1 1  83 SER HB2  H  34.069  -8.601  -6.545 1.00 . A A .  83 SER HB2  1 1 
        4  6875 1 1  83 SER HB3  H  32.782  -7.394  -6.426 1.00 . A A .  83 SER HB3  1 1 
        4  6876 1 1  83 SER HG   H  33.098  -9.753  -4.900 1.00 . A A .  83 SER HG   1 1 
        4  6877 1 1  83 SER N    N  32.910 -10.404  -7.833 1.00 . A A .  83 SER N    1 1 
        4  6878 1 1  83 SER O    O  32.693  -8.222  -9.543 1.00 . A A .  83 SER O    1 1 
        4  6879 1 1  83 SER OG   O  32.692  -8.897  -5.050 1.00 . A A .  83 SER OG   1 1 
        4  6880 1 1  84 ARG C    C  29.430  -5.624  -9.103 1.00 . A A .  84 ARG C    1 1 
        4  6881 1 1  84 ARG CA   C  30.377  -6.703  -9.621 1.00 . A A .  84 ARG CA   1 1 
        4  6882 1 1  84 ARG CB   C  29.707  -7.482 -10.754 1.00 . A A .  84 ARG CB   1 1 
        4  6883 1 1  84 ARG CD   C  28.467  -7.315 -12.933 1.00 . A A .  84 ARG CD   1 1 
        4  6884 1 1  84 ARG CG   C  28.778  -6.637 -11.609 1.00 . A A .  84 ARG CG   1 1 
        4  6885 1 1  84 ARG CZ   C  26.645  -8.607 -13.960 1.00 . A A .  84 ARG CZ   1 1 
        4  6886 1 1  84 ARG H    H  30.185  -7.709  -7.769 1.00 . A A .  84 ARG H    1 1 
        4  6887 1 1  84 ARG HA   H  31.270  -6.229 -10.001 1.00 . A A .  84 ARG HA   1 1 
        4  6888 1 1  84 ARG HB2  H  30.482  -7.905 -11.393 1.00 . A A .  84 ARG HB2  1 1 
        4  6889 1 1  84 ARG HB3  H  29.133  -8.290 -10.326 1.00 . A A .  84 ARG HB3  1 1 
        4  6890 1 1  84 ARG HD2  H  28.578  -6.590 -13.739 1.00 . A A .  84 ARG HD2  1 1 
        4  6891 1 1  84 ARG HD3  H  29.173  -8.120 -13.084 1.00 . A A .  84 ARG HD3  1 1 
        4  6892 1 1  84 ARG HE   H  26.525  -7.659 -12.209 1.00 . A A .  84 ARG HE   1 1 
        4  6893 1 1  84 ARG HG2  H  27.847  -6.471 -11.066 1.00 . A A .  84 ARG HG2  1 1 
        4  6894 1 1  84 ARG HG3  H  29.248  -5.685 -11.802 1.00 . A A .  84 ARG HG3  1 1 
        4  6895 1 1  84 ARG HH11 H  28.358  -8.553 -15.032 1.00 . A A .  84 ARG HH11 1 1 
        4  6896 1 1  84 ARG HH12 H  27.064  -9.459 -15.745 1.00 . A A .  84 ARG HH12 1 1 
        4  6897 1 1  84 ARG HH21 H  24.815  -8.850 -13.137 1.00 . A A .  84 ARG HH21 1 1 
        4  6898 1 1  84 ARG HH22 H  25.049  -9.628 -14.666 1.00 . A A .  84 ARG HH22 1 1 
        4  6899 1 1  84 ARG N    N  30.771  -7.606  -8.547 1.00 . A A .  84 ARG N    1 1 
        4  6900 1 1  84 ARG NE   N  27.113  -7.859 -12.966 1.00 . A A .  84 ARG NE   1 1 
        4  6901 1 1  84 ARG NH1  N  27.418  -8.896 -14.997 1.00 . A A .  84 ARG NH1  1 1 
        4  6902 1 1  84 ARG NH2  N  25.401  -9.066 -13.918 1.00 . A A .  84 ARG NH2  1 1 
        4  6903 1 1  84 ARG O    O  28.629  -5.866  -8.199 1.00 . A A .  84 ARG O    1 1 
        4  6904 1 1  85 THR C    C  27.766  -2.879 -10.413 1.00 . A A .  85 THR C    1 1 
        4  6905 1 1  85 THR CA   C  28.684  -3.314  -9.277 1.00 . A A .  85 THR CA   1 1 
        4  6906 1 1  85 THR CB   C  29.526  -2.107  -8.822 1.00 . A A .  85 THR CB   1 1 
        4  6907 1 1  85 THR CG2  C  29.626  -2.057  -7.305 1.00 . A A .  85 THR CG2  1 1 
        4  6908 1 1  85 THR H    H  30.185  -4.298 -10.395 1.00 . A A .  85 THR H    1 1 
        4  6909 1 1  85 THR HA   H  28.079  -3.638  -8.441 1.00 . A A .  85 THR HA   1 1 
        4  6910 1 1  85 THR HB   H  29.045  -1.202  -9.166 1.00 . A A .  85 THR HB   1 1 
        4  6911 1 1  85 THR HG1  H  31.328  -2.896  -8.970 1.00 . A A .  85 THR HG1  1 1 
        4  6912 1 1  85 THR HG21 H  29.081  -2.888  -6.880 1.00 . A A .  85 THR HG21 1 1 
        4  6913 1 1  85 THR HG22 H  29.205  -1.130  -6.946 1.00 . A A .  85 THR HG22 1 1 
        4  6914 1 1  85 THR HG23 H  30.663  -2.120  -7.010 1.00 . A A .  85 THR HG23 1 1 
        4  6915 1 1  85 THR N    N  29.529  -4.430  -9.681 1.00 . A A .  85 THR N    1 1 
        4  6916 1 1  85 THR O    O  28.171  -2.851 -11.574 1.00 . A A .  85 THR O    1 1 
        4  6917 1 1  85 THR OG1  O  30.838  -2.184  -9.390 1.00 . A A .  85 THR OG1  1 1 
        4  6918 1 1  86 GLY C    C  25.075  -0.698 -10.838 1.00 . A A .  86 GLY C    1 1 
        4  6919 1 1  86 GLY CA   C  25.570  -2.110 -11.075 1.00 . A A .  86 GLY CA   1 1 
        4  6920 1 1  86 GLY H    H  26.259  -2.582  -9.128 1.00 . A A .  86 GLY H    1 1 
        4  6921 1 1  86 GLY HA2  H  26.040  -2.158 -12.046 1.00 . A A .  86 GLY HA2  1 1 
        4  6922 1 1  86 GLY HA3  H  24.725  -2.783 -11.062 1.00 . A A .  86 GLY HA3  1 1 
        4  6923 1 1  86 GLY N    N  26.527  -2.540 -10.071 1.00 . A A .  86 GLY N    1 1 
        4  6924 1 1  86 GLY O    O  24.783  -0.316  -9.704 1.00 . A A .  86 GLY O    1 1 
        4  6925 1 1  87 THR C    C  23.028   1.566 -12.100 1.00 . A A .  87 THR C    1 1 
        4  6926 1 1  87 THR CA   C  24.522   1.463 -11.812 1.00 . A A .  87 THR CA   1 1 
        4  6927 1 1  87 THR CB   C  25.286   2.379 -12.786 1.00 . A A .  87 THR CB   1 1 
        4  6928 1 1  87 THR CG2  C  24.941   3.840 -12.538 1.00 . A A .  87 THR CG2  1 1 
        4  6929 1 1  87 THR H    H  25.230  -0.278 -12.786 1.00 . A A .  87 THR H    1 1 
        4  6930 1 1  87 THR HA   H  24.710   1.808 -10.805 1.00 . A A .  87 THR HA   1 1 
        4  6931 1 1  87 THR HB   H  24.999   2.125 -13.796 1.00 . A A .  87 THR HB   1 1 
        4  6932 1 1  87 THR HG1  H  27.029   2.764 -11.947 1.00 . A A .  87 THR HG1  1 1 
        4  6933 1 1  87 THR HG21 H  25.667   4.271 -11.865 1.00 . A A .  87 THR HG21 1 1 
        4  6934 1 1  87 THR HG22 H  23.957   3.908 -12.096 1.00 . A A .  87 THR HG22 1 1 
        4  6935 1 1  87 THR HG23 H  24.954   4.378 -13.475 1.00 . A A .  87 THR HG23 1 1 
        4  6936 1 1  87 THR N    N  24.982   0.083 -11.909 1.00 . A A .  87 THR N    1 1 
        4  6937 1 1  87 THR O    O  22.551   1.092 -13.132 1.00 . A A .  87 THR O    1 1 
        4  6938 1 1  87 THR OG1  O  26.697   2.185 -12.638 1.00 . A A .  87 THR OG1  1 1 
        4  6939 1 1  88 LEU C    C  20.533   3.164 -12.590 1.00 . A A .  88 LEU C    1 1 
        4  6940 1 1  88 LEU CA   C  20.855   2.354 -11.340 1.00 . A A .  88 LEU CA   1 1 
        4  6941 1 1  88 LEU CB   C  20.264   3.039 -10.107 1.00 . A A .  88 LEU CB   1 1 
        4  6942 1 1  88 LEU CD1  C  18.242   1.727  -9.421 1.00 . A A .  88 LEU CD1  1 1 
        4  6943 1 1  88 LEU CD2  C  18.261   4.215  -9.163 1.00 . A A .  88 LEU CD2  1 1 
        4  6944 1 1  88 LEU CG   C  18.738   3.041 -10.005 1.00 . A A .  88 LEU CG   1 1 
        4  6945 1 1  88 LEU H    H  22.733   2.543 -10.382 1.00 . A A .  88 LEU H    1 1 
        4  6946 1 1  88 LEU HA   H  20.417   1.371 -11.438 1.00 . A A .  88 LEU HA   1 1 
        4  6947 1 1  88 LEU HB2  H  20.666   2.552  -9.218 1.00 . A A .  88 LEU HB2  1 1 
        4  6948 1 1  88 LEU HB3  H  20.597   4.068 -10.110 1.00 . A A .  88 LEU HB3  1 1 
        4  6949 1 1  88 LEU HD11 H  18.323   1.757  -8.346 1.00 . A A .  88 LEU HD11 1 1 
        4  6950 1 1  88 LEU HD12 H  18.840   0.914  -9.805 1.00 . A A .  88 LEU HD12 1 1 
        4  6951 1 1  88 LEU HD13 H  17.210   1.576  -9.701 1.00 . A A .  88 LEU HD13 1 1 
        4  6952 1 1  88 LEU HD21 H  19.092   4.620  -8.606 1.00 . A A .  88 LEU HD21 1 1 
        4  6953 1 1  88 LEU HD22 H  17.497   3.878  -8.475 1.00 . A A .  88 LEU HD22 1 1 
        4  6954 1 1  88 LEU HD23 H  17.851   4.978  -9.808 1.00 . A A .  88 LEU HD23 1 1 
        4  6955 1 1  88 LEU HG   H  18.318   3.146 -10.995 1.00 . A A .  88 LEU HG   1 1 
        4  6956 1 1  88 LEU N    N  22.296   2.187 -11.183 1.00 . A A .  88 LEU N    1 1 
        4  6957 1 1  88 LEU O    O  21.274   4.076 -12.959 1.00 . A A .  88 LEU O    1 1 
        4  6958 1 1  89 GLN C    C  17.710   4.300 -14.207 1.00 . A A .  89 GLN C    1 1 
        4  6959 1 1  89 GLN CA   C  19.001   3.525 -14.447 1.00 . A A .  89 GLN CA   1 1 
        4  6960 1 1  89 GLN CB   C  18.807   2.532 -15.594 1.00 . A A .  89 GLN CB   1 1 
        4  6961 1 1  89 GLN CD   C  19.947   2.053 -17.796 1.00 . A A .  89 GLN CD   1 1 
        4  6962 1 1  89 GLN CG   C  20.102   2.148 -16.291 1.00 . A A .  89 GLN CG   1 1 
        4  6963 1 1  89 GLN H    H  18.873   2.092 -12.895 1.00 . A A .  89 GLN H    1 1 
        4  6964 1 1  89 GLN HA   H  19.780   4.223 -14.715 1.00 . A A .  89 GLN HA   1 1 
        4  6965 1 1  89 GLN HB2  H  18.342   1.629 -15.199 1.00 . A A .  89 GLN HB2  1 1 
        4  6966 1 1  89 GLN HB3  H  18.146   2.971 -16.325 1.00 . A A .  89 GLN HB3  1 1 
        4  6967 1 1  89 GLN HE21 H  19.952   0.067 -17.695 1.00 . A A .  89 GLN HE21 1 1 
        4  6968 1 1  89 GLN HE22 H  19.792   0.737 -19.280 1.00 . A A .  89 GLN HE22 1 1 
        4  6969 1 1  89 GLN HG2  H  20.863   2.894 -16.061 1.00 . A A .  89 GLN HG2  1 1 
        4  6970 1 1  89 GLN HG3  H  20.427   1.190 -15.915 1.00 . A A .  89 GLN HG3  1 1 
        4  6971 1 1  89 GLN N    N  19.422   2.827 -13.237 1.00 . A A .  89 GLN N    1 1 
        4  6972 1 1  89 GLN NE2  N  19.893   0.829 -18.309 1.00 . A A .  89 GLN NE2  1 1 
        4  6973 1 1  89 GLN O    O  17.722   5.525 -14.087 1.00 . A A .  89 GLN O    1 1 
        4  6974 1 1  89 GLN OE1  O  19.878   3.067 -18.490 1.00 . A A .  89 GLN OE1  1 1 
        4  6975 1 1  90 LYS C    C  14.410   3.302 -13.048 1.00 . A A .  90 LYS C    1 1 
        4  6976 1 1  90 LYS CA   C  15.295   4.198 -13.907 1.00 . A A .  90 LYS CA   1 1 
        4  6977 1 1  90 LYS CB   C  14.606   4.487 -15.243 1.00 . A A .  90 LYS CB   1 1 
        4  6978 1 1  90 LYS CD   C  15.473   2.766 -16.852 1.00 . A A .  90 LYS CD   1 1 
        4  6979 1 1  90 LYS CE   C  15.071   2.384 -18.269 1.00 . A A .  90 LYS CE   1 1 
        4  6980 1 1  90 LYS CG   C  14.280   3.237 -16.041 1.00 . A A .  90 LYS CG   1 1 
        4  6981 1 1  90 LYS H    H  16.651   2.605 -14.237 1.00 . A A .  90 LYS H    1 1 
        4  6982 1 1  90 LYS HA   H  15.459   5.128 -13.386 1.00 . A A .  90 LYS HA   1 1 
        4  6983 1 1  90 LYS HB2  H  13.680   5.029 -15.048 1.00 . A A .  90 LYS HB2  1 1 
        4  6984 1 1  90 LYS HB3  H  15.253   5.112 -15.841 1.00 . A A .  90 LYS HB3  1 1 
        4  6985 1 1  90 LYS HD2  H  16.214   3.564 -16.894 1.00 . A A .  90 LYS HD2  1 1 
        4  6986 1 1  90 LYS HD3  H  15.909   1.903 -16.367 1.00 . A A .  90 LYS HD3  1 1 
        4  6987 1 1  90 LYS HE2  H  14.942   1.303 -18.324 1.00 . A A .  90 LYS HE2  1 1 
        4  6988 1 1  90 LYS HE3  H  14.133   2.865 -18.503 1.00 . A A .  90 LYS HE3  1 1 
        4  6989 1 1  90 LYS HG2  H  13.978   2.445 -15.356 1.00 . A A .  90 LYS HG2  1 1 
        4  6990 1 1  90 LYS HG3  H  13.461   3.455 -16.714 1.00 . A A .  90 LYS HG3  1 1 
        4  6991 1 1  90 LYS HZ1  H  16.995   2.318 -19.081 1.00 . A A .  90 LYS HZ1  1 1 
        4  6992 1 1  90 LYS HZ2  H  16.246   3.830 -19.213 1.00 . A A .  90 LYS HZ2  1 1 
        4  6993 1 1  90 LYS HZ3  H  15.774   2.561 -20.228 1.00 . A A .  90 LYS HZ3  1 1 
        4  6994 1 1  90 LYS N    N  16.596   3.579 -14.135 1.00 . A A .  90 LYS N    1 1 
        4  6995 1 1  90 LYS NZ   N  16.093   2.803 -19.267 1.00 . A A .  90 LYS NZ   1 1 
        4  6996 1 1  90 LYS O    O  14.630   2.094 -12.961 1.00 . A A .  90 LYS O    1 1 
        4  6997 1 1  91 ALA C    C  11.252   2.715 -12.349 1.00 . A A .  91 ALA C    1 1 
        4  6998 1 1  91 ALA CA   C  12.485   3.156 -11.567 1.00 . A A .  91 ALA CA   1 1 
        4  6999 1 1  91 ALA CB   C  12.077   3.997 -10.366 1.00 . A A .  91 ALA CB   1 1 
        4  7000 1 1  91 ALA H    H  13.282   4.867 -12.524 1.00 . A A .  91 ALA H    1 1 
        4  7001 1 1  91 ALA HA   H  13.001   2.279 -11.202 1.00 . A A .  91 ALA HA   1 1 
        4  7002 1 1  91 ALA HB1  H  11.354   3.453  -9.776 1.00 . A A .  91 ALA HB1  1 1 
        4  7003 1 1  91 ALA HB2  H  12.947   4.209  -9.763 1.00 . A A .  91 ALA HB2  1 1 
        4  7004 1 1  91 ALA HB3  H  11.642   4.924 -10.708 1.00 . A A .  91 ALA HB3  1 1 
        4  7005 1 1  91 ALA N    N  13.406   3.902 -12.415 1.00 . A A .  91 ALA N    1 1 
        4  7006 1 1  91 ALA O    O  10.560   3.536 -12.952 1.00 . A A .  91 ALA O    1 1 
        4  7007 1 1  92 LEU C    C   8.865   0.195 -12.074 1.00 . A A .  92 LEU C    1 1 
        4  7008 1 1  92 LEU CA   C   9.834   0.863 -13.045 1.00 . A A .  92 LEU CA   1 1 
        4  7009 1 1  92 LEU CB   C  10.296  -0.148 -14.097 1.00 . A A .  92 LEU CB   1 1 
        4  7010 1 1  92 LEU CD1  C  10.761  -2.608 -14.195 1.00 . A A .  92 LEU CD1  1 1 
        4  7011 1 1  92 LEU CD2  C  12.649  -0.990 -13.921 1.00 . A A .  92 LEU CD2  1 1 
        4  7012 1 1  92 LEU CG   C  11.193  -1.279 -13.594 1.00 . A A .  92 LEU CG   1 1 
        4  7013 1 1  92 LEU H    H  11.572   0.808 -11.836 1.00 . A A .  92 LEU H    1 1 
        4  7014 1 1  92 LEU HA   H   9.327   1.678 -13.538 1.00 . A A .  92 LEU HA   1 1 
        4  7015 1 1  92 LEU HB2  H   9.412  -0.590 -14.557 1.00 . A A .  92 LEU HB2  1 1 
        4  7016 1 1  92 LEU HB3  H  10.840   0.394 -14.858 1.00 . A A .  92 LEU HB3  1 1 
        4  7017 1 1  92 LEU HD11 H  10.642  -2.499 -15.262 1.00 . A A .  92 LEU HD11 1 1 
        4  7018 1 1  92 LEU HD12 H   9.823  -2.914 -13.758 1.00 . A A .  92 LEU HD12 1 1 
        4  7019 1 1  92 LEU HD13 H  11.514  -3.356 -13.991 1.00 . A A .  92 LEU HD13 1 1 
        4  7020 1 1  92 LEU HD21 H  13.082  -0.385 -13.138 1.00 . A A .  92 LEU HD21 1 1 
        4  7021 1 1  92 LEU HD22 H  12.710  -0.460 -14.861 1.00 . A A .  92 LEU HD22 1 1 
        4  7022 1 1  92 LEU HD23 H  13.193  -1.922 -14.000 1.00 . A A .  92 LEU HD23 1 1 
        4  7023 1 1  92 LEU HG   H  11.098  -1.354 -12.519 1.00 . A A .  92 LEU HG   1 1 
        4  7024 1 1  92 LEU N    N  10.984   1.414 -12.336 1.00 . A A .  92 LEU N    1 1 
        4  7025 1 1  92 LEU O    O   8.248  -0.820 -12.396 1.00 . A A .  92 LEU O    1 1 
        4  7026 1 1  93 PHE C    C   7.334   1.344  -8.946 1.00 . A A .  93 PHE C    1 1 
        4  7027 1 1  93 PHE CA   C   7.837   0.237  -9.867 1.00 . A A .  93 PHE CA   1 1 
        4  7028 1 1  93 PHE CB   C   8.551  -0.840  -9.047 1.00 . A A .  93 PHE CB   1 1 
        4  7029 1 1  93 PHE CD1  C   6.832  -2.472  -8.224 1.00 . A A .  93 PHE CD1  1 1 
        4  7030 1 1  93 PHE CD2  C   8.269  -3.141 -10.006 1.00 . A A .  93 PHE CD2  1 1 
        4  7031 1 1  93 PHE CE1  C   6.205  -3.703  -8.264 1.00 . A A .  93 PHE CE1  1 1 
        4  7032 1 1  93 PHE CE2  C   7.645  -4.374 -10.051 1.00 . A A .  93 PHE CE2  1 1 
        4  7033 1 1  93 PHE CG   C   7.871  -2.177  -9.093 1.00 . A A .  93 PHE CG   1 1 
        4  7034 1 1  93 PHE CZ   C   6.612  -4.655  -9.180 1.00 . A A .  93 PHE CZ   1 1 
        4  7035 1 1  93 PHE H    H   9.252   1.583 -10.688 1.00 . A A .  93 PHE H    1 1 
        4  7036 1 1  93 PHE HA   H   6.993  -0.207 -10.371 1.00 . A A .  93 PHE HA   1 1 
        4  7037 1 1  93 PHE HB2  H   9.568  -0.950  -9.424 1.00 . A A .  93 PHE HB2  1 1 
        4  7038 1 1  93 PHE HB3  H   8.596  -0.524  -8.016 1.00 . A A .  93 PHE HB3  1 1 
        4  7039 1 1  93 PHE HD1  H   6.512  -1.729  -7.509 1.00 . A A .  93 PHE HD1  1 1 
        4  7040 1 1  93 PHE HD2  H   9.078  -2.922 -10.689 1.00 . A A .  93 PHE HD2  1 1 
        4  7041 1 1  93 PHE HE1  H   5.397  -3.920  -7.583 1.00 . A A .  93 PHE HE1  1 1 
        4  7042 1 1  93 PHE HE2  H   7.965  -5.114 -10.768 1.00 . A A .  93 PHE HE2  1 1 
        4  7043 1 1  93 PHE HZ   H   6.123  -5.617  -9.213 1.00 . A A .  93 PHE HZ   1 1 
        4  7044 1 1  93 PHE N    N   8.733   0.775 -10.885 1.00 . A A .  93 PHE N    1 1 
        4  7045 1 1  93 PHE O    O   6.885   1.083  -7.832 1.00 . A A .  93 PHE O    1 1 
        4  7046 1 1  94 ASN C    C   7.592   3.719  -7.248 1.00 . A A .  94 ASN C    1 1 
        4  7047 1 1  94 ASN CA   C   6.967   3.732  -8.641 1.00 . A A .  94 ASN CA   1 1 
        4  7048 1 1  94 ASN CB   C   5.442   3.735  -8.527 1.00 . A A .  94 ASN CB   1 1 
        4  7049 1 1  94 ASN CG   C   4.762   3.930  -9.869 1.00 . A A .  94 ASN CG   1 1 
        4  7050 1 1  94 ASN H    H   7.782   2.730 -10.318 1.00 . A A .  94 ASN H    1 1 
        4  7051 1 1  94 ASN HA   H   7.284   4.626  -9.157 1.00 . A A .  94 ASN HA   1 1 
        4  7052 1 1  94 ASN HB2  H   5.117   2.786  -8.101 1.00 . A A .  94 ASN HB2  1 1 
        4  7053 1 1  94 ASN HB3  H   5.137   4.536  -7.870 1.00 . A A .  94 ASN HB3  1 1 
        4  7054 1 1  94 ASN HD21 H   4.705   1.963 -10.153 1.00 . A A .  94 ASN HD21 1 1 
        4  7055 1 1  94 ASN HD22 H   4.030   2.924 -11.420 1.00 . A A .  94 ASN HD22 1 1 
        4  7056 1 1  94 ASN N    N   7.414   2.584  -9.422 1.00 . A A .  94 ASN N    1 1 
        4  7057 1 1  94 ASN ND2  N   4.469   2.828 -10.549 1.00 . A A .  94 ASN ND2  1 1 
        4  7058 1 1  94 ASN O    O   6.911   3.485  -6.253 1.00 . A A .  94 ASN O    1 1 
        4  7059 1 1  94 ASN OD1  O   4.504   5.058 -10.289 1.00 . A A .  94 ASN OD1  1 1 
        4  7060 1 1  95 VAL C    C  11.065   4.420  -6.116 1.00 . A A .  95 VAL C    1 1 
        4  7061 1 1  95 VAL CA   C   9.613   3.995  -5.921 1.00 . A A .  95 VAL CA   1 1 
        4  7062 1 1  95 VAL CB   C   9.581   2.616  -5.235 1.00 . A A .  95 VAL CB   1 1 
        4  7063 1 1  95 VAL CG1  C  10.432   1.616  -6.007 1.00 . A A .  95 VAL CG1  1 1 
        4  7064 1 1  95 VAL CG2  C  10.052   2.726  -3.793 1.00 . A A .  95 VAL CG2  1 1 
        4  7065 1 1  95 VAL H    H   9.386   4.153  -8.019 1.00 . A A .  95 VAL H    1 1 
        4  7066 1 1  95 VAL HA   H   9.125   4.706  -5.272 1.00 . A A .  95 VAL HA   1 1 
        4  7067 1 1  95 VAL HB   H   8.562   2.261  -5.234 1.00 . A A .  95 VAL HB   1 1 
        4  7068 1 1  95 VAL HG11 H  10.533   1.946  -7.031 1.00 . A A .  95 VAL HG11 1 1 
        4  7069 1 1  95 VAL HG12 H  11.407   1.546  -5.552 1.00 . A A .  95 VAL HG12 1 1 
        4  7070 1 1  95 VAL HG13 H   9.954   0.648  -5.987 1.00 . A A .  95 VAL HG13 1 1 
        4  7071 1 1  95 VAL HG21 H   9.723   3.666  -3.377 1.00 . A A .  95 VAL HG21 1 1 
        4  7072 1 1  95 VAL HG22 H   9.639   1.912  -3.218 1.00 . A A .  95 VAL HG22 1 1 
        4  7073 1 1  95 VAL HG23 H  11.132   2.676  -3.761 1.00 . A A .  95 VAL HG23 1 1 
        4  7074 1 1  95 VAL N    N   8.895   3.975  -7.189 1.00 . A A .  95 VAL N    1 1 
        4  7075 1 1  95 VAL O    O  11.647   4.202  -7.178 1.00 . A A .  95 VAL O    1 1 
        4  7076 1 1  96 GLU C    C  13.990   4.333  -4.856 1.00 . A A .  96 GLU C    1 1 
        4  7077 1 1  96 GLU CA   C  13.027   5.482  -5.143 1.00 . A A .  96 GLU CA   1 1 
        4  7078 1 1  96 GLU CB   C  13.256   6.617  -4.143 1.00 . A A .  96 GLU CB   1 1 
        4  7079 1 1  96 GLU CD   C  11.682   7.106  -2.230 1.00 . A A .  96 GLU CD   1 1 
        4  7080 1 1  96 GLU CG   C  12.846   6.269  -2.723 1.00 . A A .  96 GLU CG   1 1 
        4  7081 1 1  96 GLU H    H  11.126   5.170  -4.264 1.00 . A A .  96 GLU H    1 1 
        4  7082 1 1  96 GLU HA   H  13.211   5.850  -6.141 1.00 . A A .  96 GLU HA   1 1 
        4  7083 1 1  96 GLU HB2  H  14.314   6.878  -4.147 1.00 . A A .  96 GLU HB2  1 1 
        4  7084 1 1  96 GLU HB3  H  12.686   7.479  -4.460 1.00 . A A .  96 GLU HB3  1 1 
        4  7085 1 1  96 GLU HG2  H  12.567   5.217  -2.684 1.00 . A A .  96 GLU HG2  1 1 
        4  7086 1 1  96 GLU HG3  H  13.690   6.432  -2.068 1.00 . A A .  96 GLU HG3  1 1 
        4  7087 1 1  96 GLU N    N  11.642   5.025  -5.084 1.00 . A A .  96 GLU N    1 1 
        4  7088 1 1  96 GLU O    O  13.979   3.756  -3.769 1.00 . A A .  96 GLU O    1 1 
        4  7089 1 1  96 GLU OE1  O  10.593   7.021  -2.835 1.00 . A A .  96 GLU OE1  1 1 
        4  7090 1 1  96 GLU OE2  O  11.860   7.844  -1.239 1.00 . A A .  96 GLU OE2  1 1 
        4  7091 1 1  97 CYS C    C  17.190   3.485  -5.443 1.00 . A A .  97 CYS C    1 1 
        4  7092 1 1  97 CYS CA   C  15.792   2.929  -5.695 1.00 . A A .  97 CYS CA   1 1 
        4  7093 1 1  97 CYS CB   C  15.799   2.050  -6.947 1.00 . A A .  97 CYS CB   1 1 
        4  7094 1 1  97 CYS H    H  14.783   4.506  -6.684 1.00 . A A .  97 CYS H    1 1 
        4  7095 1 1  97 CYS HA   H  15.499   2.331  -4.845 1.00 . A A .  97 CYS HA   1 1 
        4  7096 1 1  97 CYS HB2  H  15.582   2.675  -7.813 1.00 . A A .  97 CYS HB2  1 1 
        4  7097 1 1  97 CYS HB3  H  16.782   1.619  -7.069 1.00 . A A .  97 CYS HB3  1 1 
        4  7098 1 1  97 CYS HG   H  14.041   0.617  -5.687 1.00 . A A .  97 CYS HG   1 1 
        4  7099 1 1  97 CYS N    N  14.822   4.008  -5.840 1.00 . A A .  97 CYS N    1 1 
        4  7100 1 1  97 CYS O    O  17.448   4.668  -5.665 1.00 . A A .  97 CYS O    1 1 
        4  7101 1 1  97 CYS SG   S  14.595   0.683  -6.901 1.00 . A A .  97 CYS SG   1 1 
        4  7102 1 1  98 GLN C    C  20.183   3.437  -5.978 1.00 . A A .  98 GLN C    1 1 
        4  7103 1 1  98 GLN CA   C  19.462   3.028  -4.698 1.00 . A A .  98 GLN CA   1 1 
        4  7104 1 1  98 GLN CB   C  20.221   1.892  -4.010 1.00 . A A .  98 GLN CB   1 1 
        4  7105 1 1  98 GLN CD   C  19.657   1.283  -1.624 1.00 . A A .  98 GLN CD   1 1 
        4  7106 1 1  98 GLN CG   C  20.501   2.148  -2.538 1.00 . A A .  98 GLN CG   1 1 
        4  7107 1 1  98 GLN H    H  17.824   1.693  -4.822 1.00 . A A .  98 GLN H    1 1 
        4  7108 1 1  98 GLN HA   H  19.427   3.878  -4.032 1.00 . A A .  98 GLN HA   1 1 
        4  7109 1 1  98 GLN HB2  H  19.636   0.977  -4.100 1.00 . A A .  98 GLN HB2  1 1 
        4  7110 1 1  98 GLN HB3  H  21.165   1.750  -4.514 1.00 . A A .  98 GLN HB3  1 1 
        4  7111 1 1  98 GLN HE21 H  20.675  -0.333  -2.175 1.00 . A A .  98 GLN HE21 1 1 
        4  7112 1 1  98 GLN HE22 H  19.415  -0.596  -1.024 1.00 . A A .  98 GLN HE22 1 1 
        4  7113 1 1  98 GLN HG2  H  21.554   1.951  -2.339 1.00 . A A .  98 GLN HG2  1 1 
        4  7114 1 1  98 GLN HG3  H  20.292   3.187  -2.322 1.00 . A A .  98 GLN HG3  1 1 
        4  7115 1 1  98 GLN N    N  18.090   2.623  -4.979 1.00 . A A .  98 GLN N    1 1 
        4  7116 1 1  98 GLN NE2  N  19.944  -0.013  -1.606 1.00 . A A .  98 GLN NE2  1 1 
        4  7117 1 1  98 GLN O    O  19.838   2.979  -7.066 1.00 . A A .  98 GLN O    1 1 
        4  7118 1 1  98 GLN OE1  O  18.758   1.774  -0.941 1.00 . A A .  98 GLN OE1  1 1 
        4  7119 1 1  99 GLN C    C  22.844   3.661  -7.533 1.00 . A A .  99 GLN C    1 1 
        4  7120 1 1  99 GLN CA   C  21.952   4.769  -6.985 1.00 . A A .  99 GLN CA   1 1 
        4  7121 1 1  99 GLN CB   C  22.804   5.979  -6.592 1.00 . A A .  99 GLN CB   1 1 
        4  7122 1 1  99 GLN CD   C  22.666   7.925  -8.197 1.00 . A A .  99 GLN CD   1 1 
        4  7123 1 1  99 GLN CG   C  23.435   6.687  -7.781 1.00 . A A .  99 GLN CG   1 1 
        4  7124 1 1  99 GLN H    H  21.410   4.628  -4.943 1.00 . A A .  99 GLN H    1 1 
        4  7125 1 1  99 GLN HA   H  21.254   5.066  -7.752 1.00 . A A .  99 GLN HA   1 1 
        4  7126 1 1  99 GLN HB2  H  22.176   6.689  -6.055 1.00 . A A .  99 GLN HB2  1 1 
        4  7127 1 1  99 GLN HB3  H  23.596   5.650  -5.936 1.00 . A A .  99 GLN HB3  1 1 
        4  7128 1 1  99 GLN HE21 H  21.401   6.813  -9.253 1.00 . A A .  99 GLN HE21 1 1 
        4  7129 1 1  99 GLN HE22 H  21.102   8.515  -9.272 1.00 . A A .  99 GLN HE22 1 1 
        4  7130 1 1  99 GLN HG2  H  24.453   6.975  -7.519 1.00 . A A .  99 GLN HG2  1 1 
        4  7131 1 1  99 GLN HG3  H  23.469   6.003  -8.616 1.00 . A A .  99 GLN HG3  1 1 
        4  7132 1 1  99 GLN N    N  21.184   4.300  -5.838 1.00 . A A .  99 GLN N    1 1 
        4  7133 1 1  99 GLN NE2  N  21.617   7.733  -8.989 1.00 . A A .  99 GLN NE2  1 1 
        4  7134 1 1  99 GLN O    O  23.018   3.532  -8.746 1.00 . A A .  99 GLN O    1 1 
        4  7135 1 1  99 GLN OE1  O  23.011   9.044  -7.814 1.00 . A A .  99 GLN OE1  1 1 
        4  7136 1 1 100 THR C    C  24.181   0.601  -6.048 1.00 . A A . 100 THR C    1 1 
        4  7137 1 1 100 THR CA   C  24.285   1.765  -7.027 1.00 . A A . 100 THR CA   1 1 
        4  7138 1 1 100 THR CB   C  25.753   2.221  -7.112 1.00 . A A . 100 THR CB   1 1 
        4  7139 1 1 100 THR CG2  C  26.510   1.417  -8.157 1.00 . A A . 100 THR CG2  1 1 
        4  7140 1 1 100 THR H    H  23.232   3.014  -5.681 1.00 . A A . 100 THR H    1 1 
        4  7141 1 1 100 THR HA   H  23.977   1.429  -8.007 1.00 . A A . 100 THR HA   1 1 
        4  7142 1 1 100 THR HB   H  26.219   2.062  -6.149 1.00 . A A . 100 THR HB   1 1 
        4  7143 1 1 100 THR HG1  H  25.455   4.130  -6.710 1.00 . A A . 100 THR HG1  1 1 
        4  7144 1 1 100 THR HG21 H  26.179   1.708  -9.143 1.00 . A A . 100 THR HG21 1 1 
        4  7145 1 1 100 THR HG22 H  26.320   0.364  -8.010 1.00 . A A . 100 THR HG22 1 1 
        4  7146 1 1 100 THR HG23 H  27.569   1.607  -8.061 1.00 . A A . 100 THR HG23 1 1 
        4  7147 1 1 100 THR N    N  23.410   2.862  -6.634 1.00 . A A . 100 THR N    1 1 
        4  7148 1 1 100 THR O    O  23.936   0.797  -4.858 1.00 . A A . 100 THR O    1 1 
        4  7149 1 1 100 THR OG1  O  25.815   3.615  -7.436 1.00 . A A . 100 THR OG1  1 1 
        4  7150 1 1 101 VAL C    C  25.367  -2.821  -6.132 1.00 . A A . 101 VAL C    1 1 
        4  7151 1 1 101 VAL CA   C  24.300  -1.809  -5.728 1.00 . A A . 101 VAL CA   1 1 
        4  7152 1 1 101 VAL CB   C  22.915  -2.476  -5.819 1.00 . A A . 101 VAL CB   1 1 
        4  7153 1 1 101 VAL CG1  C  21.819  -1.480  -5.470 1.00 . A A . 101 VAL CG1  1 1 
        4  7154 1 1 101 VAL CG2  C  22.695  -3.058  -7.207 1.00 . A A . 101 VAL CG2  1 1 
        4  7155 1 1 101 VAL H    H  24.562  -0.705  -7.514 1.00 . A A . 101 VAL H    1 1 
        4  7156 1 1 101 VAL HA   H  24.468  -1.513  -4.703 1.00 . A A . 101 VAL HA   1 1 
        4  7157 1 1 101 VAL HB   H  22.878  -3.283  -5.103 1.00 . A A . 101 VAL HB   1 1 
        4  7158 1 1 101 VAL HG11 H  20.856  -1.902  -5.721 1.00 . A A . 101 VAL HG11 1 1 
        4  7159 1 1 101 VAL HG12 H  21.853  -1.262  -4.413 1.00 . A A . 101 VAL HG12 1 1 
        4  7160 1 1 101 VAL HG13 H  21.969  -0.570  -6.032 1.00 . A A . 101 VAL HG13 1 1 
        4  7161 1 1 101 VAL HG21 H  22.694  -4.136  -7.150 1.00 . A A . 101 VAL HG21 1 1 
        4  7162 1 1 101 VAL HG22 H  21.747  -2.715  -7.595 1.00 . A A . 101 VAL HG22 1 1 
        4  7163 1 1 101 VAL HG23 H  23.489  -2.734  -7.865 1.00 . A A . 101 VAL HG23 1 1 
        4  7164 1 1 101 VAL N    N  24.370  -0.612  -6.558 1.00 . A A . 101 VAL N    1 1 
        4  7165 1 1 101 VAL O    O  25.709  -2.941  -7.308 1.00 . A A . 101 VAL O    1 1 
        4  7166 1 1 102 SER C    C  26.303  -5.936  -5.552 1.00 . A A . 102 SER C    1 1 
        4  7167 1 1 102 SER CA   C  26.918  -4.547  -5.400 1.00 . A A . 102 SER CA   1 1 
        4  7168 1 1 102 SER CB   C  27.943  -4.553  -4.264 1.00 . A A . 102 SER CB   1 1 
        4  7169 1 1 102 SER H    H  25.574  -3.405  -4.230 1.00 . A A . 102 SER H    1 1 
        4  7170 1 1 102 SER HA   H  27.417  -4.285  -6.321 1.00 . A A . 102 SER HA   1 1 
        4  7171 1 1 102 SER HB2  H  28.580  -5.431  -4.360 1.00 . A A . 102 SER HB2  1 1 
        4  7172 1 1 102 SER HB3  H  28.552  -3.663  -4.328 1.00 . A A . 102 SER HB3  1 1 
        4  7173 1 1 102 SER HG   H  27.929  -4.327  -2.317 1.00 . A A . 102 SER HG   1 1 
        4  7174 1 1 102 SER N    N  25.888  -3.547  -5.148 1.00 . A A . 102 SER N    1 1 
        4  7175 1 1 102 SER O    O  25.198  -6.193  -5.072 1.00 . A A . 102 SER O    1 1 
        4  7176 1 1 102 SER OG   O  27.302  -4.578  -3.000 1.00 . A A . 102 SER OG   1 1 
        4  7177 1 1 103 VAL C    C  27.683  -9.197  -6.260 1.00 . A A . 103 VAL C    1 1 
        4  7178 1 1 103 VAL CA   C  26.553  -8.189  -6.437 1.00 . A A . 103 VAL CA   1 1 
        4  7179 1 1 103 VAL CB   C  25.945  -8.356  -7.844 1.00 . A A . 103 VAL CB   1 1 
        4  7180 1 1 103 VAL CG1  C  24.911  -7.274  -8.111 1.00 . A A . 103 VAL CG1  1 1 
        4  7181 1 1 103 VAL CG2  C  27.038  -8.336  -8.902 1.00 . A A . 103 VAL CG2  1 1 
        4  7182 1 1 103 VAL H    H  27.898  -6.561  -6.581 1.00 . A A . 103 VAL H    1 1 
        4  7183 1 1 103 VAL HA   H  25.783  -8.394  -5.708 1.00 . A A . 103 VAL HA   1 1 
        4  7184 1 1 103 VAL HB   H  25.450  -9.316  -7.887 1.00 . A A . 103 VAL HB   1 1 
        4  7185 1 1 103 VAL HG11 H  24.500  -6.930  -7.173 1.00 . A A . 103 VAL HG11 1 1 
        4  7186 1 1 103 VAL HG12 H  25.380  -6.447  -8.625 1.00 . A A . 103 VAL HG12 1 1 
        4  7187 1 1 103 VAL HG13 H  24.119  -7.677  -8.724 1.00 . A A . 103 VAL HG13 1 1 
        4  7188 1 1 103 VAL HG21 H  27.974  -8.050  -8.447 1.00 . A A . 103 VAL HG21 1 1 
        4  7189 1 1 103 VAL HG22 H  27.135  -9.319  -9.338 1.00 . A A . 103 VAL HG22 1 1 
        4  7190 1 1 103 VAL HG23 H  26.780  -7.623  -9.673 1.00 . A A . 103 VAL HG23 1 1 
        4  7191 1 1 103 VAL N    N  27.026  -6.826  -6.223 1.00 . A A . 103 VAL N    1 1 
        4  7192 1 1 103 VAL O    O  28.855  -8.873  -6.448 1.00 . A A . 103 VAL O    1 1 
        4  7193 1 1 104 THR C    C  27.813 -12.806  -6.265 1.00 . A A . 104 THR C    1 1 
        4  7194 1 1 104 THR CA   C  28.305 -11.482  -5.694 1.00 . A A . 104 THR CA   1 1 
        4  7195 1 1 104 THR CB   C  28.628 -11.667  -4.201 1.00 . A A . 104 THR CB   1 1 
        4  7196 1 1 104 THR CG2  C  30.121 -11.867  -3.990 1.00 . A A . 104 THR CG2  1 1 
        4  7197 1 1 104 THR H    H  26.371 -10.623  -5.764 1.00 . A A . 104 THR H    1 1 
        4  7198 1 1 104 THR HA   H  29.213 -11.195  -6.205 1.00 . A A . 104 THR HA   1 1 
        4  7199 1 1 104 THR HB   H  28.108 -12.545  -3.842 1.00 . A A . 104 THR HB   1 1 
        4  7200 1 1 104 THR HG1  H  28.817  -9.812  -3.563 1.00 . A A . 104 THR HG1  1 1 
        4  7201 1 1 104 THR HG21 H  30.586 -10.914  -3.793 1.00 . A A . 104 THR HG21 1 1 
        4  7202 1 1 104 THR HG22 H  30.554 -12.302  -4.878 1.00 . A A . 104 THR HG22 1 1 
        4  7203 1 1 104 THR HG23 H  30.282 -12.527  -3.151 1.00 . A A . 104 THR HG23 1 1 
        4  7204 1 1 104 THR N    N  27.322 -10.425  -5.898 1.00 . A A . 104 THR N    1 1 
        4  7205 1 1 104 THR O    O  26.641 -13.159  -6.126 1.00 . A A . 104 THR O    1 1 
        4  7206 1 1 104 THR OG1  O  28.184 -10.526  -3.457 1.00 . A A . 104 THR OG1  1 1 
        4  7207 1 1 105 LYS C    C  29.587 -15.753  -7.523 1.00 . A A . 105 LYS C    1 1 
        4  7208 1 1 105 LYS CA   C  28.375 -14.828  -7.500 1.00 . A A . 105 LYS CA   1 1 
        4  7209 1 1 105 LYS CB   C  27.840 -14.635  -8.921 1.00 . A A . 105 LYS CB   1 1 
        4  7210 1 1 105 LYS CD   C  25.673 -14.138 -10.090 1.00 . A A . 105 LYS CD   1 1 
        4  7211 1 1 105 LYS CE   C  25.663 -14.766 -11.475 1.00 . A A . 105 LYS CE   1 1 
        4  7212 1 1 105 LYS CG   C  26.382 -15.026  -9.081 1.00 . A A . 105 LYS CG   1 1 
        4  7213 1 1 105 LYS H    H  29.634 -13.205  -6.988 1.00 . A A . 105 LYS H    1 1 
        4  7214 1 1 105 LYS HA   H  27.604 -15.279  -6.893 1.00 . A A . 105 LYS HA   1 1 
        4  7215 1 1 105 LYS HB2  H  27.952 -13.587  -9.197 1.00 . A A . 105 LYS HB2  1 1 
        4  7216 1 1 105 LYS HB3  H  28.428 -15.236  -9.599 1.00 . A A . 105 LYS HB3  1 1 
        4  7217 1 1 105 LYS HD2  H  24.645 -13.977  -9.763 1.00 . A A . 105 LYS HD2  1 1 
        4  7218 1 1 105 LYS HD3  H  26.182 -13.187 -10.137 1.00 . A A . 105 LYS HD3  1 1 
        4  7219 1 1 105 LYS HE2  H  25.184 -14.079 -12.173 1.00 . A A . 105 LYS HE2  1 1 
        4  7220 1 1 105 LYS HE3  H  26.683 -14.932 -11.787 1.00 . A A . 105 LYS HE3  1 1 
        4  7221 1 1 105 LYS HG2  H  26.325 -16.062  -9.415 1.00 . A A . 105 LYS HG2  1 1 
        4  7222 1 1 105 LYS HG3  H  25.887 -14.935  -8.124 1.00 . A A . 105 LYS HG3  1 1 
        4  7223 1 1 105 LYS HZ1  H  25.586 -16.844 -11.276 1.00 . A A . 105 LYS HZ1  1 1 
        4  7224 1 1 105 LYS HZ2  H  24.513 -16.225 -12.429 1.00 . A A . 105 LYS HZ2  1 1 
        4  7225 1 1 105 LYS HZ3  H  24.174 -16.055 -10.782 1.00 . A A . 105 LYS HZ3  1 1 
        4  7226 1 1 105 LYS N    N  28.715 -13.539  -6.909 1.00 . A A . 105 LYS N    1 1 
        4  7227 1 1 105 LYS NZ   N  24.933 -16.063 -11.491 1.00 . A A . 105 LYS NZ   1 1 
        4  7228 1 1 105 LYS O    O  30.735 -15.312  -7.573 1.00 . A A . 105 LYS O    1 1 
        4  7229 1 1 106 PRO C    C  31.095 -18.159  -8.853 1.00 . A A . 106 PRO C    1 1 
        4  7230 1 1 106 PRO CA   C  30.386 -18.084  -7.506 1.00 . A A . 106 PRO CA   1 1 
        4  7231 1 1 106 PRO CB   C  29.633 -19.386  -7.224 1.00 . A A . 106 PRO CB   1 1 
        4  7232 1 1 106 PRO CD   C  27.984 -17.667  -7.428 1.00 . A A . 106 PRO CD   1 1 
        4  7233 1 1 106 PRO CG   C  28.240 -19.126  -7.686 1.00 . A A . 106 PRO CG   1 1 
        4  7234 1 1 106 PRO HA   H  31.114 -17.912  -6.727 1.00 . A A . 106 PRO HA   1 1 
        4  7235 1 1 106 PRO HB2  H  30.072 -20.207  -7.790 1.00 . A A . 106 PRO HB2  1 1 
        4  7236 1 1 106 PRO HB3  H  29.663 -19.603  -6.167 1.00 . A A . 106 PRO HB3  1 1 
        4  7237 1 1 106 PRO HD2  H  27.342 -17.247  -8.203 1.00 . A A . 106 PRO HD2  1 1 
        4  7238 1 1 106 PRO HD3  H  27.544 -17.528  -6.452 1.00 . A A . 106 PRO HD3  1 1 
        4  7239 1 1 106 PRO HG2  H  28.151 -19.342  -8.751 1.00 . A A . 106 PRO HG2  1 1 
        4  7240 1 1 106 PRO HG3  H  27.548 -19.734  -7.123 1.00 . A A . 106 PRO HG3  1 1 
        4  7241 1 1 106 PRO N    N  29.328 -17.069  -7.488 1.00 . A A . 106 PRO N    1 1 
        4  7242 1 1 106 PRO O    O  30.482 -18.484  -9.871 1.00 . A A . 106 PRO O    1 1 
        4  7243 1 1 107 CYS C    C  34.621 -18.301  -9.782 1.00 . A A . 107 CYS C    1 1 
        4  7244 1 1 107 CYS CA   C  33.181 -17.892 -10.078 1.00 . A A . 107 CYS CA   1 1 
        4  7245 1 1 107 CYS CB   C  33.159 -16.524 -10.763 1.00 . A A . 107 CYS CB   1 1 
        4  7246 1 1 107 CYS H    H  32.823 -17.606  -8.012 1.00 . A A . 107 CYS H    1 1 
        4  7247 1 1 107 CYS HA   H  32.740 -18.623 -10.738 1.00 . A A . 107 CYS HA   1 1 
        4  7248 1 1 107 CYS HB2  H  32.129 -16.283 -11.026 1.00 . A A . 107 CYS HB2  1 1 
        4  7249 1 1 107 CYS HB3  H  33.522 -15.778 -10.071 1.00 . A A . 107 CYS HB3  1 1 
        4  7250 1 1 107 CYS HG   H  33.881 -17.451 -13.075 1.00 . A A . 107 CYS HG   1 1 
        4  7251 1 1 107 CYS N    N  32.389 -17.859  -8.855 1.00 . A A . 107 CYS N    1 1 
        4  7252 1 1 107 CYS O    O  35.177 -17.952  -8.741 1.00 . A A . 107 CYS O    1 1 
        4  7253 1 1 107 CYS SG   S  34.181 -16.430 -12.267 1.00 . A A . 107 CYS SG   1 1 
        4  7254 1 1 108 THR C    C  37.390 -19.323 -11.833 1.00 . A A . 108 THR C    1 1 
        4  7255 1 1 108 THR CA   C  36.595 -19.505 -10.544 1.00 . A A . 108 THR CA   1 1 
        4  7256 1 1 108 THR CB   C  36.648 -20.986 -10.126 1.00 . A A . 108 THR CB   1 1 
        4  7257 1 1 108 THR CG2  C  35.698 -21.822 -10.971 1.00 . A A . 108 THR CG2  1 1 
        4  7258 1 1 108 THR H    H  34.726 -19.293 -11.515 1.00 . A A . 108 THR H    1 1 
        4  7259 1 1 108 THR HA   H  37.053 -18.916  -9.764 1.00 . A A . 108 THR HA   1 1 
        4  7260 1 1 108 THR HB   H  36.346 -21.064  -9.092 1.00 . A A . 108 THR HB   1 1 
        4  7261 1 1 108 THR HG1  H  38.097 -21.852 -11.145 1.00 . A A . 108 THR HG1  1 1 
        4  7262 1 1 108 THR HG21 H  34.696 -21.736 -10.578 1.00 . A A . 108 THR HG21 1 1 
        4  7263 1 1 108 THR HG22 H  36.006 -22.855 -10.947 1.00 . A A . 108 THR HG22 1 1 
        4  7264 1 1 108 THR HG23 H  35.715 -21.465 -11.991 1.00 . A A . 108 THR HG23 1 1 
        4  7265 1 1 108 THR N    N  35.220 -19.047 -10.706 1.00 . A A . 108 THR N    1 1 
        4  7266 1 1 108 THR O    O  36.837 -19.394 -12.932 1.00 . A A . 108 THR O    1 1 
        4  7267 1 1 108 THR OG1  O  37.981 -21.487 -10.263 1.00 . A A . 108 THR OG1  1 1 
        4  7268 1 1 109 THR C    C  39.667 -20.176 -13.673 1.00 . A A . 109 THR C    1 1 
        4  7269 1 1 109 THR CA   C  39.562 -18.899 -12.845 1.00 . A A . 109 THR CA   1 1 
        4  7270 1 1 109 THR CB   C  40.975 -18.462 -12.415 1.00 . A A . 109 THR CB   1 1 
        4  7271 1 1 109 THR CG2  C  41.561 -17.471 -13.409 1.00 . A A . 109 THR CG2  1 1 
        4  7272 1 1 109 THR H    H  39.073 -19.047 -10.790 1.00 . A A . 109 THR H    1 1 
        4  7273 1 1 109 THR HA   H  39.137 -18.118 -13.457 1.00 . A A . 109 THR HA   1 1 
        4  7274 1 1 109 THR HB   H  41.611 -19.336 -12.381 1.00 . A A . 109 THR HB   1 1 
        4  7275 1 1 109 THR HG1  H  40.198 -17.246 -11.069 1.00 . A A . 109 THR HG1  1 1 
        4  7276 1 1 109 THR HG21 H  41.818 -16.557 -12.896 1.00 . A A . 109 THR HG21 1 1 
        4  7277 1 1 109 THR HG22 H  40.833 -17.260 -14.178 1.00 . A A . 109 THR HG22 1 1 
        4  7278 1 1 109 THR HG23 H  42.447 -17.894 -13.857 1.00 . A A . 109 THR HG23 1 1 
        4  7279 1 1 109 THR N    N  38.691 -19.091 -11.691 1.00 . A A . 109 THR N    1 1 
        4  7280 1 1 109 THR O    O  39.191 -21.235 -13.265 1.00 . A A . 109 THR O    1 1 
        4  7281 1 1 109 THR OG1  O  40.930 -17.869 -11.112 1.00 . A A . 109 THR OG1  1 1 
        4  7282 1 1 110 LYS C    C  41.854 -21.213 -16.354 1.00 . A A . 110 LYS C    1 1 
        4  7283 1 1 110 LYS CA   C  40.466 -21.214 -15.724 1.00 . A A . 110 LYS CA   1 1 
        4  7284 1 1 110 LYS CB   C  39.397 -21.200 -16.820 1.00 . A A . 110 LYS CB   1 1 
        4  7285 1 1 110 LYS CD   C  38.356 -23.456 -16.454 1.00 . A A . 110 LYS CD   1 1 
        4  7286 1 1 110 LYS CE   C  36.880 -23.089 -16.411 1.00 . A A . 110 LYS CE   1 1 
        4  7287 1 1 110 LYS CG   C  39.123 -22.568 -17.419 1.00 . A A . 110 LYS CG   1 1 
        4  7288 1 1 110 LYS H    H  40.654 -19.196 -15.110 1.00 . A A . 110 LYS H    1 1 
        4  7289 1 1 110 LYS HA   H  40.351 -22.110 -15.133 1.00 . A A . 110 LYS HA   1 1 
        4  7290 1 1 110 LYS HB2  H  38.470 -20.811 -16.400 1.00 . A A . 110 LYS HB2  1 1 
        4  7291 1 1 110 LYS HB3  H  39.720 -20.541 -17.614 1.00 . A A . 110 LYS HB3  1 1 
        4  7292 1 1 110 LYS HD2  H  38.456 -24.495 -16.768 1.00 . A A . 110 LYS HD2  1 1 
        4  7293 1 1 110 LYS HD3  H  38.775 -23.342 -15.464 1.00 . A A . 110 LYS HD3  1 1 
        4  7294 1 1 110 LYS HE2  H  36.457 -23.424 -15.464 1.00 . A A . 110 LYS HE2  1 1 
        4  7295 1 1 110 LYS HE3  H  36.788 -22.014 -16.477 1.00 . A A . 110 LYS HE3  1 1 
        4  7296 1 1 110 LYS HG2  H  38.541 -22.448 -18.333 1.00 . A A . 110 LYS HG2  1 1 
        4  7297 1 1 110 LYS HG3  H  40.064 -23.042 -17.659 1.00 . A A . 110 LYS HG3  1 1 
        4  7298 1 1 110 LYS HZ1  H  35.582 -24.531 -17.185 1.00 . A A . 110 LYS HZ1  1 1 
        4  7299 1 1 110 LYS HZ2  H  36.775 -24.027 -18.273 1.00 . A A . 110 LYS HZ2  1 1 
        4  7300 1 1 110 LYS HZ3  H  35.458 -23.021 -17.939 1.00 . A A . 110 LYS HZ3  1 1 
        4  7301 1 1 110 LYS N    N  40.295 -20.068 -14.839 1.00 . A A . 110 LYS N    1 1 
        4  7302 1 1 110 LYS NZ   N  36.121 -23.711 -17.530 1.00 . A A . 110 LYS NZ   1 1 
        4  7303 1 1 110 LYS O    O  42.482 -20.164 -16.497 1.00 . A A . 110 LYS O    1 1 
        4  7304 1 1 111 VAL C    C  43.791 -21.590 -18.537 1.00 . A A . 111 VAL C    1 1 
        4  7305 1 1 111 VAL CA   C  43.643 -22.531 -17.348 1.00 . A A . 111 VAL CA   1 1 
        4  7306 1 1 111 VAL CB   C  43.898 -23.976 -17.817 1.00 . A A . 111 VAL CB   1 1 
        4  7307 1 1 111 VAL CG1  C  45.265 -24.092 -18.471 1.00 . A A . 111 VAL CG1  1 1 
        4  7308 1 1 111 VAL CG2  C  43.772 -24.944 -16.650 1.00 . A A . 111 VAL CG2  1 1 
        4  7309 1 1 111 VAL H    H  41.781 -23.197 -16.590 1.00 . A A . 111 VAL H    1 1 
        4  7310 1 1 111 VAL HA   H  44.388 -22.279 -16.606 1.00 . A A . 111 VAL HA   1 1 
        4  7311 1 1 111 VAL HB   H  43.147 -24.232 -18.551 1.00 . A A . 111 VAL HB   1 1 
        4  7312 1 1 111 VAL HG11 H  45.161 -23.979 -19.541 1.00 . A A . 111 VAL HG11 1 1 
        4  7313 1 1 111 VAL HG12 H  45.915 -23.320 -18.089 1.00 . A A . 111 VAL HG12 1 1 
        4  7314 1 1 111 VAL HG13 H  45.687 -25.063 -18.253 1.00 . A A . 111 VAL HG13 1 1 
        4  7315 1 1 111 VAL HG21 H  44.723 -25.427 -16.479 1.00 . A A . 111 VAL HG21 1 1 
        4  7316 1 1 111 VAL HG22 H  43.478 -24.402 -15.764 1.00 . A A . 111 VAL HG22 1 1 
        4  7317 1 1 111 VAL HG23 H  43.026 -25.691 -16.878 1.00 . A A . 111 VAL HG23 1 1 
        4  7318 1 1 111 VAL N    N  42.329 -22.395 -16.731 1.00 . A A . 111 VAL N    1 1 
        4  7319 1 1 111 VAL O    O  42.939 -21.554 -19.425 1.00 . A A . 111 VAL O    1 1 
        4  7320 1 1 112 LYS C    C  46.603 -19.948 -20.064 1.00 . A A . 112 LYS C    1 1 
        4  7321 1 1 112 LYS CA   C  45.142 -19.885 -19.631 1.00 . A A . 112 LYS CA   1 1 
        4  7322 1 1 112 LYS CB   C  44.790 -18.461 -19.191 1.00 . A A . 112 LYS CB   1 1 
        4  7323 1 1 112 LYS CD   C  43.017 -16.949 -20.128 1.00 . A A . 112 LYS CD   1 1 
        4  7324 1 1 112 LYS CE   C  43.225 -17.268 -21.600 1.00 . A A . 112 LYS CE   1 1 
        4  7325 1 1 112 LYS CG   C  43.304 -18.155 -19.252 1.00 . A A . 112 LYS CG   1 1 
        4  7326 1 1 112 LYS H    H  45.523 -20.900 -17.813 1.00 . A A . 112 LYS H    1 1 
        4  7327 1 1 112 LYS HA   H  44.519 -20.158 -20.468 1.00 . A A . 112 LYS HA   1 1 
        4  7328 1 1 112 LYS HB2  H  45.135 -18.316 -18.167 1.00 . A A . 112 LYS HB2  1 1 
        4  7329 1 1 112 LYS HB3  H  45.307 -17.762 -19.833 1.00 . A A . 112 LYS HB3  1 1 
        4  7330 1 1 112 LYS HD2  H  41.987 -16.631 -19.973 1.00 . A A . 112 LYS HD2  1 1 
        4  7331 1 1 112 LYS HD3  H  43.683 -16.144 -19.847 1.00 . A A . 112 LYS HD3  1 1 
        4  7332 1 1 112 LYS HE2  H  43.443 -16.345 -22.137 1.00 . A A . 112 LYS HE2  1 1 
        4  7333 1 1 112 LYS HE3  H  44.066 -17.939 -21.696 1.00 . A A . 112 LYS HE3  1 1 
        4  7334 1 1 112 LYS HG2  H  42.777 -19.021 -19.653 1.00 . A A . 112 LYS HG2  1 1 
        4  7335 1 1 112 LYS HG3  H  42.946 -17.956 -18.252 1.00 . A A . 112 LYS HG3  1 1 
        4  7336 1 1 112 LYS HZ1  H  41.601 -17.279 -22.917 1.00 . A A . 112 LYS HZ1  1 1 
        4  7337 1 1 112 LYS HZ2  H  41.315 -18.102 -21.466 1.00 . A A . 112 LYS HZ2  1 1 
        4  7338 1 1 112 LYS HZ3  H  42.286 -18.805 -22.659 1.00 . A A . 112 LYS HZ3  1 1 
        4  7339 1 1 112 LYS N    N  44.880 -20.827 -18.549 1.00 . A A . 112 LYS N    1 1 
        4  7340 1 1 112 LYS NZ   N  42.022 -17.908 -22.203 1.00 . A A . 112 LYS NZ   1 1 
        4  7341 1 1 112 LYS O    O  47.182 -18.942 -20.476 1.00 . A A . 112 LYS O    1 1 
        4  7342 1 1 113 ASN C    C  48.691 -22.163 -21.625 1.00 . A A . 113 ASN C    1 1 
        4  7343 1 1 113 ASN CA   C  48.587 -21.327 -20.352 1.00 . A A . 113 ASN CA   1 1 
        4  7344 1 1 113 ASN CB   C  49.359 -22.008 -19.220 1.00 . A A . 113 ASN CB   1 1 
        4  7345 1 1 113 ASN CG   C  49.253 -21.249 -17.911 1.00 . A A . 113 ASN CG   1 1 
        4  7346 1 1 113 ASN H    H  46.680 -21.899 -19.633 1.00 . A A . 113 ASN H    1 1 
        4  7347 1 1 113 ASN HA   H  49.018 -20.356 -20.537 1.00 . A A . 113 ASN HA   1 1 
        4  7348 1 1 113 ASN HB2  H  48.966 -23.014 -19.078 1.00 . A A . 113 ASN HB2  1 1 
        4  7349 1 1 113 ASN HB3  H  50.402 -22.075 -19.493 1.00 . A A . 113 ASN HB3  1 1 
        4  7350 1 1 113 ASN HD21 H  48.011 -22.622 -17.187 1.00 . A A . 113 ASN HD21 1 1 
        4  7351 1 1 113 ASN HD22 H  48.382 -21.311 -16.125 1.00 . A A . 113 ASN HD22 1 1 
        4  7352 1 1 113 ASN N    N  47.194 -21.135 -19.969 1.00 . A A . 113 ASN N    1 1 
        4  7353 1 1 113 ASN ND2  N  48.470 -21.782 -16.980 1.00 . A A . 113 ASN ND2  1 1 
        4  7354 1 1 113 ASN O    O  48.380 -23.354 -21.626 1.00 . A A . 113 ASN O    1 1 
        4  7355 1 1 113 ASN OD1  O  49.868 -20.196 -17.739 1.00 . A A . 113 ASN OD1  1 1 
        4  7356 1 1 114 LYS C    C  50.731 -22.591 -24.239 1.00 . A A . 114 LYS C    1 1 
        4  7357 1 1 114 LYS CA   C  49.274 -22.212 -23.987 1.00 . A A . 114 LYS CA   1 1 
        4  7358 1 1 114 LYS CB   C  48.764 -21.324 -25.124 1.00 . A A . 114 LYS CB   1 1 
        4  7359 1 1 114 LYS CD   C  46.954 -21.017 -26.838 1.00 . A A . 114 LYS CD   1 1 
        4  7360 1 1 114 LYS CE   C  46.755 -22.151 -27.832 1.00 . A A . 114 LYS CE   1 1 
        4  7361 1 1 114 LYS CG   C  47.298 -21.542 -25.455 1.00 . A A . 114 LYS CG   1 1 
        4  7362 1 1 114 LYS H    H  49.359 -20.579 -22.644 1.00 . A A . 114 LYS H    1 1 
        4  7363 1 1 114 LYS HA   H  48.682 -23.114 -23.953 1.00 . A A . 114 LYS HA   1 1 
        4  7364 1 1 114 LYS HB2  H  48.907 -20.281 -24.844 1.00 . A A . 114 LYS HB2  1 1 
        4  7365 1 1 114 LYS HB3  H  49.345 -21.527 -26.012 1.00 . A A . 114 LYS HB3  1 1 
        4  7366 1 1 114 LYS HD2  H  46.038 -20.429 -26.779 1.00 . A A . 114 LYS HD2  1 1 
        4  7367 1 1 114 LYS HD3  H  47.759 -20.384 -27.185 1.00 . A A . 114 LYS HD3  1 1 
        4  7368 1 1 114 LYS HE2  H  47.362 -23.003 -27.525 1.00 . A A . 114 LYS HE2  1 1 
        4  7369 1 1 114 LYS HE3  H  45.714 -22.439 -27.827 1.00 . A A . 114 LYS HE3  1 1 
        4  7370 1 1 114 LYS HG2  H  47.077 -22.608 -25.412 1.00 . A A . 114 LYS HG2  1 1 
        4  7371 1 1 114 LYS HG3  H  46.693 -21.026 -24.722 1.00 . A A . 114 LYS HG3  1 1 
        4  7372 1 1 114 LYS HZ1  H  47.008 -20.729 -29.340 1.00 . A A . 114 LYS HZ1  1 1 
        4  7373 1 1 114 LYS HZ2  H  46.553 -22.256 -29.908 1.00 . A A . 114 LYS HZ2  1 1 
        4  7374 1 1 114 LYS HZ3  H  48.140 -21.986 -29.387 1.00 . A A . 114 LYS HZ3  1 1 
        4  7375 1 1 114 LYS N    N  49.129 -21.531 -22.708 1.00 . A A . 114 LYS N    1 1 
        4  7376 1 1 114 LYS NZ   N  47.142 -21.752 -29.214 1.00 . A A . 114 LYS NZ   1 1 
        4  7377 1 1 114 LYS O    O  51.653 -22.043 -23.635 1.00 . A A . 114 LYS O    1 1 
        4  7378 1 1 115 PRO C    C  53.085 -22.974 -26.274 1.00 . A A . 115 PRO C    1 1 
        4  7379 1 1 115 PRO CA   C  52.288 -24.021 -25.505 1.00 . A A . 115 PRO CA   1 1 
        4  7380 1 1 115 PRO CB   C  52.015 -25.241 -26.389 1.00 . A A . 115 PRO CB   1 1 
        4  7381 1 1 115 PRO CD   C  49.893 -24.248 -25.910 1.00 . A A . 115 PRO CD   1 1 
        4  7382 1 1 115 PRO CG   C  50.662 -24.996 -26.964 1.00 . A A . 115 PRO CG   1 1 
        4  7383 1 1 115 PRO HA   H  52.844 -24.325 -24.631 1.00 . A A . 115 PRO HA   1 1 
        4  7384 1 1 115 PRO HB2  H  52.757 -25.306 -27.184 1.00 . A A . 115 PRO HB2  1 1 
        4  7385 1 1 115 PRO HB3  H  52.031 -26.137 -25.787 1.00 . A A . 115 PRO HB3  1 1 
        4  7386 1 1 115 PRO HD2  H  49.211 -23.532 -26.368 1.00 . A A . 115 PRO HD2  1 1 
        4  7387 1 1 115 PRO HD3  H  49.354 -24.936 -25.277 1.00 . A A . 115 PRO HD3  1 1 
        4  7388 1 1 115 PRO HG2  H  50.740 -24.395 -27.870 1.00 . A A . 115 PRO HG2  1 1 
        4  7389 1 1 115 PRO HG3  H  50.180 -25.938 -27.180 1.00 . A A . 115 PRO HG3  1 1 
        4  7390 1 1 115 PRO N    N  50.945 -23.549 -25.152 1.00 . A A . 115 PRO N    1 1 
        4  7391 1 1 115 PRO O    O  52.625 -22.447 -27.287 1.00 . A A . 115 PRO O    1 1 
        4  7392 1 1 116 LYS C    C  56.620 -22.004 -26.164 1.00 . A A . 116 LYS C    1 1 
        4  7393 1 1 116 LYS CA   C  55.150 -21.693 -26.429 1.00 . A A . 116 LYS CA   1 1 
        4  7394 1 1 116 LYS CB   C  54.817 -20.286 -25.927 1.00 . A A . 116 LYS CB   1 1 
        4  7395 1 1 116 LYS CD   C  53.086 -18.491 -25.620 1.00 . A A . 116 LYS CD   1 1 
        4  7396 1 1 116 LYS CE   C  52.141 -18.514 -24.429 1.00 . A A . 116 LYS CE   1 1 
        4  7397 1 1 116 LYS CG   C  53.365 -19.893 -26.138 1.00 . A A . 116 LYS CG   1 1 
        4  7398 1 1 116 LYS H    H  54.598 -23.129 -24.975 1.00 . A A . 116 LYS H    1 1 
        4  7399 1 1 116 LYS HA   H  54.972 -21.739 -27.493 1.00 . A A . 116 LYS HA   1 1 
        4  7400 1 1 116 LYS HB2  H  55.042 -20.232 -24.862 1.00 . A A . 116 LYS HB2  1 1 
        4  7401 1 1 116 LYS HB3  H  55.440 -19.574 -26.450 1.00 . A A . 116 LYS HB3  1 1 
        4  7402 1 1 116 LYS HD2  H  54.026 -18.027 -25.322 1.00 . A A . 116 LYS HD2  1 1 
        4  7403 1 1 116 LYS HD3  H  52.639 -17.908 -26.413 1.00 . A A . 116 LYS HD3  1 1 
        4  7404 1 1 116 LYS HE2  H  51.681 -17.532 -24.320 1.00 . A A . 116 LYS HE2  1 1 
        4  7405 1 1 116 LYS HE3  H  51.369 -19.247 -24.613 1.00 . A A . 116 LYS HE3  1 1 
        4  7406 1 1 116 LYS HG2  H  53.134 -19.935 -27.202 1.00 . A A . 116 LYS HG2  1 1 
        4  7407 1 1 116 LYS HG3  H  52.733 -20.593 -25.610 1.00 . A A . 116 LYS HG3  1 1 
        4  7408 1 1 116 LYS HZ1  H  52.716 -19.870 -22.947 1.00 . A A . 116 LYS HZ1  1 1 
        4  7409 1 1 116 LYS HZ2  H  52.475 -18.295 -22.379 1.00 . A A . 116 LYS HZ2  1 1 
        4  7410 1 1 116 LYS HZ3  H  53.867 -18.670 -23.263 1.00 . A A . 116 LYS HZ3  1 1 
        4  7411 1 1 116 LYS N    N  54.286 -22.676 -25.787 1.00 . A A . 116 LYS N    1 1 
        4  7412 1 1 116 LYS NZ   N  52.849 -18.862 -23.165 1.00 . A A . 116 LYS NZ   1 1 
        4  7413 1 1 116 LYS O    O  57.222 -21.462 -25.238 1.00 . A A . 116 LYS O    1 1 
        4  7414 1 1 117 GLY C    C  58.758 -24.571 -26.102 1.00 . A A . 117 GLY C    1 1 
        4  7415 1 1 117 GLY CA   C  58.586 -23.247 -26.822 1.00 . A A . 117 GLY CA   1 1 
        4  7416 1 1 117 GLY H    H  56.662 -23.280 -27.705 1.00 . A A . 117 GLY H    1 1 
        4  7417 1 1 117 GLY HA2  H  59.045 -23.317 -27.797 1.00 . A A . 117 GLY HA2  1 1 
        4  7418 1 1 117 GLY HA3  H  59.086 -22.476 -26.253 1.00 . A A . 117 GLY HA3  1 1 
        4  7419 1 1 117 GLY N    N  57.191 -22.880 -26.984 1.00 . A A . 117 GLY N    1 1 
        4  7420 1 1 117 GLY O    O  58.171 -24.792 -25.043 1.00 . A A . 117 GLY O    1 1 
        4  7421 1 1 118 LYS C    C  60.939 -26.697 -25.067 1.00 . A A . 118 LYS C    1 1 
        4  7422 1 1 118 LYS CA   C  59.810 -26.766 -26.090 1.00 . A A . 118 LYS CA   1 1 
        4  7423 1 1 118 LYS CB   C  60.157 -27.783 -27.181 1.00 . A A . 118 LYS CB   1 1 
        4  7424 1 1 118 LYS CD   C  60.590 -30.122 -26.371 1.00 . A A . 118 LYS CD   1 1 
        4  7425 1 1 118 LYS CE   C  59.948 -31.135 -25.436 1.00 . A A . 118 LYS CE   1 1 
        4  7426 1 1 118 LYS CG   C  59.561 -29.159 -26.941 1.00 . A A . 118 LYS CG   1 1 
        4  7427 1 1 118 LYS H    H  60.003 -25.222 -27.525 1.00 . A A . 118 LYS H    1 1 
        4  7428 1 1 118 LYS HA   H  58.906 -27.081 -25.590 1.00 . A A . 118 LYS HA   1 1 
        4  7429 1 1 118 LYS HB2  H  59.794 -27.407 -28.138 1.00 . A A . 118 LYS HB2  1 1 
        4  7430 1 1 118 LYS HB3  H  61.232 -27.884 -27.233 1.00 . A A . 118 LYS HB3  1 1 
        4  7431 1 1 118 LYS HD2  H  61.076 -30.651 -27.191 1.00 . A A . 118 LYS HD2  1 1 
        4  7432 1 1 118 LYS HD3  H  61.333 -29.558 -25.823 1.00 . A A . 118 LYS HD3  1 1 
        4  7433 1 1 118 LYS HE2  H  60.655 -31.386 -24.645 1.00 . A A . 118 LYS HE2  1 1 
        4  7434 1 1 118 LYS HE3  H  59.069 -30.690 -24.994 1.00 . A A . 118 LYS HE3  1 1 
        4  7435 1 1 118 LYS HG2  H  58.729 -29.071 -26.241 1.00 . A A . 118 LYS HG2  1 1 
        4  7436 1 1 118 LYS HG3  H  59.194 -29.551 -27.880 1.00 . A A . 118 LYS HG3  1 1 
        4  7437 1 1 118 LYS HZ1  H  58.592 -32.660 -25.879 1.00 . A A . 118 LYS HZ1  1 1 
        4  7438 1 1 118 LYS HZ2  H  60.212 -33.151 -25.912 1.00 . A A . 118 LYS HZ2  1 1 
        4  7439 1 1 118 LYS HZ3  H  59.582 -32.225 -27.179 1.00 . A A . 118 LYS HZ3  1 1 
        4  7440 1 1 118 LYS N    N  59.563 -25.457 -26.680 1.00 . A A . 118 LYS N    1 1 
        4  7441 1 1 118 LYS NZ   N  59.556 -32.380 -26.152 1.00 . A A . 118 LYS NZ   1 1 
        4  7442 1 1 118 LYS O    O  60.785 -27.134 -23.926 1.00 . A A . 118 LYS O    1 1 
        4  7443 1 1 119 LYS C    C  64.244 -25.032 -25.176 1.00 . A A . 119 LYS C    1 1 
        4  7444 1 1 119 LYS CA   C  63.228 -26.015 -24.600 1.00 . A A . 119 LYS CA   1 1 
        4  7445 1 1 119 LYS CB   C  63.888 -27.378 -24.386 1.00 . A A . 119 LYS CB   1 1 
        4  7446 1 1 119 LYS CD   C  66.016 -27.831 -23.130 1.00 . A A . 119 LYS CD   1 1 
        4  7447 1 1 119 LYS CE   C  66.741 -27.544 -21.824 1.00 . A A . 119 LYS CE   1 1 
        4  7448 1 1 119 LYS CG   C  64.529 -27.536 -23.018 1.00 . A A . 119 LYS CG   1 1 
        4  7449 1 1 119 LYS H    H  62.135 -25.813 -26.402 1.00 . A A . 119 LYS H    1 1 
        4  7450 1 1 119 LYS HA   H  62.881 -25.639 -23.650 1.00 . A A . 119 LYS HA   1 1 
        4  7451 1 1 119 LYS HB2  H  63.133 -28.155 -24.509 1.00 . A A . 119 LYS HB2  1 1 
        4  7452 1 1 119 LYS HB3  H  64.652 -27.517 -25.137 1.00 . A A . 119 LYS HB3  1 1 
        4  7453 1 1 119 LYS HD2  H  66.154 -28.880 -23.392 1.00 . A A . 119 LYS HD2  1 1 
        4  7454 1 1 119 LYS HD3  H  66.439 -27.212 -23.909 1.00 . A A . 119 LYS HD3  1 1 
        4  7455 1 1 119 LYS HE2  H  66.782 -26.466 -21.669 1.00 . A A . 119 LYS HE2  1 1 
        4  7456 1 1 119 LYS HE3  H  66.187 -27.997 -21.014 1.00 . A A . 119 LYS HE3  1 1 
        4  7457 1 1 119 LYS HG2  H  64.389 -26.616 -22.450 1.00 . A A . 119 LYS HG2  1 1 
        4  7458 1 1 119 LYS HG3  H  64.048 -28.351 -22.497 1.00 . A A . 119 LYS HG3  1 1 
        4  7459 1 1 119 LYS HZ1  H  68.593 -27.885 -20.920 1.00 . A A . 119 LYS HZ1  1 1 
        4  7460 1 1 119 LYS HZ2  H  68.678 -27.654 -22.594 1.00 . A A . 119 LYS HZ2  1 1 
        4  7461 1 1 119 LYS HZ3  H  68.106 -29.118 -21.971 1.00 . A A . 119 LYS HZ3  1 1 
        4  7462 1 1 119 LYS N    N  62.074 -26.143 -25.481 1.00 . A A . 119 LYS N    1 1 
        4  7463 1 1 119 LYS NZ   N  68.126 -28.089 -21.828 1.00 . A A . 119 LYS NZ   1 1 
        4  7464 1 1 119 LYS O    O  65.443 -25.151 -24.932 1.00 . A A . 119 LYS O    1 1 
        4  7465 1 1 120 GLY C    C  64.865 -23.317 -28.013 1.00 . A A . 120 GLY C    1 1 
        4  7466 1 1 120 GLY CA   C  64.633 -23.070 -26.535 1.00 . A A . 120 GLY CA   1 1 
        4  7467 1 1 120 GLY H    H  62.788 -24.015 -26.099 1.00 . A A . 120 GLY H    1 1 
        4  7468 1 1 120 GLY HA2  H  64.193 -22.093 -26.410 1.00 . A A . 120 GLY HA2  1 1 
        4  7469 1 1 120 GLY HA3  H  65.583 -23.095 -26.024 1.00 . A A . 120 GLY HA3  1 1 
        4  7470 1 1 120 GLY N    N  63.753 -24.060 -25.940 1.00 . A A . 120 GLY N    1 1 
        4  7471 1 1 120 GLY O    O  65.968 -23.107 -28.519 1.00 . A A . 120 GLY O    1 1 
        4  7472 1 1 121 LYS C    C  64.944 -25.141 -30.410 1.00 . A A . 121 LYS C    1 1 
        4  7473 1 1 121 LYS CA   C  63.920 -24.043 -30.136 1.00 . A A . 121 LYS CA   1 1 
        4  7474 1 1 121 LYS CB   C  64.303 -22.772 -30.898 1.00 . A A . 121 LYS CB   1 1 
        4  7475 1 1 121 LYS CD   C  63.551 -21.137 -32.651 1.00 . A A . 121 LYS CD   1 1 
        4  7476 1 1 121 LYS CE   C  64.808 -20.821 -33.449 1.00 . A A . 121 LYS CE   1 1 
        4  7477 1 1 121 LYS CG   C  63.531 -22.585 -32.194 1.00 . A A . 121 LYS CG   1 1 
        4  7478 1 1 121 LYS H    H  62.971 -23.913 -28.248 1.00 . A A . 121 LYS H    1 1 
        4  7479 1 1 121 LYS HA   H  62.951 -24.378 -30.475 1.00 . A A . 121 LYS HA   1 1 
        4  7480 1 1 121 LYS HB2  H  64.120 -21.911 -30.256 1.00 . A A . 121 LYS HB2  1 1 
        4  7481 1 1 121 LYS HB3  H  65.356 -22.811 -31.133 1.00 . A A . 121 LYS HB3  1 1 
        4  7482 1 1 121 LYS HD2  H  62.676 -20.946 -33.271 1.00 . A A . 121 LYS HD2  1 1 
        4  7483 1 1 121 LYS HD3  H  63.518 -20.493 -31.782 1.00 . A A . 121 LYS HD3  1 1 
        4  7484 1 1 121 LYS HE2  H  65.467 -21.689 -33.433 1.00 . A A . 121 LYS HE2  1 1 
        4  7485 1 1 121 LYS HE3  H  64.525 -20.612 -34.471 1.00 . A A . 121 LYS HE3  1 1 
        4  7486 1 1 121 LYS HG2  H  63.976 -23.210 -32.968 1.00 . A A . 121 LYS HG2  1 1 
        4  7487 1 1 121 LYS HG3  H  62.506 -22.889 -32.038 1.00 . A A . 121 LYS HG3  1 1 
        4  7488 1 1 121 LYS HZ1  H  65.612 -19.725 -31.864 1.00 . A A . 121 LYS HZ1  1 1 
        4  7489 1 1 121 LYS HZ2  H  65.027 -18.768 -33.132 1.00 . A A . 121 LYS HZ2  1 1 
        4  7490 1 1 121 LYS HZ3  H  66.492 -19.596 -33.303 1.00 . A A . 121 LYS HZ3  1 1 
        4  7491 1 1 121 LYS N    N  63.826 -23.765 -28.708 1.00 . A A . 121 LYS N    1 1 
        4  7492 1 1 121 LYS NZ   N  65.537 -19.646 -32.898 1.00 . A A . 121 LYS NZ   1 1 
        4  7493 1 1 121 LYS O    O  65.537 -25.692 -29.487 1.00 . A A . 121 LYS O    1 1 
        4  7494 1 1 122 GLY C    C  66.819 -26.159 -33.358 1.00 . A A . 122 GLY C    1 1 
        4  7495 1 1 122 GLY CA   C  66.100 -26.476 -32.060 1.00 . A A . 122 GLY CA   1 1 
        4  7496 1 1 122 GLY H    H  64.643 -24.973 -32.383 1.00 . A A . 122 GLY H    1 1 
        4  7497 1 1 122 GLY HA2  H  66.830 -26.579 -31.273 1.00 . A A . 122 GLY HA2  1 1 
        4  7498 1 1 122 GLY HA3  H  65.574 -27.414 -32.174 1.00 . A A . 122 GLY HA3  1 1 
        4  7499 1 1 122 GLY N    N  65.146 -25.448 -31.687 1.00 . A A . 122 GLY N    1 1 
        4  7500 1 1 122 GLY O    O  66.343 -25.353 -34.158 1.00 . A A . 122 GLY O    1 1 
        4  7501 1 1 123 LYS C    C  69.479 -27.848 -35.189 1.00 . A A . 123 LYS C    1 1 
        4  7502 1 1 123 LYS CA   C  68.755 -26.573 -34.772 1.00 . A A . 123 LYS CA   1 1 
        4  7503 1 1 123 LYS CB   C  69.768 -25.448 -34.548 1.00 . A A . 123 LYS CB   1 1 
        4  7504 1 1 123 LYS CD   C  71.643 -24.517 -35.936 1.00 . A A . 123 LYS CD   1 1 
        4  7505 1 1 123 LYS CE   C  72.083 -24.458 -37.392 1.00 . A A . 123 LYS CE   1 1 
        4  7506 1 1 123 LYS CG   C  70.140 -24.701 -35.819 1.00 . A A . 123 LYS CG   1 1 
        4  7507 1 1 123 LYS H    H  68.295 -27.423 -32.889 1.00 . A A . 123 LYS H    1 1 
        4  7508 1 1 123 LYS HA   H  68.077 -26.284 -35.562 1.00 . A A . 123 LYS HA   1 1 
        4  7509 1 1 123 LYS HB2  H  69.350 -24.738 -33.835 1.00 . A A . 123 LYS HB2  1 1 
        4  7510 1 1 123 LYS HB3  H  70.669 -25.871 -34.128 1.00 . A A . 123 LYS HB3  1 1 
        4  7511 1 1 123 LYS HD2  H  71.929 -23.591 -35.438 1.00 . A A . 123 LYS HD2  1 1 
        4  7512 1 1 123 LYS HD3  H  72.138 -25.347 -35.453 1.00 . A A . 123 LYS HD3  1 1 
        4  7513 1 1 123 LYS HE2  H  72.968 -25.081 -37.521 1.00 . A A . 123 LYS HE2  1 1 
        4  7514 1 1 123 LYS HE3  H  71.288 -24.844 -38.012 1.00 . A A . 123 LYS HE3  1 1 
        4  7515 1 1 123 LYS HG2  H  69.780 -25.262 -36.681 1.00 . A A . 123 LYS HG2  1 1 
        4  7516 1 1 123 LYS HG3  H  69.666 -23.730 -35.805 1.00 . A A . 123 LYS HG3  1 1 
        4  7517 1 1 123 LYS HZ1  H  72.140 -22.394 -37.071 1.00 . A A . 123 LYS HZ1  1 1 
        4  7518 1 1 123 LYS HZ2  H  71.874 -22.831 -38.683 1.00 . A A . 123 LYS HZ2  1 1 
        4  7519 1 1 123 LYS HZ3  H  73.418 -22.976 -38.013 1.00 . A A . 123 LYS HZ3  1 1 
        4  7520 1 1 123 LYS N    N  67.968 -26.792 -33.565 1.00 . A A . 123 LYS N    1 1 
        4  7521 1 1 123 LYS NZ   N  72.402 -23.067 -37.818 1.00 . A A . 123 LYS NZ   1 1 
        4  7522 1 1 123 LYS O    O  70.040 -28.556 -34.353 1.00 . A A . 123 LYS O    1 1 
        4  7523 1 1 124 GLY C    C  70.304 -29.296 -38.496 1.00 . A A . 124 GLY C    1 1 
        4  7524 1 1 124 GLY CA   C  70.125 -29.326 -36.990 1.00 . A A . 124 GLY CA   1 1 
        4  7525 1 1 124 GLY H    H  69.001 -27.535 -37.107 1.00 . A A . 124 GLY H    1 1 
        4  7526 1 1 124 GLY HA2  H  71.094 -29.411 -36.525 1.00 . A A . 124 GLY HA2  1 1 
        4  7527 1 1 124 GLY HA3  H  69.532 -30.191 -36.727 1.00 . A A . 124 GLY HA3  1 1 
        4  7528 1 1 124 GLY N    N  69.464 -28.136 -36.488 1.00 . A A . 124 GLY N    1 1 
        4  7529 1 1 124 GLY O    O  69.957 -28.314 -39.149 1.00 . A A . 124 GLY O    1 1 
        4  7530 1 1 125 ASN C    C  69.839 -31.010 -41.196 1.00 . A A . 125 ASN C    1 1 
        4  7531 1 1 125 ASN CA   C  71.076 -30.469 -40.485 1.00 . A A . 125 ASN CA   1 1 
        4  7532 1 1 125 ASN CB   C  72.279 -31.369 -40.774 1.00 . A A . 125 ASN CB   1 1 
        4  7533 1 1 125 ASN CG   C  72.377 -31.748 -42.239 1.00 . A A . 125 ASN CG   1 1 
        4  7534 1 1 125 ASN H    H  71.106 -31.128 -38.473 1.00 . A A . 125 ASN H    1 1 
        4  7535 1 1 125 ASN HA   H  71.283 -29.476 -40.851 1.00 . A A . 125 ASN HA   1 1 
        4  7536 1 1 125 ASN HB2  H  73.190 -30.845 -40.483 1.00 . A A . 125 ASN HB2  1 1 
        4  7537 1 1 125 ASN HB3  H  72.194 -32.273 -40.192 1.00 . A A . 125 ASN HB3  1 1 
        4  7538 1 1 125 ASN HD21 H  73.326 -30.048 -42.642 1.00 . A A . 125 ASN HD21 1 1 
        4  7539 1 1 125 ASN HD22 H  73.057 -31.096 -43.989 1.00 . A A . 125 ASN HD22 1 1 
        4  7540 1 1 125 ASN N    N  70.848 -30.376 -39.047 1.00 . A A . 125 ASN N    1 1 
        4  7541 1 1 125 ASN ND2  N  72.981 -30.876 -43.038 1.00 . A A . 125 ASN ND2  1 1 
        4  7542 1 1 125 ASN O    O  69.658 -32.221 -41.312 1.00 . A A . 125 ASN O    1 1 
        4  7543 1 1 125 ASN OXT  O  69.014 -30.225 -41.659 1.00 . A A . 125 ASN OXT  1 1 
        4  7544 1 1 125 ASN OD1  O  71.914 -32.814 -42.649 1.00 . A A . 125 ASN OD1  1 1 
        5  7545 1 1   1 GLY C    C  40.455 -15.782  20.160 1.00 . A A .   1 GLY C    1 1 
        5  7546 1 1   1 GLY CA   C  39.561 -16.390  21.222 1.00 . A A .   1 GLY CA   1 1 
        5  7547 1 1   1 GLY H1   H  39.000 -16.124  23.115 1.00 . A A .   1 GLY H1   1 1 
        5  7548 1 1   1 GLY H2   H  38.931 -14.768  22.213 1.00 . A A .   1 GLY H2   1 1 
        5  7549 1 1   1 GLY H3   H  40.320 -15.266  22.848 1.00 . A A .   1 GLY H3   1 1 
        5  7550 1 1   1 GLY HA2  H  39.941 -17.368  21.481 1.00 . A A .   1 GLY HA2  1 1 
        5  7551 1 1   1 GLY HA3  H  38.565 -16.499  20.818 1.00 . A A .   1 GLY HA3  1 1 
        5  7552 1 1   1 GLY N    N  39.495 -15.580  22.423 1.00 . A A .   1 GLY N    1 1 
        5  7553 1 1   1 GLY O    O  41.233 -16.485  19.515 1.00 . A A .   1 GLY O    1 1 
        5  7554 1 1   2 SER C    C  40.828 -14.269  17.575 1.00 . A A .   2 SER C    1 1 
        5  7555 1 1   2 SER CA   C  41.144 -13.767  18.981 1.00 . A A .   2 SER CA   1 1 
        5  7556 1 1   2 SER CB   C  42.634 -13.947  19.275 1.00 . A A .   2 SER CB   1 1 
        5  7557 1 1   2 SER H    H  39.705 -13.964  20.521 1.00 . A A .   2 SER H    1 1 
        5  7558 1 1   2 SER HA   H  40.898 -12.718  19.039 1.00 . A A .   2 SER HA   1 1 
        5  7559 1 1   2 SER HB2  H  42.974 -14.889  18.844 1.00 . A A .   2 SER HB2  1 1 
        5  7560 1 1   2 SER HB3  H  43.187 -13.133  18.828 1.00 . A A .   2 SER HB3  1 1 
        5  7561 1 1   2 SER HG   H  43.717 -14.397  20.845 1.00 . A A .   2 SER HG   1 1 
        5  7562 1 1   2 SER N    N  40.343 -14.470  19.976 1.00 . A A .   2 SER N    1 1 
        5  7563 1 1   2 SER O    O  40.201 -15.314  17.403 1.00 . A A .   2 SER O    1 1 
        5  7564 1 1   2 SER OG   O  42.882 -13.956  20.670 1.00 . A A .   2 SER OG   1 1 
        5  7565 1 1   3 LYS C    C  42.338 -13.916  14.399 1.00 . A A .   3 LYS C    1 1 
        5  7566 1 1   3 LYS CA   C  41.029 -13.881  15.180 1.00 . A A .   3 LYS CA   1 1 
        5  7567 1 1   3 LYS CB   C  40.060 -12.893  14.528 1.00 . A A .   3 LYS CB   1 1 
        5  7568 1 1   3 LYS CD   C  38.104 -14.416  14.120 1.00 . A A .   3 LYS CD   1 1 
        5  7569 1 1   3 LYS CE   C  37.122 -15.204  14.973 1.00 . A A .   3 LYS CE   1 1 
        5  7570 1 1   3 LYS CG   C  38.602 -13.175  14.843 1.00 . A A .   3 LYS CG   1 1 
        5  7571 1 1   3 LYS H    H  41.758 -12.692  16.773 1.00 . A A .   3 LYS H    1 1 
        5  7572 1 1   3 LYS HA   H  40.590 -14.867  15.167 1.00 . A A .   3 LYS HA   1 1 
        5  7573 1 1   3 LYS HB2  H  40.303 -11.887  14.871 1.00 . A A .   3 LYS HB2  1 1 
        5  7574 1 1   3 LYS HB3  H  40.190 -12.935  13.456 1.00 . A A .   3 LYS HB3  1 1 
        5  7575 1 1   3 LYS HD2  H  37.612 -14.116  13.194 1.00 . A A .   3 LYS HD2  1 1 
        5  7576 1 1   3 LYS HD3  H  38.949 -15.047  13.883 1.00 . A A .   3 LYS HD3  1 1 
        5  7577 1 1   3 LYS HE2  H  37.061 -14.746  15.960 1.00 . A A .   3 LYS HE2  1 1 
        5  7578 1 1   3 LYS HE3  H  36.148 -15.165  14.506 1.00 . A A .   3 LYS HE3  1 1 
        5  7579 1 1   3 LYS HG2  H  38.491 -13.320  15.918 1.00 . A A .   3 LYS HG2  1 1 
        5  7580 1 1   3 LYS HG3  H  38.005 -12.327  14.537 1.00 . A A .   3 LYS HG3  1 1 
        5  7581 1 1   3 LYS HZ1  H  38.544 -16.732  14.899 1.00 . A A .   3 LYS HZ1  1 1 
        5  7582 1 1   3 LYS HZ2  H  36.983 -17.227  14.474 1.00 . A A .   3 LYS HZ2  1 1 
        5  7583 1 1   3 LYS HZ3  H  37.367 -16.946  16.096 1.00 . A A .   3 LYS HZ3  1 1 
        5  7584 1 1   3 LYS N    N  41.264 -13.515  16.573 1.00 . A A .   3 LYS N    1 1 
        5  7585 1 1   3 LYS NZ   N  37.533 -16.626  15.122 1.00 . A A .   3 LYS NZ   1 1 
        5  7586 1 1   3 LYS O    O  43.207 -13.064  14.587 1.00 . A A .   3 LYS O    1 1 
        5  7587 1 1   4 ASN C    C  43.374 -14.796  11.237 1.00 . A A .   4 ASN C    1 1 
        5  7588 1 1   4 ASN CA   C  43.676 -15.050  12.712 1.00 . A A .   4 ASN CA   1 1 
        5  7589 1 1   4 ASN CB   C  44.272 -16.448  12.887 1.00 . A A .   4 ASN CB   1 1 
        5  7590 1 1   4 ASN CG   C  45.663 -16.414  13.490 1.00 . A A .   4 ASN CG   1 1 
        5  7591 1 1   4 ASN H    H  41.747 -15.554  13.418 1.00 . A A .   4 ASN H    1 1 
        5  7592 1 1   4 ASN HA   H  44.395 -14.318  13.051 1.00 . A A .   4 ASN HA   1 1 
        5  7593 1 1   4 ASN HB2  H  43.620 -17.030  13.539 1.00 . A A .   4 ASN HB2  1 1 
        5  7594 1 1   4 ASN HB3  H  44.328 -16.934  11.925 1.00 . A A .   4 ASN HB3  1 1 
        5  7595 1 1   4 ASN HD21 H  45.408 -18.237  14.244 1.00 . A A .   4 ASN HD21 1 1 
        5  7596 1 1   4 ASN HD22 H  46.934 -17.495  14.570 1.00 . A A .   4 ASN HD22 1 1 
        5  7597 1 1   4 ASN N    N  42.473 -14.906  13.522 1.00 . A A .   4 ASN N    1 1 
        5  7598 1 1   4 ASN ND2  N  46.039 -17.490  14.170 1.00 . A A .   4 ASN ND2  1 1 
        5  7599 1 1   4 ASN O    O  42.246 -14.463  10.872 1.00 . A A .   4 ASN O    1 1 
        5  7600 1 1   4 ASN OD1  O  46.390 -15.431  13.345 1.00 . A A .   4 ASN OD1  1 1 
        5  7601 1 1   5 LYS C    C  45.389 -15.375   8.189 1.00 . A A .   5 LYS C    1 1 
        5  7602 1 1   5 LYS CA   C  44.233 -14.745   8.960 1.00 . A A .   5 LYS CA   1 1 
        5  7603 1 1   5 LYS CB   C  44.152 -13.249   8.648 1.00 . A A .   5 LYS CB   1 1 
        5  7604 1 1   5 LYS CD   C  44.473 -12.422   6.298 1.00 . A A .   5 LYS CD   1 1 
        5  7605 1 1   5 LYS CE   C  44.612 -10.910   6.369 1.00 . A A .   5 LYS CE   1 1 
        5  7606 1 1   5 LYS CG   C  43.477 -12.940   7.323 1.00 . A A .   5 LYS CG   1 1 
        5  7607 1 1   5 LYS H    H  45.264 -15.221  10.746 1.00 . A A .   5 LYS H    1 1 
        5  7608 1 1   5 LYS HA   H  43.312 -15.218   8.654 1.00 . A A .   5 LYS HA   1 1 
        5  7609 1 1   5 LYS HB2  H  43.598 -12.754   9.446 1.00 . A A .   5 LYS HB2  1 1 
        5  7610 1 1   5 LYS HB3  H  45.154 -12.845   8.620 1.00 . A A .   5 LYS HB3  1 1 
        5  7611 1 1   5 LYS HD2  H  45.445 -12.879   6.481 1.00 . A A .   5 LYS HD2  1 1 
        5  7612 1 1   5 LYS HD3  H  44.133 -12.698   5.309 1.00 . A A .   5 LYS HD3  1 1 
        5  7613 1 1   5 LYS HE2  H  43.796 -10.505   6.968 1.00 . A A .   5 LYS HE2  1 1 
        5  7614 1 1   5 LYS HE3  H  45.552 -10.670   6.846 1.00 . A A .   5 LYS HE3  1 1 
        5  7615 1 1   5 LYS HG2  H  43.009 -13.847   6.941 1.00 . A A .   5 LYS HG2  1 1 
        5  7616 1 1   5 LYS HG3  H  42.717 -12.189   7.483 1.00 . A A .   5 LYS HG3  1 1 
        5  7617 1 1   5 LYS HZ1  H  44.598  -9.250   5.102 1.00 . A A .   5 LYS HZ1  1 1 
        5  7618 1 1   5 LYS HZ2  H  43.713 -10.567   4.515 1.00 . A A .   5 LYS HZ2  1 1 
        5  7619 1 1   5 LYS HZ3  H  45.404 -10.593   4.462 1.00 . A A .   5 LYS HZ3  1 1 
        5  7620 1 1   5 LYS N    N  44.388 -14.955  10.394 1.00 . A A .   5 LYS N    1 1 
        5  7621 1 1   5 LYS NZ   N  44.579 -10.285   5.018 1.00 . A A .   5 LYS NZ   1 1 
        5  7622 1 1   5 LYS O    O  46.525 -15.397   8.663 1.00 . A A .   5 LYS O    1 1 
        5  7623 1 1   6 LYS C    C  46.022 -15.995   4.726 1.00 . A A .   6 LYS C    1 1 
        5  7624 1 1   6 LYS CA   C  46.107 -16.511   6.159 1.00 . A A .   6 LYS CA   1 1 
        5  7625 1 1   6 LYS CB   C  45.941 -18.031   6.175 1.00 . A A .   6 LYS CB   1 1 
        5  7626 1 1   6 LYS CD   C  44.397 -19.999   5.939 1.00 . A A .   6 LYS CD   1 1 
        5  7627 1 1   6 LYS CE   C  43.261 -20.338   6.894 1.00 . A A .   6 LYS CE   1 1 
        5  7628 1 1   6 LYS CG   C  44.553 -18.498   5.771 1.00 . A A .   6 LYS CG   1 1 
        5  7629 1 1   6 LYS H    H  44.166 -15.835   6.675 1.00 . A A .   6 LYS H    1 1 
        5  7630 1 1   6 LYS HA   H  47.075 -16.258   6.564 1.00 . A A .   6 LYS HA   1 1 
        5  7631 1 1   6 LYS HB2  H  46.669 -18.469   5.492 1.00 . A A .   6 LYS HB2  1 1 
        5  7632 1 1   6 LYS HB3  H  46.142 -18.393   7.174 1.00 . A A .   6 LYS HB3  1 1 
        5  7633 1 1   6 LYS HD2  H  44.194 -20.449   4.967 1.00 . A A .   6 LYS HD2  1 1 
        5  7634 1 1   6 LYS HD3  H  45.318 -20.406   6.333 1.00 . A A .   6 LYS HD3  1 1 
        5  7635 1 1   6 LYS HE2  H  43.674 -20.541   7.882 1.00 . A A .   6 LYS HE2  1 1 
        5  7636 1 1   6 LYS HE3  H  42.597 -19.489   6.956 1.00 . A A .   6 LYS HE3  1 1 
        5  7637 1 1   6 LYS HG2  H  43.812 -17.990   6.388 1.00 . A A .   6 LYS HG2  1 1 
        5  7638 1 1   6 LYS HG3  H  44.385 -18.241   4.734 1.00 . A A .   6 LYS HG3  1 1 
        5  7639 1 1   6 LYS HZ1  H  42.097 -21.353   5.487 1.00 . A A .   6 LYS HZ1  1 1 
        5  7640 1 1   6 LYS HZ2  H  41.705 -21.718   7.093 1.00 . A A .   6 LYS HZ2  1 1 
        5  7641 1 1   6 LYS HZ3  H  43.107 -22.361   6.397 1.00 . A A .   6 LYS HZ3  1 1 
        5  7642 1 1   6 LYS N    N  45.092 -15.883   6.998 1.00 . A A .   6 LYS N    1 1 
        5  7643 1 1   6 LYS NZ   N  42.488 -21.526   6.436 1.00 . A A .   6 LYS NZ   1 1 
        5  7644 1 1   6 LYS O    O  45.150 -15.192   4.396 1.00 . A A .   6 LYS O    1 1 
        5  7645 1 1   7 GLU C    C  46.994 -17.258   1.555 1.00 . A A .   7 GLU C    1 1 
        5  7646 1 1   7 GLU CA   C  46.962 -16.046   2.482 1.00 . A A .   7 GLU CA   1 1 
        5  7647 1 1   7 GLU CB   C  48.177 -15.155   2.216 1.00 . A A .   7 GLU CB   1 1 
        5  7648 1 1   7 GLU CD   C  49.468 -13.081   2.864 1.00 . A A .   7 GLU CD   1 1 
        5  7649 1 1   7 GLU CG   C  48.339 -14.030   3.223 1.00 . A A .   7 GLU CG   1 1 
        5  7650 1 1   7 GLU H    H  47.605 -17.100   4.202 1.00 . A A .   7 GLU H    1 1 
        5  7651 1 1   7 GLU HA   H  46.064 -15.482   2.287 1.00 . A A .   7 GLU HA   1 1 
        5  7652 1 1   7 GLU HB2  H  49.075 -15.773   2.235 1.00 . A A .   7 GLU HB2  1 1 
        5  7653 1 1   7 GLU HB3  H  48.078 -14.718   1.233 1.00 . A A .   7 GLU HB3  1 1 
        5  7654 1 1   7 GLU HG2  H  47.407 -13.466   3.277 1.00 . A A .   7 GLU HG2  1 1 
        5  7655 1 1   7 GLU HG3  H  48.545 -14.460   4.193 1.00 . A A .   7 GLU HG3  1 1 
        5  7656 1 1   7 GLU N    N  46.935 -16.461   3.880 1.00 . A A .   7 GLU N    1 1 
        5  7657 1 1   7 GLU O    O  47.068 -18.400   2.009 1.00 . A A .   7 GLU O    1 1 
        5  7658 1 1   7 GLU OE1  O  50.619 -13.549   2.741 1.00 . A A .   7 GLU OE1  1 1 
        5  7659 1 1   7 GLU OE2  O  49.197 -11.874   2.705 1.00 . A A .   7 GLU OE2  1 1 
        5  7660 1 1   8 LYS C    C  47.199 -17.507  -2.138 1.00 . A A .   8 LYS C    1 1 
        5  7661 1 1   8 LYS CA   C  46.958 -18.069  -0.740 1.00 . A A .   8 LYS CA   1 1 
        5  7662 1 1   8 LYS CB   C  45.641 -18.848  -0.712 1.00 . A A .   8 LYS CB   1 1 
        5  7663 1 1   8 LYS CD   C  44.631 -20.891   0.343 1.00 . A A .   8 LYS CD   1 1 
        5  7664 1 1   8 LYS CE   C  44.823 -22.366   0.662 1.00 . A A .   8 LYS CE   1 1 
        5  7665 1 1   8 LYS CG   C  45.816 -20.329  -0.423 1.00 . A A .   8 LYS CG   1 1 
        5  7666 1 1   8 LYS H    H  46.878 -16.070  -0.048 1.00 . A A .   8 LYS H    1 1 
        5  7667 1 1   8 LYS HA   H  47.768 -18.738  -0.490 1.00 . A A .   8 LYS HA   1 1 
        5  7668 1 1   8 LYS HB2  H  44.997 -18.416   0.054 1.00 . A A .   8 LYS HB2  1 1 
        5  7669 1 1   8 LYS HB3  H  45.156 -18.744  -1.671 1.00 . A A .   8 LYS HB3  1 1 
        5  7670 1 1   8 LYS HD2  H  44.511 -20.336   1.273 1.00 . A A .   8 LYS HD2  1 1 
        5  7671 1 1   8 LYS HD3  H  43.739 -20.774  -0.257 1.00 . A A .   8 LYS HD3  1 1 
        5  7672 1 1   8 LYS HE2  H  43.950 -22.921   0.317 1.00 . A A .   8 LYS HE2  1 1 
        5  7673 1 1   8 LYS HE3  H  45.697 -22.722   0.138 1.00 . A A .   8 LYS HE3  1 1 
        5  7674 1 1   8 LYS HG2  H  45.920 -20.867  -1.366 1.00 . A A .   8 LYS HG2  1 1 
        5  7675 1 1   8 LYS HG3  H  46.712 -20.468   0.166 1.00 . A A .   8 LYS HG3  1 1 
        5  7676 1 1   8 LYS HZ1  H  46.003 -22.482   2.381 1.00 . A A .   8 LYS HZ1  1 1 
        5  7677 1 1   8 LYS HZ2  H  44.701 -23.563   2.368 1.00 . A A .   8 LYS HZ2  1 1 
        5  7678 1 1   8 LYS HZ3  H  44.433 -21.919   2.664 1.00 . A A .   8 LYS HZ3  1 1 
        5  7679 1 1   8 LYS N    N  46.937 -17.001   0.253 1.00 . A A .   8 LYS N    1 1 
        5  7680 1 1   8 LYS NZ   N  45.002 -22.598   2.121 1.00 . A A .   8 LYS NZ   1 1 
        5  7681 1 1   8 LYS O    O  47.242 -16.293  -2.329 1.00 . A A .   8 LYS O    1 1 
        5  7682 1 1   9 ASN C    C  46.427 -17.158  -5.018 1.00 . A A .   9 ASN C    1 1 
        5  7683 1 1   9 ASN CA   C  47.591 -17.992  -4.491 1.00 . A A .   9 ASN CA   1 1 
        5  7684 1 1   9 ASN CB   C  47.796 -19.221  -5.379 1.00 . A A .   9 ASN CB   1 1 
        5  7685 1 1   9 ASN CG   C  46.486 -19.869  -5.781 1.00 . A A .   9 ASN CG   1 1 
        5  7686 1 1   9 ASN H    H  47.312 -19.354  -2.895 1.00 . A A .   9 ASN H    1 1 
        5  7687 1 1   9 ASN HA   H  48.487 -17.389  -4.510 1.00 . A A .   9 ASN HA   1 1 
        5  7688 1 1   9 ASN HB2  H  48.331 -18.920  -6.280 1.00 . A A .   9 ASN HB2  1 1 
        5  7689 1 1   9 ASN HB3  H  48.389 -19.947  -4.846 1.00 . A A .   9 ASN HB3  1 1 
        5  7690 1 1   9 ASN HD21 H  46.932 -19.636  -7.704 1.00 . A A .   9 ASN HD21 1 1 
        5  7691 1 1   9 ASN HD22 H  45.415 -20.394  -7.371 1.00 . A A .   9 ASN HD22 1 1 
        5  7692 1 1   9 ASN N    N  47.355 -18.399  -3.111 1.00 . A A .   9 ASN N    1 1 
        5  7693 1 1   9 ASN ND2  N  46.255 -19.978  -7.083 1.00 . A A .   9 ASN ND2  1 1 
        5  7694 1 1   9 ASN O    O  45.262 -17.461  -4.755 1.00 . A A .   9 ASN O    1 1 
        5  7695 1 1   9 ASN OD1  O  45.693 -20.271  -4.927 1.00 . A A .   9 ASN OD1  1 1 
        5  7696 1 1  10 LYS C    C  46.148 -14.735  -7.713 1.00 . A A .  10 LYS C    1 1 
        5  7697 1 1  10 LYS CA   C  45.731 -15.231  -6.332 1.00 . A A .  10 LYS CA   1 1 
        5  7698 1 1  10 LYS CB   C  45.480 -14.040  -5.404 1.00 . A A .  10 LYS CB   1 1 
        5  7699 1 1  10 LYS CD   C  46.491 -11.834  -4.756 1.00 . A A .  10 LYS CD   1 1 
        5  7700 1 1  10 LYS CE   C  47.738 -11.125  -4.249 1.00 . A A .  10 LYS CE   1 1 
        5  7701 1 1  10 LYS CG   C  46.749 -13.312  -4.993 1.00 . A A .  10 LYS CG   1 1 
        5  7702 1 1  10 LYS H    H  47.695 -15.918  -5.940 1.00 . A A .  10 LYS H    1 1 
        5  7703 1 1  10 LYS HA   H  44.818 -15.800  -6.428 1.00 . A A .  10 LYS HA   1 1 
        5  7704 1 1  10 LYS HB2  H  44.822 -13.334  -5.911 1.00 . A A .  10 LYS HB2  1 1 
        5  7705 1 1  10 LYS HB3  H  44.987 -14.392  -4.510 1.00 . A A .  10 LYS HB3  1 1 
        5  7706 1 1  10 LYS HD2  H  46.174 -11.372  -5.691 1.00 . A A .  10 LYS HD2  1 1 
        5  7707 1 1  10 LYS HD3  H  45.703 -11.726  -4.023 1.00 . A A .  10 LYS HD3  1 1 
        5  7708 1 1  10 LYS HE2  H  47.894 -11.385  -3.202 1.00 . A A .  10 LYS HE2  1 1 
        5  7709 1 1  10 LYS HE3  H  48.586 -11.461  -4.826 1.00 . A A .  10 LYS HE3  1 1 
        5  7710 1 1  10 LYS HG2  H  47.135 -13.758  -4.076 1.00 . A A .  10 LYS HG2  1 1 
        5  7711 1 1  10 LYS HG3  H  47.485 -13.420  -5.776 1.00 . A A .  10 LYS HG3  1 1 
        5  7712 1 1  10 LYS HZ1  H  48.554  -9.229  -4.574 1.00 . A A .  10 LYS HZ1  1 1 
        5  7713 1 1  10 LYS HZ2  H  47.261  -9.240  -3.483 1.00 . A A .  10 LYS HZ2  1 1 
        5  7714 1 1  10 LYS HZ3  H  46.969  -9.400  -5.141 1.00 . A A .  10 LYS HZ3  1 1 
        5  7715 1 1  10 LYS N    N  46.749 -16.108  -5.765 1.00 . A A .  10 LYS N    1 1 
        5  7716 1 1  10 LYS NZ   N  47.623  -9.645  -4.371 1.00 . A A .  10 LYS NZ   1 1 
        5  7717 1 1  10 LYS O    O  47.337 -14.612  -8.005 1.00 . A A .  10 LYS O    1 1 
        5  7718 1 1  11 GLY C    C  45.395 -15.072 -10.933 1.00 . A A .  11 GLY C    1 1 
        5  7719 1 1  11 GLY CA   C  45.448 -13.968  -9.896 1.00 . A A .  11 GLY CA   1 1 
        5  7720 1 1  11 GLY H    H  44.233 -14.566  -8.269 1.00 . A A .  11 GLY H    1 1 
        5  7721 1 1  11 GLY HA2  H  44.725 -13.210 -10.156 1.00 . A A .  11 GLY HA2  1 1 
        5  7722 1 1  11 GLY HA3  H  46.435 -13.528  -9.906 1.00 . A A .  11 GLY HA3  1 1 
        5  7723 1 1  11 GLY N    N  45.163 -14.449  -8.558 1.00 . A A .  11 GLY N    1 1 
        5  7724 1 1  11 GLY O    O  45.875 -16.180 -10.694 1.00 . A A .  11 GLY O    1 1 
        5  7725 1 1  12 GLY C    C  43.548 -15.482 -14.084 1.00 . A A .  12 GLY C    1 1 
        5  7726 1 1  12 GLY CA   C  44.707 -15.758 -13.146 1.00 . A A .  12 GLY CA   1 1 
        5  7727 1 1  12 GLY H    H  44.446 -13.871 -12.223 1.00 . A A .  12 GLY H    1 1 
        5  7728 1 1  12 GLY HA2  H  45.625 -15.759 -13.715 1.00 . A A .  12 GLY HA2  1 1 
        5  7729 1 1  12 GLY HA3  H  44.569 -16.733 -12.702 1.00 . A A .  12 GLY HA3  1 1 
        5  7730 1 1  12 GLY N    N  44.811 -14.772 -12.088 1.00 . A A .  12 GLY N    1 1 
        5  7731 1 1  12 GLY O    O  42.757 -14.568 -13.854 1.00 . A A .  12 GLY O    1 1 
        5  7732 1 1  13 LYS C    C  42.123 -17.414 -16.874 1.00 . A A .  13 LYS C    1 1 
        5  7733 1 1  13 LYS CA   C  42.381 -16.110 -16.128 1.00 . A A .  13 LYS CA   1 1 
        5  7734 1 1  13 LYS CB   C  42.736 -15.002 -17.121 1.00 . A A .  13 LYS CB   1 1 
        5  7735 1 1  13 LYS CD   C  41.029 -13.462 -18.132 1.00 . A A .  13 LYS CD   1 1 
        5  7736 1 1  13 LYS CE   C  40.401 -13.063 -19.459 1.00 . A A .  13 LYS CE   1 1 
        5  7737 1 1  13 LYS CG   C  41.706 -14.819 -18.222 1.00 . A A .  13 LYS CG   1 1 
        5  7738 1 1  13 LYS H    H  44.112 -16.985 -15.279 1.00 . A A .  13 LYS H    1 1 
        5  7739 1 1  13 LYS HA   H  41.484 -15.830 -15.595 1.00 . A A .  13 LYS HA   1 1 
        5  7740 1 1  13 LYS HB2  H  42.837 -14.063 -16.576 1.00 . A A .  13 LYS HB2  1 1 
        5  7741 1 1  13 LYS HB3  H  43.685 -15.240 -17.582 1.00 . A A .  13 LYS HB3  1 1 
        5  7742 1 1  13 LYS HD2  H  40.254 -13.499 -17.367 1.00 . A A .  13 LYS HD2  1 1 
        5  7743 1 1  13 LYS HD3  H  41.766 -12.720 -17.855 1.00 . A A .  13 LYS HD3  1 1 
        5  7744 1 1  13 LYS HE2  H  40.819 -12.108 -19.778 1.00 . A A .  13 LYS HE2  1 1 
        5  7745 1 1  13 LYS HE3  H  40.640 -13.815 -20.195 1.00 . A A .  13 LYS HE3  1 1 
        5  7746 1 1  13 LYS HG2  H  42.198 -14.910 -19.190 1.00 . A A .  13 LYS HG2  1 1 
        5  7747 1 1  13 LYS HG3  H  40.955 -15.592 -18.133 1.00 . A A .  13 LYS HG3  1 1 
        5  7748 1 1  13 LYS HZ1  H  38.560 -13.555 -18.602 1.00 . A A .  13 LYS HZ1  1 1 
        5  7749 1 1  13 LYS HZ2  H  38.477 -13.207 -20.256 1.00 . A A .  13 LYS HZ2  1 1 
        5  7750 1 1  13 LYS HZ3  H  38.662 -11.953 -19.136 1.00 . A A .  13 LYS HZ3  1 1 
        5  7751 1 1  13 LYS N    N  43.449 -16.273 -15.149 1.00 . A A .  13 LYS N    1 1 
        5  7752 1 1  13 LYS NZ   N  38.922 -12.936 -19.356 1.00 . A A .  13 LYS NZ   1 1 
        5  7753 1 1  13 LYS O    O  42.913 -17.821 -17.725 1.00 . A A .  13 LYS O    1 1 
        5  7754 1 1  14 GLY C    C  39.210 -19.378 -17.613 1.00 . A A .  14 GLY C    1 1 
        5  7755 1 1  14 GLY CA   C  40.668 -19.318 -17.202 1.00 . A A .  14 GLY CA   1 1 
        5  7756 1 1  14 GLY H    H  40.416 -17.695 -15.864 1.00 . A A .  14 GLY H    1 1 
        5  7757 1 1  14 GLY HA2  H  41.284 -19.434 -18.080 1.00 . A A .  14 GLY HA2  1 1 
        5  7758 1 1  14 GLY HA3  H  40.871 -20.132 -16.520 1.00 . A A .  14 GLY HA3  1 1 
        5  7759 1 1  14 GLY N    N  41.010 -18.067 -16.551 1.00 . A A .  14 GLY N    1 1 
        5  7760 1 1  14 GLY O    O  38.331 -18.940 -16.872 1.00 . A A .  14 GLY O    1 1 
        5  7761 1 1  15 GLY C    C  37.394 -21.208 -20.213 1.00 . A A .  15 GLY C    1 1 
        5  7762 1 1  15 GLY CA   C  37.590 -20.023 -19.288 1.00 . A A .  15 GLY CA   1 1 
        5  7763 1 1  15 GLY H    H  39.694 -20.252 -19.347 1.00 . A A .  15 GLY H    1 1 
        5  7764 1 1  15 GLY HA2  H  36.923 -20.124 -18.446 1.00 . A A .  15 GLY HA2  1 1 
        5  7765 1 1  15 GLY HA3  H  37.343 -19.118 -19.824 1.00 . A A .  15 GLY HA3  1 1 
        5  7766 1 1  15 GLY N    N  38.953 -19.920 -18.800 1.00 . A A .  15 GLY N    1 1 
        5  7767 1 1  15 GLY O    O  37.705 -21.134 -21.401 1.00 . A A .  15 GLY O    1 1 
        5  7768 1 1  16 ALA C    C  35.330 -23.416 -21.220 1.00 . A A .  16 ALA C    1 1 
        5  7769 1 1  16 ALA CA   C  36.644 -23.511 -20.451 1.00 . A A .  16 ALA CA   1 1 
        5  7770 1 1  16 ALA CB   C  36.643 -24.735 -19.549 1.00 . A A .  16 ALA CB   1 1 
        5  7771 1 1  16 ALA H    H  36.654 -22.303 -18.713 1.00 . A A .  16 ALA H    1 1 
        5  7772 1 1  16 ALA HA   H  37.455 -23.614 -21.156 1.00 . A A .  16 ALA HA   1 1 
        5  7773 1 1  16 ALA HB1  H  35.704 -25.259 -19.655 1.00 . A A .  16 ALA HB1  1 1 
        5  7774 1 1  16 ALA HB2  H  37.454 -25.389 -19.829 1.00 . A A .  16 ALA HB2  1 1 
        5  7775 1 1  16 ALA HB3  H  36.767 -24.426 -18.522 1.00 . A A .  16 ALA HB3  1 1 
        5  7776 1 1  16 ALA N    N  36.881 -22.305 -19.667 1.00 . A A .  16 ALA N    1 1 
        5  7777 1 1  16 ALA O    O  34.513 -22.532 -20.965 1.00 . A A .  16 ALA O    1 1 
        5  7778 1 1  17 ASP C    C  32.863 -25.252 -22.337 1.00 . A A .  17 ASP C    1 1 
        5  7779 1 1  17 ASP CA   C  33.921 -24.351 -22.969 1.00 . A A .  17 ASP CA   1 1 
        5  7780 1 1  17 ASP CB   C  34.232 -24.829 -24.388 1.00 . A A .  17 ASP CB   1 1 
        5  7781 1 1  17 ASP CG   C  33.385 -24.130 -25.434 1.00 . A A .  17 ASP CG   1 1 
        5  7782 1 1  17 ASP H    H  35.824 -25.012 -22.319 1.00 . A A .  17 ASP H    1 1 
        5  7783 1 1  17 ASP HA   H  33.536 -23.345 -23.015 1.00 . A A .  17 ASP HA   1 1 
        5  7784 1 1  17 ASP HB2  H  35.284 -24.640 -24.602 1.00 . A A .  17 ASP HB2  1 1 
        5  7785 1 1  17 ASP HB3  H  34.048 -25.891 -24.453 1.00 . A A .  17 ASP HB3  1 1 
        5  7786 1 1  17 ASP N    N  35.135 -24.332 -22.163 1.00 . A A .  17 ASP N    1 1 
        5  7787 1 1  17 ASP O    O  33.188 -26.212 -21.639 1.00 . A A .  17 ASP O    1 1 
        5  7788 1 1  17 ASP OD1  O  32.146 -24.277 -25.388 1.00 . A A .  17 ASP OD1  1 1 
        5  7789 1 1  17 ASP OD2  O  33.962 -23.437 -26.297 1.00 . A A .  17 ASP OD2  1 1 
        5  7790 1 1  18 CYS C    C  30.097 -26.837 -22.990 1.00 . A A .  18 CYS C    1 1 
        5  7791 1 1  18 CYS CA   C  30.491 -25.711 -22.039 1.00 . A A .  18 CYS CA   1 1 
        5  7792 1 1  18 CYS CB   C  29.286 -24.806 -21.773 1.00 . A A .  18 CYS CB   1 1 
        5  7793 1 1  18 CYS H    H  31.402 -24.155 -23.148 1.00 . A A .  18 CYS H    1 1 
        5  7794 1 1  18 CYS HA   H  30.819 -26.144 -21.106 1.00 . A A .  18 CYS HA   1 1 
        5  7795 1 1  18 CYS HB2  H  29.550 -24.097 -20.989 1.00 . A A .  18 CYS HB2  1 1 
        5  7796 1 1  18 CYS HB3  H  29.054 -24.255 -22.673 1.00 . A A .  18 CYS HB3  1 1 
        5  7797 1 1  18 CYS HG   H  27.365 -26.476 -22.273 1.00 . A A .  18 CYS HG   1 1 
        5  7798 1 1  18 CYS N    N  31.597 -24.932 -22.585 1.00 . A A .  18 CYS N    1 1 
        5  7799 1 1  18 CYS O    O  29.661 -27.903 -22.559 1.00 . A A .  18 CYS O    1 1 
        5  7800 1 1  18 CYS SG   S  27.782 -25.702 -21.268 1.00 . A A .  18 CYS SG   1 1 
        5  7801 1 1  19 ALA C    C  28.419 -27.871 -25.308 1.00 . A A .  19 ALA C    1 1 
        5  7802 1 1  19 ALA CA   C  29.917 -27.582 -25.300 1.00 . A A .  19 ALA CA   1 1 
        5  7803 1 1  19 ALA CB   C  30.701 -28.864 -25.065 1.00 . A A .  19 ALA CB   1 1 
        5  7804 1 1  19 ALA H    H  30.605 -25.720 -24.569 1.00 . A A .  19 ALA H    1 1 
        5  7805 1 1  19 ALA HA   H  30.202 -27.186 -26.263 1.00 . A A .  19 ALA HA   1 1 
        5  7806 1 1  19 ALA HB1  H  31.323 -29.068 -25.924 1.00 . A A .  19 ALA HB1  1 1 
        5  7807 1 1  19 ALA HB2  H  31.322 -28.750 -24.188 1.00 . A A .  19 ALA HB2  1 1 
        5  7808 1 1  19 ALA HB3  H  30.014 -29.684 -24.915 1.00 . A A .  19 ALA HB3  1 1 
        5  7809 1 1  19 ALA N    N  30.254 -26.590 -24.287 1.00 . A A .  19 ALA N    1 1 
        5  7810 1 1  19 ALA O    O  27.970 -28.846 -25.909 1.00 . A A .  19 ALA O    1 1 
        5  7811 1 1  20 GLU C    C  25.561 -26.024 -23.810 1.00 . A A .  20 GLU C    1 1 
        5  7812 1 1  20 GLU CA   C  26.205 -27.181 -24.568 1.00 . A A .  20 GLU CA   1 1 
        5  7813 1 1  20 GLU CB   C  25.853 -28.508 -23.892 1.00 . A A .  20 GLU CB   1 1 
        5  7814 1 1  20 GLU CD   C  24.747 -30.486 -25.008 1.00 . A A .  20 GLU CD   1 1 
        5  7815 1 1  20 GLU CG   C  24.551 -29.116 -24.387 1.00 . A A .  20 GLU CG   1 1 
        5  7816 1 1  20 GLU H    H  28.069 -26.258 -24.179 1.00 . A A .  20 GLU H    1 1 
        5  7817 1 1  20 GLU HA   H  25.824 -27.190 -25.578 1.00 . A A .  20 GLU HA   1 1 
        5  7818 1 1  20 GLU HB2  H  26.661 -29.218 -24.072 1.00 . A A .  20 GLU HB2  1 1 
        5  7819 1 1  20 GLU HB3  H  25.767 -28.344 -22.828 1.00 . A A .  20 GLU HB3  1 1 
        5  7820 1 1  20 GLU HG2  H  23.861 -29.205 -23.548 1.00 . A A .  20 GLU HG2  1 1 
        5  7821 1 1  20 GLU HG3  H  24.120 -28.460 -25.127 1.00 . A A .  20 GLU HG3  1 1 
        5  7822 1 1  20 GLU N    N  27.653 -27.016 -24.639 1.00 . A A .  20 GLU N    1 1 
        5  7823 1 1  20 GLU O    O  24.921 -26.225 -22.779 1.00 . A A .  20 GLU O    1 1 
        5  7824 1 1  20 GLU OE1  O  24.930 -31.462 -24.251 1.00 . A A .  20 GLU OE1  1 1 
        5  7825 1 1  20 GLU OE2  O  24.717 -30.582 -26.254 1.00 . A A .  20 GLU OE2  1 1 
        5  7826 1 1  21 TRP C    C  23.652 -23.632 -23.784 1.00 . A A .  21 TRP C    1 1 
        5  7827 1 1  21 TRP CA   C  25.174 -23.625 -23.700 1.00 . A A .  21 TRP CA   1 1 
        5  7828 1 1  21 TRP CB   C  25.728 -22.363 -24.363 1.00 . A A .  21 TRP CB   1 1 
        5  7829 1 1  21 TRP CD1  C  28.167 -22.473 -25.138 1.00 . A A .  21 TRP CD1  1 1 
        5  7830 1 1  21 TRP CD2  C  27.902 -21.754 -23.035 1.00 . A A .  21 TRP CD2  1 1 
        5  7831 1 1  21 TRP CE2  C  29.278 -21.769 -23.334 1.00 . A A .  21 TRP CE2  1 1 
        5  7832 1 1  21 TRP CE3  C  27.494 -21.334 -21.765 1.00 . A A .  21 TRP CE3  1 1 
        5  7833 1 1  21 TRP CG   C  27.209 -22.207 -24.202 1.00 . A A .  21 TRP CG   1 1 
        5  7834 1 1  21 TRP CH2  C  29.817 -20.975 -21.176 1.00 . A A .  21 TRP CH2  1 1 
        5  7835 1 1  21 TRP CZ2  C  30.246 -21.381 -22.411 1.00 . A A .  21 TRP CZ2  1 1 
        5  7836 1 1  21 TRP CZ3  C  28.456 -20.950 -20.850 1.00 . A A .  21 TRP CZ3  1 1 
        5  7837 1 1  21 TRP H    H  26.258 -24.718 -25.153 1.00 . A A .  21 TRP H    1 1 
        5  7838 1 1  21 TRP HA   H  25.465 -23.631 -22.660 1.00 . A A .  21 TRP HA   1 1 
        5  7839 1 1  21 TRP HB2  H  25.492 -22.392 -25.426 1.00 . A A .  21 TRP HB2  1 1 
        5  7840 1 1  21 TRP HB3  H  25.252 -21.496 -23.925 1.00 . A A .  21 TRP HB3  1 1 
        5  7841 1 1  21 TRP HD1  H  27.960 -22.838 -26.134 1.00 . A A .  21 TRP HD1  1 1 
        5  7842 1 1  21 TRP HE1  H  30.262 -22.323 -25.102 1.00 . A A .  21 TRP HE1  1 1 
        5  7843 1 1  21 TRP HE3  H  26.449 -21.309 -21.496 1.00 . A A .  21 TRP HE3  1 1 
        5  7844 1 1  21 TRP HH2  H  30.533 -20.667 -20.429 1.00 . A A .  21 TRP HH2  1 1 
        5  7845 1 1  21 TRP HZ2  H  31.300 -21.394 -22.647 1.00 . A A .  21 TRP HZ2  1 1 
        5  7846 1 1  21 TRP HZ3  H  28.159 -20.624 -19.864 1.00 . A A .  21 TRP HZ3  1 1 
        5  7847 1 1  21 TRP N    N  25.737 -24.814 -24.328 1.00 . A A .  21 TRP N    1 1 
        5  7848 1 1  21 TRP NE1  N  29.414 -22.212 -24.624 1.00 . A A .  21 TRP NE1  1 1 
        5  7849 1 1  21 TRP O    O  23.081 -23.677 -24.875 1.00 . A A .  21 TRP O    1 1 
        5  7850 1 1  22 LEU C    C  21.009 -22.216 -22.191 1.00 . A A .  22 LEU C    1 1 
        5  7851 1 1  22 LEU CA   C  21.541 -23.593 -22.573 1.00 . A A .  22 LEU CA   1 1 
        5  7852 1 1  22 LEU CB   C  21.051 -24.638 -21.569 1.00 . A A .  22 LEU CB   1 1 
        5  7853 1 1  22 LEU CD1  C  20.885 -24.735 -19.069 1.00 . A A .  22 LEU CD1  1 1 
        5  7854 1 1  22 LEU CD2  C  22.715 -25.968 -20.247 1.00 . A A .  22 LEU CD2  1 1 
        5  7855 1 1  22 LEU CG   C  21.834 -24.728 -20.258 1.00 . A A .  22 LEU CG   1 1 
        5  7856 1 1  22 LEU H    H  23.507 -23.558 -21.792 1.00 . A A .  22 LEU H    1 1 
        5  7857 1 1  22 LEU HA   H  21.173 -23.849 -23.554 1.00 . A A .  22 LEU HA   1 1 
        5  7858 1 1  22 LEU HB2  H  20.009 -24.423 -21.332 1.00 . A A .  22 LEU HB2  1 1 
        5  7859 1 1  22 LEU HB3  H  21.098 -25.605 -22.050 1.00 . A A .  22 LEU HB3  1 1 
        5  7860 1 1  22 LEU HD11 H  20.216 -25.578 -19.148 1.00 . A A .  22 LEU HD11 1 1 
        5  7861 1 1  22 LEU HD12 H  20.313 -23.820 -19.060 1.00 . A A .  22 LEU HD12 1 1 
        5  7862 1 1  22 LEU HD13 H  21.455 -24.811 -18.154 1.00 . A A .  22 LEU HD13 1 1 
        5  7863 1 1  22 LEU HD21 H  23.397 -25.934 -21.084 1.00 . A A .  22 LEU HD21 1 1 
        5  7864 1 1  22 LEU HD22 H  22.096 -26.850 -20.323 1.00 . A A .  22 LEU HD22 1 1 
        5  7865 1 1  22 LEU HD23 H  23.277 -26.002 -19.325 1.00 . A A .  22 LEU HD23 1 1 
        5  7866 1 1  22 LEU HG   H  22.474 -23.861 -20.168 1.00 . A A .  22 LEU HG   1 1 
        5  7867 1 1  22 LEU N    N  22.999 -23.592 -22.629 1.00 . A A .  22 LEU N    1 1 
        5  7868 1 1  22 LEU O    O  21.133 -21.788 -21.044 1.00 . A A .  22 LEU O    1 1 
        5  7869 1 1  23 TYR C    C  18.430 -20.105 -23.442 1.00 . A A .  23 TYR C    1 1 
        5  7870 1 1  23 TYR CA   C  19.862 -20.199 -22.926 1.00 . A A .  23 TYR CA   1 1 
        5  7871 1 1  23 TYR CB   C  20.731 -19.138 -23.603 1.00 . A A .  23 TYR CB   1 1 
        5  7872 1 1  23 TYR CD1  C  21.070 -20.268 -25.834 1.00 . A A .  23 TYR CD1  1 1 
        5  7873 1 1  23 TYR CD2  C  23.001 -19.625 -24.594 1.00 . A A .  23 TYR CD2  1 1 
        5  7874 1 1  23 TYR CE1  C  21.876 -20.773 -26.836 1.00 . A A .  23 TYR CE1  1 1 
        5  7875 1 1  23 TYR CE2  C  23.815 -20.126 -25.594 1.00 . A A .  23 TYR CE2  1 1 
        5  7876 1 1  23 TYR CG   C  21.617 -19.687 -24.698 1.00 . A A .  23 TYR CG   1 1 
        5  7877 1 1  23 TYR CZ   C  23.247 -20.698 -26.711 1.00 . A A .  23 TYR CZ   1 1 
        5  7878 1 1  23 TYR H    H  20.346 -21.923 -24.054 1.00 . A A .  23 TYR H    1 1 
        5  7879 1 1  23 TYR HA   H  19.862 -20.023 -21.860 1.00 . A A .  23 TYR HA   1 1 
        5  7880 1 1  23 TYR HB2  H  20.080 -18.374 -24.030 1.00 . A A .  23 TYR HB2  1 1 
        5  7881 1 1  23 TYR HB3  H  21.367 -18.675 -22.861 1.00 . A A .  23 TYR HB3  1 1 
        5  7882 1 1  23 TYR HD1  H  19.994 -20.325 -25.929 1.00 . A A .  23 TYR HD1  1 1 
        5  7883 1 1  23 TYR HD2  H  23.443 -19.174 -23.718 1.00 . A A .  23 TYR HD2  1 1 
        5  7884 1 1  23 TYR HE1  H  21.431 -21.221 -27.713 1.00 . A A .  23 TYR HE1  1 1 
        5  7885 1 1  23 TYR HE2  H  24.888 -20.067 -25.496 1.00 . A A .  23 TYR HE2  1 1 
        5  7886 1 1  23 TYR HH   H  24.374 -20.475 -28.253 1.00 . A A .  23 TYR HH   1 1 
        5  7887 1 1  23 TYR N    N  20.415 -21.528 -23.159 1.00 . A A .  23 TYR N    1 1 
        5  7888 1 1  23 TYR O    O  17.985 -20.940 -24.227 1.00 . A A .  23 TYR O    1 1 
        5  7889 1 1  23 TYR OH   O  24.052 -21.198 -27.709 1.00 . A A .  23 TYR OH   1 1 
        5  7890 1 1  24 GLY C    C  15.852 -17.473 -23.206 1.00 . A A .  24 GLY C    1 1 
        5  7891 1 1  24 GLY CA   C  16.337 -18.893 -23.420 1.00 . A A .  24 GLY CA   1 1 
        5  7892 1 1  24 GLY H    H  18.119 -18.444 -22.368 1.00 . A A .  24 GLY H    1 1 
        5  7893 1 1  24 GLY HA2  H  16.263 -19.135 -24.470 1.00 . A A .  24 GLY HA2  1 1 
        5  7894 1 1  24 GLY HA3  H  15.705 -19.566 -22.859 1.00 . A A .  24 GLY HA3  1 1 
        5  7895 1 1  24 GLY N    N  17.712 -19.079 -22.993 1.00 . A A .  24 GLY N    1 1 
        5  7896 1 1  24 GLY O    O  15.182 -16.902 -24.067 1.00 . A A .  24 GLY O    1 1 
        5  7897 1 1  25 SER C    C  16.458 -14.531 -22.647 1.00 . A A .  25 SER C    1 1 
        5  7898 1 1  25 SER CA   C  15.776 -15.541 -21.727 1.00 . A A .  25 SER CA   1 1 
        5  7899 1 1  25 SER CB   C  16.106 -15.222 -20.269 1.00 . A A .  25 SER CB   1 1 
        5  7900 1 1  25 SER H    H  16.722 -17.407 -21.408 1.00 . A A .  25 SER H    1 1 
        5  7901 1 1  25 SER HA   H  14.708 -15.475 -21.869 1.00 . A A .  25 SER HA   1 1 
        5  7902 1 1  25 SER HB2  H  15.212 -14.844 -19.773 1.00 . A A .  25 SER HB2  1 1 
        5  7903 1 1  25 SER HB3  H  16.434 -16.124 -19.771 1.00 . A A .  25 SER HB3  1 1 
        5  7904 1 1  25 SER HG   H  16.756 -13.407 -19.918 1.00 . A A .  25 SER HG   1 1 
        5  7905 1 1  25 SER N    N  16.188 -16.901 -22.053 1.00 . A A .  25 SER N    1 1 
        5  7906 1 1  25 SER O    O  17.680 -14.531 -22.790 1.00 . A A .  25 SER O    1 1 
        5  7907 1 1  25 SER OG   O  17.135 -14.250 -20.178 1.00 . A A .  25 SER OG   1 1 
        5  7908 1 1  26 CYS C    C  15.904 -11.256 -23.639 1.00 . A A .  26 CYS C    1 1 
        5  7909 1 1  26 CYS CA   C  16.180 -12.658 -24.174 1.00 . A A .  26 CYS CA   1 1 
        5  7910 1 1  26 CYS CB   C  15.560 -12.817 -25.564 1.00 . A A .  26 CYS CB   1 1 
        5  7911 1 1  26 CYS H    H  14.689 -13.722 -23.113 1.00 . A A .  26 CYS H    1 1 
        5  7912 1 1  26 CYS HA   H  17.248 -12.797 -24.248 1.00 . A A .  26 CYS HA   1 1 
        5  7913 1 1  26 CYS HB2  H  14.567 -13.252 -25.454 1.00 . A A .  26 CYS HB2  1 1 
        5  7914 1 1  26 CYS HB3  H  15.462 -11.843 -26.020 1.00 . A A .  26 CYS HB3  1 1 
        5  7915 1 1  26 CYS HG   H  16.097 -15.123 -26.621 1.00 . A A .  26 CYS HG   1 1 
        5  7916 1 1  26 CYS N    N  15.657 -13.672 -23.269 1.00 . A A .  26 CYS N    1 1 
        5  7917 1 1  26 CYS O    O  14.783 -10.944 -23.231 1.00 . A A .  26 CYS O    1 1 
        5  7918 1 1  26 CYS SG   S  16.530 -13.862 -26.696 1.00 . A A .  26 CYS SG   1 1 
        5  7919 1 1  27 VAL C    C  16.589  -8.070 -24.317 1.00 . A A .  27 VAL C    1 1 
        5  7920 1 1  27 VAL CA   C  16.798  -9.042 -23.162 1.00 . A A .  27 VAL CA   1 1 
        5  7921 1 1  27 VAL CB   C  18.038  -8.609 -22.357 1.00 . A A .  27 VAL CB   1 1 
        5  7922 1 1  27 VAL CG1  C  17.806  -7.253 -21.709 1.00 . A A .  27 VAL CG1  1 1 
        5  7923 1 1  27 VAL CG2  C  18.386  -9.657 -21.311 1.00 . A A .  27 VAL CG2  1 1 
        5  7924 1 1  27 VAL H    H  17.798 -10.718 -23.983 1.00 . A A .  27 VAL H    1 1 
        5  7925 1 1  27 VAL HA   H  15.939  -9.001 -22.509 1.00 . A A .  27 VAL HA   1 1 
        5  7926 1 1  27 VAL HB   H  18.872  -8.520 -23.039 1.00 . A A .  27 VAL HB   1 1 
        5  7927 1 1  27 VAL HG11 H  16.886  -7.276 -21.146 1.00 . A A .  27 VAL HG11 1 1 
        5  7928 1 1  27 VAL HG12 H  18.630  -7.024 -21.049 1.00 . A A .  27 VAL HG12 1 1 
        5  7929 1 1  27 VAL HG13 H  17.740  -6.495 -22.475 1.00 . A A .  27 VAL HG13 1 1 
        5  7930 1 1  27 VAL HG21 H  17.587 -10.379 -21.243 1.00 . A A .  27 VAL HG21 1 1 
        5  7931 1 1  27 VAL HG22 H  19.302 -10.156 -21.594 1.00 . A A .  27 VAL HG22 1 1 
        5  7932 1 1  27 VAL HG23 H  18.521  -9.177 -20.352 1.00 . A A .  27 VAL HG23 1 1 
        5  7933 1 1  27 VAL N    N  16.931 -10.413 -23.644 1.00 . A A .  27 VAL N    1 1 
        5  7934 1 1  27 VAL O    O  17.449  -7.930 -25.187 1.00 . A A .  27 VAL O    1 1 
        5  7935 1 1  28 ALA C    C  15.657  -5.052 -25.022 1.00 . A A .  28 ALA C    1 1 
        5  7936 1 1  28 ALA CA   C  15.122  -6.438 -25.367 1.00 . A A .  28 ALA CA   1 1 
        5  7937 1 1  28 ALA CB   C  13.617  -6.384 -25.591 1.00 . A A .  28 ALA CB   1 1 
        5  7938 1 1  28 ALA H    H  14.796  -7.555 -23.600 1.00 . A A .  28 ALA H    1 1 
        5  7939 1 1  28 ALA HA   H  15.586  -6.775 -26.283 1.00 . A A .  28 ALA HA   1 1 
        5  7940 1 1  28 ALA HB1  H  13.238  -5.432 -25.250 1.00 . A A .  28 ALA HB1  1 1 
        5  7941 1 1  28 ALA HB2  H  13.407  -6.500 -26.644 1.00 . A A .  28 ALA HB2  1 1 
        5  7942 1 1  28 ALA HB3  H  13.143  -7.181 -25.039 1.00 . A A .  28 ALA HB3  1 1 
        5  7943 1 1  28 ALA N    N  15.443  -7.400 -24.320 1.00 . A A .  28 ALA N    1 1 
        5  7944 1 1  28 ALA O    O  15.665  -4.652 -23.859 1.00 . A A .  28 ALA O    1 1 
        5  7945 1 1  29 ASN C    C  16.029  -2.001 -26.837 1.00 . A A .  29 ASN C    1 1 
        5  7946 1 1  29 ASN CA   C  16.642  -2.984 -25.845 1.00 . A A .  29 ASN CA   1 1 
        5  7947 1 1  29 ASN CB   C  18.165  -2.996 -25.998 1.00 . A A .  29 ASN CB   1 1 
        5  7948 1 1  29 ASN CG   C  18.851  -3.768 -24.888 1.00 . A A .  29 ASN CG   1 1 
        5  7949 1 1  29 ASN H    H  16.072  -4.699 -26.947 1.00 . A A .  29 ASN H    1 1 
        5  7950 1 1  29 ASN HA   H  16.392  -2.670 -24.843 1.00 . A A .  29 ASN HA   1 1 
        5  7951 1 1  29 ASN HB2  H  18.421  -3.451 -26.955 1.00 . A A .  29 ASN HB2  1 1 
        5  7952 1 1  29 ASN HB3  H  18.530  -1.980 -25.985 1.00 . A A .  29 ASN HB3  1 1 
        5  7953 1 1  29 ASN HD21 H  19.100  -2.093 -23.844 1.00 . A A .  29 ASN HD21 1 1 
        5  7954 1 1  29 ASN HD22 H  19.709  -3.535 -23.109 1.00 . A A .  29 ASN HD22 1 1 
        5  7955 1 1  29 ASN N    N  16.104  -4.325 -26.041 1.00 . A A .  29 ASN N    1 1 
        5  7956 1 1  29 ASN ND2  N  19.260  -3.060 -23.840 1.00 . A A .  29 ASN ND2  1 1 
        5  7957 1 1  29 ASN O    O  16.683  -1.055 -27.275 1.00 . A A .  29 ASN O    1 1 
        5  7958 1 1  29 ASN OD1  O  19.012  -4.986 -24.970 1.00 . A A .  29 ASN OD1  1 1 
        5  7959 1 1  30 ASN C    C  12.630  -1.114 -27.665 1.00 . A A .  30 ASN C    1 1 
        5  7960 1 1  30 ASN CA   C  14.063  -1.366 -28.126 1.00 . A A .  30 ASN CA   1 1 
        5  7961 1 1  30 ASN CB   C  14.059  -1.992 -29.522 1.00 . A A .  30 ASN CB   1 1 
        5  7962 1 1  30 ASN CG   C  15.427  -1.956 -30.175 1.00 . A A .  30 ASN CG   1 1 
        5  7963 1 1  30 ASN H    H  14.297  -3.002 -26.802 1.00 . A A .  30 ASN H    1 1 
        5  7964 1 1  30 ASN HA   H  14.588  -0.423 -28.164 1.00 . A A .  30 ASN HA   1 1 
        5  7965 1 1  30 ASN HB2  H  13.731  -3.029 -29.443 1.00 . A A .  30 ASN HB2  1 1 
        5  7966 1 1  30 ASN HB3  H  13.366  -1.453 -30.149 1.00 . A A .  30 ASN HB3  1 1 
        5  7967 1 1  30 ASN HD21 H  15.480  -3.944 -30.226 1.00 . A A .  30 ASN HD21 1 1 
        5  7968 1 1  30 ASN HD22 H  16.864  -3.136 -30.877 1.00 . A A .  30 ASN HD22 1 1 
        5  7969 1 1  30 ASN N    N  14.767  -2.232 -27.185 1.00 . A A .  30 ASN N    1 1 
        5  7970 1 1  30 ASN ND2  N  15.980  -3.131 -30.455 1.00 . A A .  30 ASN ND2  1 1 
        5  7971 1 1  30 ASN O    O  11.676  -1.575 -28.288 1.00 . A A .  30 ASN O    1 1 
        5  7972 1 1  30 ASN OD1  O  15.979  -0.885 -30.426 1.00 . A A .  30 ASN OD1  1 1 
        5  7973 1 1  31 GLY C    C  10.563  -1.242 -25.294 1.00 . A A .  31 GLY C    1 1 
        5  7974 1 1  31 GLY CA   C  11.170  -0.072 -26.043 1.00 . A A .  31 GLY CA   1 1 
        5  7975 1 1  31 GLY H    H  13.287  -0.032 -26.114 1.00 . A A .  31 GLY H    1 1 
        5  7976 1 1  31 GLY HA2  H  11.247   0.771 -25.372 1.00 . A A .  31 GLY HA2  1 1 
        5  7977 1 1  31 GLY HA3  H  10.520   0.192 -26.864 1.00 . A A .  31 GLY HA3  1 1 
        5  7978 1 1  31 GLY N    N  12.489  -0.374 -26.569 1.00 . A A .  31 GLY N    1 1 
        5  7979 1 1  31 GLY O    O  10.412  -1.196 -24.073 1.00 . A A .  31 GLY O    1 1 
        5  7980 1 1  32 ASP C    C   9.999  -4.733 -26.204 1.00 . A A .  32 ASP C    1 1 
        5  7981 1 1  32 ASP CA   C   9.615  -3.479 -25.426 1.00 . A A .  32 ASP CA   1 1 
        5  7982 1 1  32 ASP CB   C   8.093  -3.342 -25.375 1.00 . A A .  32 ASP CB   1 1 
        5  7983 1 1  32 ASP CG   C   7.396  -4.674 -25.176 1.00 . A A .  32 ASP CG   1 1 
        5  7984 1 1  32 ASP H    H  10.356  -2.269 -26.997 1.00 . A A .  32 ASP H    1 1 
        5  7985 1 1  32 ASP HA   H   9.993  -3.566 -24.418 1.00 . A A .  32 ASP HA   1 1 
        5  7986 1 1  32 ASP HB2  H   7.826  -2.678 -24.553 1.00 . A A .  32 ASP HB2  1 1 
        5  7987 1 1  32 ASP HB3  H   7.745  -2.910 -26.301 1.00 . A A .  32 ASP HB3  1 1 
        5  7988 1 1  32 ASP N    N  10.210  -2.292 -26.028 1.00 . A A .  32 ASP N    1 1 
        5  7989 1 1  32 ASP O    O  10.317  -5.768 -25.617 1.00 . A A .  32 ASP O    1 1 
        5  7990 1 1  32 ASP OD1  O   7.898  -5.492 -24.376 1.00 . A A .  32 ASP OD1  1 1 
        5  7991 1 1  32 ASP OD2  O   6.350  -4.899 -25.818 1.00 . A A .  32 ASP OD2  1 1 
        5  7992 1 1  33 CYS C    C  11.260  -5.330 -29.498 1.00 . A A .  33 CYS C    1 1 
        5  7993 1 1  33 CYS CA   C  10.307  -5.763 -28.389 1.00 . A A .  33 CYS CA   1 1 
        5  7994 1 1  33 CYS CB   C   9.042  -6.371 -28.996 1.00 . A A .  33 CYS CB   1 1 
        5  7995 1 1  33 CYS H    H   9.703  -3.784 -27.939 1.00 . A A .  33 CYS H    1 1 
        5  7996 1 1  33 CYS HA   H  10.798  -6.507 -27.780 1.00 . A A .  33 CYS HA   1 1 
        5  7997 1 1  33 CYS HB2  H   9.327  -6.985 -29.849 1.00 . A A .  33 CYS HB2  1 1 
        5  7998 1 1  33 CYS HB3  H   8.566  -7.002 -28.261 1.00 . A A .  33 CYS HB3  1 1 
        5  7999 1 1  33 CYS HG   H   8.447  -4.104 -30.109 1.00 . A A .  33 CYS HG   1 1 
        5  8000 1 1  33 CYS N    N   9.964  -4.636 -27.529 1.00 . A A .  33 CYS N    1 1 
        5  8001 1 1  33 CYS O    O  11.228  -4.185 -29.947 1.00 . A A .  33 CYS O    1 1 
        5  8002 1 1  33 CYS SG   S   7.817  -5.141 -29.549 1.00 . A A .  33 CYS SG   1 1 
        5  8003 1 1  34 GLY C    C  14.388  -6.651 -30.795 1.00 . A A .  34 GLY C    1 1 
        5  8004 1 1  34 GLY CA   C  13.058  -5.949 -30.991 1.00 . A A .  34 GLY CA   1 1 
        5  8005 1 1  34 GLY H    H  12.089  -7.152 -29.543 1.00 . A A .  34 GLY H    1 1 
        5  8006 1 1  34 GLY HA2  H  12.639  -6.255 -31.939 1.00 . A A .  34 GLY HA2  1 1 
        5  8007 1 1  34 GLY HA3  H  13.226  -4.884 -31.011 1.00 . A A .  34 GLY HA3  1 1 
        5  8008 1 1  34 GLY N    N  12.108  -6.255 -29.937 1.00 . A A .  34 GLY N    1 1 
        5  8009 1 1  34 GLY O    O  14.678  -7.149 -29.706 1.00 . A A .  34 GLY O    1 1 
        5  8010 1 1  35 GLN C    C  17.295  -6.849 -30.581 1.00 . A A .  35 GLN C    1 1 
        5  8011 1 1  35 GLN CA   C  16.500  -7.340 -31.786 1.00 . A A .  35 GLN CA   1 1 
        5  8012 1 1  35 GLN CB   C  17.286  -7.076 -33.072 1.00 . A A .  35 GLN CB   1 1 
        5  8013 1 1  35 GLN CD   C  19.060  -5.283 -32.914 1.00 . A A .  35 GLN CD   1 1 
        5  8014 1 1  35 GLN CG   C  17.627  -5.610 -33.287 1.00 . A A .  35 GLN CG   1 1 
        5  8015 1 1  35 GLN H    H  14.908  -6.277 -32.688 1.00 . A A .  35 GLN H    1 1 
        5  8016 1 1  35 GLN HA   H  16.338  -8.402 -31.686 1.00 . A A .  35 GLN HA   1 1 
        5  8017 1 1  35 GLN HB2  H  18.213  -7.648 -33.038 1.00 . A A .  35 GLN HB2  1 1 
        5  8018 1 1  35 GLN HB3  H  16.701  -7.414 -33.914 1.00 . A A .  35 GLN HB3  1 1 
        5  8019 1 1  35 GLN HE21 H  19.725  -6.260 -34.514 1.00 . A A .  35 GLN HE21 1 1 
        5  8020 1 1  35 GLN HE22 H  20.938  -5.545 -33.512 1.00 . A A .  35 GLN HE22 1 1 
        5  8021 1 1  35 GLN HG2  H  17.468  -5.361 -34.336 1.00 . A A .  35 GLN HG2  1 1 
        5  8022 1 1  35 GLN HG3  H  16.966  -5.008 -32.680 1.00 . A A .  35 GLN HG3  1 1 
        5  8023 1 1  35 GLN N    N  15.196  -6.692 -31.849 1.00 . A A .  35 GLN N    1 1 
        5  8024 1 1  35 GLN NE2  N  20.003  -5.743 -33.728 1.00 . A A .  35 GLN NE2  1 1 
        5  8025 1 1  35 GLN O    O  17.385  -5.648 -30.331 1.00 . A A .  35 GLN O    1 1 
        5  8026 1 1  35 GLN OE1  O  19.316  -4.625 -31.906 1.00 . A A .  35 GLN OE1  1 1 
        5  8027 1 1  36 GLY C    C  19.736  -8.444 -28.360 1.00 . A A .  36 GLY C    1 1 
        5  8028 1 1  36 GLY CA   C  18.649  -7.432 -28.664 1.00 . A A .  36 GLY CA   1 1 
        5  8029 1 1  36 GLY H    H  17.765  -8.730 -30.083 1.00 . A A .  36 GLY H    1 1 
        5  8030 1 1  36 GLY HA2  H  19.106  -6.467 -28.829 1.00 . A A .  36 GLY HA2  1 1 
        5  8031 1 1  36 GLY HA3  H  17.988  -7.364 -27.812 1.00 . A A .  36 GLY HA3  1 1 
        5  8032 1 1  36 GLY N    N  17.870  -7.788 -29.835 1.00 . A A .  36 GLY N    1 1 
        5  8033 1 1  36 GLY O    O  20.417  -8.923 -29.265 1.00 . A A .  36 GLY O    1 1 
        5  8034 1 1  37 MET C    C  20.336 -10.713 -25.643 1.00 . A A .  37 MET C    1 1 
        5  8035 1 1  37 MET CA   C  20.910  -9.732 -26.661 1.00 . A A .  37 MET CA   1 1 
        5  8036 1 1  37 MET CB   C  22.117  -9.005 -26.064 1.00 . A A .  37 MET CB   1 1 
        5  8037 1 1  37 MET CE   C  23.935  -7.283 -28.353 1.00 . A A .  37 MET CE   1 1 
        5  8038 1 1  37 MET CG   C  23.443  -9.430 -26.671 1.00 . A A .  37 MET CG   1 1 
        5  8039 1 1  37 MET H    H  19.323  -8.354 -26.405 1.00 . A A .  37 MET H    1 1 
        5  8040 1 1  37 MET HA   H  21.227 -10.281 -27.534 1.00 . A A .  37 MET HA   1 1 
        5  8041 1 1  37 MET HB2  H  21.990  -7.933 -26.215 1.00 . A A .  37 MET HB2  1 1 
        5  8042 1 1  37 MET HB3  H  22.153  -9.204 -25.003 1.00 . A A .  37 MET HB3  1 1 
        5  8043 1 1  37 MET HE1  H  23.741  -6.833 -29.316 1.00 . A A .  37 MET HE1  1 1 
        5  8044 1 1  37 MET HE2  H  23.313  -6.813 -27.606 1.00 . A A .  37 MET HE2  1 1 
        5  8045 1 1  37 MET HE3  H  24.973  -7.146 -28.094 1.00 . A A .  37 MET HE3  1 1 
        5  8046 1 1  37 MET HG2  H  24.252  -8.928 -26.141 1.00 . A A .  37 MET HG2  1 1 
        5  8047 1 1  37 MET HG3  H  23.554 -10.497 -26.549 1.00 . A A .  37 MET HG3  1 1 
        5  8048 1 1  37 MET N    N  19.898  -8.769 -27.081 1.00 . A A .  37 MET N    1 1 
        5  8049 1 1  37 MET O    O  19.228 -10.524 -25.140 1.00 . A A .  37 MET O    1 1 
        5  8050 1 1  37 MET SD   S  23.561  -9.033 -28.426 1.00 . A A .  37 MET SD   1 1 
        5  8051 1 1  38 ARG C    C  21.848 -13.310 -23.591 1.00 . A A .  38 ARG C    1 1 
        5  8052 1 1  38 ARG CA   C  20.664 -12.773 -24.388 1.00 . A A .  38 ARG CA   1 1 
        5  8053 1 1  38 ARG CB   C  19.961 -13.922 -25.113 1.00 . A A .  38 ARG CB   1 1 
        5  8054 1 1  38 ARG CD   C  18.912 -16.187 -24.824 1.00 . A A .  38 ARG CD   1 1 
        5  8055 1 1  38 ARG CG   C  20.002 -15.237 -24.353 1.00 . A A .  38 ARG CG   1 1 
        5  8056 1 1  38 ARG CZ   C  18.526 -17.630 -26.776 1.00 . A A .  38 ARG CZ   1 1 
        5  8057 1 1  38 ARG H    H  21.970 -11.857 -25.780 1.00 . A A .  38 ARG H    1 1 
        5  8058 1 1  38 ARG HA   H  19.967 -12.309 -23.708 1.00 . A A .  38 ARG HA   1 1 
        5  8059 1 1  38 ARG HB2  H  18.919 -13.646 -25.277 1.00 . A A .  38 ARG HB2  1 1 
        5  8060 1 1  38 ARG HB3  H  20.434 -14.070 -26.072 1.00 . A A .  38 ARG HB3  1 1 
        5  8061 1 1  38 ARG HD2  H  18.618 -16.829 -23.994 1.00 . A A .  38 ARG HD2  1 1 
        5  8062 1 1  38 ARG HD3  H  18.058 -15.606 -25.140 1.00 . A A .  38 ARG HD3  1 1 
        5  8063 1 1  38 ARG HE   H  20.320 -17.134 -26.063 1.00 . A A .  38 ARG HE   1 1 
        5  8064 1 1  38 ARG HG2  H  20.974 -15.706 -24.505 1.00 . A A .  38 ARG HG2  1 1 
        5  8065 1 1  38 ARG HG3  H  19.866 -15.039 -23.301 1.00 . A A .  38 ARG HG3  1 1 
        5  8066 1 1  38 ARG HH11 H  16.850 -16.938 -25.886 1.00 . A A .  38 ARG HH11 1 1 
        5  8067 1 1  38 ARG HH12 H  16.590 -17.956 -27.263 1.00 . A A .  38 ARG HH12 1 1 
        5  8068 1 1  38 ARG HH21 H  19.993 -18.476 -27.879 1.00 . A A .  38 ARG HH21 1 1 
        5  8069 1 1  38 ARG HH22 H  18.379 -18.831 -28.396 1.00 . A A .  38 ARG HH22 1 1 
        5  8070 1 1  38 ARG N    N  21.097 -11.761 -25.345 1.00 . A A .  38 ARG N    1 1 
        5  8071 1 1  38 ARG NE   N  19.356 -17.022 -25.937 1.00 . A A .  38 ARG NE   1 1 
        5  8072 1 1  38 ARG NH1  N  17.214 -17.498 -26.629 1.00 . A A .  38 ARG NH1  1 1 
        5  8073 1 1  38 ARG NH2  N  19.005 -18.373 -27.765 1.00 . A A .  38 ARG NH2  1 1 
        5  8074 1 1  38 ARG O    O  22.955 -13.436 -24.114 1.00 . A A .  38 ARG O    1 1 
        5  8075 1 1  39 GLU C    C  22.321 -15.560 -20.986 1.00 . A A .  39 GLU C    1 1 
        5  8076 1 1  39 GLU CA   C  22.655 -14.146 -21.452 1.00 . A A .  39 GLU CA   1 1 
        5  8077 1 1  39 GLU CB   C  22.846 -13.231 -20.242 1.00 . A A .  39 GLU CB   1 1 
        5  8078 1 1  39 GLU CD   C  23.474 -10.784 -20.246 1.00 . A A .  39 GLU CD   1 1 
        5  8079 1 1  39 GLU CG   C  23.957 -12.209 -20.420 1.00 . A A .  39 GLU CG   1 1 
        5  8080 1 1  39 GLU H    H  20.704 -13.502 -21.963 1.00 . A A .  39 GLU H    1 1 
        5  8081 1 1  39 GLU HA   H  23.573 -14.174 -22.020 1.00 . A A .  39 GLU HA   1 1 
        5  8082 1 1  39 GLU HB2  H  21.912 -12.701 -20.053 1.00 . A A .  39 GLU HB2  1 1 
        5  8083 1 1  39 GLU HB3  H  23.080 -13.839 -19.380 1.00 . A A .  39 GLU HB3  1 1 
        5  8084 1 1  39 GLU HG2  H  24.740 -12.408 -19.688 1.00 . A A .  39 GLU HG2  1 1 
        5  8085 1 1  39 GLU HG3  H  24.370 -12.316 -21.412 1.00 . A A .  39 GLU HG3  1 1 
        5  8086 1 1  39 GLU N    N  21.607 -13.624 -22.323 1.00 . A A .  39 GLU N    1 1 
        5  8087 1 1  39 GLU O    O  21.332 -15.779 -20.289 1.00 . A A .  39 GLU O    1 1 
        5  8088 1 1  39 GLU OE1  O  22.719 -10.302 -21.117 1.00 . A A .  39 GLU OE1  1 1 
        5  8089 1 1  39 GLU OE2  O  23.848 -10.148 -19.238 1.00 . A A .  39 GLU OE2  1 1 
        5  8090 1 1  40 GLY C    C  23.882 -18.360 -19.908 1.00 . A A .  40 GLY C    1 1 
        5  8091 1 1  40 GLY CA   C  22.932 -17.900 -20.995 1.00 . A A .  40 GLY CA   1 1 
        5  8092 1 1  40 GLY H    H  23.927 -16.286 -21.936 1.00 . A A .  40 GLY H    1 1 
        5  8093 1 1  40 GLY HA2  H  21.917 -18.004 -20.640 1.00 . A A .  40 GLY HA2  1 1 
        5  8094 1 1  40 GLY HA3  H  23.065 -18.530 -21.864 1.00 . A A .  40 GLY HA3  1 1 
        5  8095 1 1  40 GLY N    N  23.154 -16.519 -21.380 1.00 . A A .  40 GLY N    1 1 
        5  8096 1 1  40 GLY O    O  25.012 -17.879 -19.817 1.00 . A A .  40 GLY O    1 1 
        5  8097 1 1  41 THR C    C  24.390 -21.327 -18.092 1.00 . A A .  41 THR C    1 1 
        5  8098 1 1  41 THR CA   C  24.238 -19.814 -17.988 1.00 . A A .  41 THR CA   1 1 
        5  8099 1 1  41 THR CB   C  23.635 -19.461 -16.615 1.00 . A A .  41 THR CB   1 1 
        5  8100 1 1  41 THR CG2  C  22.168 -19.864 -16.550 1.00 . A A .  41 THR CG2  1 1 
        5  8101 1 1  41 THR H    H  22.513 -19.633 -19.201 1.00 . A A .  41 THR H    1 1 
        5  8102 1 1  41 THR HA   H  25.216 -19.358 -18.055 1.00 . A A .  41 THR HA   1 1 
        5  8103 1 1  41 THR HB   H  23.706 -18.393 -16.471 1.00 . A A .  41 THR HB   1 1 
        5  8104 1 1  41 THR HG1  H  24.154 -19.719 -14.731 1.00 . A A .  41 THR HG1  1 1 
        5  8105 1 1  41 THR HG21 H  21.599 -19.254 -17.234 1.00 . A A .  41 THR HG21 1 1 
        5  8106 1 1  41 THR HG22 H  21.800 -19.719 -15.545 1.00 . A A .  41 THR HG22 1 1 
        5  8107 1 1  41 THR HG23 H  22.068 -20.904 -16.824 1.00 . A A .  41 THR HG23 1 1 
        5  8108 1 1  41 THR N    N  23.424 -19.291 -19.077 1.00 . A A .  41 THR N    1 1 
        5  8109 1 1  41 THR O    O  23.413 -22.046 -18.300 1.00 . A A .  41 THR O    1 1 
        5  8110 1 1  41 THR OG1  O  24.363 -20.123 -15.576 1.00 . A A .  41 THR OG1  1 1 
        5  8111 1 1  42 CYS C    C  26.767 -23.681 -16.847 1.00 . A A .  42 CYS C    1 1 
        5  8112 1 1  42 CYS CA   C  25.901 -23.233 -18.020 1.00 . A A .  42 CYS CA   1 1 
        5  8113 1 1  42 CYS CB   C  26.598 -23.568 -19.341 1.00 . A A .  42 CYS CB   1 1 
        5  8114 1 1  42 CYS H    H  26.360 -21.182 -17.780 1.00 . A A .  42 CYS H    1 1 
        5  8115 1 1  42 CYS HA   H  24.960 -23.759 -17.978 1.00 . A A .  42 CYS HA   1 1 
        5  8116 1 1  42 CYS HB2  H  25.893 -23.412 -20.157 1.00 . A A .  42 CYS HB2  1 1 
        5  8117 1 1  42 CYS HB3  H  27.436 -22.899 -19.476 1.00 . A A .  42 CYS HB3  1 1 
        5  8118 1 1  42 CYS HG   H  27.169 -25.841 -18.227 1.00 . A A .  42 CYS HG   1 1 
        5  8119 1 1  42 CYS N    N  25.621 -21.805 -17.945 1.00 . A A .  42 CYS N    1 1 
        5  8120 1 1  42 CYS O    O  27.938 -23.315 -16.751 1.00 . A A .  42 CYS O    1 1 
        5  8121 1 1  42 CYS SG   S  27.230 -25.275 -19.436 1.00 . A A .  42 CYS SG   1 1 
        5  8122 1 1  43 ASN C    C  27.289 -23.829 -13.859 1.00 . A A .  43 ASN C    1 1 
        5  8123 1 1  43 ASN CA   C  26.900 -24.973 -14.788 1.00 . A A .  43 ASN CA   1 1 
        5  8124 1 1  43 ASN CB   C  28.152 -25.741 -15.221 1.00 . A A .  43 ASN CB   1 1 
        5  8125 1 1  43 ASN CG   C  27.821 -26.958 -16.064 1.00 . A A .  43 ASN CG   1 1 
        5  8126 1 1  43 ASN H    H  25.246 -24.733 -16.086 1.00 . A A .  43 ASN H    1 1 
        5  8127 1 1  43 ASN HA   H  26.243 -25.646 -14.258 1.00 . A A .  43 ASN HA   1 1 
        5  8128 1 1  43 ASN HB2  H  28.792 -25.075 -15.799 1.00 . A A .  43 ASN HB2  1 1 
        5  8129 1 1  43 ASN HB3  H  28.688 -26.068 -14.345 1.00 . A A .  43 ASN HB3  1 1 
        5  8130 1 1  43 ASN HD21 H  29.625 -26.900 -16.900 1.00 . A A .  43 ASN HD21 1 1 
        5  8131 1 1  43 ASN HD22 H  28.586 -28.170 -17.442 1.00 . A A .  43 ASN HD22 1 1 
        5  8132 1 1  43 ASN N    N  26.182 -24.477 -15.956 1.00 . A A .  43 ASN N    1 1 
        5  8133 1 1  43 ASN ND2  N  28.773 -27.386 -16.885 1.00 . A A .  43 ASN ND2  1 1 
        5  8134 1 1  43 ASN O    O  26.636 -23.591 -12.844 1.00 . A A .  43 ASN O    1 1 
        5  8135 1 1  43 ASN OD1  O  26.722 -27.506 -15.978 1.00 . A A .  43 ASN OD1  1 1 
        5  8136 1 1  44 GLU C    C  29.499 -20.945 -14.292 1.00 . A A .  44 GLU C    1 1 
        5  8137 1 1  44 GLU CA   C  28.832 -22.001 -13.413 1.00 . A A .  44 GLU CA   1 1 
        5  8138 1 1  44 GLU CB   C  29.817 -22.487 -12.349 1.00 . A A .  44 GLU CB   1 1 
        5  8139 1 1  44 GLU CD   C  32.287 -23.010 -12.435 1.00 . A A .  44 GLU CD   1 1 
        5  8140 1 1  44 GLU CG   C  30.898 -23.407 -12.894 1.00 . A A .  44 GLU CG   1 1 
        5  8141 1 1  44 GLU H    H  28.836 -23.359 -15.036 1.00 . A A .  44 GLU H    1 1 
        5  8142 1 1  44 GLU HA   H  27.979 -21.557 -12.924 1.00 . A A .  44 GLU HA   1 1 
        5  8143 1 1  44 GLU HB2  H  30.294 -21.621 -11.891 1.00 . A A .  44 GLU HB2  1 1 
        5  8144 1 1  44 GLU HB3  H  29.269 -23.024 -11.587 1.00 . A A .  44 GLU HB3  1 1 
        5  8145 1 1  44 GLU HG2  H  30.694 -24.425 -12.564 1.00 . A A .  44 GLU HG2  1 1 
        5  8146 1 1  44 GLU HG3  H  30.868 -23.375 -13.974 1.00 . A A .  44 GLU HG3  1 1 
        5  8147 1 1  44 GLU N    N  28.357 -23.121 -14.216 1.00 . A A .  44 GLU N    1 1 
        5  8148 1 1  44 GLU O    O  30.414 -20.249 -13.857 1.00 . A A .  44 GLU O    1 1 
        5  8149 1 1  44 GLU OE1  O  32.855 -22.061 -13.013 1.00 . A A .  44 GLU OE1  1 1 
        5  8150 1 1  44 GLU OE2  O  32.806 -23.650 -11.497 1.00 . A A .  44 GLU OE2  1 1 
        5  8151 1 1  45 GLN C    C  28.468 -19.125 -17.203 1.00 . A A .  45 GLN C    1 1 
        5  8152 1 1  45 GLN CA   C  29.582 -19.867 -16.473 1.00 . A A .  45 GLN CA   1 1 
        5  8153 1 1  45 GLN CB   C  30.491 -20.567 -17.483 1.00 . A A .  45 GLN CB   1 1 
        5  8154 1 1  45 GLN CD   C  32.358 -22.226 -17.868 1.00 . A A .  45 GLN CD   1 1 
        5  8155 1 1  45 GLN CG   C  31.454 -21.559 -16.850 1.00 . A A .  45 GLN CG   1 1 
        5  8156 1 1  45 GLN H    H  28.299 -21.419 -15.820 1.00 . A A .  45 GLN H    1 1 
        5  8157 1 1  45 GLN HA   H  30.165 -19.153 -15.911 1.00 . A A .  45 GLN HA   1 1 
        5  8158 1 1  45 GLN HB2  H  29.870 -21.095 -18.206 1.00 . A A .  45 GLN HB2  1 1 
        5  8159 1 1  45 GLN HB3  H  31.071 -19.821 -18.005 1.00 . A A .  45 GLN HB3  1 1 
        5  8160 1 1  45 GLN HE21 H  33.920 -22.006 -16.659 1.00 . A A .  45 GLN HE21 1 1 
        5  8161 1 1  45 GLN HE22 H  34.244 -22.776 -18.172 1.00 . A A .  45 GLN HE22 1 1 
        5  8162 1 1  45 GLN HG2  H  32.070 -21.036 -16.118 1.00 . A A .  45 GLN HG2  1 1 
        5  8163 1 1  45 GLN HG3  H  30.881 -22.323 -16.344 1.00 . A A .  45 GLN HG3  1 1 
        5  8164 1 1  45 GLN N    N  29.030 -20.836 -15.532 1.00 . A A .  45 GLN N    1 1 
        5  8165 1 1  45 GLN NE2  N  33.637 -22.348 -17.533 1.00 . A A .  45 GLN NE2  1 1 
        5  8166 1 1  45 GLN O    O  27.307 -19.537 -17.173 1.00 . A A .  45 GLN O    1 1 
        5  8167 1 1  45 GLN OE1  O  31.912 -22.626 -18.942 1.00 . A A .  45 GLN OE1  1 1 
        5  8168 1 1  46 THR C    C  28.226 -17.138 -20.072 1.00 . A A .  46 THR C    1 1 
        5  8169 1 1  46 THR CA   C  27.859 -17.224 -18.597 1.00 . A A .  46 THR CA   1 1 
        5  8170 1 1  46 THR CB   C  27.756 -15.798 -18.022 1.00 . A A .  46 THR CB   1 1 
        5  8171 1 1  46 THR CG2  C  26.642 -15.711 -16.987 1.00 . A A .  46 THR CG2  1 1 
        5  8172 1 1  46 THR H    H  29.767 -17.748 -17.845 1.00 . A A .  46 THR H    1 1 
        5  8173 1 1  46 THR HA   H  26.893 -17.698 -18.502 1.00 . A A .  46 THR HA   1 1 
        5  8174 1 1  46 THR HB   H  27.532 -15.116 -18.829 1.00 . A A .  46 THR HB   1 1 
        5  8175 1 1  46 THR HG1  H  28.996 -14.477 -17.243 1.00 . A A .  46 THR HG1  1 1 
        5  8176 1 1  46 THR HG21 H  25.747 -16.163 -17.385 1.00 . A A .  46 THR HG21 1 1 
        5  8177 1 1  46 THR HG22 H  26.449 -14.674 -16.755 1.00 . A A .  46 THR HG22 1 1 
        5  8178 1 1  46 THR HG23 H  26.943 -16.231 -16.091 1.00 . A A .  46 THR HG23 1 1 
        5  8179 1 1  46 THR N    N  28.827 -18.025 -17.860 1.00 . A A .  46 THR N    1 1 
        5  8180 1 1  46 THR O    O  29.388 -17.305 -20.444 1.00 . A A .  46 THR O    1 1 
        5  8181 1 1  46 THR OG1  O  29.000 -15.420 -17.422 1.00 . A A .  46 THR OG1  1 1 
        5  8182 1 1  47 ARG C    C  26.498 -15.750 -22.969 1.00 . A A .  47 ARG C    1 1 
        5  8183 1 1  47 ARG CA   C  27.448 -16.770 -22.349 1.00 . A A .  47 ARG CA   1 1 
        5  8184 1 1  47 ARG CB   C  27.258 -18.133 -23.019 1.00 . A A .  47 ARG CB   1 1 
        5  8185 1 1  47 ARG CD   C  29.170 -17.769 -24.608 1.00 . A A .  47 ARG CD   1 1 
        5  8186 1 1  47 ARG CG   C  27.709 -18.167 -24.470 1.00 . A A .  47 ARG CG   1 1 
        5  8187 1 1  47 ARG CZ   C  31.036 -18.204 -26.149 1.00 . A A .  47 ARG CZ   1 1 
        5  8188 1 1  47 ARG H    H  26.324 -16.754 -20.557 1.00 . A A .  47 ARG H    1 1 
        5  8189 1 1  47 ARG HA   H  28.464 -16.441 -22.507 1.00 . A A .  47 ARG HA   1 1 
        5  8190 1 1  47 ARG HB2  H  27.823 -18.878 -22.460 1.00 . A A .  47 ARG HB2  1 1 
        5  8191 1 1  47 ARG HB3  H  26.211 -18.394 -22.983 1.00 . A A .  47 ARG HB3  1 1 
        5  8192 1 1  47 ARG HD2  H  29.229 -16.707 -24.848 1.00 . A A .  47 ARG HD2  1 1 
        5  8193 1 1  47 ARG HD3  H  29.668 -17.946 -23.666 1.00 . A A .  47 ARG HD3  1 1 
        5  8194 1 1  47 ARG HE   H  29.394 -19.326 -26.001 1.00 . A A .  47 ARG HE   1 1 
        5  8195 1 1  47 ARG HG2  H  27.574 -19.175 -24.863 1.00 . A A .  47 ARG HG2  1 1 
        5  8196 1 1  47 ARG HG3  H  27.102 -17.481 -25.042 1.00 . A A .  47 ARG HG3  1 1 
        5  8197 1 1  47 ARG HH11 H  31.261 -16.570 -24.980 1.00 . A A .  47 ARG HH11 1 1 
        5  8198 1 1  47 ARG HH12 H  32.568 -16.887 -26.072 1.00 . A A .  47 ARG HH12 1 1 
        5  8199 1 1  47 ARG HH21 H  31.110 -19.756 -27.442 1.00 . A A .  47 ARG HH21 1 1 
        5  8200 1 1  47 ARG HH22 H  32.482 -18.699 -27.472 1.00 . A A .  47 ARG HH22 1 1 
        5  8201 1 1  47 ARG N    N  27.229 -16.877 -20.912 1.00 . A A .  47 ARG N    1 1 
        5  8202 1 1  47 ARG NE   N  29.848 -18.532 -25.653 1.00 . A A .  47 ARG NE   1 1 
        5  8203 1 1  47 ARG NH1  N  31.674 -17.132 -25.697 1.00 . A A .  47 ARG NH1  1 1 
        5  8204 1 1  47 ARG NH2  N  31.588 -18.947 -27.099 1.00 . A A .  47 ARG NH2  1 1 
        5  8205 1 1  47 ARG O    O  25.454 -15.431 -22.400 1.00 . A A .  47 ARG O    1 1 
        5  8206 1 1  48 LYS C    C  25.776 -14.697 -26.275 1.00 . A A .  48 LYS C    1 1 
        5  8207 1 1  48 LYS CA   C  26.047 -14.258 -24.840 1.00 . A A .  48 LYS CA   1 1 
        5  8208 1 1  48 LYS CB   C  26.738 -12.892 -24.835 1.00 . A A .  48 LYS CB   1 1 
        5  8209 1 1  48 LYS CD   C  28.876 -11.592 -24.608 1.00 . A A .  48 LYS CD   1 1 
        5  8210 1 1  48 LYS CE   C  29.201 -11.120 -23.200 1.00 . A A .  48 LYS CE   1 1 
        5  8211 1 1  48 LYS CG   C  28.237 -12.970 -24.601 1.00 . A A .  48 LYS CG   1 1 
        5  8212 1 1  48 LYS H    H  27.709 -15.536 -24.544 1.00 . A A .  48 LYS H    1 1 
        5  8213 1 1  48 LYS HA   H  25.106 -14.177 -24.317 1.00 . A A .  48 LYS HA   1 1 
        5  8214 1 1  48 LYS HB2  H  26.559 -12.407 -25.795 1.00 . A A .  48 LYS HB2  1 1 
        5  8215 1 1  48 LYS HB3  H  26.304 -12.285 -24.054 1.00 . A A .  48 LYS HB3  1 1 
        5  8216 1 1  48 LYS HD2  H  29.794 -11.627 -25.194 1.00 . A A .  48 LYS HD2  1 1 
        5  8217 1 1  48 LYS HD3  H  28.191 -10.889 -25.065 1.00 . A A .  48 LYS HD3  1 1 
        5  8218 1 1  48 LYS HE2  H  28.731 -10.150 -23.032 1.00 . A A .  48 LYS HE2  1 1 
        5  8219 1 1  48 LYS HE3  H  28.801 -11.833 -22.494 1.00 . A A .  48 LYS HE3  1 1 
        5  8220 1 1  48 LYS HG2  H  28.424 -13.444 -23.637 1.00 . A A .  48 LYS HG2  1 1 
        5  8221 1 1  48 LYS HG3  H  28.684 -13.568 -25.382 1.00 . A A .  48 LYS HG3  1 1 
        5  8222 1 1  48 LYS HZ1  H  31.018 -11.797 -22.423 1.00 . A A .  48 LYS HZ1  1 1 
        5  8223 1 1  48 LYS HZ2  H  30.878 -10.111 -22.471 1.00 . A A .  48 LYS HZ2  1 1 
        5  8224 1 1  48 LYS HZ3  H  31.165 -10.977 -23.895 1.00 . A A .  48 LYS HZ3  1 1 
        5  8225 1 1  48 LYS N    N  26.866 -15.241 -24.140 1.00 . A A .  48 LYS N    1 1 
        5  8226 1 1  48 LYS NZ   N  30.668 -10.993 -22.981 1.00 . A A .  48 LYS NZ   1 1 
        5  8227 1 1  48 LYS O    O  26.635 -15.297 -26.924 1.00 . A A .  48 LYS O    1 1 
        5  8228 1 1  49 VAL C    C  23.227 -13.736 -28.714 1.00 . A A .  49 VAL C    1 1 
        5  8229 1 1  49 VAL CA   C  24.197 -14.756 -28.125 1.00 . A A .  49 VAL CA   1 1 
        5  8230 1 1  49 VAL CB   C  23.547 -16.152 -28.174 1.00 . A A .  49 VAL CB   1 1 
        5  8231 1 1  49 VAL CG1  C  24.473 -17.193 -27.564 1.00 . A A .  49 VAL CG1  1 1 
        5  8232 1 1  49 VAL CG2  C  22.204 -16.139 -27.461 1.00 . A A .  49 VAL CG2  1 1 
        5  8233 1 1  49 VAL H    H  23.938 -13.916 -26.201 1.00 . A A .  49 VAL H    1 1 
        5  8234 1 1  49 VAL HA   H  25.092 -14.777 -28.731 1.00 . A A .  49 VAL HA   1 1 
        5  8235 1 1  49 VAL HB   H  23.380 -16.414 -29.209 1.00 . A A .  49 VAL HB   1 1 
        5  8236 1 1  49 VAL HG11 H  25.467 -17.073 -27.972 1.00 . A A .  49 VAL HG11 1 1 
        5  8237 1 1  49 VAL HG12 H  24.505 -17.064 -26.493 1.00 . A A .  49 VAL HG12 1 1 
        5  8238 1 1  49 VAL HG13 H  24.106 -18.182 -27.798 1.00 . A A .  49 VAL HG13 1 1 
        5  8239 1 1  49 VAL HG21 H  22.096 -15.215 -26.912 1.00 . A A .  49 VAL HG21 1 1 
        5  8240 1 1  49 VAL HG22 H  21.410 -16.220 -28.188 1.00 . A A .  49 VAL HG22 1 1 
        5  8241 1 1  49 VAL HG23 H  22.152 -16.973 -26.775 1.00 . A A .  49 VAL HG23 1 1 
        5  8242 1 1  49 VAL N    N  24.579 -14.394 -26.765 1.00 . A A .  49 VAL N    1 1 
        5  8243 1 1  49 VAL O    O  22.380 -13.188 -28.007 1.00 . A A .  49 VAL O    1 1 
        5  8244 1 1  50 LYS C    C  21.079 -13.090 -30.849 1.00 . A A .  50 LYS C    1 1 
        5  8245 1 1  50 LYS CA   C  22.492 -12.532 -30.697 1.00 . A A .  50 LYS CA   1 1 
        5  8246 1 1  50 LYS CB   C  23.067 -12.188 -32.073 1.00 . A A .  50 LYS CB   1 1 
        5  8247 1 1  50 LYS CD   C  23.834  -9.797 -32.062 1.00 . A A .  50 LYS CD   1 1 
        5  8248 1 1  50 LYS CE   C  24.925  -8.878 -31.536 1.00 . A A .  50 LYS CE   1 1 
        5  8249 1 1  50 LYS CG   C  24.263 -11.254 -32.016 1.00 . A A .  50 LYS CG   1 1 
        5  8250 1 1  50 LYS H    H  24.051 -13.953 -30.522 1.00 . A A .  50 LYS H    1 1 
        5  8251 1 1  50 LYS HA   H  22.448 -11.634 -30.099 1.00 . A A .  50 LYS HA   1 1 
        5  8252 1 1  50 LYS HB2  H  23.369 -13.112 -32.566 1.00 . A A .  50 LYS HB2  1 1 
        5  8253 1 1  50 LYS HB3  H  22.295 -11.717 -32.665 1.00 . A A .  50 LYS HB3  1 1 
        5  8254 1 1  50 LYS HD2  H  23.603  -9.524 -33.092 1.00 . A A .  50 LYS HD2  1 1 
        5  8255 1 1  50 LYS HD3  H  22.947  -9.672 -31.456 1.00 . A A .  50 LYS HD3  1 1 
        5  8256 1 1  50 LYS HE2  H  24.503  -7.888 -31.361 1.00 . A A .  50 LYS HE2  1 1 
        5  8257 1 1  50 LYS HE3  H  25.292  -9.275 -30.601 1.00 . A A .  50 LYS HE3  1 1 
        5  8258 1 1  50 LYS HG2  H  24.814 -11.436 -31.094 1.00 . A A .  50 LYS HG2  1 1 
        5  8259 1 1  50 LYS HG3  H  24.907 -11.456 -32.860 1.00 . A A .  50 LYS HG3  1 1 
        5  8260 1 1  50 LYS HZ1  H  25.809  -8.113 -33.267 1.00 . A A .  50 LYS HZ1  1 1 
        5  8261 1 1  50 LYS HZ2  H  26.287  -9.693 -32.894 1.00 . A A .  50 LYS HZ2  1 1 
        5  8262 1 1  50 LYS HZ3  H  26.901  -8.391 -32.006 1.00 . A A .  50 LYS HZ3  1 1 
        5  8263 1 1  50 LYS N    N  23.357 -13.485 -30.011 1.00 . A A .  50 LYS N    1 1 
        5  8264 1 1  50 LYS NZ   N  26.059  -8.760 -32.493 1.00 . A A .  50 LYS NZ   1 1 
        5  8265 1 1  50 LYS O    O  20.875 -14.121 -31.492 1.00 . A A .  50 LYS O    1 1 
        5  8266 1 1  51 CYS C    C  17.788 -11.628 -30.475 1.00 . A A .  51 CYS C    1 1 
        5  8267 1 1  51 CYS CA   C  18.717 -12.828 -30.327 1.00 . A A .  51 CYS CA   1 1 
        5  8268 1 1  51 CYS CB   C  18.342 -13.627 -29.077 1.00 . A A .  51 CYS CB   1 1 
        5  8269 1 1  51 CYS H    H  20.335 -11.588 -29.760 1.00 . A A .  51 CYS H    1 1 
        5  8270 1 1  51 CYS HA   H  18.607 -13.463 -31.195 1.00 . A A .  51 CYS HA   1 1 
        5  8271 1 1  51 CYS HB2  H  17.486 -14.259 -29.311 1.00 . A A .  51 CYS HB2  1 1 
        5  8272 1 1  51 CYS HB3  H  19.173 -14.260 -28.801 1.00 . A A .  51 CYS HB3  1 1 
        5  8273 1 1  51 CYS HG   H  18.623 -11.456 -27.684 1.00 . A A .  51 CYS HG   1 1 
        5  8274 1 1  51 CYS N    N  20.110 -12.402 -30.257 1.00 . A A .  51 CYS N    1 1 
        5  8275 1 1  51 CYS O    O  18.220 -10.479 -30.373 1.00 . A A .  51 CYS O    1 1 
        5  8276 1 1  51 CYS SG   S  17.926 -12.595 -27.634 1.00 . A A .  51 CYS SG   1 1 
        5  8277 1 1  52 ARG C    C  14.241 -11.173 -30.113 1.00 . A A .  52 ARG C    1 1 
        5  8278 1 1  52 ARG CA   C  15.520 -10.844 -30.878 1.00 . A A .  52 ARG CA   1 1 
        5  8279 1 1  52 ARG CB   C  15.201 -10.638 -32.361 1.00 . A A .  52 ARG CB   1 1 
        5  8280 1 1  52 ARG CD   C  14.710 -13.059 -32.826 1.00 . A A .  52 ARG CD   1 1 
        5  8281 1 1  52 ARG CG   C  14.190 -11.632 -32.908 1.00 . A A .  52 ARG CG   1 1 
        5  8282 1 1  52 ARG CZ   C  14.908 -13.736 -35.180 1.00 . A A .  52 ARG CZ   1 1 
        5  8283 1 1  52 ARG H    H  16.226 -12.836 -30.786 1.00 . A A .  52 ARG H    1 1 
        5  8284 1 1  52 ARG HA   H  15.939  -9.931 -30.479 1.00 . A A .  52 ARG HA   1 1 
        5  8285 1 1  52 ARG HB2  H  14.809  -9.630 -32.498 1.00 . A A .  52 ARG HB2  1 1 
        5  8286 1 1  52 ARG HB3  H  16.113 -10.735 -32.929 1.00 . A A .  52 ARG HB3  1 1 
        5  8287 1 1  52 ARG HD2  H  15.797 -13.038 -32.752 1.00 . A A .  52 ARG HD2  1 1 
        5  8288 1 1  52 ARG HD3  H  14.306 -13.524 -31.938 1.00 . A A .  52 ARG HD3  1 1 
        5  8289 1 1  52 ARG HE   H  13.602 -14.499 -33.882 1.00 . A A .  52 ARG HE   1 1 
        5  8290 1 1  52 ARG HG2  H  13.266 -11.555 -32.336 1.00 . A A .  52 ARG HG2  1 1 
        5  8291 1 1  52 ARG HG3  H  13.987 -11.392 -33.943 1.00 . A A .  52 ARG HG3  1 1 
        5  8292 1 1  52 ARG HH11 H  16.201 -12.297 -34.598 1.00 . A A .  52 ARG HH11 1 1 
        5  8293 1 1  52 ARG HH12 H  16.330 -12.784 -36.256 1.00 . A A .  52 ARG HH12 1 1 
        5  8294 1 1  52 ARG HH21 H  13.762 -15.148 -36.062 1.00 . A A .  52 ARG HH21 1 1 
        5  8295 1 1  52 ARG HH22 H  14.941 -14.405 -37.088 1.00 . A A .  52 ARG HH22 1 1 
        5  8296 1 1  52 ARG N    N  16.510 -11.901 -30.715 1.00 . A A .  52 ARG N    1 1 
        5  8297 1 1  52 ARG NE   N  14.327 -13.850 -33.991 1.00 . A A .  52 ARG NE   1 1 
        5  8298 1 1  52 ARG NH1  N  15.893 -12.868 -35.360 1.00 . A A .  52 ARG NH1  1 1 
        5  8299 1 1  52 ARG NH2  N  14.504 -14.492 -36.194 1.00 . A A .  52 ARG NH2  1 1 
        5  8300 1 1  52 ARG O    O  13.826 -12.330 -30.045 1.00 . A A .  52 ARG O    1 1 
        5  8301 1 1  53 VAL C    C  11.191  -9.772 -29.534 1.00 . A A .  53 VAL C    1 1 
        5  8302 1 1  53 VAL CA   C  12.391 -10.328 -28.776 1.00 . A A .  53 VAL CA   1 1 
        5  8303 1 1  53 VAL CB   C  12.477  -9.644 -27.398 1.00 . A A .  53 VAL CB   1 1 
        5  8304 1 1  53 VAL CG1  C  11.303 -10.055 -26.523 1.00 . A A .  53 VAL CG1  1 1 
        5  8305 1 1  53 VAL CG2  C  13.799  -9.973 -26.722 1.00 . A A .  53 VAL CG2  1 1 
        5  8306 1 1  53 VAL H    H  14.002  -9.249 -29.626 1.00 . A A .  53 VAL H    1 1 
        5  8307 1 1  53 VAL HA   H  12.247 -11.386 -28.619 1.00 . A A .  53 VAL HA   1 1 
        5  8308 1 1  53 VAL HB   H  12.429  -8.574 -27.547 1.00 . A A .  53 VAL HB   1 1 
        5  8309 1 1  53 VAL HG11 H  11.648 -10.731 -25.754 1.00 . A A .  53 VAL HG11 1 1 
        5  8310 1 1  53 VAL HG12 H  10.870  -9.179 -26.066 1.00 . A A .  53 VAL HG12 1 1 
        5  8311 1 1  53 VAL HG13 H  10.559 -10.552 -27.129 1.00 . A A .  53 VAL HG13 1 1 
        5  8312 1 1  53 VAL HG21 H  14.441  -9.105 -26.744 1.00 . A A .  53 VAL HG21 1 1 
        5  8313 1 1  53 VAL HG22 H  13.617 -10.261 -25.698 1.00 . A A .  53 VAL HG22 1 1 
        5  8314 1 1  53 VAL HG23 H  14.279 -10.788 -27.245 1.00 . A A .  53 VAL HG23 1 1 
        5  8315 1 1  53 VAL N    N  13.622 -10.148 -29.537 1.00 . A A .  53 VAL N    1 1 
        5  8316 1 1  53 VAL O    O  10.835  -8.599 -29.409 1.00 . A A .  53 VAL O    1 1 
        5  8317 1 1  54 PRO C    C   8.150  -9.992 -30.265 1.00 . A A .  54 PRO C    1 1 
        5  8318 1 1  54 PRO CA   C   9.378 -10.250 -31.132 1.00 . A A .  54 PRO CA   1 1 
        5  8319 1 1  54 PRO CB   C   9.150 -11.464 -32.035 1.00 . A A .  54 PRO CB   1 1 
        5  8320 1 1  54 PRO CD   C  10.918 -12.044 -30.534 1.00 . A A .  54 PRO CD   1 1 
        5  8321 1 1  54 PRO CG   C   9.746 -12.608 -31.290 1.00 . A A .  54 PRO CG   1 1 
        5  8322 1 1  54 PRO HA   H   9.577  -9.380 -31.739 1.00 . A A .  54 PRO HA   1 1 
        5  8323 1 1  54 PRO HB2  H   8.083 -11.627 -32.186 1.00 . A A .  54 PRO HB2  1 1 
        5  8324 1 1  54 PRO HB3  H   9.642 -11.310 -32.982 1.00 . A A .  54 PRO HB3  1 1 
        5  8325 1 1  54 PRO HD2  H  11.035 -12.548 -29.575 1.00 . A A .  54 PRO HD2  1 1 
        5  8326 1 1  54 PRO HD3  H  11.820 -12.128 -31.122 1.00 . A A .  54 PRO HD3  1 1 
        5  8327 1 1  54 PRO HG2  H   9.017 -13.027 -30.596 1.00 . A A .  54 PRO HG2  1 1 
        5  8328 1 1  54 PRO HG3  H  10.077 -13.365 -31.985 1.00 . A A .  54 PRO HG3  1 1 
        5  8329 1 1  54 PRO N    N  10.549 -10.633 -30.338 1.00 . A A .  54 PRO N    1 1 
        5  8330 1 1  54 PRO O    O   7.972 -10.619 -29.220 1.00 . A A .  54 PRO O    1 1 
        5  8331 1 1  55 CYS C    C   4.961  -9.694 -30.307 1.00 . A A .  55 CYS C    1 1 
        5  8332 1 1  55 CYS CA   C   6.091  -8.727 -29.971 1.00 . A A .  55 CYS CA   1 1 
        5  8333 1 1  55 CYS CB   C   5.662  -7.293 -30.291 1.00 . A A .  55 CYS CB   1 1 
        5  8334 1 1  55 CYS H    H   7.499  -8.601 -31.546 1.00 . A A .  55 CYS H    1 1 
        5  8335 1 1  55 CYS HA   H   6.311  -8.799 -28.916 1.00 . A A .  55 CYS HA   1 1 
        5  8336 1 1  55 CYS HB2  H   6.173  -6.971 -31.198 1.00 . A A .  55 CYS HB2  1 1 
        5  8337 1 1  55 CYS HB3  H   4.597  -7.275 -30.470 1.00 . A A .  55 CYS HB3  1 1 
        5  8338 1 1  55 CYS HG   H   5.071  -6.163 -28.031 1.00 . A A .  55 CYS HG   1 1 
        5  8339 1 1  55 CYS N    N   7.303  -9.066 -30.705 1.00 . A A .  55 CYS N    1 1 
        5  8340 1 1  55 CYS O    O   4.539  -9.795 -31.457 1.00 . A A .  55 CYS O    1 1 
        5  8341 1 1  55 CYS SG   S   6.023  -6.095 -28.966 1.00 . A A .  55 CYS SG   1 1 
        5  8342 1 1  56 ASN C    C   3.035 -12.041 -28.161 1.00 . A A .  56 ASN C    1 1 
        5  8343 1 1  56 ASN CA   C   3.396 -11.364 -29.481 1.00 . A A .  56 ASN CA   1 1 
        5  8344 1 1  56 ASN CB   C   3.795 -12.418 -30.514 1.00 . A A .  56 ASN CB   1 1 
        5  8345 1 1  56 ASN CG   C   2.846 -12.459 -31.697 1.00 . A A .  56 ASN CG   1 1 
        5  8346 1 1  56 ASN H    H   4.855 -10.279 -28.398 1.00 . A A .  56 ASN H    1 1 
        5  8347 1 1  56 ASN HA   H   2.533 -10.826 -29.843 1.00 . A A .  56 ASN HA   1 1 
        5  8348 1 1  56 ASN HB2  H   4.799 -12.195 -30.874 1.00 . A A .  56 ASN HB2  1 1 
        5  8349 1 1  56 ASN HB3  H   3.800 -13.392 -30.046 1.00 . A A .  56 ASN HB3  1 1 
        5  8350 1 1  56 ASN HD21 H   1.286 -12.598 -30.470 1.00 . A A .  56 ASN HD21 1 1 
        5  8351 1 1  56 ASN HD22 H   0.917 -12.584 -32.158 1.00 . A A .  56 ASN HD22 1 1 
        5  8352 1 1  56 ASN N    N   4.477 -10.404 -29.292 1.00 . A A .  56 ASN N    1 1 
        5  8353 1 1  56 ASN ND2  N   1.553 -12.557 -31.413 1.00 . A A .  56 ASN ND2  1 1 
        5  8354 1 1  56 ASN O    O   1.859 -12.248 -27.860 1.00 . A A .  56 ASN O    1 1 
        5  8355 1 1  56 ASN OD1  O   3.271 -12.400 -32.851 1.00 . A A .  56 ASN OD1  1 1 
        5  8356 1 1  57 TRP C    C   4.276 -12.130 -24.946 1.00 . A A .  57 TRP C    1 1 
        5  8357 1 1  57 TRP CA   C   3.843 -13.037 -26.093 1.00 . A A .  57 TRP CA   1 1 
        5  8358 1 1  57 TRP CB   C   4.615 -14.356 -26.036 1.00 . A A .  57 TRP CB   1 1 
        5  8359 1 1  57 TRP CD1  C   7.013 -13.584 -25.569 1.00 . A A .  57 TRP CD1  1 1 
        5  8360 1 1  57 TRP CD2  C   6.759 -14.680 -27.506 1.00 . A A .  57 TRP CD2  1 1 
        5  8361 1 1  57 TRP CE2  C   8.113 -14.313 -27.372 1.00 . A A .  57 TRP CE2  1 1 
        5  8362 1 1  57 TRP CE3  C   6.362 -15.381 -28.647 1.00 . A A .  57 TRP CE3  1 1 
        5  8363 1 1  57 TRP CG   C   6.073 -14.204 -26.343 1.00 . A A .  57 TRP CG   1 1 
        5  8364 1 1  57 TRP CH2  C   8.651 -15.313 -29.442 1.00 . A A .  57 TRP CH2  1 1 
        5  8365 1 1  57 TRP CZ2  C   9.067 -14.625 -28.335 1.00 . A A .  57 TRP CZ2  1 1 
        5  8366 1 1  57 TRP CZ3  C   7.311 -15.690 -29.604 1.00 . A A .  57 TRP CZ3  1 1 
        5  8367 1 1  57 TRP H    H   4.967 -12.192 -27.676 1.00 . A A .  57 TRP H    1 1 
        5  8368 1 1  57 TRP HA   H   2.787 -13.243 -25.996 1.00 . A A .  57 TRP HA   1 1 
        5  8369 1 1  57 TRP HB2  H   4.508 -14.783 -25.039 1.00 . A A .  57 TRP HB2  1 1 
        5  8370 1 1  57 TRP HB3  H   4.192 -15.043 -26.755 1.00 . A A .  57 TRP HB3  1 1 
        5  8371 1 1  57 TRP HD1  H   6.806 -13.116 -24.620 1.00 . A A .  57 TRP HD1  1 1 
        5  8372 1 1  57 TRP HE1  H   9.075 -13.273 -25.824 1.00 . A A .  57 TRP HE1  1 1 
        5  8373 1 1  57 TRP HE3  H   5.334 -15.682 -28.789 1.00 . A A .  57 TRP HE3  1 1 
        5  8374 1 1  57 TRP HH2  H   9.358 -15.574 -30.215 1.00 . A A .  57 TRP HH2  1 1 
        5  8375 1 1  57 TRP HZ2  H  10.104 -14.342 -28.226 1.00 . A A .  57 TRP HZ2  1 1 
        5  8376 1 1  57 TRP HZ3  H   7.022 -16.231 -30.492 1.00 . A A .  57 TRP HZ3  1 1 
        5  8377 1 1  57 TRP N    N   4.053 -12.383 -27.381 1.00 . A A .  57 TRP N    1 1 
        5  8378 1 1  57 TRP NE1  N   8.242 -13.646 -26.182 1.00 . A A .  57 TRP NE1  1 1 
        5  8379 1 1  57 TRP O    O   5.022 -11.171 -25.147 1.00 . A A .  57 TRP O    1 1 
        5  8380 1 1  58 LYS C    C   5.253 -12.326 -21.762 1.00 . A A .  58 LYS C    1 1 
        5  8381 1 1  58 LYS CA   C   4.142 -11.654 -22.563 1.00 . A A .  58 LYS CA   1 1 
        5  8382 1 1  58 LYS CB   C   2.907 -11.462 -21.679 1.00 . A A .  58 LYS CB   1 1 
        5  8383 1 1  58 LYS CD   C   0.710 -10.739 -22.661 1.00 . A A .  58 LYS CD   1 1 
        5  8384 1 1  58 LYS CE   C   0.107  -9.688 -23.578 1.00 . A A .  58 LYS CE   1 1 
        5  8385 1 1  58 LYS CG   C   2.043 -10.283 -22.091 1.00 . A A .  58 LYS CG   1 1 
        5  8386 1 1  58 LYS H    H   3.212 -13.216 -23.647 1.00 . A A .  58 LYS H    1 1 
        5  8387 1 1  58 LYS HA   H   4.490 -10.687 -22.895 1.00 . A A .  58 LYS HA   1 1 
        5  8388 1 1  58 LYS HB2  H   2.304 -12.369 -21.722 1.00 . A A .  58 LYS HB2  1 1 
        5  8389 1 1  58 LYS HB3  H   3.228 -11.308 -20.660 1.00 . A A .  58 LYS HB3  1 1 
        5  8390 1 1  58 LYS HD2  H   0.859 -11.660 -23.224 1.00 . A A .  58 LYS HD2  1 1 
        5  8391 1 1  58 LYS HD3  H   0.026 -10.929 -21.845 1.00 . A A .  58 LYS HD3  1 1 
        5  8392 1 1  58 LYS HE2  H   0.582  -8.727 -23.379 1.00 . A A .  58 LYS HE2  1 1 
        5  8393 1 1  58 LYS HE3  H   0.299  -9.971 -24.604 1.00 . A A .  58 LYS HE3  1 1 
        5  8394 1 1  58 LYS HG2  H   1.861  -9.653 -21.221 1.00 . A A .  58 LYS HG2  1 1 
        5  8395 1 1  58 LYS HG3  H   2.567  -9.709 -22.841 1.00 . A A .  58 LYS HG3  1 1 
        5  8396 1 1  58 LYS HZ1  H  -1.569  -8.732 -22.776 1.00 . A A .  58 LYS HZ1  1 1 
        5  8397 1 1  58 LYS HZ2  H  -1.740 -10.409 -22.922 1.00 . A A .  58 LYS HZ2  1 1 
        5  8398 1 1  58 LYS HZ3  H  -1.838  -9.427 -24.295 1.00 . A A .  58 LYS HZ3  1 1 
        5  8399 1 1  58 LYS N    N   3.803 -12.440 -23.743 1.00 . A A .  58 LYS N    1 1 
        5  8400 1 1  58 LYS NZ   N  -1.363  -9.554 -23.379 1.00 . A A .  58 LYS NZ   1 1 
        5  8401 1 1  58 LYS O    O   6.186 -11.668 -21.300 1.00 . A A .  58 LYS O    1 1 
        5  8402 1 1  59 LYS C    C   6.187 -13.967 -19.400 1.00 . A A .  59 LYS C    1 1 
        5  8403 1 1  59 LYS CA   C   6.145 -14.403 -20.860 1.00 . A A .  59 LYS CA   1 1 
        5  8404 1 1  59 LYS CB   C   7.526 -14.233 -21.496 1.00 . A A .  59 LYS CB   1 1 
        5  8405 1 1  59 LYS CD   C   9.492 -15.745 -21.094 1.00 . A A .  59 LYS CD   1 1 
        5  8406 1 1  59 LYS CE   C   9.890 -17.212 -21.046 1.00 . A A .  59 LYS CE   1 1 
        5  8407 1 1  59 LYS CG   C   8.195 -15.546 -21.863 1.00 . A A .  59 LYS CG   1 1 
        5  8408 1 1  59 LYS H    H   4.382 -14.110 -21.995 1.00 . A A .  59 LYS H    1 1 
        5  8409 1 1  59 LYS HA   H   5.865 -15.446 -20.903 1.00 . A A .  59 LYS HA   1 1 
        5  8410 1 1  59 LYS HB2  H   7.423 -13.630 -22.398 1.00 . A A .  59 LYS HB2  1 1 
        5  8411 1 1  59 LYS HB3  H   8.165 -13.708 -20.801 1.00 . A A .  59 LYS HB3  1 1 
        5  8412 1 1  59 LYS HD2  H  10.285 -15.174 -21.576 1.00 . A A .  59 LYS HD2  1 1 
        5  8413 1 1  59 LYS HD3  H   9.359 -15.384 -20.083 1.00 . A A .  59 LYS HD3  1 1 
        5  8414 1 1  59 LYS HE2  H   9.003 -17.817 -20.859 1.00 . A A .  59 LYS HE2  1 1 
        5  8415 1 1  59 LYS HE3  H  10.311 -17.487 -22.004 1.00 . A A .  59 LYS HE3  1 1 
        5  8416 1 1  59 LYS HG2  H   7.516 -16.368 -21.637 1.00 . A A .  59 LYS HG2  1 1 
        5  8417 1 1  59 LYS HG3  H   8.411 -15.546 -22.921 1.00 . A A .  59 LYS HG3  1 1 
        5  8418 1 1  59 LYS HZ1  H  10.439 -17.461 -19.046 1.00 . A A .  59 LYS HZ1  1 1 
        5  8419 1 1  59 LYS HZ2  H  11.642 -16.754 -20.004 1.00 . A A .  59 LYS HZ2  1 1 
        5  8420 1 1  59 LYS HZ3  H  11.331 -18.411 -20.126 1.00 . A A .  59 LYS HZ3  1 1 
        5  8421 1 1  59 LYS N    N   5.148 -13.642 -21.602 1.00 . A A .  59 LYS N    1 1 
        5  8422 1 1  59 LYS NZ   N  10.896 -17.478 -19.981 1.00 . A A .  59 LYS NZ   1 1 
        5  8423 1 1  59 LYS O    O   5.566 -12.975 -19.022 1.00 . A A .  59 LYS O    1 1 
        5  8424 1 1  60 GLU C    C   8.088 -13.308 -16.936 1.00 . A A .  60 GLU C    1 1 
        5  8425 1 1  60 GLU CA   C   7.048 -14.402 -17.165 1.00 . A A .  60 GLU CA   1 1 
        5  8426 1 1  60 GLU CB   C   7.431 -15.655 -16.376 1.00 . A A .  60 GLU CB   1 1 
        5  8427 1 1  60 GLU CD   C   8.091 -16.619 -14.136 1.00 . A A .  60 GLU CD   1 1 
        5  8428 1 1  60 GLU CG   C   7.513 -15.429 -14.876 1.00 . A A .  60 GLU CG   1 1 
        5  8429 1 1  60 GLU H    H   7.398 -15.493 -18.945 1.00 . A A .  60 GLU H    1 1 
        5  8430 1 1  60 GLU HA   H   6.090 -14.048 -16.819 1.00 . A A .  60 GLU HA   1 1 
        5  8431 1 1  60 GLU HB2  H   6.691 -16.431 -16.571 1.00 . A A .  60 GLU HB2  1 1 
        5  8432 1 1  60 GLU HB3  H   8.395 -16.002 -16.720 1.00 . A A .  60 GLU HB3  1 1 
        5  8433 1 1  60 GLU HG2  H   8.138 -14.556 -14.684 1.00 . A A .  60 GLU HG2  1 1 
        5  8434 1 1  60 GLU HG3  H   6.519 -15.238 -14.498 1.00 . A A .  60 GLU HG3  1 1 
        5  8435 1 1  60 GLU N    N   6.925 -14.714 -18.585 1.00 . A A .  60 GLU N    1 1 
        5  8436 1 1  60 GLU O    O   9.267 -13.481 -17.247 1.00 . A A .  60 GLU O    1 1 
        5  8437 1 1  60 GLU OE1  O   7.905 -17.761 -14.609 1.00 . A A .  60 GLU OE1  1 1 
        5  8438 1 1  60 GLU OE2  O   8.731 -16.410 -13.085 1.00 . A A .  60 GLU OE2  1 1 
        5  8439 1 1  61 PHE C    C   8.134 -10.344 -14.836 1.00 . A A .  61 PHE C    1 1 
        5  8440 1 1  61 PHE CA   C   8.532 -11.056 -16.124 1.00 . A A .  61 PHE CA   1 1 
        5  8441 1 1  61 PHE CB   C   8.508 -10.070 -17.295 1.00 . A A .  61 PHE CB   1 1 
        5  8442 1 1  61 PHE CD1  C  10.858  -9.197 -17.180 1.00 . A A .  61 PHE CD1  1 1 
        5  8443 1 1  61 PHE CD2  C  10.133 -10.237 -19.199 1.00 . A A .  61 PHE CD2  1 1 
        5  8444 1 1  61 PHE CE1  C  12.104  -8.976 -17.737 1.00 . A A .  61 PHE CE1  1 1 
        5  8445 1 1  61 PHE CE2  C  11.377 -10.020 -19.761 1.00 . A A .  61 PHE CE2  1 1 
        5  8446 1 1  61 PHE CG   C   9.860  -9.831 -17.903 1.00 . A A .  61 PHE CG   1 1 
        5  8447 1 1  61 PHE CZ   C  12.362  -9.387 -19.030 1.00 . A A .  61 PHE CZ   1 1 
        5  8448 1 1  61 PHE H    H   6.690 -12.101 -16.168 1.00 . A A .  61 PHE H    1 1 
        5  8449 1 1  61 PHE HA   H   9.531 -11.445 -16.012 1.00 . A A .  61 PHE HA   1 1 
        5  8450 1 1  61 PHE HB2  H   7.841 -10.456 -18.065 1.00 . A A .  61 PHE HB2  1 1 
        5  8451 1 1  61 PHE HB3  H   8.126  -9.122 -16.948 1.00 . A A .  61 PHE HB3  1 1 
        5  8452 1 1  61 PHE HD1  H  10.656  -8.875 -16.168 1.00 . A A .  61 PHE HD1  1 1 
        5  8453 1 1  61 PHE HD2  H   9.362 -10.732 -19.774 1.00 . A A .  61 PHE HD2  1 1 
        5  8454 1 1  61 PHE HE1  H  12.872  -8.481 -17.162 1.00 . A A .  61 PHE HE1  1 1 
        5  8455 1 1  61 PHE HE2  H  11.576 -10.342 -20.772 1.00 . A A .  61 PHE HE2  1 1 
        5  8456 1 1  61 PHE HZ   H  13.335  -9.216 -19.467 1.00 . A A .  61 PHE HZ   1 1 
        5  8457 1 1  61 PHE N    N   7.642 -12.180 -16.394 1.00 . A A .  61 PHE N    1 1 
        5  8458 1 1  61 PHE O    O   7.025  -9.821 -14.719 1.00 . A A .  61 PHE O    1 1 
        5  8459 1 1  62 GLY C    C   9.996  -8.999 -12.020 1.00 . A A .  62 GLY C    1 1 
        5  8460 1 1  62 GLY CA   C   8.771  -9.680 -12.600 1.00 . A A .  62 GLY CA   1 1 
        5  8461 1 1  62 GLY H    H   9.912 -10.763 -14.017 1.00 . A A .  62 GLY H    1 1 
        5  8462 1 1  62 GLY HA2  H   7.998  -8.941 -12.746 1.00 . A A .  62 GLY HA2  1 1 
        5  8463 1 1  62 GLY HA3  H   8.420 -10.422 -11.897 1.00 . A A .  62 GLY HA3  1 1 
        5  8464 1 1  62 GLY N    N   9.044 -10.329 -13.868 1.00 . A A .  62 GLY N    1 1 
        5  8465 1 1  62 GLY O    O  10.771  -9.618 -11.291 1.00 . A A .  62 GLY O    1 1 
        5  8466 1 1  63 ALA C    C  10.853  -5.704 -11.119 1.00 . A A .  63 ALA C    1 1 
        5  8467 1 1  63 ALA CA   C  11.311  -6.960 -11.853 1.00 . A A .  63 ALA CA   1 1 
        5  8468 1 1  63 ALA CB   C  12.238  -6.591 -13.004 1.00 . A A .  63 ALA CB   1 1 
        5  8469 1 1  63 ALA H    H   9.520  -7.286 -12.933 1.00 . A A .  63 ALA H    1 1 
        5  8470 1 1  63 ALA HA   H  11.862  -7.587 -11.167 1.00 . A A .  63 ALA HA   1 1 
        5  8471 1 1  63 ALA HB1  H  11.717  -5.940 -13.690 1.00 . A A .  63 ALA HB1  1 1 
        5  8472 1 1  63 ALA HB2  H  13.108  -6.084 -12.616 1.00 . A A .  63 ALA HB2  1 1 
        5  8473 1 1  63 ALA HB3  H  12.543  -7.489 -13.520 1.00 . A A .  63 ALA HB3  1 1 
        5  8474 1 1  63 ALA N    N  10.172  -7.723 -12.348 1.00 . A A .  63 ALA N    1 1 
        5  8475 1 1  63 ALA O    O   9.770  -5.181 -11.381 1.00 . A A .  63 ALA O    1 1 
        5  8476 1 1  64 ASP C    C  12.202  -2.846  -9.887 1.00 . A A .  64 ASP C    1 1 
        5  8477 1 1  64 ASP CA   C  11.363  -4.034  -9.426 1.00 . A A .  64 ASP CA   1 1 
        5  8478 1 1  64 ASP CB   C  11.595  -4.288  -7.935 1.00 . A A .  64 ASP CB   1 1 
        5  8479 1 1  64 ASP CG   C  10.392  -4.919  -7.261 1.00 . A A .  64 ASP CG   1 1 
        5  8480 1 1  64 ASP H    H  12.533  -5.690 -10.035 1.00 . A A .  64 ASP H    1 1 
        5  8481 1 1  64 ASP HA   H  10.321  -3.805  -9.584 1.00 . A A .  64 ASP HA   1 1 
        5  8482 1 1  64 ASP HB2  H  12.453  -4.951  -7.819 1.00 . A A .  64 ASP HB2  1 1 
        5  8483 1 1  64 ASP HB3  H  11.809  -3.349  -7.445 1.00 . A A .  64 ASP HB3  1 1 
        5  8484 1 1  64 ASP N    N  11.683  -5.227 -10.198 1.00 . A A .  64 ASP N    1 1 
        5  8485 1 1  64 ASP O    O  11.667  -1.822 -10.312 1.00 . A A .  64 ASP O    1 1 
        5  8486 1 1  64 ASP OD1  O   9.480  -5.376  -7.982 1.00 . A A .  64 ASP OD1  1 1 
        5  8487 1 1  64 ASP OD2  O  10.363  -4.957  -6.014 1.00 . A A .  64 ASP OD2  1 1 
        5  8488 1 1  65 CYS C    C  15.346  -2.401 -11.336 1.00 . A A .  65 CYS C    1 1 
        5  8489 1 1  65 CYS CA   C  14.434  -1.929 -10.207 1.00 . A A .  65 CYS CA   1 1 
        5  8490 1 1  65 CYS CB   C  15.276  -1.467  -9.016 1.00 . A A .  65 CYS CB   1 1 
        5  8491 1 1  65 CYS H    H  13.888  -3.829  -9.453 1.00 . A A .  65 CYS H    1 1 
        5  8492 1 1  65 CYS HA   H  13.843  -1.099 -10.562 1.00 . A A .  65 CYS HA   1 1 
        5  8493 1 1  65 CYS HB2  H  14.816  -1.837  -8.100 1.00 . A A .  65 CYS HB2  1 1 
        5  8494 1 1  65 CYS HB3  H  16.266  -1.890  -9.099 1.00 . A A .  65 CYS HB3  1 1 
        5  8495 1 1  65 CYS HG   H  15.636   0.860 -10.105 1.00 . A A .  65 CYS HG   1 1 
        5  8496 1 1  65 CYS N    N  13.520  -2.989  -9.801 1.00 . A A .  65 CYS N    1 1 
        5  8497 1 1  65 CYS O    O  15.854  -3.523 -11.312 1.00 . A A .  65 CYS O    1 1 
        5  8498 1 1  65 CYS SG   S  15.453   0.342  -8.888 1.00 . A A .  65 CYS SG   1 1 
        5  8499 1 1  66 LYS C    C  17.811  -1.307 -13.264 1.00 . A A .  66 LYS C    1 1 
        5  8500 1 1  66 LYS CA   C  16.403  -1.862 -13.461 1.00 . A A .  66 LYS CA   1 1 
        5  8501 1 1  66 LYS CB   C  15.800  -1.304 -14.752 1.00 . A A .  66 LYS CB   1 1 
        5  8502 1 1  66 LYS CD   C  16.167  -2.159 -17.087 1.00 . A A .  66 LYS CD   1 1 
        5  8503 1 1  66 LYS CE   C  16.384  -3.471 -17.825 1.00 . A A .  66 LYS CE   1 1 
        5  8504 1 1  66 LYS CG   C  15.442  -2.375 -15.770 1.00 . A A .  66 LYS CG   1 1 
        5  8505 1 1  66 LYS H    H  15.119  -0.657 -12.287 1.00 . A A .  66 LYS H    1 1 
        5  8506 1 1  66 LYS HA   H  16.461  -2.937 -13.536 1.00 . A A .  66 LYS HA   1 1 
        5  8507 1 1  66 LYS HB2  H  14.899  -0.744 -14.503 1.00 . A A .  66 LYS HB2  1 1 
        5  8508 1 1  66 LYS HB3  H  16.513  -0.631 -15.207 1.00 . A A .  66 LYS HB3  1 1 
        5  8509 1 1  66 LYS HD2  H  15.578  -1.490 -17.713 1.00 . A A .  66 LYS HD2  1 1 
        5  8510 1 1  66 LYS HD3  H  17.127  -1.705 -16.889 1.00 . A A .  66 LYS HD3  1 1 
        5  8511 1 1  66 LYS HE2  H  17.445  -3.718 -17.809 1.00 . A A .  66 LYS HE2  1 1 
        5  8512 1 1  66 LYS HE3  H  15.832  -4.249 -17.319 1.00 . A A .  66 LYS HE3  1 1 
        5  8513 1 1  66 LYS HG2  H  15.713  -3.352 -15.369 1.00 . A A .  66 LYS HG2  1 1 
        5  8514 1 1  66 LYS HG3  H  14.376  -2.347 -15.945 1.00 . A A .  66 LYS HG3  1 1 
        5  8515 1 1  66 LYS HZ1  H  16.486  -2.687 -19.759 1.00 . A A .  66 LYS HZ1  1 1 
        5  8516 1 1  66 LYS HZ2  H  14.921  -3.117 -19.276 1.00 . A A .  66 LYS HZ2  1 1 
        5  8517 1 1  66 LYS HZ3  H  16.035  -4.317 -19.703 1.00 . A A .  66 LYS HZ3  1 1 
        5  8518 1 1  66 LYS N    N  15.551  -1.536 -12.325 1.00 . A A .  66 LYS N    1 1 
        5  8519 1 1  66 LYS NZ   N  15.924  -3.392 -19.240 1.00 . A A .  66 LYS NZ   1 1 
        5  8520 1 1  66 LYS O    O  17.987  -0.214 -12.726 1.00 . A A .  66 LYS O    1 1 
        5  8521 1 1  67 TYR C    C  20.983  -1.972 -14.843 1.00 . A A .  67 TYR C    1 1 
        5  8522 1 1  67 TYR CA   C  20.199  -1.650 -13.576 1.00 . A A .  67 TYR CA   1 1 
        5  8523 1 1  67 TYR CB   C  20.849  -2.335 -12.372 1.00 . A A .  67 TYR CB   1 1 
        5  8524 1 1  67 TYR CD1  C  19.336  -1.737 -10.441 1.00 . A A .  67 TYR CD1  1 1 
        5  8525 1 1  67 TYR CD2  C  21.559  -0.881 -10.434 1.00 . A A .  67 TYR CD2  1 1 
        5  8526 1 1  67 TYR CE1  C  19.082  -1.101  -9.241 1.00 . A A .  67 TYR CE1  1 1 
        5  8527 1 1  67 TYR CE2  C  21.316  -0.243  -9.234 1.00 . A A .  67 TYR CE2  1 1 
        5  8528 1 1  67 TYR CG   C  20.576  -1.637 -11.058 1.00 . A A .  67 TYR CG   1 1 
        5  8529 1 1  67 TYR CZ   C  20.075  -0.355  -8.641 1.00 . A A .  67 TYR CZ   1 1 
        5  8530 1 1  67 TYR H    H  18.604  -2.927 -14.127 1.00 . A A .  67 TYR H    1 1 
        5  8531 1 1  67 TYR HA   H  20.212  -0.581 -13.420 1.00 . A A .  67 TYR HA   1 1 
        5  8532 1 1  67 TYR HB2  H  20.477  -3.358 -12.308 1.00 . A A .  67 TYR HB2  1 1 
        5  8533 1 1  67 TYR HB3  H  21.919  -2.364 -12.518 1.00 . A A .  67 TYR HB3  1 1 
        5  8534 1 1  67 TYR HD1  H  18.560  -2.323 -10.913 1.00 . A A .  67 TYR HD1  1 1 
        5  8535 1 1  67 TYR HD2  H  22.530  -0.794 -10.901 1.00 . A A .  67 TYR HD2  1 1 
        5  8536 1 1  67 TYR HE1  H  18.111  -1.191  -8.777 1.00 . A A .  67 TYR HE1  1 1 
        5  8537 1 1  67 TYR HE2  H  22.092   0.343  -8.763 1.00 . A A .  67 TYR HE2  1 1 
        5  8538 1 1  67 TYR HH   H  19.358  -0.318  -6.858 1.00 . A A .  67 TYR HH   1 1 
        5  8539 1 1  67 TYR N    N  18.809  -2.065 -13.705 1.00 . A A .  67 TYR N    1 1 
        5  8540 1 1  67 TYR O    O  20.676  -2.931 -15.552 1.00 . A A .  67 TYR O    1 1 
        5  8541 1 1  67 TYR OH   O  19.827   0.279  -7.446 1.00 . A A .  67 TYR OH   1 1 
        5  8542 1 1  68 LYS C    C  24.029  -2.255 -15.984 1.00 . A A .  68 LYS C    1 1 
        5  8543 1 1  68 LYS CA   C  22.834  -1.362 -16.303 1.00 . A A .  68 LYS CA   1 1 
        5  8544 1 1  68 LYS CB   C  23.321  -0.014 -16.842 1.00 . A A .  68 LYS CB   1 1 
        5  8545 1 1  68 LYS CD   C  25.648   0.449 -17.666 1.00 . A A .  68 LYS CD   1 1 
        5  8546 1 1  68 LYS CE   C  26.290   1.109 -18.878 1.00 . A A .  68 LYS CE   1 1 
        5  8547 1 1  68 LYS CG   C  24.288  -0.138 -18.006 1.00 . A A .  68 LYS CG   1 1 
        5  8548 1 1  68 LYS H    H  22.197  -0.416 -14.520 1.00 . A A .  68 LYS H    1 1 
        5  8549 1 1  68 LYS HA   H  22.231  -1.844 -17.058 1.00 . A A .  68 LYS HA   1 1 
        5  8550 1 1  68 LYS HB2  H  22.456   0.566 -17.165 1.00 . A A .  68 LYS HB2  1 1 
        5  8551 1 1  68 LYS HB3  H  23.817   0.520 -16.044 1.00 . A A .  68 LYS HB3  1 1 
        5  8552 1 1  68 LYS HD2  H  25.529   1.191 -16.877 1.00 . A A .  68 LYS HD2  1 1 
        5  8553 1 1  68 LYS HD3  H  26.294  -0.343 -17.314 1.00 . A A .  68 LYS HD3  1 1 
        5  8554 1 1  68 LYS HE2  H  25.506   1.459 -19.549 1.00 . A A .  68 LYS HE2  1 1 
        5  8555 1 1  68 LYS HE3  H  26.871   1.955 -18.544 1.00 . A A .  68 LYS HE3  1 1 
        5  8556 1 1  68 LYS HG2  H  24.406  -1.191 -18.263 1.00 . A A .  68 LYS HG2  1 1 
        5  8557 1 1  68 LYS HG3  H  23.880   0.391 -18.857 1.00 . A A .  68 LYS HG3  1 1 
        5  8558 1 1  68 LYS HZ1  H  26.805  -0.800 -19.552 1.00 . A A .  68 LYS HZ1  1 1 
        5  8559 1 1  68 LYS HZ2  H  28.134   0.188 -19.209 1.00 . A A .  68 LYS HZ2  1 1 
        5  8560 1 1  68 LYS HZ3  H  27.234   0.442 -20.618 1.00 . A A .  68 LYS HZ3  1 1 
        5  8561 1 1  68 LYS N    N  22.001  -1.164 -15.124 1.00 . A A .  68 LYS N    1 1 
        5  8562 1 1  68 LYS NZ   N  27.177   0.169 -19.616 1.00 . A A .  68 LYS NZ   1 1 
        5  8563 1 1  68 LYS O    O  25.047  -1.786 -15.475 1.00 . A A .  68 LYS O    1 1 
        5  8564 1 1  69 PHE C    C  25.925  -4.574 -17.216 1.00 . A A .  69 PHE C    1 1 
        5  8565 1 1  69 PHE CA   C  24.967  -4.500 -16.031 1.00 . A A .  69 PHE CA   1 1 
        5  8566 1 1  69 PHE CB   C  24.381  -5.885 -15.746 1.00 . A A .  69 PHE CB   1 1 
        5  8567 1 1  69 PHE CD1  C  24.348  -5.405 -13.285 1.00 . A A .  69 PHE CD1  1 1 
        5  8568 1 1  69 PHE CD2  C  24.840  -7.626 -13.998 1.00 . A A .  69 PHE CD2  1 1 
        5  8569 1 1  69 PHE CE1  C  24.478  -5.795 -11.966 1.00 . A A .  69 PHE CE1  1 1 
        5  8570 1 1  69 PHE CE2  C  24.971  -8.023 -12.681 1.00 . A A .  69 PHE CE2  1 1 
        5  8571 1 1  69 PHE CG   C  24.525  -6.314 -14.314 1.00 . A A .  69 PHE CG   1 1 
        5  8572 1 1  69 PHE CZ   C  24.792  -7.106 -11.663 1.00 . A A .  69 PHE CZ   1 1 
        5  8573 1 1  69 PHE H    H  23.062  -3.855 -16.690 1.00 . A A .  69 PHE H    1 1 
        5  8574 1 1  69 PHE HA   H  25.512  -4.163 -15.163 1.00 . A A .  69 PHE HA   1 1 
        5  8575 1 1  69 PHE HB2  H  23.322  -5.877 -16.004 1.00 . A A .  69 PHE HB2  1 1 
        5  8576 1 1  69 PHE HB3  H  24.884  -6.614 -16.365 1.00 . A A .  69 PHE HB3  1 1 
        5  8577 1 1  69 PHE HD1  H  24.102  -4.377 -13.519 1.00 . A A .  69 PHE HD1  1 1 
        5  8578 1 1  69 PHE HD2  H  24.981  -8.342 -14.793 1.00 . A A .  69 PHE HD2  1 1 
        5  8579 1 1  69 PHE HE1  H  24.337  -5.077 -11.172 1.00 . A A .  69 PHE HE1  1 1 
        5  8580 1 1  69 PHE HE2  H  25.218  -9.047 -12.447 1.00 . A A .  69 PHE HE2  1 1 
        5  8581 1 1  69 PHE HZ   H  24.894  -7.414 -10.633 1.00 . A A .  69 PHE HZ   1 1 
        5  8582 1 1  69 PHE N    N  23.898  -3.542 -16.287 1.00 . A A .  69 PHE N    1 1 
        5  8583 1 1  69 PHE O    O  25.500  -4.590 -18.371 1.00 . A A .  69 PHE O    1 1 
        5  8584 1 1  70 GLY C    C  28.869  -6.055 -18.062 1.00 . A A .  70 GLY C    1 1 
        5  8585 1 1  70 GLY CA   C  28.219  -4.689 -17.971 1.00 . A A .  70 GLY CA   1 1 
        5  8586 1 1  70 GLY H    H  27.500  -4.604 -15.981 1.00 . A A .  70 GLY H    1 1 
        5  8587 1 1  70 GLY HA2  H  27.748  -4.463 -18.916 1.00 . A A .  70 GLY HA2  1 1 
        5  8588 1 1  70 GLY HA3  H  28.984  -3.951 -17.776 1.00 . A A .  70 GLY HA3  1 1 
        5  8589 1 1  70 GLY N    N  27.220  -4.619 -16.921 1.00 . A A .  70 GLY N    1 1 
        5  8590 1 1  70 GLY O    O  28.468  -6.889 -18.872 1.00 . A A .  70 GLY O    1 1 
        5  8591 1 1  71 ASN C    C  31.153  -7.857 -15.833 1.00 . A A .  71 ASN C    1 1 
        5  8592 1 1  71 ASN CA   C  30.588  -7.559 -17.219 1.00 . A A .  71 ASN CA   1 1 
        5  8593 1 1  71 ASN CB   C  31.719  -7.545 -18.251 1.00 . A A .  71 ASN CB   1 1 
        5  8594 1 1  71 ASN CG   C  32.047  -8.933 -18.767 1.00 . A A .  71 ASN CG   1 1 
        5  8595 1 1  71 ASN H    H  30.155  -5.580 -16.604 1.00 . A A .  71 ASN H    1 1 
        5  8596 1 1  71 ASN HA   H  29.883  -8.333 -17.482 1.00 . A A .  71 ASN HA   1 1 
        5  8597 1 1  71 ASN HB2  H  31.423  -6.916 -19.090 1.00 . A A .  71 ASN HB2  1 1 
        5  8598 1 1  71 ASN HB3  H  32.606  -7.129 -17.798 1.00 . A A .  71 ASN HB3  1 1 
        5  8599 1 1  71 ASN HD21 H  30.414  -8.923 -19.901 1.00 . A A .  71 ASN HD21 1 1 
        5  8600 1 1  71 ASN HD22 H  31.383 -10.350 -19.991 1.00 . A A .  71 ASN HD22 1 1 
        5  8601 1 1  71 ASN N    N  29.879  -6.284 -17.227 1.00 . A A .  71 ASN N    1 1 
        5  8602 1 1  71 ASN ND2  N  31.195  -9.455 -19.642 1.00 . A A .  71 ASN ND2  1 1 
        5  8603 1 1  71 ASN O    O  31.537  -6.946 -15.099 1.00 . A A .  71 ASN O    1 1 
        5  8604 1 1  71 ASN OD1  O  33.055  -9.527 -18.385 1.00 . A A .  71 ASN OD1  1 1 
        5  8605 1 1  72 TRP C    C  33.223  -9.308 -14.095 1.00 . A A .  72 TRP C    1 1 
        5  8606 1 1  72 TRP CA   C  31.722  -9.555 -14.186 1.00 . A A .  72 TRP CA   1 1 
        5  8607 1 1  72 TRP CB   C  31.420 -11.035 -13.946 1.00 . A A .  72 TRP CB   1 1 
        5  8608 1 1  72 TRP CD1  C  29.617 -11.943 -15.526 1.00 . A A .  72 TRP CD1  1 1 
        5  8609 1 1  72 TRP CD2  C  28.853 -11.333 -13.511 1.00 . A A .  72 TRP CD2  1 1 
        5  8610 1 1  72 TRP CE2  C  27.771 -11.810 -14.276 1.00 . A A .  72 TRP CE2  1 1 
        5  8611 1 1  72 TRP CE3  C  28.614 -10.896 -12.205 1.00 . A A .  72 TRP CE3  1 1 
        5  8612 1 1  72 TRP CG   C  30.024 -11.428 -14.329 1.00 . A A .  72 TRP CG   1 1 
        5  8613 1 1  72 TRP CH2  C  26.267 -11.423 -12.497 1.00 . A A .  72 TRP CH2  1 1 
        5  8614 1 1  72 TRP CZ2  C  26.472 -11.858 -13.777 1.00 . A A .  72 TRP CZ2  1 1 
        5  8615 1 1  72 TRP CZ3  C  27.324 -10.943 -11.712 1.00 . A A .  72 TRP CZ3  1 1 
        5  8616 1 1  72 TRP H    H  30.882  -9.818 -16.111 1.00 . A A .  72 TRP H    1 1 
        5  8617 1 1  72 TRP HA   H  31.225  -8.969 -13.427 1.00 . A A .  72 TRP HA   1 1 
        5  8618 1 1  72 TRP HB2  H  32.124 -11.634 -14.524 1.00 . A A .  72 TRP HB2  1 1 
        5  8619 1 1  72 TRP HB3  H  31.553 -11.257 -12.898 1.00 . A A .  72 TRP HB3  1 1 
        5  8620 1 1  72 TRP HD1  H  30.274 -12.132 -16.361 1.00 . A A .  72 TRP HD1  1 1 
        5  8621 1 1  72 TRP HE1  H  27.736 -12.542 -16.242 1.00 . A A .  72 TRP HE1  1 1 
        5  8622 1 1  72 TRP HE3  H  29.416 -10.523 -11.585 1.00 . A A .  72 TRP HE3  1 1 
        5  8623 1 1  72 TRP HH2  H  25.275 -11.442 -12.072 1.00 . A A .  72 TRP HH2  1 1 
        5  8624 1 1  72 TRP HZ2  H  25.646 -12.225 -14.370 1.00 . A A .  72 TRP HZ2  1 1 
        5  8625 1 1  72 TRP HZ3  H  27.119 -10.609 -10.706 1.00 . A A .  72 TRP HZ3  1 1 
        5  8626 1 1  72 TRP N    N  31.202  -9.137 -15.484 1.00 . A A .  72 TRP N    1 1 
        5  8627 1 1  72 TRP NE1  N  28.262 -12.175 -15.501 1.00 . A A .  72 TRP NE1  1 1 
        5  8628 1 1  72 TRP O    O  33.932  -9.357 -15.100 1.00 . A A .  72 TRP O    1 1 
        5  8629 1 1  73 GLY C    C  35.940 -10.066 -12.699 1.00 . A A .  73 GLY C    1 1 
        5  8630 1 1  73 GLY CA   C  35.118  -8.792 -12.685 1.00 . A A .  73 GLY CA   1 1 
        5  8631 1 1  73 GLY H    H  33.090  -9.016 -12.117 1.00 . A A .  73 GLY H    1 1 
        5  8632 1 1  73 GLY HA2  H  35.471  -8.140 -13.469 1.00 . A A .  73 GLY HA2  1 1 
        5  8633 1 1  73 GLY HA3  H  35.255  -8.301 -11.732 1.00 . A A .  73 GLY HA3  1 1 
        5  8634 1 1  73 GLY N    N  33.703  -9.043 -12.883 1.00 . A A .  73 GLY N    1 1 
        5  8635 1 1  73 GLY O    O  35.495 -11.093 -13.210 1.00 . A A .  73 GLY O    1 1 
        5  8636 1 1  74 GLU C    C  37.633 -12.100 -10.962 1.00 . A A .  74 GLU C    1 1 
        5  8637 1 1  74 GLU CA   C  38.030 -11.155 -12.092 1.00 . A A .  74 GLU CA   1 1 
        5  8638 1 1  74 GLU CB   C  39.482 -10.706 -11.912 1.00 . A A .  74 GLU CB   1 1 
        5  8639 1 1  74 GLU CD   C  40.453 -10.970  -9.595 1.00 . A A .  74 GLU CD   1 1 
        5  8640 1 1  74 GLU CG   C  39.751 -10.045 -10.571 1.00 . A A .  74 GLU CG   1 1 
        5  8641 1 1  74 GLU H    H  37.443  -9.151 -11.749 1.00 . A A .  74 GLU H    1 1 
        5  8642 1 1  74 GLU HA   H  37.940 -11.680 -13.032 1.00 . A A .  74 GLU HA   1 1 
        5  8643 1 1  74 GLU HB2  H  40.131 -11.577 -12.009 1.00 . A A .  74 GLU HB2  1 1 
        5  8644 1 1  74 GLU HB3  H  39.729 -10.001 -12.693 1.00 . A A .  74 GLU HB3  1 1 
        5  8645 1 1  74 GLU HG2  H  40.371  -9.163 -10.730 1.00 . A A .  74 GLU HG2  1 1 
        5  8646 1 1  74 GLU HG3  H  38.809  -9.739 -10.139 1.00 . A A .  74 GLU HG3  1 1 
        5  8647 1 1  74 GLU N    N  37.144  -9.999 -12.139 1.00 . A A .  74 GLU N    1 1 
        5  8648 1 1  74 GLU O    O  37.374 -11.668  -9.838 1.00 . A A .  74 GLU O    1 1 
        5  8649 1 1  74 GLU OE1  O  40.291 -12.201  -9.722 1.00 . A A .  74 GLU OE1  1 1 
        5  8650 1 1  74 GLU OE2  O  41.167 -10.461  -8.704 1.00 . A A .  74 GLU OE2  1 1 
        5  8651 1 1  75 CYS C    C  38.426 -14.788  -9.426 1.00 . A A .  75 CYS C    1 1 
        5  8652 1 1  75 CYS CA   C  37.221 -14.399 -10.280 1.00 . A A .  75 CYS CA   1 1 
        5  8653 1 1  75 CYS CB   C  36.651 -15.639 -10.971 1.00 . A A .  75 CYS CB   1 1 
        5  8654 1 1  75 CYS H    H  37.805 -13.676 -12.181 1.00 . A A .  75 CYS H    1 1 
        5  8655 1 1  75 CYS HA   H  36.464 -13.976  -9.638 1.00 . A A .  75 CYS HA   1 1 
        5  8656 1 1  75 CYS HB2  H  37.414 -16.051 -11.631 1.00 . A A .  75 CYS HB2  1 1 
        5  8657 1 1  75 CYS HB3  H  36.407 -16.379 -10.223 1.00 . A A .  75 CYS HB3  1 1 
        5  8658 1 1  75 CYS HG   H  35.168 -14.062 -12.399 1.00 . A A .  75 CYS HG   1 1 
        5  8659 1 1  75 CYS N    N  37.587 -13.392 -11.267 1.00 . A A .  75 CYS N    1 1 
        5  8660 1 1  75 CYS O    O  39.470 -15.179  -9.950 1.00 . A A .  75 CYS O    1 1 
        5  8661 1 1  75 CYS SG   S  35.148 -15.320 -11.948 1.00 . A A .  75 CYS SG   1 1 
        5  8662 1 1  76 ASP C    C  39.162 -16.429  -6.636 1.00 . A A .  76 ASP C    1 1 
        5  8663 1 1  76 ASP CA   C  39.346 -15.018  -7.186 1.00 . A A .  76 ASP CA   1 1 
        5  8664 1 1  76 ASP CB   C  39.394 -14.011  -6.035 1.00 . A A .  76 ASP CB   1 1 
        5  8665 1 1  76 ASP CG   C  40.630 -13.133  -6.085 1.00 . A A .  76 ASP CG   1 1 
        5  8666 1 1  76 ASP H    H  37.416 -14.361  -7.756 1.00 . A A .  76 ASP H    1 1 
        5  8667 1 1  76 ASP HA   H  40.278 -14.976  -7.729 1.00 . A A .  76 ASP HA   1 1 
        5  8668 1 1  76 ASP HB2  H  38.508 -13.378  -6.082 1.00 . A A .  76 ASP HB2  1 1 
        5  8669 1 1  76 ASP HB3  H  39.393 -14.547  -5.096 1.00 . A A .  76 ASP HB3  1 1 
        5  8670 1 1  76 ASP N    N  38.273 -14.677  -8.112 1.00 . A A .  76 ASP N    1 1 
        5  8671 1 1  76 ASP O    O  38.259 -16.682  -5.840 1.00 . A A .  76 ASP O    1 1 
        5  8672 1 1  76 ASP OD1  O  41.739 -13.654  -5.841 1.00 . A A .  76 ASP OD1  1 1 
        5  8673 1 1  76 ASP OD2  O  40.487 -11.927  -6.371 1.00 . A A .  76 ASP OD2  1 1 
        5  8674 1 1  77 ALA C    C  40.159 -18.826  -5.109 1.00 . A A .  77 ALA C    1 1 
        5  8675 1 1  77 ALA CA   C  39.958 -18.729  -6.618 1.00 . A A .  77 ALA CA   1 1 
        5  8676 1 1  77 ALA CB   C  40.996 -19.570  -7.345 1.00 . A A .  77 ALA CB   1 1 
        5  8677 1 1  77 ALA H    H  40.723 -17.081  -7.701 1.00 . A A .  77 ALA H    1 1 
        5  8678 1 1  77 ALA HA   H  38.980 -19.114  -6.866 1.00 . A A .  77 ALA HA   1 1 
        5  8679 1 1  77 ALA HB1  H  41.550 -20.157  -6.627 1.00 . A A .  77 ALA HB1  1 1 
        5  8680 1 1  77 ALA HB2  H  40.501 -20.228  -8.044 1.00 . A A .  77 ALA HB2  1 1 
        5  8681 1 1  77 ALA HB3  H  41.676 -18.922  -7.878 1.00 . A A .  77 ALA HB3  1 1 
        5  8682 1 1  77 ALA N    N  40.026 -17.343  -7.068 1.00 . A A .  77 ALA N    1 1 
        5  8683 1 1  77 ALA O    O  39.827 -19.839  -4.494 1.00 . A A .  77 ALA O    1 1 
        5  8684 1 1  78 ALA C    C  39.634 -17.708  -2.305 1.00 . A A .  78 ALA C    1 1 
        5  8685 1 1  78 ALA CA   C  40.946 -17.734  -3.081 1.00 . A A .  78 ALA CA   1 1 
        5  8686 1 1  78 ALA CB   C  41.800 -16.528  -2.719 1.00 . A A .  78 ALA CB   1 1 
        5  8687 1 1  78 ALA H    H  40.946 -16.990  -5.063 1.00 . A A .  78 ALA H    1 1 
        5  8688 1 1  78 ALA HA   H  41.494 -18.626  -2.815 1.00 . A A .  78 ALA HA   1 1 
        5  8689 1 1  78 ALA HB1  H  42.629 -16.848  -2.103 1.00 . A A .  78 ALA HB1  1 1 
        5  8690 1 1  78 ALA HB2  H  42.177 -16.070  -3.621 1.00 . A A .  78 ALA HB2  1 1 
        5  8691 1 1  78 ALA HB3  H  41.202 -15.814  -2.175 1.00 . A A .  78 ALA HB3  1 1 
        5  8692 1 1  78 ALA N    N  40.703 -17.767  -4.519 1.00 . A A .  78 ALA N    1 1 
        5  8693 1 1  78 ALA O    O  39.564 -18.179  -1.169 1.00 . A A .  78 ALA O    1 1 
        5  8694 1 1  79 THR C    C  36.236 -17.832  -3.083 1.00 . A A .  79 THR C    1 1 
        5  8695 1 1  79 THR CA   C  37.287 -17.066  -2.288 1.00 . A A .  79 THR CA   1 1 
        5  8696 1 1  79 THR CB   C  36.833 -15.602  -2.138 1.00 . A A .  79 THR CB   1 1 
        5  8697 1 1  79 THR CG2  C  36.750 -14.919  -3.495 1.00 . A A .  79 THR CG2  1 1 
        5  8698 1 1  79 THR H    H  38.713 -16.797  -3.828 1.00 . A A .  79 THR H    1 1 
        5  8699 1 1  79 THR HA   H  37.364 -17.500  -1.301 1.00 . A A .  79 THR HA   1 1 
        5  8700 1 1  79 THR HB   H  37.557 -15.077  -1.531 1.00 . A A .  79 THR HB   1 1 
        5  8701 1 1  79 THR HG1  H  35.672 -15.654  -0.545 1.00 . A A .  79 THR HG1  1 1 
        5  8702 1 1  79 THR HG21 H  36.683 -15.666  -4.269 1.00 . A A .  79 THR HG21 1 1 
        5  8703 1 1  79 THR HG22 H  37.635 -14.318  -3.649 1.00 . A A .  79 THR HG22 1 1 
        5  8704 1 1  79 THR HG23 H  35.875 -14.287  -3.525 1.00 . A A .  79 THR HG23 1 1 
        5  8705 1 1  79 THR N    N  38.595 -17.155  -2.923 1.00 . A A .  79 THR N    1 1 
        5  8706 1 1  79 THR O    O  35.166 -18.155  -2.568 1.00 . A A .  79 THR O    1 1 
        5  8707 1 1  79 THR OG1  O  35.555 -15.547  -1.492 1.00 . A A .  79 THR OG1  1 1 
        5  8708 1 1  80 SER C    C  34.354 -18.045  -5.445 1.00 . A A .  80 SER C    1 1 
        5  8709 1 1  80 SER CA   C  35.630 -18.848  -5.211 1.00 . A A .  80 SER CA   1 1 
        5  8710 1 1  80 SER CB   C  35.287 -20.208  -4.603 1.00 . A A .  80 SER CB   1 1 
        5  8711 1 1  80 SER H    H  37.417 -17.837  -4.697 1.00 . A A .  80 SER H    1 1 
        5  8712 1 1  80 SER HA   H  36.123 -19.002  -6.160 1.00 . A A .  80 SER HA   1 1 
        5  8713 1 1  80 SER HB2  H  34.385 -20.113  -3.998 1.00 . A A .  80 SER HB2  1 1 
        5  8714 1 1  80 SER HB3  H  35.110 -20.920  -5.395 1.00 . A A .  80 SER HB3  1 1 
        5  8715 1 1  80 SER HG   H  36.068 -21.487  -3.341 1.00 . A A .  80 SER HG   1 1 
        5  8716 1 1  80 SER N    N  36.549 -18.121  -4.342 1.00 . A A .  80 SER N    1 1 
        5  8717 1 1  80 SER O    O  33.255 -18.599  -5.478 1.00 . A A .  80 SER O    1 1 
        5  8718 1 1  80 SER OG   O  36.345 -20.684  -3.789 1.00 . A A .  80 SER OG   1 1 
        5  8719 1 1  81 THR C    C  33.769 -14.644  -6.669 1.00 . A A .  81 THR C    1 1 
        5  8720 1 1  81 THR CA   C  33.369 -15.854  -5.833 1.00 . A A .  81 THR CA   1 1 
        5  8721 1 1  81 THR CB   C  32.760 -15.366  -4.504 1.00 . A A .  81 THR CB   1 1 
        5  8722 1 1  81 THR CG2  C  31.690 -16.331  -4.013 1.00 . A A .  81 THR CG2  1 1 
        5  8723 1 1  81 THR H    H  35.409 -16.351  -5.566 1.00 . A A .  81 THR H    1 1 
        5  8724 1 1  81 THR HA   H  32.615 -16.415  -6.365 1.00 . A A .  81 THR HA   1 1 
        5  8725 1 1  81 THR HB   H  32.305 -14.400  -4.667 1.00 . A A .  81 THR HB   1 1 
        5  8726 1 1  81 THR HG1  H  33.391 -14.987  -2.674 1.00 . A A .  81 THR HG1  1 1 
        5  8727 1 1  81 THR HG21 H  32.041 -16.832  -3.124 1.00 . A A .  81 THR HG21 1 1 
        5  8728 1 1  81 THR HG22 H  31.484 -17.060  -4.782 1.00 . A A .  81 THR HG22 1 1 
        5  8729 1 1  81 THR HG23 H  30.788 -15.782  -3.785 1.00 . A A .  81 THR HG23 1 1 
        5  8730 1 1  81 THR N    N  34.507 -16.735  -5.604 1.00 . A A .  81 THR N    1 1 
        5  8731 1 1  81 THR O    O  34.890 -14.146  -6.565 1.00 . A A .  81 THR O    1 1 
        5  8732 1 1  81 THR OG1  O  33.786 -15.239  -3.513 1.00 . A A .  81 THR OG1  1 1 
        5  8733 1 1  82 LYS C    C  32.322 -11.800  -7.866 1.00 . A A .  82 LYS C    1 1 
        5  8734 1 1  82 LYS CA   C  33.098 -13.018  -8.354 1.00 . A A .  82 LYS CA   1 1 
        5  8735 1 1  82 LYS CB   C  32.716 -13.335  -9.800 1.00 . A A .  82 LYS CB   1 1 
        5  8736 1 1  82 LYS CD   C  30.738 -13.528 -11.336 1.00 . A A .  82 LYS CD   1 1 
        5  8737 1 1  82 LYS CE   C  30.398 -14.798 -12.101 1.00 . A A .  82 LYS CE   1 1 
        5  8738 1 1  82 LYS CG   C  31.293 -13.841  -9.957 1.00 . A A .  82 LYS CG   1 1 
        5  8739 1 1  82 LYS H    H  31.968 -14.611  -7.538 1.00 . A A .  82 LYS H    1 1 
        5  8740 1 1  82 LYS HA   H  34.155 -12.800  -8.309 1.00 . A A .  82 LYS HA   1 1 
        5  8741 1 1  82 LYS HB2  H  32.834 -12.431 -10.398 1.00 . A A .  82 LYS HB2  1 1 
        5  8742 1 1  82 LYS HB3  H  33.388 -14.092 -10.181 1.00 . A A .  82 LYS HB3  1 1 
        5  8743 1 1  82 LYS HD2  H  29.838 -12.923 -11.230 1.00 . A A .  82 LYS HD2  1 1 
        5  8744 1 1  82 LYS HD3  H  31.477 -12.970 -11.894 1.00 . A A .  82 LYS HD3  1 1 
        5  8745 1 1  82 LYS HE2  H  30.277 -15.619 -11.394 1.00 . A A .  82 LYS HE2  1 1 
        5  8746 1 1  82 LYS HE3  H  29.467 -14.646 -12.629 1.00 . A A .  82 LYS HE3  1 1 
        5  8747 1 1  82 LYS HG2  H  31.278 -14.920  -9.802 1.00 . A A .  82 LYS HG2  1 1 
        5  8748 1 1  82 LYS HG3  H  30.669 -13.367  -9.212 1.00 . A A .  82 LYS HG3  1 1 
        5  8749 1 1  82 LYS HZ1  H  31.514 -16.188 -13.192 1.00 . A A .  82 LYS HZ1  1 1 
        5  8750 1 1  82 LYS HZ2  H  32.382 -14.802 -12.757 1.00 . A A .  82 LYS HZ2  1 1 
        5  8751 1 1  82 LYS HZ3  H  31.247 -14.731 -14.009 1.00 . A A .  82 LYS HZ3  1 1 
        5  8752 1 1  82 LYS N    N  32.845 -14.173  -7.499 1.00 . A A .  82 LYS N    1 1 
        5  8753 1 1  82 LYS NZ   N  31.460 -15.154 -13.084 1.00 . A A .  82 LYS NZ   1 1 
        5  8754 1 1  82 LYS O    O  31.322 -11.930  -7.160 1.00 . A A .  82 LYS O    1 1 
        5  8755 1 1  83 SER C    C  31.719  -8.561  -9.073 1.00 . A A .  83 SER C    1 1 
        5  8756 1 1  83 SER CA   C  32.137  -9.373  -7.851 1.00 . A A .  83 SER CA   1 1 
        5  8757 1 1  83 SER CB   C  33.073  -8.543  -6.969 1.00 . A A .  83 SER CB   1 1 
        5  8758 1 1  83 SER H    H  33.588 -10.576  -8.814 1.00 . A A .  83 SER H    1 1 
        5  8759 1 1  83 SER HA   H  31.254  -9.627  -7.283 1.00 . A A .  83 SER HA   1 1 
        5  8760 1 1  83 SER HB2  H  34.107  -8.794  -7.207 1.00 . A A .  83 SER HB2  1 1 
        5  8761 1 1  83 SER HB3  H  32.909  -7.493  -7.163 1.00 . A A .  83 SER HB3  1 1 
        5  8762 1 1  83 SER HG   H  33.280  -8.128  -5.066 1.00 . A A .  83 SER HG   1 1 
        5  8763 1 1  83 SER N    N  32.787 -10.615  -8.251 1.00 . A A .  83 SER N    1 1 
        5  8764 1 1  83 SER O    O  32.366  -8.615 -10.119 1.00 . A A .  83 SER O    1 1 
        5  8765 1 1  83 SER OG   O  32.837  -8.795  -5.595 1.00 . A A .  83 SER OG   1 1 
        5  8766 1 1  84 ARG C    C  29.297  -5.822  -9.489 1.00 . A A .  84 ARG C    1 1 
        5  8767 1 1  84 ARG CA   C  30.126  -6.986 -10.024 1.00 . A A .  84 ARG CA   1 1 
        5  8768 1 1  84 ARG CB   C  29.280  -7.831 -10.978 1.00 . A A .  84 ARG CB   1 1 
        5  8769 1 1  84 ARG CD   C  28.771  -6.149 -12.774 1.00 . A A .  84 ARG CD   1 1 
        5  8770 1 1  84 ARG CG   C  28.192  -7.043 -11.689 1.00 . A A .  84 ARG CG   1 1 
        5  8771 1 1  84 ARG CZ   C  27.981  -7.358 -14.765 1.00 . A A .  84 ARG CZ   1 1 
        5  8772 1 1  84 ARG H    H  30.159  -7.807  -8.073 1.00 . A A .  84 ARG H    1 1 
        5  8773 1 1  84 ARG HA   H  30.974  -6.591 -10.565 1.00 . A A .  84 ARG HA   1 1 
        5  8774 1 1  84 ARG HB2  H  29.936  -8.274 -11.727 1.00 . A A .  84 ARG HB2  1 1 
        5  8775 1 1  84 ARG HB3  H  28.811  -8.625 -10.417 1.00 . A A .  84 ARG HB3  1 1 
        5  8776 1 1  84 ARG HD2  H  28.748  -5.114 -12.432 1.00 . A A .  84 ARG HD2  1 1 
        5  8777 1 1  84 ARG HD3  H  29.797  -6.439 -12.951 1.00 . A A .  84 ARG HD3  1 1 
        5  8778 1 1  84 ARG HE   H  27.534  -5.463 -14.329 1.00 . A A .  84 ARG HE   1 1 
        5  8779 1 1  84 ARG HG2  H  27.484  -7.738 -12.140 1.00 . A A .  84 ARG HG2  1 1 
        5  8780 1 1  84 ARG HG3  H  27.675  -6.428 -10.967 1.00 . A A .  84 ARG HG3  1 1 
        5  8781 1 1  84 ARG HH11 H  29.164  -8.434 -13.531 1.00 . A A .  84 ARG HH11 1 1 
        5  8782 1 1  84 ARG HH12 H  28.600  -9.273 -14.938 1.00 . A A .  84 ARG HH12 1 1 
        5  8783 1 1  84 ARG HH21 H  26.785  -6.558 -16.185 1.00 . A A .  84 ARG HH21 1 1 
        5  8784 1 1  84 ARG HH22 H  27.247  -8.204 -16.447 1.00 . A A .  84 ARG HH22 1 1 
        5  8785 1 1  84 ARG N    N  30.632  -7.809  -8.932 1.00 . A A .  84 ARG N    1 1 
        5  8786 1 1  84 ARG NE   N  28.024  -6.254 -14.026 1.00 . A A .  84 ARG NE   1 1 
        5  8787 1 1  84 ARG NH1  N  28.636  -8.444 -14.380 1.00 . A A .  84 ARG NH1  1 1 
        5  8788 1 1  84 ARG NH2  N  27.279  -7.375 -15.891 1.00 . A A .  84 ARG NH2  1 1 
        5  8789 1 1  84 ARG O    O  28.615  -5.946  -8.471 1.00 . A A .  84 ARG O    1 1 
        5  8790 1 1  85 THR C    C  27.679  -3.036 -10.881 1.00 . A A .  85 THR C    1 1 
        5  8791 1 1  85 THR CA   C  28.621  -3.501  -9.775 1.00 . A A .  85 THR CA   1 1 
        5  8792 1 1  85 THR CB   C  29.569  -2.346  -9.403 1.00 . A A .  85 THR CB   1 1 
        5  8793 1 1  85 THR CG2  C  29.714  -2.228  -7.895 1.00 . A A .  85 THR CG2  1 1 
        5  8794 1 1  85 THR H    H  29.923  -4.651 -10.984 1.00 . A A .  85 THR H    1 1 
        5  8795 1 1  85 THR HA   H  28.036  -3.755  -8.902 1.00 . A A .  85 THR HA   1 1 
        5  8796 1 1  85 THR HB   H  29.155  -1.423  -9.785 1.00 . A A .  85 THR HB   1 1 
        5  8797 1 1  85 THR HG1  H  30.977  -1.951 -10.729 1.00 . A A .  85 THR HG1  1 1 
        5  8798 1 1  85 THR HG21 H  30.284  -1.343  -7.656 1.00 . A A .  85 THR HG21 1 1 
        5  8799 1 1  85 THR HG22 H  30.224  -3.099  -7.512 1.00 . A A .  85 THR HG22 1 1 
        5  8800 1 1  85 THR HG23 H  28.734  -2.157  -7.443 1.00 . A A .  85 THR HG23 1 1 
        5  8801 1 1  85 THR N    N  29.363  -4.688 -10.182 1.00 . A A .  85 THR N    1 1 
        5  8802 1 1  85 THR O    O  28.108  -2.780 -12.007 1.00 . A A .  85 THR O    1 1 
        5  8803 1 1  85 THR OG1  O  30.855  -2.559  -9.995 1.00 . A A .  85 THR OG1  1 1 
        5  8804 1 1  86 GLY C    C  24.992  -1.050 -11.323 1.00 . A A .  86 GLY C    1 1 
        5  8805 1 1  86 GLY CA   C  25.414  -2.491 -11.530 1.00 . A A .  86 GLY CA   1 1 
        5  8806 1 1  86 GLY H    H  26.112  -3.143  -9.641 1.00 . A A .  86 GLY H    1 1 
        5  8807 1 1  86 GLY HA2  H  25.838  -2.594 -12.519 1.00 . A A .  86 GLY HA2  1 1 
        5  8808 1 1  86 GLY HA3  H  24.543  -3.125 -11.455 1.00 . A A .  86 GLY HA3  1 1 
        5  8809 1 1  86 GLY N    N  26.396  -2.927 -10.553 1.00 . A A .  86 GLY N    1 1 
        5  8810 1 1  86 GLY O    O  24.795  -0.609 -10.191 1.00 . A A .  86 GLY O    1 1 
        5  8811 1 1  87 THR C    C  22.933   1.224 -12.322 1.00 . A A .  87 THR C    1 1 
        5  8812 1 1  87 THR CA   C  24.450   1.087 -12.356 1.00 . A A .  87 THR CA   1 1 
        5  8813 1 1  87 THR CB   C  25.001   1.885 -13.551 1.00 . A A .  87 THR CB   1 1 
        5  8814 1 1  87 THR CG2  C  24.556   3.338 -13.484 1.00 . A A .  87 THR CG2  1 1 
        5  8815 1 1  87 THR H    H  25.021  -0.723 -13.294 1.00 . A A .  87 THR H    1 1 
        5  8816 1 1  87 THR HA   H  24.860   1.508 -11.448 1.00 . A A .  87 THR HA   1 1 
        5  8817 1 1  87 THR HB   H  24.617   1.448 -14.463 1.00 . A A .  87 THR HB   1 1 
        5  8818 1 1  87 THR HG1  H  26.789   2.489 -12.984 1.00 . A A .  87 THR HG1  1 1 
        5  8819 1 1  87 THR HG21 H  23.674   3.472 -14.091 1.00 . A A .  87 THR HG21 1 1 
        5  8820 1 1  87 THR HG22 H  25.347   3.975 -13.852 1.00 . A A .  87 THR HG22 1 1 
        5  8821 1 1  87 THR HG23 H  24.332   3.598 -12.459 1.00 . A A .  87 THR HG23 1 1 
        5  8822 1 1  87 THR N    N  24.850  -0.313 -12.420 1.00 . A A .  87 THR N    1 1 
        5  8823 1 1  87 THR O    O  22.214   0.432 -12.934 1.00 . A A .  87 THR O    1 1 
        5  8824 1 1  87 THR OG1  O  26.431   1.819 -13.568 1.00 . A A .  87 THR OG1  1 1 
        5  8825 1 1  88 LEU C    C  20.487   3.197 -12.729 1.00 . A A .  88 LEU C    1 1 
        5  8826 1 1  88 LEU CA   C  21.015   2.473 -11.495 1.00 . A A .  88 LEU CA   1 1 
        5  8827 1 1  88 LEU CB   C  20.713   3.295 -10.240 1.00 . A A .  88 LEU CB   1 1 
        5  8828 1 1  88 LEU CD1  C  18.517   2.261  -9.616 1.00 . A A .  88 LEU CD1  1 1 
        5  8829 1 1  88 LEU CD2  C  19.084   4.562  -8.816 1.00 . A A .  88 LEU CD2  1 1 
        5  8830 1 1  88 LEU CG   C  19.234   3.559  -9.950 1.00 . A A .  88 LEU CG   1 1 
        5  8831 1 1  88 LEU H    H  23.071   2.830 -11.140 1.00 . A A .  88 LEU H    1 1 
        5  8832 1 1  88 LEU HA   H  20.523   1.516 -11.414 1.00 . A A .  88 LEU HA   1 1 
        5  8833 1 1  88 LEU HB2  H  21.144   2.781  -9.381 1.00 . A A .  88 LEU HB2  1 1 
        5  8834 1 1  88 LEU HB3  H  21.206   4.252 -10.346 1.00 . A A .  88 LEU HB3  1 1 
        5  8835 1 1  88 LEU HD11 H  18.974   1.447 -10.157 1.00 . A A .  88 LEU HD11 1 1 
        5  8836 1 1  88 LEU HD12 H  17.477   2.341  -9.896 1.00 . A A .  88 LEU HD12 1 1 
        5  8837 1 1  88 LEU HD13 H  18.589   2.073  -8.554 1.00 . A A .  88 LEU HD13 1 1 
        5  8838 1 1  88 LEU HD21 H  19.964   5.186  -8.768 1.00 . A A .  88 LEU HD21 1 1 
        5  8839 1 1  88 LEU HD22 H  18.964   4.034  -7.882 1.00 . A A .  88 LEU HD22 1 1 
        5  8840 1 1  88 LEU HD23 H  18.215   5.178  -8.995 1.00 . A A .  88 LEU HD23 1 1 
        5  8841 1 1  88 LEU HG   H  18.769   3.978 -10.832 1.00 . A A .  88 LEU HG   1 1 
        5  8842 1 1  88 LEU N    N  22.450   2.232 -11.606 1.00 . A A .  88 LEU N    1 1 
        5  8843 1 1  88 LEU O    O  20.924   4.302 -13.047 1.00 . A A .  88 LEU O    1 1 
        5  8844 1 1  89 GLN C    C  17.648   3.865 -14.290 1.00 . A A .  89 GLN C    1 1 
        5  8845 1 1  89 GLN CA   C  18.955   3.148 -14.619 1.00 . A A .  89 GLN CA   1 1 
        5  8846 1 1  89 GLN CB   C  18.705   2.064 -15.669 1.00 . A A .  89 GLN CB   1 1 
        5  8847 1 1  89 GLN CD   C  19.995   0.849 -17.470 1.00 . A A .  89 GLN CD   1 1 
        5  8848 1 1  89 GLN CG   C  19.590   2.193 -16.898 1.00 . A A .  89 GLN CG   1 1 
        5  8849 1 1  89 GLN H    H  19.236   1.685 -13.116 1.00 . A A .  89 GLN H    1 1 
        5  8850 1 1  89 GLN HA   H  19.654   3.866 -15.016 1.00 . A A .  89 GLN HA   1 1 
        5  8851 1 1  89 GLN HB2  H  18.880   1.089 -15.213 1.00 . A A .  89 GLN HB2  1 1 
        5  8852 1 1  89 GLN HB3  H  17.674   2.119 -15.987 1.00 . A A .  89 GLN HB3  1 1 
        5  8853 1 1  89 GLN HE21 H  20.246   1.660 -19.268 1.00 . A A .  89 GLN HE21 1 1 
        5  8854 1 1  89 GLN HE22 H  20.565  -0.034 -19.156 1.00 . A A .  89 GLN HE22 1 1 
        5  8855 1 1  89 GLN HG2  H  19.053   2.755 -17.663 1.00 . A A .  89 GLN HG2  1 1 
        5  8856 1 1  89 GLN HG3  H  20.483   2.737 -16.627 1.00 . A A .  89 GLN HG3  1 1 
        5  8857 1 1  89 GLN N    N  19.543   2.564 -13.419 1.00 . A A .  89 GLN N    1 1 
        5  8858 1 1  89 GLN NE2  N  20.299   0.821 -18.762 1.00 . A A .  89 GLN NE2  1 1 
        5  8859 1 1  89 GLN O    O  17.598   5.094 -14.238 1.00 . A A .  89 GLN O    1 1 
        5  8860 1 1  89 GLN OE1  O  20.036  -0.155 -16.757 1.00 . A A .  89 GLN OE1  1 1 
        5  8861 1 1  90 LYS C    C  14.532   2.745 -12.776 1.00 . A A .  90 LYS C    1 1 
        5  8862 1 1  90 LYS CA   C  15.286   3.648 -13.747 1.00 . A A .  90 LYS CA   1 1 
        5  8863 1 1  90 LYS CB   C  14.461   3.844 -15.022 1.00 . A A .  90 LYS CB   1 1 
        5  8864 1 1  90 LYS CD   C  14.796   1.515 -15.900 1.00 . A A .  90 LYS CD   1 1 
        5  8865 1 1  90 LYS CE   C  13.821   0.850 -16.861 1.00 . A A .  90 LYS CE   1 1 
        5  8866 1 1  90 LYS CG   C  14.938   3.000 -16.190 1.00 . A A .  90 LYS CG   1 1 
        5  8867 1 1  90 LYS H    H  16.694   2.116 -14.128 1.00 . A A .  90 LYS H    1 1 
        5  8868 1 1  90 LYS HA   H  15.443   4.608 -13.279 1.00 . A A .  90 LYS HA   1 1 
        5  8869 1 1  90 LYS HB2  H  13.423   3.591 -14.808 1.00 . A A .  90 LYS HB2  1 1 
        5  8870 1 1  90 LYS HB3  H  14.511   4.883 -15.312 1.00 . A A .  90 LYS HB3  1 1 
        5  8871 1 1  90 LYS HD2  H  15.772   1.038 -15.994 1.00 . A A .  90 LYS HD2  1 1 
        5  8872 1 1  90 LYS HD3  H  14.435   1.387 -14.889 1.00 . A A .  90 LYS HD3  1 1 
        5  8873 1 1  90 LYS HE2  H  14.198   0.953 -17.878 1.00 . A A .  90 LYS HE2  1 1 
        5  8874 1 1  90 LYS HE3  H  13.752  -0.200 -16.614 1.00 . A A .  90 LYS HE3  1 1 
        5  8875 1 1  90 LYS HG2  H  14.352   3.249 -17.074 1.00 . A A .  90 LYS HG2  1 1 
        5  8876 1 1  90 LYS HG3  H  15.979   3.220 -16.382 1.00 . A A .  90 LYS HG3  1 1 
        5  8877 1 1  90 LYS HZ1  H  11.747   0.714 -16.654 1.00 . A A .  90 LYS HZ1  1 1 
        5  8878 1 1  90 LYS HZ2  H  12.254   1.979 -17.655 1.00 . A A .  90 LYS HZ2  1 1 
        5  8879 1 1  90 LYS HZ3  H  12.413   2.114 -15.976 1.00 . A A .  90 LYS HZ3  1 1 
        5  8880 1 1  90 LYS N    N  16.593   3.089 -14.071 1.00 . A A .  90 LYS N    1 1 
        5  8881 1 1  90 LYS NZ   N  12.464   1.456 -16.781 1.00 . A A .  90 LYS NZ   1 1 
        5  8882 1 1  90 LYS O    O  14.836   1.558 -12.653 1.00 . A A .  90 LYS O    1 1 
        5  8883 1 1  91 ALA C    C  11.280   2.538 -11.536 1.00 . A A .  91 ALA C    1 1 
        5  8884 1 1  91 ALA CA   C  12.750   2.558 -11.130 1.00 . A A .  91 ALA CA   1 1 
        5  8885 1 1  91 ALA CB   C  12.906   3.143  -9.734 1.00 . A A .  91 ALA CB   1 1 
        5  8886 1 1  91 ALA H    H  13.353   4.263 -12.229 1.00 . A A .  91 ALA H    1 1 
        5  8887 1 1  91 ALA HA   H  13.121   1.543 -11.112 1.00 . A A .  91 ALA HA   1 1 
        5  8888 1 1  91 ALA HB1  H  12.499   2.454  -9.008 1.00 . A A .  91 ALA HB1  1 1 
        5  8889 1 1  91 ALA HB2  H  13.953   3.308  -9.529 1.00 . A A .  91 ALA HB2  1 1 
        5  8890 1 1  91 ALA HB3  H  12.375   4.082  -9.676 1.00 . A A .  91 ALA HB3  1 1 
        5  8891 1 1  91 ALA N    N  13.549   3.313 -12.088 1.00 . A A .  91 ALA N    1 1 
        5  8892 1 1  91 ALA O    O  10.657   3.588 -11.702 1.00 . A A .  91 ALA O    1 1 
        5  8893 1 1  92 LEU C    C   8.478   0.783 -10.883 1.00 . A A .  92 LEU C    1 1 
        5  8894 1 1  92 LEU CA   C   9.332   1.182 -12.082 1.00 . A A .  92 LEU CA   1 1 
        5  8895 1 1  92 LEU CB   C   9.204   0.132 -13.187 1.00 . A A .  92 LEU CB   1 1 
        5  8896 1 1  92 LEU CD1  C   9.280  -2.335 -13.616 1.00 . A A .  92 LEU CD1  1 1 
        5  8897 1 1  92 LEU CD2  C  11.402  -1.013 -13.568 1.00 . A A .  92 LEU CD2  1 1 
        5  8898 1 1  92 LEU CG   C  10.003  -1.156 -12.986 1.00 . A A .  92 LEU CG   1 1 
        5  8899 1 1  92 LEU H    H  11.277   0.539 -11.549 1.00 . A A .  92 LEU H    1 1 
        5  8900 1 1  92 LEU HA   H   8.985   2.133 -12.456 1.00 . A A .  92 LEU HA   1 1 
        5  8901 1 1  92 LEU HB2  H   8.151  -0.130 -13.290 1.00 . A A .  92 LEU HB2  1 1 
        5  8902 1 1  92 LEU HB3  H   9.534   0.586 -14.112 1.00 . A A .  92 LEU HB3  1 1 
        5  8903 1 1  92 LEU HD11 H   9.967  -3.161 -13.730 1.00 . A A .  92 LEU HD11 1 1 
        5  8904 1 1  92 LEU HD12 H   8.899  -2.048 -14.585 1.00 . A A .  92 LEU HD12 1 1 
        5  8905 1 1  92 LEU HD13 H   8.458  -2.635 -12.982 1.00 . A A .  92 LEU HD13 1 1 
        5  8906 1 1  92 LEU HD21 H  11.446  -1.510 -14.525 1.00 . A A .  92 LEU HD21 1 1 
        5  8907 1 1  92 LEU HD22 H  12.118  -1.460 -12.895 1.00 . A A .  92 LEU HD22 1 1 
        5  8908 1 1  92 LEU HD23 H  11.634   0.035 -13.694 1.00 . A A .  92 LEU HD23 1 1 
        5  8909 1 1  92 LEU HG   H  10.098  -1.351 -11.927 1.00 . A A .  92 LEU HG   1 1 
        5  8910 1 1  92 LEU N    N  10.731   1.339 -11.695 1.00 . A A .  92 LEU N    1 1 
        5  8911 1 1  92 LEU O    O   7.312   1.167 -10.784 1.00 . A A .  92 LEU O    1 1 
        5  8912 1 1  93 PHE C    C   8.595   0.516  -7.615 1.00 . A A .  93 PHE C    1 1 
        5  8913 1 1  93 PHE CA   C   8.357  -0.439  -8.782 1.00 . A A .  93 PHE CA   1 1 
        5  8914 1 1  93 PHE CB   C   8.805  -1.851  -8.400 1.00 . A A .  93 PHE CB   1 1 
        5  8915 1 1  93 PHE CD1  C   7.980  -2.085  -6.042 1.00 . A A .  93 PHE CD1  1 1 
        5  8916 1 1  93 PHE CD2  C   7.061  -3.519  -7.711 1.00 . A A .  93 PHE CD2  1 1 
        5  8917 1 1  93 PHE CE1  C   7.176  -2.677  -5.086 1.00 . A A .  93 PHE CE1  1 1 
        5  8918 1 1  93 PHE CE2  C   6.255  -4.114  -6.760 1.00 . A A .  93 PHE CE2  1 1 
        5  8919 1 1  93 PHE CG   C   7.931  -2.498  -7.363 1.00 . A A .  93 PHE CG   1 1 
        5  8920 1 1  93 PHE CZ   C   6.314  -3.694  -5.445 1.00 . A A .  93 PHE CZ   1 1 
        5  8921 1 1  93 PHE H    H   9.996  -0.262 -10.110 1.00 . A A .  93 PHE H    1 1 
        5  8922 1 1  93 PHE HA   H   7.303  -0.455  -9.010 1.00 . A A .  93 PHE HA   1 1 
        5  8923 1 1  93 PHE HB2  H   8.804  -2.472  -9.296 1.00 . A A .  93 PHE HB2  1 1 
        5  8924 1 1  93 PHE HB3  H   9.811  -1.807  -8.009 1.00 . A A .  93 PHE HB3  1 1 
        5  8925 1 1  93 PHE HD1  H   8.654  -1.289  -5.761 1.00 . A A .  93 PHE HD1  1 1 
        5  8926 1 1  93 PHE HD2  H   7.016  -3.850  -8.739 1.00 . A A .  93 PHE HD2  1 1 
        5  8927 1 1  93 PHE HE1  H   7.224  -2.345  -4.059 1.00 . A A .  93 PHE HE1  1 1 
        5  8928 1 1  93 PHE HE2  H   5.583  -4.910  -7.043 1.00 . A A .  93 PHE HE2  1 1 
        5  8929 1 1  93 PHE HZ   H   5.685  -4.158  -4.700 1.00 . A A .  93 PHE HZ   1 1 
        5  8930 1 1  93 PHE N    N   9.065   0.011  -9.975 1.00 . A A .  93 PHE N    1 1 
        5  8931 1 1  93 PHE O    O   9.720   0.953  -7.377 1.00 . A A .  93 PHE O    1 1 
        5  8932 1 1  94 ASN C    C   8.637   1.231  -4.736 1.00 . A A .  94 ASN C    1 1 
        5  8933 1 1  94 ASN CA   C   7.617   1.739  -5.751 1.00 . A A .  94 ASN CA   1 1 
        5  8934 1 1  94 ASN CB   C   6.249   1.891  -5.084 1.00 . A A .  94 ASN CB   1 1 
        5  8935 1 1  94 ASN CG   C   5.647   3.264  -5.307 1.00 . A A .  94 ASN CG   1 1 
        5  8936 1 1  94 ASN H    H   6.656   0.454  -7.131 1.00 . A A .  94 ASN H    1 1 
        5  8937 1 1  94 ASN HA   H   7.939   2.702  -6.116 1.00 . A A .  94 ASN HA   1 1 
        5  8938 1 1  94 ASN HB2  H   5.573   1.139  -5.490 1.00 . A A .  94 ASN HB2  1 1 
        5  8939 1 1  94 ASN HB3  H   6.352   1.732  -4.022 1.00 . A A .  94 ASN HB3  1 1 
        5  8940 1 1  94 ASN HD21 H   4.709   2.616  -6.938 1.00 . A A .  94 ASN HD21 1 1 
        5  8941 1 1  94 ASN HD22 H   4.456   4.276  -6.535 1.00 . A A .  94 ASN HD22 1 1 
        5  8942 1 1  94 ASN N    N   7.526   0.834  -6.893 1.00 . A A .  94 ASN N    1 1 
        5  8943 1 1  94 ASN ND2  N   4.857   3.399  -6.367 1.00 . A A .  94 ASN ND2  1 1 
        5  8944 1 1  94 ASN O    O   8.348   0.332  -3.947 1.00 . A A .  94 ASN O    1 1 
        5  8945 1 1  94 ASN OD1  O   5.889   4.193  -4.536 1.00 . A A .  94 ASN OD1  1 1 
        5  8946 1 1  95 VAL C    C  12.116   2.320  -4.004 1.00 . A A .  95 VAL C    1 1 
        5  8947 1 1  95 VAL CA   C  10.893   1.424  -3.842 1.00 . A A .  95 VAL CA   1 1 
        5  8948 1 1  95 VAL CB   C  11.314  -0.042  -4.061 1.00 . A A .  95 VAL CB   1 1 
        5  8949 1 1  95 VAL CG1  C  11.991  -0.208  -5.413 1.00 . A A .  95 VAL CG1  1 1 
        5  8950 1 1  95 VAL CG2  C  12.227  -0.508  -2.937 1.00 . A A .  95 VAL CG2  1 1 
        5  8951 1 1  95 VAL H    H  10.001   2.526  -5.414 1.00 . A A .  95 VAL H    1 1 
        5  8952 1 1  95 VAL HA   H  10.516   1.522  -2.835 1.00 . A A .  95 VAL HA   1 1 
        5  8953 1 1  95 VAL HB   H  10.423  -0.655  -4.051 1.00 . A A .  95 VAL HB   1 1 
        5  8954 1 1  95 VAL HG11 H  13.027  -0.475  -5.266 1.00 . A A .  95 VAL HG11 1 1 
        5  8955 1 1  95 VAL HG12 H  11.493  -0.987  -5.972 1.00 . A A .  95 VAL HG12 1 1 
        5  8956 1 1  95 VAL HG13 H  11.933   0.721  -5.960 1.00 . A A .  95 VAL HG13 1 1 
        5  8957 1 1  95 VAL HG21 H  13.252  -0.292  -3.194 1.00 . A A .  95 VAL HG21 1 1 
        5  8958 1 1  95 VAL HG22 H  11.968   0.011  -2.026 1.00 . A A .  95 VAL HG22 1 1 
        5  8959 1 1  95 VAL HG23 H  12.107  -1.572  -2.792 1.00 . A A .  95 VAL HG23 1 1 
        5  8960 1 1  95 VAL N    N   9.831   1.815  -4.761 1.00 . A A .  95 VAL N    1 1 
        5  8961 1 1  95 VAL O    O  12.389   2.824  -5.092 1.00 . A A .  95 VAL O    1 1 
        5  8962 1 1  96 GLU C    C  15.258   2.553  -3.395 1.00 . A A .  96 GLU C    1 1 
        5  8963 1 1  96 GLU CA   C  14.043   3.351  -2.932 1.00 . A A .  96 GLU CA   1 1 
        5  8964 1 1  96 GLU CB   C  14.304   3.938  -1.543 1.00 . A A .  96 GLU CB   1 1 
        5  8965 1 1  96 GLU CD   C  15.193   6.240  -1.006 1.00 . A A .  96 GLU CD   1 1 
        5  8966 1 1  96 GLU CG   C  15.525   4.840  -1.484 1.00 . A A .  96 GLU CG   1 1 
        5  8967 1 1  96 GLU H    H  12.579   2.085  -2.072 1.00 . A A .  96 GLU H    1 1 
        5  8968 1 1  96 GLU HA   H  13.871   4.158  -3.627 1.00 . A A .  96 GLU HA   1 1 
        5  8969 1 1  96 GLU HB2  H  13.430   4.511  -1.235 1.00 . A A .  96 GLU HB2  1 1 
        5  8970 1 1  96 GLU HB3  H  14.450   3.126  -0.844 1.00 . A A .  96 GLU HB3  1 1 
        5  8971 1 1  96 GLU HG2  H  16.258   4.400  -0.807 1.00 . A A .  96 GLU HG2  1 1 
        5  8972 1 1  96 GLU HG3  H  15.956   4.907  -2.472 1.00 . A A .  96 GLU HG3  1 1 
        5  8973 1 1  96 GLU N    N  12.849   2.513  -2.911 1.00 . A A .  96 GLU N    1 1 
        5  8974 1 1  96 GLU O    O  15.710   1.634  -2.712 1.00 . A A .  96 GLU O    1 1 
        5  8975 1 1  96 GLU OE1  O  14.141   6.773  -1.418 1.00 . A A .  96 GLU OE1  1 1 
        5  8976 1 1  96 GLU OE2  O  15.984   6.802  -0.218 1.00 . A A .  96 GLU OE2  1 1 
        5  8977 1 1  97 CYS C    C  18.190   3.104  -5.016 1.00 . A A .  97 CYS C    1 1 
        5  8978 1 1  97 CYS CA   C  16.944   2.229  -5.121 1.00 . A A .  97 CYS CA   1 1 
        5  8979 1 1  97 CYS CB   C  16.690   1.859  -6.584 1.00 . A A .  97 CYS CB   1 1 
        5  8980 1 1  97 CYS H    H  15.378   3.652  -5.062 1.00 . A A .  97 CYS H    1 1 
        5  8981 1 1  97 CYS HA   H  17.104   1.326  -4.553 1.00 . A A .  97 CYS HA   1 1 
        5  8982 1 1  97 CYS HB2  H  16.511   2.774  -7.148 1.00 . A A .  97 CYS HB2  1 1 
        5  8983 1 1  97 CYS HB3  H  17.568   1.375  -6.982 1.00 . A A .  97 CYS HB3  1 1 
        5  8984 1 1  97 CYS HG   H  14.640   0.557  -5.671 1.00 . A A .  97 CYS HG   1 1 
        5  8985 1 1  97 CYS N    N  15.782   2.910  -4.563 1.00 . A A .  97 CYS N    1 1 
        5  8986 1 1  97 CYS O    O  18.111   4.328  -5.116 1.00 . A A .  97 CYS O    1 1 
        5  8987 1 1  97 CYS SG   S  15.276   0.736  -6.832 1.00 . A A .  97 CYS SG   1 1 
        5  8988 1 1  98 GLN C    C  21.213   3.442  -6.067 1.00 . A A .  98 GLN C    1 1 
        5  8989 1 1  98 GLN CA   C  20.600   3.185  -4.694 1.00 . A A .  98 GLN CA   1 1 
        5  8990 1 1  98 GLN CB   C  21.580   2.396  -3.824 1.00 . A A .  98 GLN CB   1 1 
        5  8991 1 1  98 GLN CD   C  20.930   1.642  -1.502 1.00 . A A .  98 GLN CD   1 1 
        5  8992 1 1  98 GLN CG   C  21.512   2.758  -2.348 1.00 . A A .  98 GLN CG   1 1 
        5  8993 1 1  98 GLN H    H  19.336   1.490  -4.742 1.00 . A A .  98 GLN H    1 1 
        5  8994 1 1  98 GLN HA   H  20.397   4.135  -4.221 1.00 . A A .  98 GLN HA   1 1 
        5  8995 1 1  98 GLN HB2  H  21.368   1.333  -3.934 1.00 . A A .  98 GLN HB2  1 1 
        5  8996 1 1  98 GLN HB3  H  22.585   2.587  -4.172 1.00 . A A .  98 GLN HB3  1 1 
        5  8997 1 1  98 GLN HE21 H  19.124   1.970  -2.266 1.00 . A A .  98 GLN HE21 1 1 
        5  8998 1 1  98 GLN HE22 H  19.227   0.699  -1.102 1.00 . A A .  98 GLN HE22 1 1 
        5  8999 1 1  98 GLN HG2  H  22.518   2.984  -1.993 1.00 . A A .  98 GLN HG2  1 1 
        5  9000 1 1  98 GLN HG3  H  20.895   3.636  -2.235 1.00 . A A .  98 GLN HG3  1 1 
        5  9001 1 1  98 GLN N    N  19.339   2.465  -4.813 1.00 . A A .  98 GLN N    1 1 
        5  9002 1 1  98 GLN NE2  N  19.629   1.414  -1.637 1.00 . A A .  98 GLN NE2  1 1 
        5  9003 1 1  98 GLN O    O  20.961   2.702  -7.017 1.00 . A A .  98 GLN O    1 1 
        5  9004 1 1  98 GLN OE1  O  21.642   0.993  -0.736 1.00 . A A .  98 GLN OE1  1 1 
        5  9005 1 1  99 GLN C    C  23.399   3.650  -8.011 1.00 . A A .  99 GLN C    1 1 
        5  9006 1 1  99 GLN CA   C  22.665   4.849  -7.420 1.00 . A A .  99 GLN CA   1 1 
        5  9007 1 1  99 GLN CB   C  23.643   6.006  -7.207 1.00 . A A .  99 GLN CB   1 1 
        5  9008 1 1  99 GLN CD   C  23.308   8.053  -8.652 1.00 . A A .  99 GLN CD   1 1 
        5  9009 1 1  99 GLN CG   C  24.023   6.726  -8.492 1.00 . A A .  99 GLN CG   1 1 
        5  9010 1 1  99 GLN H    H  22.179   5.048  -5.370 1.00 . A A .  99 GLN H    1 1 
        5  9011 1 1  99 GLN HA   H  21.898   5.162  -8.111 1.00 . A A .  99 GLN HA   1 1 
        5  9012 1 1  99 GLN HB2  H  23.190   6.725  -6.525 1.00 . A A .  99 GLN HB2  1 1 
        5  9013 1 1  99 GLN HB3  H  24.545   5.621  -6.755 1.00 . A A .  99 GLN HB3  1 1 
        5  9014 1 1  99 GLN HE21 H  24.556   8.578 -10.107 1.00 . A A .  99 GLN HE21 1 1 
        5  9015 1 1  99 GLN HE22 H  23.338   9.737  -9.708 1.00 . A A .  99 GLN HE22 1 1 
        5  9016 1 1  99 GLN HG2  H  25.098   6.902  -8.492 1.00 . A A .  99 GLN HG2  1 1 
        5  9017 1 1  99 GLN HG3  H  23.772   6.094  -9.331 1.00 . A A .  99 GLN HG3  1 1 
        5  9018 1 1  99 GLN N    N  22.018   4.495  -6.162 1.00 . A A .  99 GLN N    1 1 
        5  9019 1 1  99 GLN NE2  N  23.782   8.872  -9.582 1.00 . A A .  99 GLN NE2  1 1 
        5  9020 1 1  99 GLN O    O  23.420   3.460  -9.228 1.00 . A A .  99 GLN O    1 1 
        5  9021 1 1  99 GLN OE1  O  22.339   8.337  -7.947 1.00 . A A .  99 GLN OE1  1 1 
        5  9022 1 1 100 THR C    C  24.662   0.553  -6.536 1.00 . A A . 100 THR C    1 1 
        5  9023 1 1 100 THR CA   C  24.737   1.664  -7.578 1.00 . A A . 100 THR CA   1 1 
        5  9024 1 1 100 THR CB   C  26.216   1.995  -7.853 1.00 . A A . 100 THR CB   1 1 
        5  9025 1 1 100 THR CG2  C  26.780   1.091  -8.939 1.00 . A A . 100 THR CG2  1 1 
        5  9026 1 1 100 THR H    H  23.947   3.049  -6.186 1.00 . A A . 100 THR H    1 1 
        5  9027 1 1 100 THR HA   H  24.291   1.313  -8.498 1.00 . A A . 100 THR HA   1 1 
        5  9028 1 1 100 THR HB   H  26.779   1.836  -6.946 1.00 . A A . 100 THR HB   1 1 
        5  9029 1 1 100 THR HG1  H  26.817   3.852  -7.569 1.00 . A A . 100 THR HG1  1 1 
        5  9030 1 1 100 THR HG21 H  26.318   1.334  -9.884 1.00 . A A . 100 THR HG21 1 1 
        5  9031 1 1 100 THR HG22 H  26.574   0.061  -8.693 1.00 . A A . 100 THR HG22 1 1 
        5  9032 1 1 100 THR HG23 H  27.847   1.239  -9.013 1.00 . A A . 100 THR HG23 1 1 
        5  9033 1 1 100 THR N    N  24.001   2.844  -7.142 1.00 . A A . 100 THR N    1 1 
        5  9034 1 1 100 THR O    O  24.575   0.818  -5.337 1.00 . A A . 100 THR O    1 1 
        5  9035 1 1 100 THR OG1  O  26.346   3.365  -8.250 1.00 . A A . 100 THR OG1  1 1 
        5  9036 1 1 101 VAL C    C  25.634  -2.915  -6.526 1.00 . A A . 101 VAL C    1 1 
        5  9037 1 1 101 VAL CA   C  24.634  -1.843  -6.111 1.00 . A A . 101 VAL CA   1 1 
        5  9038 1 1 101 VAL CB   C  23.221  -2.457  -6.084 1.00 . A A . 101 VAL CB   1 1 
        5  9039 1 1 101 VAL CG1  C  22.189  -1.404  -5.715 1.00 . A A . 101 VAL CG1  1 1 
        5  9040 1 1 101 VAL CG2  C  22.891  -3.090  -7.428 1.00 . A A . 101 VAL CG2  1 1 
        5  9041 1 1 101 VAL H    H  24.766  -0.839  -7.969 1.00 . A A . 101 VAL H    1 1 
        5  9042 1 1 101 VAL HA   H  24.876  -1.506  -5.112 1.00 . A A . 101 VAL HA   1 1 
        5  9043 1 1 101 VAL HB   H  23.201  -3.231  -5.331 1.00 . A A . 101 VAL HB   1 1 
        5  9044 1 1 101 VAL HG11 H  22.548  -0.824  -4.878 1.00 . A A . 101 VAL HG11 1 1 
        5  9045 1 1 101 VAL HG12 H  22.018  -0.752  -6.559 1.00 . A A . 101 VAL HG12 1 1 
        5  9046 1 1 101 VAL HG13 H  21.262  -1.889  -5.443 1.00 . A A . 101 VAL HG13 1 1 
        5  9047 1 1 101 VAL HG21 H  23.651  -2.825  -8.147 1.00 . A A . 101 VAL HG21 1 1 
        5  9048 1 1 101 VAL HG22 H  22.857  -4.164  -7.320 1.00 . A A . 101 VAL HG22 1 1 
        5  9049 1 1 101 VAL HG23 H  21.931  -2.732  -7.769 1.00 . A A . 101 VAL HG23 1 1 
        5  9050 1 1 101 VAL N    N  24.696  -0.691  -7.002 1.00 . A A . 101 VAL N    1 1 
        5  9051 1 1 101 VAL O    O  25.888  -3.114  -7.715 1.00 . A A . 101 VAL O    1 1 
        5  9052 1 1 102 SER C    C  26.514  -6.029  -5.781 1.00 . A A . 102 SER C    1 1 
        5  9053 1 1 102 SER CA   C  27.176  -4.655  -5.803 1.00 . A A . 102 SER CA   1 1 
        5  9054 1 1 102 SER CB   C  28.304  -4.602  -4.771 1.00 . A A . 102 SER CB   1 1 
        5  9055 1 1 102 SER H    H  25.956  -3.399  -4.614 1.00 . A A . 102 SER H    1 1 
        5  9056 1 1 102 SER HA   H  27.590  -4.483  -6.786 1.00 . A A . 102 SER HA   1 1 
        5  9057 1 1 102 SER HB2  H  28.904  -5.509  -4.850 1.00 . A A . 102 SER HB2  1 1 
        5  9058 1 1 102 SER HB3  H  28.929  -3.743  -4.969 1.00 . A A . 102 SER HB3  1 1 
        5  9059 1 1 102 SER HG   H  27.078  -5.135  -3.339 1.00 . A A . 102 SER HG   1 1 
        5  9060 1 1 102 SER N    N  26.200  -3.604  -5.541 1.00 . A A . 102 SER N    1 1 
        5  9061 1 1 102 SER O    O  25.472  -6.220  -5.153 1.00 . A A . 102 SER O    1 1 
        5  9062 1 1 102 SER OG   O  27.786  -4.499  -3.456 1.00 . A A . 102 SER OG   1 1 
        5  9063 1 1 103 VAL C    C  27.719  -9.373  -6.425 1.00 . A A . 103 VAL C    1 1 
        5  9064 1 1 103 VAL CA   C  26.599  -8.344  -6.530 1.00 . A A . 103 VAL CA   1 1 
        5  9065 1 1 103 VAL CB   C  25.817  -8.585  -7.835 1.00 . A A . 103 VAL CB   1 1 
        5  9066 1 1 103 VAL CG1  C  24.781  -7.493  -8.046 1.00 . A A . 103 VAL CG1  1 1 
        5  9067 1 1 103 VAL CG2  C  26.768  -8.664  -9.020 1.00 . A A . 103 VAL CG2  1 1 
        5  9068 1 1 103 VAL H    H  27.955  -6.773  -6.951 1.00 . A A . 103 VAL H    1 1 
        5  9069 1 1 103 VAL HA   H  25.923  -8.475  -5.700 1.00 . A A . 103 VAL HA   1 1 
        5  9070 1 1 103 VAL HB   H  25.301  -9.530  -7.752 1.00 . A A . 103 VAL HB   1 1 
        5  9071 1 1 103 VAL HG11 H  23.882  -7.925  -8.462 1.00 . A A . 103 VAL HG11 1 1 
        5  9072 1 1 103 VAL HG12 H  24.552  -7.025  -7.100 1.00 . A A . 103 VAL HG12 1 1 
        5  9073 1 1 103 VAL HG13 H  25.171  -6.752  -8.729 1.00 . A A . 103 VAL HG13 1 1 
        5  9074 1 1 103 VAL HG21 H  26.202  -8.798  -9.928 1.00 . A A . 103 VAL HG21 1 1 
        5  9075 1 1 103 VAL HG22 H  27.340  -7.750  -9.083 1.00 . A A . 103 VAL HG22 1 1 
        5  9076 1 1 103 VAL HG23 H  27.440  -9.500  -8.887 1.00 . A A . 103 VAL HG23 1 1 
        5  9077 1 1 103 VAL N    N  27.128  -6.985  -6.471 1.00 . A A . 103 VAL N    1 1 
        5  9078 1 1 103 VAL O    O  28.897  -9.045  -6.569 1.00 . A A . 103 VAL O    1 1 
        5  9079 1 1 104 THR C    C  27.823 -12.969  -6.733 1.00 . A A . 104 THR C    1 1 
        5  9080 1 1 104 THR CA   C  28.315 -11.702  -6.044 1.00 . A A . 104 THR CA   1 1 
        5  9081 1 1 104 THR CB   C  28.615 -12.017  -4.567 1.00 . A A . 104 THR CB   1 1 
        5  9082 1 1 104 THR CG2  C  30.014 -12.593  -4.408 1.00 . A A . 104 THR CG2  1 1 
        5  9083 1 1 104 THR H    H  26.390 -10.822  -6.066 1.00 . A A . 104 THR H    1 1 
        5  9084 1 1 104 THR HA   H  29.234 -11.380  -6.515 1.00 . A A . 104 THR HA   1 1 
        5  9085 1 1 104 THR HB   H  27.899 -12.750  -4.218 1.00 . A A . 104 THR HB   1 1 
        5  9086 1 1 104 THR HG1  H  28.751 -11.019  -2.872 1.00 . A A . 104 THR HG1  1 1 
        5  9087 1 1 104 THR HG21 H  30.687 -11.817  -4.077 1.00 . A A . 104 THR HG21 1 1 
        5  9088 1 1 104 THR HG22 H  30.353 -12.982  -5.358 1.00 . A A . 104 THR HG22 1 1 
        5  9089 1 1 104 THR HG23 H  29.996 -13.390  -3.679 1.00 . A A . 104 THR HG23 1 1 
        5  9090 1 1 104 THR N    N  27.344 -10.622  -6.171 1.00 . A A . 104 THR N    1 1 
        5  9091 1 1 104 THR O    O  26.620 -13.213  -6.821 1.00 . A A . 104 THR O    1 1 
        5  9092 1 1 104 THR OG1  O  28.490 -10.831  -3.776 1.00 . A A . 104 THR OG1  1 1 
        5  9093 1 1 105 LYS C    C  29.474 -16.091  -7.627 1.00 . A A . 105 LYS C    1 1 
        5  9094 1 1 105 LYS CA   C  28.423 -15.019  -7.900 1.00 . A A . 105 LYS CA   1 1 
        5  9095 1 1 105 LYS CB   C  28.299 -14.784  -9.408 1.00 . A A . 105 LYS CB   1 1 
        5  9096 1 1 105 LYS CD   C  26.892 -15.622 -11.312 1.00 . A A . 105 LYS CD   1 1 
        5  9097 1 1 105 LYS CE   C  25.789 -15.061 -12.196 1.00 . A A . 105 LYS CE   1 1 
        5  9098 1 1 105 LYS CG   C  26.889 -14.970  -9.938 1.00 . A A . 105 LYS CG   1 1 
        5  9099 1 1 105 LYS H    H  29.703 -13.525  -7.119 1.00 . A A . 105 LYS H    1 1 
        5  9100 1 1 105 LYS HA   H  27.471 -15.359  -7.519 1.00 . A A . 105 LYS HA   1 1 
        5  9101 1 1 105 LYS HB2  H  28.625 -13.768  -9.631 1.00 . A A . 105 LYS HB2  1 1 
        5  9102 1 1 105 LYS HB3  H  28.950 -15.476  -9.922 1.00 . A A . 105 LYS HB3  1 1 
        5  9103 1 1 105 LYS HD2  H  27.856 -15.446 -11.788 1.00 . A A . 105 LYS HD2  1 1 
        5  9104 1 1 105 LYS HD3  H  26.743 -16.686 -11.197 1.00 . A A . 105 LYS HD3  1 1 
        5  9105 1 1 105 LYS HE2  H  24.982 -14.687 -11.566 1.00 . A A . 105 LYS HE2  1 1 
        5  9106 1 1 105 LYS HE3  H  26.191 -14.244 -12.776 1.00 . A A . 105 LYS HE3  1 1 
        5  9107 1 1 105 LYS HG2  H  26.327 -15.597  -9.246 1.00 . A A . 105 LYS HG2  1 1 
        5  9108 1 1 105 LYS HG3  H  26.410 -14.003 -10.010 1.00 . A A . 105 LYS HG3  1 1 
        5  9109 1 1 105 LYS HZ1  H  24.206 -16.111 -13.068 1.00 . A A . 105 LYS HZ1  1 1 
        5  9110 1 1 105 LYS HZ2  H  25.614 -17.029 -12.872 1.00 . A A . 105 LYS HZ2  1 1 
        5  9111 1 1 105 LYS HZ3  H  25.524 -15.873 -14.103 1.00 . A A . 105 LYS HZ3  1 1 
        5  9112 1 1 105 LYS N    N  28.761 -13.775  -7.220 1.00 . A A . 105 LYS N    1 1 
        5  9113 1 1 105 LYS NZ   N  25.245 -16.091 -13.125 1.00 . A A . 105 LYS NZ   1 1 
        5  9114 1 1 105 LYS O    O  30.662 -15.807  -7.480 1.00 . A A . 105 LYS O    1 1 
        5  9115 1 1 106 PRO C    C  30.839 -18.781  -8.481 1.00 . A A . 106 PRO C    1 1 
        5  9116 1 1 106 PRO CA   C  29.913 -18.494  -7.305 1.00 . A A . 106 PRO CA   1 1 
        5  9117 1 1 106 PRO CB   C  28.942 -19.659  -7.092 1.00 . A A . 106 PRO CB   1 1 
        5  9118 1 1 106 PRO CD   C  27.623 -17.767  -7.725 1.00 . A A . 106 PRO CD   1 1 
        5  9119 1 1 106 PRO CG   C  27.711 -19.265  -7.833 1.00 . A A . 106 PRO CG   1 1 
        5  9120 1 1 106 PRO HA   H  30.503 -18.348  -6.411 1.00 . A A . 106 PRO HA   1 1 
        5  9121 1 1 106 PRO HB2  H  29.356 -20.577  -7.508 1.00 . A A . 106 PRO HB2  1 1 
        5  9122 1 1 106 PRO HB3  H  28.746 -19.780  -6.037 1.00 . A A . 106 PRO HB3  1 1 
        5  9123 1 1 106 PRO HD2  H  27.201 -17.340  -8.634 1.00 . A A . 106 PRO HD2  1 1 
        5  9124 1 1 106 PRO HD3  H  27.034 -17.486  -6.863 1.00 . A A . 106 PRO HD3  1 1 
        5  9125 1 1 106 PRO HG2  H  27.788 -19.563  -8.879 1.00 . A A . 106 PRO HG2  1 1 
        5  9126 1 1 106 PRO HG3  H  26.846 -19.724  -7.377 1.00 . A A . 106 PRO HG3  1 1 
        5  9127 1 1 106 PRO N    N  29.027 -17.354  -7.559 1.00 . A A . 106 PRO N    1 1 
        5  9128 1 1 106 PRO O    O  30.632 -19.738  -9.228 1.00 . A A . 106 PRO O    1 1 
        5  9129 1 1 107 CYS C    C  34.239 -18.259  -9.182 1.00 . A A . 107 CYS C    1 1 
        5  9130 1 1 107 CYS CA   C  32.821 -18.113  -9.727 1.00 . A A . 107 CYS CA   1 1 
        5  9131 1 1 107 CYS CB   C  32.751 -16.920 -10.682 1.00 . A A . 107 CYS CB   1 1 
        5  9132 1 1 107 CYS H    H  31.975 -17.204  -8.012 1.00 . A A . 107 CYS H    1 1 
        5  9133 1 1 107 CYS HA   H  32.561 -19.011 -10.266 1.00 . A A . 107 CYS HA   1 1 
        5  9134 1 1 107 CYS HB2  H  31.761 -16.899 -11.139 1.00 . A A . 107 CYS HB2  1 1 
        5  9135 1 1 107 CYS HB3  H  32.890 -16.008 -10.119 1.00 . A A . 107 CYS HB3  1 1 
        5  9136 1 1 107 CYS HG   H  33.865 -18.073 -12.721 1.00 . A A . 107 CYS HG   1 1 
        5  9137 1 1 107 CYS N    N  31.862 -17.949  -8.641 1.00 . A A . 107 CYS N    1 1 
        5  9138 1 1 107 CYS O    O  34.605 -17.626  -8.191 1.00 . A A . 107 CYS O    1 1 
        5  9139 1 1 107 CYS SG   S  34.002 -16.952 -12.006 1.00 . A A . 107 CYS SG   1 1 
        5  9140 1 1 108 THR C    C  37.352 -19.365 -10.620 1.00 . A A . 108 THR C    1 1 
        5  9141 1 1 108 THR CA   C  36.413 -19.330  -9.419 1.00 . A A . 108 THR CA   1 1 
        5  9142 1 1 108 THR CB   C  36.548 -20.648  -8.636 1.00 . A A . 108 THR CB   1 1 
        5  9143 1 1 108 THR CG2  C  35.797 -21.772  -9.334 1.00 . A A . 108 THR CG2  1 1 
        5  9144 1 1 108 THR H    H  34.685 -19.574 -10.619 1.00 . A A . 108 THR H    1 1 
        5  9145 1 1 108 THR HA   H  36.705 -18.516  -8.771 1.00 . A A . 108 THR HA   1 1 
        5  9146 1 1 108 THR HB   H  36.125 -20.510  -7.652 1.00 . A A . 108 THR HB   1 1 
        5  9147 1 1 108 THR HG1  H  38.017 -21.735  -7.894 1.00 . A A . 108 THR HG1  1 1 
        5  9148 1 1 108 THR HG21 H  34.851 -21.932  -8.841 1.00 . A A . 108 THR HG21 1 1 
        5  9149 1 1 108 THR HG22 H  36.384 -22.678  -9.291 1.00 . A A . 108 THR HG22 1 1 
        5  9150 1 1 108 THR HG23 H  35.625 -21.503 -10.366 1.00 . A A . 108 THR HG23 1 1 
        5  9151 1 1 108 THR N    N  35.036 -19.099  -9.837 1.00 . A A . 108 THR N    1 1 
        5  9152 1 1 108 THR O    O  36.948 -19.720 -11.729 1.00 . A A . 108 THR O    1 1 
        5  9153 1 1 108 THR OG1  O  37.930 -21.000  -8.504 1.00 . A A . 108 THR OG1  1 1 
        5  9154 1 1 109 THR C    C  40.591 -20.138 -11.295 1.00 . A A . 109 THR C    1 1 
        5  9155 1 1 109 THR CA   C  39.606 -18.987 -11.455 1.00 . A A . 109 THR CA   1 1 
        5  9156 1 1 109 THR CB   C  40.386 -17.659 -11.480 1.00 . A A . 109 THR CB   1 1 
        5  9157 1 1 109 THR CG2  C  41.248 -17.512 -10.235 1.00 . A A . 109 THR CG2  1 1 
        5  9158 1 1 109 THR H    H  38.870 -18.724  -9.488 1.00 . A A . 109 THR H    1 1 
        5  9159 1 1 109 THR HA   H  39.090 -19.094 -12.399 1.00 . A A . 109 THR HA   1 1 
        5  9160 1 1 109 THR HB   H  39.678 -16.843 -11.508 1.00 . A A . 109 THR HB   1 1 
        5  9161 1 1 109 THR HG1  H  42.035 -18.068 -12.483 1.00 . A A . 109 THR HG1  1 1 
        5  9162 1 1 109 THR HG21 H  40.767 -18.010  -9.406 1.00 . A A . 109 THR HG21 1 1 
        5  9163 1 1 109 THR HG22 H  41.370 -16.465 -10.003 1.00 . A A . 109 THR HG22 1 1 
        5  9164 1 1 109 THR HG23 H  42.215 -17.958 -10.412 1.00 . A A . 109 THR HG23 1 1 
        5  9165 1 1 109 THR N    N  38.609 -18.996 -10.393 1.00 . A A . 109 THR N    1 1 
        5  9166 1 1 109 THR O    O  40.622 -20.806 -10.261 1.00 . A A . 109 THR O    1 1 
        5  9167 1 1 109 THR OG1  O  41.214 -17.599 -12.648 1.00 . A A . 109 THR OG1  1 1 
        5  9168 1 1 110 LYS C    C  43.377 -21.293 -13.452 1.00 . A A . 110 LYS C    1 1 
        5  9169 1 1 110 LYS CA   C  42.389 -21.438 -12.300 1.00 . A A . 110 LYS CA   1 1 
        5  9170 1 1 110 LYS CB   C  41.697 -22.801 -12.377 1.00 . A A . 110 LYS CB   1 1 
        5  9171 1 1 110 LYS CD   C  40.553 -24.449 -13.889 1.00 . A A . 110 LYS CD   1 1 
        5  9172 1 1 110 LYS CE   C  39.435 -24.618 -14.907 1.00 . A A . 110 LYS CE   1 1 
        5  9173 1 1 110 LYS CG   C  40.843 -22.982 -13.621 1.00 . A A . 110 LYS CG   1 1 
        5  9174 1 1 110 LYS H    H  41.327 -19.802 -13.123 1.00 . A A . 110 LYS H    1 1 
        5  9175 1 1 110 LYS HA   H  42.927 -21.369 -11.367 1.00 . A A . 110 LYS HA   1 1 
        5  9176 1 1 110 LYS HB2  H  42.459 -23.580 -12.359 1.00 . A A . 110 LYS HB2  1 1 
        5  9177 1 1 110 LYS HB3  H  41.061 -22.919 -11.510 1.00 . A A . 110 LYS HB3  1 1 
        5  9178 1 1 110 LYS HD2  H  41.456 -24.929 -14.266 1.00 . A A . 110 LYS HD2  1 1 
        5  9179 1 1 110 LYS HD3  H  40.259 -24.924 -12.963 1.00 . A A . 110 LYS HD3  1 1 
        5  9180 1 1 110 LYS HE2  H  38.662 -25.259 -14.483 1.00 . A A . 110 LYS HE2  1 1 
        5  9181 1 1 110 LYS HE3  H  39.011 -23.648 -15.121 1.00 . A A . 110 LYS HE3  1 1 
        5  9182 1 1 110 LYS HG2  H  39.901 -22.449 -13.489 1.00 . A A . 110 LYS HG2  1 1 
        5  9183 1 1 110 LYS HG3  H  41.369 -22.568 -14.469 1.00 . A A . 110 LYS HG3  1 1 
        5  9184 1 1 110 LYS HZ1  H  40.632 -24.601 -16.619 1.00 . A A . 110 LYS HZ1  1 1 
        5  9185 1 1 110 LYS HZ2  H  39.137 -25.360 -16.836 1.00 . A A . 110 LYS HZ2  1 1 
        5  9186 1 1 110 LYS HZ3  H  40.369 -26.147 -15.983 1.00 . A A . 110 LYS HZ3  1 1 
        5  9187 1 1 110 LYS N    N  41.399 -20.368 -12.326 1.00 . A A . 110 LYS N    1 1 
        5  9188 1 1 110 LYS NZ   N  39.928 -25.223 -16.174 1.00 . A A . 110 LYS NZ   1 1 
        5  9189 1 1 110 LYS O    O  43.338 -20.314 -14.198 1.00 . A A . 110 LYS O    1 1 
        5  9190 1 1 111 VAL C    C  46.019 -20.934 -14.676 1.00 . A A . 111 VAL C    1 1 
        5  9191 1 1 111 VAL CA   C  45.260 -22.257 -14.657 1.00 . A A . 111 VAL CA   1 1 
        5  9192 1 1 111 VAL CB   C  44.615 -22.487 -16.036 1.00 . A A . 111 VAL CB   1 1 
        5  9193 1 1 111 VAL CG1  C  45.664 -22.416 -17.135 1.00 . A A . 111 VAL CG1  1 1 
        5  9194 1 1 111 VAL CG2  C  43.887 -23.822 -16.067 1.00 . A A . 111 VAL CG2  1 1 
        5  9195 1 1 111 VAL H    H  44.244 -23.028 -12.968 1.00 . A A . 111 VAL H    1 1 
        5  9196 1 1 111 VAL HA   H  45.960 -23.058 -14.471 1.00 . A A . 111 VAL HA   1 1 
        5  9197 1 1 111 VAL HB   H  43.892 -21.702 -16.208 1.00 . A A . 111 VAL HB   1 1 
        5  9198 1 1 111 VAL HG11 H  45.724 -21.405 -17.510 1.00 . A A . 111 VAL HG11 1 1 
        5  9199 1 1 111 VAL HG12 H  46.623 -22.712 -16.737 1.00 . A A . 111 VAL HG12 1 1 
        5  9200 1 1 111 VAL HG13 H  45.388 -23.082 -17.939 1.00 . A A . 111 VAL HG13 1 1 
        5  9201 1 1 111 VAL HG21 H  44.325 -24.454 -16.824 1.00 . A A . 111 VAL HG21 1 1 
        5  9202 1 1 111 VAL HG22 H  43.974 -24.301 -15.103 1.00 . A A . 111 VAL HG22 1 1 
        5  9203 1 1 111 VAL HG23 H  42.844 -23.658 -16.295 1.00 . A A . 111 VAL HG23 1 1 
        5  9204 1 1 111 VAL N    N  44.262 -22.274 -13.594 1.00 . A A . 111 VAL N    1 1 
        5  9205 1 1 111 VAL O    O  45.715 -20.044 -15.469 1.00 . A A . 111 VAL O    1 1 
        5  9206 1 1 112 LYS C    C  48.560 -19.351 -15.021 1.00 . A A . 112 LYS C    1 1 
        5  9207 1 1 112 LYS CA   C  47.813 -19.600 -13.714 1.00 . A A . 112 LYS CA   1 1 
        5  9208 1 1 112 LYS CB   C  48.809 -19.703 -12.557 1.00 . A A . 112 LYS CB   1 1 
        5  9209 1 1 112 LYS CD   C  51.122 -20.606 -12.176 1.00 . A A . 112 LYS CD   1 1 
        5  9210 1 1 112 LYS CE   C  52.129 -21.593 -12.748 1.00 . A A . 112 LYS CE   1 1 
        5  9211 1 1 112 LYS CG   C  49.709 -20.925 -12.635 1.00 . A A . 112 LYS CG   1 1 
        5  9212 1 1 112 LYS H    H  47.203 -21.559 -13.191 1.00 . A A . 112 LYS H    1 1 
        5  9213 1 1 112 LYS HA   H  47.146 -18.772 -13.532 1.00 . A A . 112 LYS HA   1 1 
        5  9214 1 1 112 LYS HB2  H  49.433 -18.810 -12.554 1.00 . A A . 112 LYS HB2  1 1 
        5  9215 1 1 112 LYS HB3  H  48.260 -19.745 -11.628 1.00 . A A . 112 LYS HB3  1 1 
        5  9216 1 1 112 LYS HD2  H  51.384 -19.599 -12.499 1.00 . A A . 112 LYS HD2  1 1 
        5  9217 1 1 112 LYS HD3  H  51.159 -20.653 -11.097 1.00 . A A . 112 LYS HD3  1 1 
        5  9218 1 1 112 LYS HE2  H  51.877 -22.598 -12.408 1.00 . A A . 112 LYS HE2  1 1 
        5  9219 1 1 112 LYS HE3  H  52.070 -21.561 -13.827 1.00 . A A . 112 LYS HE3  1 1 
        5  9220 1 1 112 LYS HG2  H  49.297 -21.712 -12.004 1.00 . A A . 112 LYS HG2  1 1 
        5  9221 1 1 112 LYS HG3  H  49.741 -21.271 -13.658 1.00 . A A . 112 LYS HG3  1 1 
        5  9222 1 1 112 LYS HZ1  H  54.031 -20.806 -13.107 1.00 . A A . 112 LYS HZ1  1 1 
        5  9223 1 1 112 LYS HZ2  H  54.024 -22.142 -12.067 1.00 . A A . 112 LYS HZ2  1 1 
        5  9224 1 1 112 LYS HZ3  H  53.509 -20.633 -11.507 1.00 . A A . 112 LYS HZ3  1 1 
        5  9225 1 1 112 LYS N    N  47.009 -20.813 -13.798 1.00 . A A . 112 LYS N    1 1 
        5  9226 1 1 112 LYS NZ   N  53.520 -21.271 -12.329 1.00 . A A . 112 LYS NZ   1 1 
        5  9227 1 1 112 LYS O    O  48.504 -20.164 -15.942 1.00 . A A . 112 LYS O    1 1 
        5  9228 1 1 113 ASN C    C  51.255 -18.754 -16.428 1.00 . A A . 113 ASN C    1 1 
        5  9229 1 1 113 ASN CA   C  50.020 -17.870 -16.286 1.00 . A A . 113 ASN CA   1 1 
        5  9230 1 1 113 ASN CB   C  50.435 -16.398 -16.234 1.00 . A A . 113 ASN CB   1 1 
        5  9231 1 1 113 ASN CG   C  49.265 -15.477 -15.955 1.00 . A A . 113 ASN CG   1 1 
        5  9232 1 1 113 ASN H    H  49.267 -17.616 -14.325 1.00 . A A . 113 ASN H    1 1 
        5  9233 1 1 113 ASN HA   H  49.380 -18.024 -17.143 1.00 . A A . 113 ASN HA   1 1 
        5  9234 1 1 113 ASN HB2  H  51.181 -16.270 -15.449 1.00 . A A . 113 ASN HB2  1 1 
        5  9235 1 1 113 ASN HB3  H  50.872 -16.120 -17.179 1.00 . A A . 113 ASN HB3  1 1 
        5  9236 1 1 113 ASN HD21 H  50.509 -13.978 -15.548 1.00 . A A . 113 ASN HD21 1 1 
        5  9237 1 1 113 ASN HD22 H  48.825 -13.614 -15.419 1.00 . A A . 113 ASN HD22 1 1 
        5  9238 1 1 113 ASN N    N  49.261 -18.224 -15.092 1.00 . A A . 113 ASN N    1 1 
        5  9239 1 1 113 ASN ND2  N  49.563 -14.230 -15.606 1.00 . A A . 113 ASN ND2  1 1 
        5  9240 1 1 113 ASN O    O  51.902 -19.099 -15.439 1.00 . A A . 113 ASN O    1 1 
        5  9241 1 1 113 ASN OD1  O  48.105 -15.880 -16.052 1.00 . A A . 113 ASN OD1  1 1 
        5  9242 1 1 114 LYS C    C  53.953 -19.111 -18.292 1.00 . A A . 114 LYS C    1 1 
        5  9243 1 1 114 LYS CA   C  52.736 -19.960 -17.938 1.00 . A A . 114 LYS CA   1 1 
        5  9244 1 1 114 LYS CB   C  52.427 -20.932 -19.078 1.00 . A A . 114 LYS CB   1 1 
        5  9245 1 1 114 LYS CD   C  51.709 -23.237 -19.773 1.00 . A A . 114 LYS CD   1 1 
        5  9246 1 1 114 LYS CE   C  50.507 -22.798 -20.596 1.00 . A A . 114 LYS CE   1 1 
        5  9247 1 1 114 LYS CG   C  51.955 -22.296 -18.605 1.00 . A A . 114 LYS CG   1 1 
        5  9248 1 1 114 LYS H    H  51.022 -18.811 -18.413 1.00 . A A . 114 LYS H    1 1 
        5  9249 1 1 114 LYS HA   H  52.953 -20.524 -17.044 1.00 . A A . 114 LYS HA   1 1 
        5  9250 1 1 114 LYS HB2  H  51.652 -20.495 -19.709 1.00 . A A . 114 LYS HB2  1 1 
        5  9251 1 1 114 LYS HB3  H  53.320 -21.068 -19.671 1.00 . A A . 114 LYS HB3  1 1 
        5  9252 1 1 114 LYS HD2  H  52.592 -23.254 -20.411 1.00 . A A . 114 LYS HD2  1 1 
        5  9253 1 1 114 LYS HD3  H  51.528 -24.232 -19.390 1.00 . A A . 114 LYS HD3  1 1 
        5  9254 1 1 114 LYS HE2  H  49.734 -23.564 -20.533 1.00 . A A . 114 LYS HE2  1 1 
        5  9255 1 1 114 LYS HE3  H  50.122 -21.875 -20.187 1.00 . A A . 114 LYS HE3  1 1 
        5  9256 1 1 114 LYS HG2  H  52.713 -22.729 -17.952 1.00 . A A . 114 LYS HG2  1 1 
        5  9257 1 1 114 LYS HG3  H  51.036 -22.176 -18.050 1.00 . A A . 114 LYS HG3  1 1 
        5  9258 1 1 114 LYS HZ1  H  50.036 -22.233 -22.551 1.00 . A A . 114 LYS HZ1  1 1 
        5  9259 1 1 114 LYS HZ2  H  51.176 -23.478 -22.453 1.00 . A A . 114 LYS HZ2  1 1 
        5  9260 1 1 114 LYS HZ3  H  51.630 -21.888 -22.103 1.00 . A A . 114 LYS HZ3  1 1 
        5  9261 1 1 114 LYS N    N  51.576 -19.118 -17.664 1.00 . A A . 114 LYS N    1 1 
        5  9262 1 1 114 LYS NZ   N  50.862 -22.584 -22.026 1.00 . A A . 114 LYS NZ   1 1 
        5  9263 1 1 114 LYS O    O  53.839 -17.945 -18.669 1.00 . A A . 114 LYS O    1 1 
        5  9264 1 1 115 PRO C    C  56.580 -18.768 -19.972 1.00 . A A . 115 PRO C    1 1 
        5  9265 1 1 115 PRO CA   C  56.409 -19.030 -18.479 1.00 . A A . 115 PRO CA   1 1 
        5  9266 1 1 115 PRO CB   C  57.472 -20.013 -17.983 1.00 . A A . 115 PRO CB   1 1 
        5  9267 1 1 115 PRO CD   C  55.358 -21.099 -17.731 1.00 . A A . 115 PRO CD   1 1 
        5  9268 1 1 115 PRO CG   C  56.810 -21.346 -18.036 1.00 . A A . 115 PRO CG   1 1 
        5  9269 1 1 115 PRO HA   H  56.496 -18.098 -17.939 1.00 . A A . 115 PRO HA   1 1 
        5  9270 1 1 115 PRO HB2  H  58.340 -19.996 -18.643 1.00 . A A . 115 PRO HB2  1 1 
        5  9271 1 1 115 PRO HB3  H  57.762 -19.756 -16.975 1.00 . A A . 115 PRO HB3  1 1 
        5  9272 1 1 115 PRO HD2  H  54.725 -21.783 -18.297 1.00 . A A . 115 PRO HD2  1 1 
        5  9273 1 1 115 PRO HD3  H  55.174 -21.197 -16.671 1.00 . A A . 115 PRO HD3  1 1 
        5  9274 1 1 115 PRO HG2  H  56.917 -21.780 -19.030 1.00 . A A . 115 PRO HG2  1 1 
        5  9275 1 1 115 PRO HG3  H  57.242 -22.001 -17.294 1.00 . A A . 115 PRO HG3  1 1 
        5  9276 1 1 115 PRO N    N  55.147 -19.711 -18.173 1.00 . A A . 115 PRO N    1 1 
        5  9277 1 1 115 PRO O    O  56.414 -19.670 -20.793 1.00 . A A . 115 PRO O    1 1 
        5  9278 1 1 116 LYS C    C  57.564 -15.698 -21.820 1.00 . A A . 116 LYS C    1 1 
        5  9279 1 1 116 LYS CA   C  57.107 -17.149 -21.711 1.00 . A A . 116 LYS CA   1 1 
        5  9280 1 1 116 LYS CB   C  55.810 -17.347 -22.502 1.00 . A A . 116 LYS CB   1 1 
        5  9281 1 1 116 LYS CD   C  54.538 -15.565 -21.272 1.00 . A A . 116 LYS CD   1 1 
        5  9282 1 1 116 LYS CE   C  54.585 -14.623 -22.466 1.00 . A A . 116 LYS CE   1 1 
        5  9283 1 1 116 LYS CG   C  54.557 -17.019 -21.707 1.00 . A A . 116 LYS CG   1 1 
        5  9284 1 1 116 LYS H    H  57.028 -16.853 -19.616 1.00 . A A . 116 LYS H    1 1 
        5  9285 1 1 116 LYS HA   H  57.872 -17.787 -22.125 1.00 . A A . 116 LYS HA   1 1 
        5  9286 1 1 116 LYS HB2  H  55.840 -16.711 -23.386 1.00 . A A . 116 LYS HB2  1 1 
        5  9287 1 1 116 LYS HB3  H  55.751 -18.378 -22.818 1.00 . A A . 116 LYS HB3  1 1 
        5  9288 1 1 116 LYS HD2  H  53.628 -15.375 -20.704 1.00 . A A . 116 LYS HD2  1 1 
        5  9289 1 1 116 LYS HD3  H  55.395 -15.374 -20.640 1.00 . A A . 116 LYS HD3  1 1 
        5  9290 1 1 116 LYS HE2  H  55.543 -14.104 -22.474 1.00 . A A . 116 LYS HE2  1 1 
        5  9291 1 1 116 LYS HE3  H  54.492 -15.207 -23.370 1.00 . A A . 116 LYS HE3  1 1 
        5  9292 1 1 116 LYS HG2  H  53.681 -17.218 -22.324 1.00 . A A . 116 LYS HG2  1 1 
        5  9293 1 1 116 LYS HG3  H  54.524 -17.649 -20.830 1.00 . A A . 116 LYS HG3  1 1 
        5  9294 1 1 116 LYS HZ1  H  53.266 -13.289 -23.385 1.00 . A A . 116 LYS HZ1  1 1 
        5  9295 1 1 116 LYS HZ2  H  53.774 -12.801 -21.846 1.00 . A A . 116 LYS HZ2  1 1 
        5  9296 1 1 116 LYS HZ3  H  52.633 -14.039 -22.007 1.00 . A A . 116 LYS HZ3  1 1 
        5  9297 1 1 116 LYS N    N  56.911 -17.530 -20.317 1.00 . A A . 116 LYS N    1 1 
        5  9298 1 1 116 LYS NZ   N  53.487 -13.618 -22.424 1.00 . A A . 116 LYS NZ   1 1 
        5  9299 1 1 116 LYS O    O  57.669 -14.993 -20.816 1.00 . A A . 116 LYS O    1 1 
        5  9300 1 1 117 GLY C    C  59.731 -13.688 -22.897 1.00 . A A . 117 GLY C    1 1 
        5  9301 1 1 117 GLY CA   C  58.275 -13.892 -23.262 1.00 . A A . 117 GLY CA   1 1 
        5  9302 1 1 117 GLY H    H  57.732 -15.865 -23.808 1.00 . A A . 117 GLY H    1 1 
        5  9303 1 1 117 GLY HA2  H  58.137 -13.642 -24.304 1.00 . A A . 117 GLY HA2  1 1 
        5  9304 1 1 117 GLY HA3  H  57.669 -13.229 -22.660 1.00 . A A . 117 GLY HA3  1 1 
        5  9305 1 1 117 GLY N    N  57.833 -15.258 -23.045 1.00 . A A . 117 GLY N    1 1 
        5  9306 1 1 117 GLY O    O  60.062 -13.459 -21.732 1.00 . A A . 117 GLY O    1 1 
        5  9307 1 1 118 LYS C    C  62.720 -13.060 -24.923 1.00 . A A . 118 LYS C    1 1 
        5  9308 1 1 118 LYS CA   C  62.038 -13.599 -23.672 1.00 . A A . 118 LYS CA   1 1 
        5  9309 1 1 118 LYS CB   C  62.677 -14.927 -23.261 1.00 . A A . 118 LYS CB   1 1 
        5  9310 1 1 118 LYS CD   C  65.034 -15.300 -22.476 1.00 . A A . 118 LYS CD   1 1 
        5  9311 1 1 118 LYS CE   C  65.149 -16.807 -22.308 1.00 . A A . 118 LYS CE   1 1 
        5  9312 1 1 118 LYS CG   C  63.649 -14.801 -22.100 1.00 . A A . 118 LYS CG   1 1 
        5  9313 1 1 118 LYS H    H  60.282 -13.959 -24.799 1.00 . A A . 118 LYS H    1 1 
        5  9314 1 1 118 LYS HA   H  62.165 -12.885 -22.871 1.00 . A A . 118 LYS HA   1 1 
        5  9315 1 1 118 LYS HB2  H  61.887 -15.624 -22.982 1.00 . A A . 118 LYS HB2  1 1 
        5  9316 1 1 118 LYS HB3  H  63.213 -15.331 -24.108 1.00 . A A . 118 LYS HB3  1 1 
        5  9317 1 1 118 LYS HD2  H  65.238 -15.040 -23.515 1.00 . A A . 118 LYS HD2  1 1 
        5  9318 1 1 118 LYS HD3  H  65.764 -14.818 -21.841 1.00 . A A . 118 LYS HD3  1 1 
        5  9319 1 1 118 LYS HE2  H  65.955 -17.027 -21.607 1.00 . A A . 118 LYS HE2  1 1 
        5  9320 1 1 118 LYS HE3  H  64.220 -17.182 -21.906 1.00 . A A . 118 LYS HE3  1 1 
        5  9321 1 1 118 LYS HG2  H  63.715 -13.755 -21.802 1.00 . A A . 118 LYS HG2  1 1 
        5  9322 1 1 118 LYS HG3  H  63.280 -15.384 -21.268 1.00 . A A . 118 LYS HG3  1 1 
        5  9323 1 1 118 LYS HZ1  H  64.729 -18.240 -23.769 1.00 . A A . 118 LYS HZ1  1 1 
        5  9324 1 1 118 LYS HZ2  H  66.379 -17.912 -23.585 1.00 . A A . 118 LYS HZ2  1 1 
        5  9325 1 1 118 LYS HZ3  H  65.379 -16.805 -24.385 1.00 . A A . 118 LYS HZ3  1 1 
        5  9326 1 1 118 LYS N    N  60.607 -13.774 -23.892 1.00 . A A . 118 LYS N    1 1 
        5  9327 1 1 118 LYS NZ   N  65.429 -17.489 -23.603 1.00 . A A . 118 LYS NZ   1 1 
        5  9328 1 1 118 LYS O    O  62.076 -12.852 -25.954 1.00 . A A . 118 LYS O    1 1 
        5  9329 1 1 119 LYS C    C  64.709 -13.267 -27.152 1.00 . A A . 119 LYS C    1 1 
        5  9330 1 1 119 LYS CA   C  64.797 -12.322 -25.958 1.00 . A A . 119 LYS CA   1 1 
        5  9331 1 1 119 LYS CB   C  66.262 -12.128 -25.555 1.00 . A A . 119 LYS CB   1 1 
        5  9332 1 1 119 LYS CD   C  68.321 -10.704 -25.743 1.00 . A A . 119 LYS CD   1 1 
        5  9333 1 1 119 LYS CE   C  69.051  -9.652 -26.563 1.00 . A A . 119 LYS CE   1 1 
        5  9334 1 1 119 LYS CG   C  66.975 -11.052 -26.355 1.00 . A A . 119 LYS CG   1 1 
        5  9335 1 1 119 LYS H    H  64.483 -13.021 -23.984 1.00 . A A . 119 LYS H    1 1 
        5  9336 1 1 119 LYS HA   H  64.380 -11.368 -26.238 1.00 . A A . 119 LYS HA   1 1 
        5  9337 1 1 119 LYS HB2  H  66.301 -11.862 -24.499 1.00 . A A . 119 LYS HB2  1 1 
        5  9338 1 1 119 LYS HB3  H  66.787 -13.063 -25.696 1.00 . A A . 119 LYS HB3  1 1 
        5  9339 1 1 119 LYS HD2  H  68.167 -10.325 -24.733 1.00 . A A . 119 LYS HD2  1 1 
        5  9340 1 1 119 LYS HD3  H  68.928 -11.598 -25.697 1.00 . A A . 119 LYS HD3  1 1 
        5  9341 1 1 119 LYS HE2  H  68.347  -8.868 -26.843 1.00 . A A . 119 LYS HE2  1 1 
        5  9342 1 1 119 LYS HE3  H  69.835  -9.222 -25.958 1.00 . A A . 119 LYS HE3  1 1 
        5  9343 1 1 119 LYS HG2  H  67.126 -11.406 -27.375 1.00 . A A . 119 LYS HG2  1 1 
        5  9344 1 1 119 LYS HG3  H  66.358 -10.165 -26.376 1.00 . A A . 119 LYS HG3  1 1 
        5  9345 1 1 119 LYS HZ1  H  69.570  -9.555 -28.585 1.00 . A A . 119 LYS HZ1  1 1 
        5  9346 1 1 119 LYS HZ2  H  69.160 -11.109 -28.056 1.00 . A A . 119 LYS HZ2  1 1 
        5  9347 1 1 119 LYS HZ3  H  70.657 -10.442 -27.641 1.00 . A A . 119 LYS HZ3  1 1 
        5  9348 1 1 119 LYS N    N  64.027 -12.835 -24.832 1.00 . A A . 119 LYS N    1 1 
        5  9349 1 1 119 LYS NZ   N  69.651 -10.230 -27.798 1.00 . A A . 119 LYS NZ   1 1 
        5  9350 1 1 119 LYS O    O  64.755 -12.835 -28.303 1.00 . A A . 119 LYS O    1 1 
        5  9351 1 1 120 GLY C    C  63.267 -15.335 -28.811 1.00 . A A . 120 GLY C    1 1 
        5  9352 1 1 120 GLY CA   C  64.485 -15.544 -27.932 1.00 . A A . 120 GLY CA   1 1 
        5  9353 1 1 120 GLY H    H  64.547 -14.848 -25.934 1.00 . A A . 120 GLY H    1 1 
        5  9354 1 1 120 GLY HA2  H  65.372 -15.485 -28.545 1.00 . A A . 120 GLY HA2  1 1 
        5  9355 1 1 120 GLY HA3  H  64.431 -16.530 -27.492 1.00 . A A . 120 GLY HA3  1 1 
        5  9356 1 1 120 GLY N    N  64.579 -14.560 -26.871 1.00 . A A . 120 GLY N    1 1 
        5  9357 1 1 120 GLY O    O  63.322 -15.553 -30.022 1.00 . A A . 120 GLY O    1 1 
        5  9358 1 1 121 LYS C    C  60.946 -13.301 -29.598 1.00 . A A . 121 LYS C    1 1 
        5  9359 1 1 121 LYS CA   C  60.928 -14.675 -28.935 1.00 . A A . 121 LYS CA   1 1 
        5  9360 1 1 121 LYS CB   C  59.725 -14.785 -27.995 1.00 . A A . 121 LYS CB   1 1 
        5  9361 1 1 121 LYS CD   C  57.706 -13.399 -28.553 1.00 . A A . 121 LYS CD   1 1 
        5  9362 1 1 121 LYS CE   C  56.562 -13.468 -27.554 1.00 . A A . 121 LYS CE   1 1 
        5  9363 1 1 121 LYS CG   C  58.387 -14.747 -28.714 1.00 . A A . 121 LYS CG   1 1 
        5  9364 1 1 121 LYS H    H  62.185 -14.759 -27.233 1.00 . A A . 121 LYS H    1 1 
        5  9365 1 1 121 LYS HA   H  60.846 -15.431 -29.702 1.00 . A A . 121 LYS HA   1 1 
        5  9366 1 1 121 LYS HB2  H  59.797 -15.722 -27.443 1.00 . A A . 121 LYS HB2  1 1 
        5  9367 1 1 121 LYS HB3  H  59.755 -13.966 -27.293 1.00 . A A . 121 LYS HB3  1 1 
        5  9368 1 1 121 LYS HD2  H  58.438 -12.669 -28.207 1.00 . A A . 121 LYS HD2  1 1 
        5  9369 1 1 121 LYS HD3  H  57.316 -13.084 -29.512 1.00 . A A . 121 LYS HD3  1 1 
        5  9370 1 1 121 LYS HE2  H  55.615 -13.436 -28.093 1.00 . A A . 121 LYS HE2  1 1 
        5  9371 1 1 121 LYS HE3  H  56.629 -14.402 -27.014 1.00 . A A . 121 LYS HE3  1 1 
        5  9372 1 1 121 LYS HG2  H  58.546 -14.943 -29.774 1.00 . A A . 121 LYS HG2  1 1 
        5  9373 1 1 121 LYS HG3  H  57.747 -15.515 -28.305 1.00 . A A . 121 LYS HG3  1 1 
        5  9374 1 1 121 LYS HZ1  H  55.795 -12.397 -25.933 1.00 . A A . 121 LYS HZ1  1 1 
        5  9375 1 1 121 LYS HZ2  H  56.574 -11.433 -27.084 1.00 . A A . 121 LYS HZ2  1 1 
        5  9376 1 1 121 LYS HZ3  H  57.484 -12.385 -26.023 1.00 . A A . 121 LYS HZ3  1 1 
        5  9377 1 1 121 LYS N    N  62.166 -14.915 -28.201 1.00 . A A . 121 LYS N    1 1 
        5  9378 1 1 121 LYS NZ   N  56.605 -12.342 -26.580 1.00 . A A . 121 LYS NZ   1 1 
        5  9379 1 1 121 LYS O    O  60.658 -12.290 -28.959 1.00 . A A . 121 LYS O    1 1 
        5  9380 1 1 122 GLY C    C  62.594 -11.872 -32.433 1.00 . A A . 122 GLY C    1 1 
        5  9381 1 1 122 GLY CA   C  61.329 -12.018 -31.610 1.00 . A A . 122 GLY CA   1 1 
        5  9382 1 1 122 GLY H    H  61.501 -14.111 -31.341 1.00 . A A . 122 GLY H    1 1 
        5  9383 1 1 122 GLY HA2  H  60.474 -11.965 -32.270 1.00 . A A . 122 GLY HA2  1 1 
        5  9384 1 1 122 GLY HA3  H  61.277 -11.204 -30.904 1.00 . A A . 122 GLY HA3  1 1 
        5  9385 1 1 122 GLY N    N  61.283 -13.274 -30.884 1.00 . A A . 122 GLY N    1 1 
        5  9386 1 1 122 GLY O    O  63.547 -12.630 -32.260 1.00 . A A . 122 GLY O    1 1 
        5  9387 1 1 123 LYS C    C  64.363  -9.276 -33.904 1.00 . A A . 123 LYS C    1 1 
        5  9388 1 1 123 LYS CA   C  63.759 -10.649 -34.186 1.00 . A A . 123 LYS CA   1 1 
        5  9389 1 1 123 LYS CB   C  63.361 -10.750 -35.660 1.00 . A A . 123 LYS CB   1 1 
        5  9390 1 1 123 LYS CD   C  64.929 -10.876 -37.619 1.00 . A A . 123 LYS CD   1 1 
        5  9391 1 1 123 LYS CE   C  66.052 -11.677 -38.260 1.00 . A A . 123 LYS CE   1 1 
        5  9392 1 1 123 LYS CG   C  64.279 -11.641 -36.479 1.00 . A A . 123 LYS CG   1 1 
        5  9393 1 1 123 LYS H    H  61.811 -10.321 -33.423 1.00 . A A . 123 LYS H    1 1 
        5  9394 1 1 123 LYS HA   H  64.498 -11.405 -33.968 1.00 . A A . 123 LYS HA   1 1 
        5  9395 1 1 123 LYS HB2  H  62.347 -11.144 -35.722 1.00 . A A . 123 LYS HB2  1 1 
        5  9396 1 1 123 LYS HB3  H  63.375  -9.760 -36.093 1.00 . A A . 123 LYS HB3  1 1 
        5  9397 1 1 123 LYS HD2  H  64.175 -10.651 -38.374 1.00 . A A . 123 LYS HD2  1 1 
        5  9398 1 1 123 LYS HD3  H  65.333  -9.950 -37.234 1.00 . A A . 123 LYS HD3  1 1 
        5  9399 1 1 123 LYS HE2  H  66.989 -11.133 -38.143 1.00 . A A . 123 LYS HE2  1 1 
        5  9400 1 1 123 LYS HE3  H  66.131 -12.628 -37.754 1.00 . A A . 123 LYS HE3  1 1 
        5  9401 1 1 123 LYS HG2  H  65.057 -12.044 -35.830 1.00 . A A . 123 LYS HG2  1 1 
        5  9402 1 1 123 LYS HG3  H  63.701 -12.458 -36.889 1.00 . A A . 123 LYS HG3  1 1 
        5  9403 1 1 123 LYS HZ1  H  64.802 -11.761 -39.931 1.00 . A A . 123 LYS HZ1  1 1 
        5  9404 1 1 123 LYS HZ2  H  66.058 -12.894 -39.956 1.00 . A A . 123 LYS HZ2  1 1 
        5  9405 1 1 123 LYS HZ3  H  66.381 -11.266 -40.281 1.00 . A A . 123 LYS HZ3  1 1 
        5  9406 1 1 123 LYS N    N  62.602 -10.893 -33.332 1.00 . A A . 123 LYS N    1 1 
        5  9407 1 1 123 LYS NZ   N  65.806 -11.916 -39.708 1.00 . A A . 123 LYS NZ   1 1 
        5  9408 1 1 123 LYS O    O  63.652  -8.272 -33.865 1.00 . A A . 123 LYS O    1 1 
        5  9409 1 1 124 GLY C    C  67.862  -8.136 -33.403 1.00 . A A . 124 GLY C    1 1 
        5  9410 1 1 124 GLY CA   C  66.354  -7.987 -33.438 1.00 . A A . 124 GLY CA   1 1 
        5  9411 1 1 124 GLY H    H  66.193 -10.075 -33.755 1.00 . A A . 124 GLY H    1 1 
        5  9412 1 1 124 GLY HA2  H  66.091  -7.274 -34.206 1.00 . A A . 124 GLY HA2  1 1 
        5  9413 1 1 124 GLY HA3  H  66.019  -7.612 -32.482 1.00 . A A . 124 GLY HA3  1 1 
        5  9414 1 1 124 GLY N    N  65.678  -9.241 -33.712 1.00 . A A . 124 GLY N    1 1 
        5  9415 1 1 124 GLY O    O  68.398  -8.904 -32.603 1.00 . A A . 124 GLY O    1 1 
        5  9416 1 1 125 ASN C    C  70.632  -6.773 -33.132 1.00 . A A . 125 ASN C    1 1 
        5  9417 1 1 125 ASN CA   C  70.004  -7.462 -34.341 1.00 . A A . 125 ASN CA   1 1 
        5  9418 1 1 125 ASN CB   C  70.502  -6.807 -35.631 1.00 . A A . 125 ASN CB   1 1 
        5  9419 1 1 125 ASN CG   C  72.010  -6.648 -35.653 1.00 . A A . 125 ASN CG   1 1 
        5  9420 1 1 125 ASN H    H  68.065  -6.812 -34.886 1.00 . A A . 125 ASN H    1 1 
        5  9421 1 1 125 ASN HA   H  70.296  -8.500 -34.340 1.00 . A A . 125 ASN HA   1 1 
        5  9422 1 1 125 ASN HB2  H  70.200  -7.422 -36.478 1.00 . A A . 125 ASN HB2  1 1 
        5  9423 1 1 125 ASN HB3  H  70.053  -5.830 -35.729 1.00 . A A . 125 ASN HB3  1 1 
        5  9424 1 1 125 ASN HD21 H  72.242  -8.526 -35.043 1.00 . A A . 125 ASN HD21 1 1 
        5  9425 1 1 125 ASN HD22 H  73.699  -7.635 -35.303 1.00 . A A . 125 ASN HD22 1 1 
        5  9426 1 1 125 ASN N    N  68.548  -7.405 -34.274 1.00 . A A . 125 ASN N    1 1 
        5  9427 1 1 125 ASN ND2  N  72.722  -7.710 -35.297 1.00 . A A . 125 ASN ND2  1 1 
        5  9428 1 1 125 ASN O    O  71.301  -7.411 -32.321 1.00 . A A . 125 ASN O    1 1 
        5  9429 1 1 125 ASN OXT  O  70.466  -5.566 -32.966 1.00 . A A . 125 ASN OXT  1 1 
        5  9430 1 1 125 ASN OD1  O  72.528  -5.581 -35.986 1.00 . A A . 125 ASN OD1  1 1 
        6  9431 1 1   1 GLY C    C  16.159  13.507 -72.211 1.00 . A A .   1 GLY C    1 1 
        6  9432 1 1   1 GLY CA   C  17.046  14.477 -72.964 1.00 . A A .   1 GLY CA   1 1 
        6  9433 1 1   1 GLY H1   H  18.942  14.788 -72.431 1.00 . A A .   1 GLY H1   1 1 
        6  9434 1 1   1 GLY H2   H  18.777  14.098 -73.899 1.00 . A A .   1 GLY H2   1 1 
        6  9435 1 1   1 GLY H3   H  18.699  13.215 -72.561 1.00 . A A .   1 GLY H3   1 1 
        6  9436 1 1   1 GLY HA2  H  16.957  15.455 -72.515 1.00 . A A .   1 GLY HA2  1 1 
        6  9437 1 1   1 GLY HA3  H  16.712  14.529 -73.990 1.00 . A A .   1 GLY HA3  1 1 
        6  9438 1 1   1 GLY N    N  18.442  14.078 -72.946 1.00 . A A .   1 GLY N    1 1 
        6  9439 1 1   1 GLY O    O  16.485  12.327 -72.081 1.00 . A A .   1 GLY O    1 1 
        6  9440 1 1   2 SER C    C  12.818  13.948 -70.645 1.00 . A A .   2 SER C    1 1 
        6  9441 1 1   2 SER CA   C  14.097  13.176 -70.959 1.00 . A A .   2 SER CA   1 1 
        6  9442 1 1   2 SER CB   C  14.742  12.688 -69.660 1.00 . A A .   2 SER CB   1 1 
        6  9443 1 1   2 SER H    H  14.828  14.954 -71.845 1.00 . A A .   2 SER H    1 1 
        6  9444 1 1   2 SER HA   H  13.848  12.322 -71.570 1.00 . A A .   2 SER HA   1 1 
        6  9445 1 1   2 SER HB2  H  15.810  12.904 -69.689 1.00 . A A .   2 SER HB2  1 1 
        6  9446 1 1   2 SER HB3  H  14.298  13.206 -68.823 1.00 . A A .   2 SER HB3  1 1 
        6  9447 1 1   2 SER HG   H  14.458  11.097 -68.554 1.00 . A A .   2 SER HG   1 1 
        6  9448 1 1   2 SER N    N  15.033  14.005 -71.709 1.00 . A A .   2 SER N    1 1 
        6  9449 1 1   2 SER O    O  12.849  14.977 -69.972 1.00 . A A .   2 SER O    1 1 
        6  9450 1 1   2 SER OG   O  14.554  11.295 -69.488 1.00 . A A .   2 SER OG   1 1 
        6  9451 1 1   3 LYS C    C   9.435  13.120 -70.225 1.00 . A A .   3 LYS C    1 1 
        6  9452 1 1   3 LYS CA   C  10.402  14.079 -70.911 1.00 . A A .   3 LYS CA   1 1 
        6  9453 1 1   3 LYS CB   C   9.807  14.559 -72.238 1.00 . A A .   3 LYS CB   1 1 
        6  9454 1 1   3 LYS CD   C  10.549  16.126 -74.054 1.00 . A A .   3 LYS CD   1 1 
        6  9455 1 1   3 LYS CE   C  11.670  17.134 -74.252 1.00 . A A .   3 LYS CE   1 1 
        6  9456 1 1   3 LYS CG   C  10.177  15.989 -72.588 1.00 . A A .   3 LYS CG   1 1 
        6  9457 1 1   3 LYS H    H  11.732  12.616 -71.668 1.00 . A A .   3 LYS H    1 1 
        6  9458 1 1   3 LYS HA   H  10.561  14.931 -70.269 1.00 . A A .   3 LYS HA   1 1 
        6  9459 1 1   3 LYS HB2  H  10.156  13.903 -73.035 1.00 . A A .   3 LYS HB2  1 1 
        6  9460 1 1   3 LYS HB3  H   8.731  14.490 -72.180 1.00 . A A .   3 LYS HB3  1 1 
        6  9461 1 1   3 LYS HD2  H  10.871  15.155 -74.432 1.00 . A A .   3 LYS HD2  1 1 
        6  9462 1 1   3 LYS HD3  H   9.681  16.452 -74.609 1.00 . A A .   3 LYS HD3  1 1 
        6  9463 1 1   3 LYS HE2  H  11.311  18.125 -73.974 1.00 . A A .   3 LYS HE2  1 1 
        6  9464 1 1   3 LYS HE3  H  12.497  16.866 -73.611 1.00 . A A .   3 LYS HE3  1 1 
        6  9465 1 1   3 LYS HG2  H   9.329  16.640 -72.373 1.00 . A A .   3 LYS HG2  1 1 
        6  9466 1 1   3 LYS HG3  H  11.019  16.292 -71.982 1.00 . A A .   3 LYS HG3  1 1 
        6  9467 1 1   3 LYS HZ1  H  11.826  16.316 -76.169 1.00 . A A .   3 LYS HZ1  1 1 
        6  9468 1 1   3 LYS HZ2  H  13.183  17.207 -75.692 1.00 . A A .   3 LYS HZ2  1 1 
        6  9469 1 1   3 LYS HZ3  H  11.765  18.006 -76.149 1.00 . A A .   3 LYS HZ3  1 1 
        6  9470 1 1   3 LYS N    N  11.694  13.441 -71.138 1.00 . A A .   3 LYS N    1 1 
        6  9471 1 1   3 LYS NZ   N  12.143  17.168 -75.665 1.00 . A A .   3 LYS NZ   1 1 
        6  9472 1 1   3 LYS O    O   9.594  11.903 -70.300 1.00 . A A .   3 LYS O    1 1 
        6  9473 1 1   4 ASN C    C   6.378  13.757 -68.206 1.00 . A A .   4 ASN C    1 1 
        6  9474 1 1   4 ASN CA   C   7.436  12.871 -68.858 1.00 . A A .   4 ASN CA   1 1 
        6  9475 1 1   4 ASN CB   C   8.110  11.999 -67.798 1.00 . A A .   4 ASN CB   1 1 
        6  9476 1 1   4 ASN CG   C   8.251  10.556 -68.244 1.00 . A A .   4 ASN CG   1 1 
        6  9477 1 1   4 ASN H    H   8.356  14.654 -69.534 1.00 . A A .   4 ASN H    1 1 
        6  9478 1 1   4 ASN HA   H   6.956  12.234 -69.585 1.00 . A A .   4 ASN HA   1 1 
        6  9479 1 1   4 ASN HB2  H   9.100  12.402 -67.586 1.00 . A A .   4 ASN HB2  1 1 
        6  9480 1 1   4 ASN HB3  H   7.521  12.021 -66.894 1.00 . A A .   4 ASN HB3  1 1 
        6  9481 1 1   4 ASN HD21 H  10.064  10.458 -67.431 1.00 . A A .   4 ASN HD21 1 1 
        6  9482 1 1   4 ASN HD22 H   9.508   9.015 -68.203 1.00 . A A .   4 ASN HD22 1 1 
        6  9483 1 1   4 ASN N    N   8.429  13.678 -69.558 1.00 . A A .   4 ASN N    1 1 
        6  9484 1 1   4 ASN ND2  N   9.389   9.948 -67.927 1.00 . A A .   4 ASN ND2  1 1 
        6  9485 1 1   4 ASN O    O   6.570  14.963 -68.054 1.00 . A A .   4 ASN O    1 1 
        6  9486 1 1   4 ASN OD1  O   7.348   9.994 -68.863 1.00 . A A .   4 ASN OD1  1 1 
        6  9487 1 1   5 LYS C    C   3.310  12.945 -66.343 1.00 . A A .   5 LYS C    1 1 
        6  9488 1 1   5 LYS CA   C   4.172  13.881 -67.185 1.00 . A A .   5 LYS CA   1 1 
        6  9489 1 1   5 LYS CB   C   3.310  14.575 -68.240 1.00 . A A .   5 LYS CB   1 1 
        6  9490 1 1   5 LYS CD   C   4.471  15.842 -70.072 1.00 . A A .   5 LYS CD   1 1 
        6  9491 1 1   5 LYS CE   C   5.169  17.140 -70.448 1.00 . A A .   5 LYS CE   1 1 
        6  9492 1 1   5 LYS CG   C   3.859  15.920 -68.684 1.00 . A A .   5 LYS CG   1 1 
        6  9493 1 1   5 LYS H    H   5.167  12.184 -67.971 1.00 . A A .   5 LYS H    1 1 
        6  9494 1 1   5 LYS HA   H   4.607  14.627 -66.539 1.00 . A A .   5 LYS HA   1 1 
        6  9495 1 1   5 LYS HB2  H   3.232  13.925 -69.111 1.00 . A A .   5 LYS HB2  1 1 
        6  9496 1 1   5 LYS HB3  H   2.321  14.731 -67.834 1.00 . A A .   5 LYS HB3  1 1 
        6  9497 1 1   5 LYS HD2  H   5.195  15.027 -70.097 1.00 . A A .   5 LYS HD2  1 1 
        6  9498 1 1   5 LYS HD3  H   3.689  15.642 -70.791 1.00 . A A .   5 LYS HD3  1 1 
        6  9499 1 1   5 LYS HE2  H   5.401  17.124 -71.513 1.00 . A A .   5 LYS HE2  1 1 
        6  9500 1 1   5 LYS HE3  H   4.500  17.964 -70.244 1.00 . A A .   5 LYS HE3  1 1 
        6  9501 1 1   5 LYS HG2  H   3.050  16.651 -68.691 1.00 . A A .   5 LYS HG2  1 1 
        6  9502 1 1   5 LYS HG3  H   4.617  16.239 -67.983 1.00 . A A .   5 LYS HG3  1 1 
        6  9503 1 1   5 LYS HZ1  H   6.968  16.448 -69.644 1.00 . A A .   5 LYS HZ1  1 1 
        6  9504 1 1   5 LYS HZ2  H   6.210  17.635 -68.706 1.00 . A A .   5 LYS HZ2  1 1 
        6  9505 1 1   5 LYS HZ3  H   7.013  18.067 -70.131 1.00 . A A .   5 LYS HZ3  1 1 
        6  9506 1 1   5 LYS N    N   5.260  13.149 -67.823 1.00 . A A .   5 LYS N    1 1 
        6  9507 1 1   5 LYS NZ   N   6.428  17.337 -69.679 1.00 . A A .   5 LYS NZ   1 1 
        6  9508 1 1   5 LYS O    O   2.297  12.426 -66.814 1.00 . A A .   5 LYS O    1 1 
        6  9509 1 1   6 LYS C    C   2.030  12.678 -63.305 1.00 . A A .   6 LYS C    1 1 
        6  9510 1 1   6 LYS CA   C   2.976  11.868 -64.186 1.00 . A A .   6 LYS CA   1 1 
        6  9511 1 1   6 LYS CB   C   3.947  11.071 -63.311 1.00 . A A .   6 LYS CB   1 1 
        6  9512 1 1   6 LYS CD   C   5.539  11.142 -61.370 1.00 . A A .   6 LYS CD   1 1 
        6  9513 1 1   6 LYS CE   C   6.722  11.895 -60.779 1.00 . A A .   6 LYS CE   1 1 
        6  9514 1 1   6 LYS CG   C   4.865  11.941 -62.471 1.00 . A A .   6 LYS CG   1 1 
        6  9515 1 1   6 LYS H    H   4.529  13.180 -64.777 1.00 . A A .   6 LYS H    1 1 
        6  9516 1 1   6 LYS HA   H   2.395  11.180 -64.782 1.00 . A A .   6 LYS HA   1 1 
        6  9517 1 1   6 LYS HB2  H   3.370  10.429 -62.645 1.00 . A A .   6 LYS HB2  1 1 
        6  9518 1 1   6 LYS HB3  H   4.558  10.448 -63.946 1.00 . A A .   6 LYS HB3  1 1 
        6  9519 1 1   6 LYS HD2  H   4.814  10.939 -60.582 1.00 . A A .   6 LYS HD2  1 1 
        6  9520 1 1   6 LYS HD3  H   5.888  10.204 -61.780 1.00 . A A .   6 LYS HD3  1 1 
        6  9521 1 1   6 LYS HE2  H   7.374  12.226 -61.587 1.00 . A A .   6 LYS HE2  1 1 
        6  9522 1 1   6 LYS HE3  H   6.352  12.759 -60.247 1.00 . A A .   6 LYS HE3  1 1 
        6  9523 1 1   6 LYS HG2  H   5.630  12.378 -63.115 1.00 . A A .   6 LYS HG2  1 1 
        6  9524 1 1   6 LYS HG3  H   4.284  12.735 -62.024 1.00 . A A .   6 LYS HG3  1 1 
        6  9525 1 1   6 LYS HZ1  H   6.894  10.703 -59.072 1.00 . A A .   6 LYS HZ1  1 1 
        6  9526 1 1   6 LYS HZ2  H   8.284  11.598 -59.425 1.00 . A A .   6 LYS HZ2  1 1 
        6  9527 1 1   6 LYS HZ3  H   7.904  10.228 -60.343 1.00 . A A .   6 LYS HZ3  1 1 
        6  9528 1 1   6 LYS N    N   3.714  12.737 -65.095 1.00 . A A .   6 LYS N    1 1 
        6  9529 1 1   6 LYS NZ   N   7.505  11.045 -59.839 1.00 . A A .   6 LYS NZ   1 1 
        6  9530 1 1   6 LYS O    O   2.232  13.872 -63.098 1.00 . A A .   6 LYS O    1 1 
        6  9531 1 1   7 GLU C    C  -0.796  11.654 -61.149 1.00 . A A .   7 GLU C    1 1 
        6  9532 1 1   7 GLU CA   C   0.019  12.677 -61.935 1.00 . A A .   7 GLU CA   1 1 
        6  9533 1 1   7 GLU CB   C  -0.915  13.556 -62.770 1.00 . A A .   7 GLU CB   1 1 
        6  9534 1 1   7 GLU CD   C  -2.833  13.418 -64.407 1.00 . A A .   7 GLU CD   1 1 
        6  9535 1 1   7 GLU CG   C  -1.494  12.848 -63.983 1.00 . A A .   7 GLU CG   1 1 
        6  9536 1 1   7 GLU H    H   0.888  11.065 -62.996 1.00 . A A .   7 GLU H    1 1 
        6  9537 1 1   7 GLU HA   H   0.558  13.302 -61.239 1.00 . A A .   7 GLU HA   1 1 
        6  9538 1 1   7 GLU HB2  H  -1.736  13.894 -62.138 1.00 . A A .   7 GLU HB2  1 1 
        6  9539 1 1   7 GLU HB3  H  -0.365  14.421 -63.114 1.00 . A A .   7 GLU HB3  1 1 
        6  9540 1 1   7 GLU HG2  H  -0.793  12.937 -64.812 1.00 . A A .   7 GLU HG2  1 1 
        6  9541 1 1   7 GLU HG3  H  -1.624  11.802 -63.745 1.00 . A A .   7 GLU HG3  1 1 
        6  9542 1 1   7 GLU N    N   0.996  12.017 -62.792 1.00 . A A .   7 GLU N    1 1 
        6  9543 1 1   7 GLU O    O  -0.587  10.447 -61.276 1.00 . A A .   7 GLU O    1 1 
        6  9544 1 1   7 GLU OE1  O  -2.954  14.659 -64.476 1.00 . A A .   7 GLU OE1  1 1 
        6  9545 1 1   7 GLU OE2  O  -3.761  12.624 -64.671 1.00 . A A .   7 GLU OE2  1 1 
        6  9546 1 1   8 LYS C    C  -3.819  12.015 -59.058 1.00 . A A .   8 LYS C    1 1 
        6  9547 1 1   8 LYS CA   C  -2.573  11.274 -59.530 1.00 . A A .   8 LYS CA   1 1 
        6  9548 1 1   8 LYS CB   C  -1.793  10.744 -58.324 1.00 . A A .   8 LYS CB   1 1 
        6  9549 1 1   8 LYS CD   C   0.405  11.932 -58.073 1.00 . A A .   8 LYS CD   1 1 
        6  9550 1 1   8 LYS CE   C   1.399  11.449 -57.027 1.00 . A A .   8 LYS CE   1 1 
        6  9551 1 1   8 LYS CG   C  -1.026  11.820 -57.575 1.00 . A A .   8 LYS CG   1 1 
        6  9552 1 1   8 LYS H    H  -1.844  13.116 -60.278 1.00 . A A .   8 LYS H    1 1 
        6  9553 1 1   8 LYS HA   H  -2.875  10.441 -60.146 1.00 . A A .   8 LYS HA   1 1 
        6  9554 1 1   8 LYS HB2  H  -2.494  10.271 -57.636 1.00 . A A .   8 LYS HB2  1 1 
        6  9555 1 1   8 LYS HB3  H  -1.089  10.000 -58.665 1.00 . A A .   8 LYS HB3  1 1 
        6  9556 1 1   8 LYS HD2  H   0.517  11.332 -58.976 1.00 . A A .   8 LYS HD2  1 1 
        6  9557 1 1   8 LYS HD3  H   0.617  12.967 -58.307 1.00 . A A .   8 LYS HD3  1 1 
        6  9558 1 1   8 LYS HE2  H   1.321  12.081 -56.143 1.00 . A A .   8 LYS HE2  1 1 
        6  9559 1 1   8 LYS HE3  H   1.150  10.434 -56.757 1.00 . A A .   8 LYS HE3  1 1 
        6  9560 1 1   8 LYS HG2  H  -1.528  12.778 -57.712 1.00 . A A .   8 LYS HG2  1 1 
        6  9561 1 1   8 LYS HG3  H  -1.013  11.574 -56.523 1.00 . A A .   8 LYS HG3  1 1 
        6  9562 1 1   8 LYS HZ1  H   3.079  12.469 -57.734 1.00 . A A .   8 LYS HZ1  1 1 
        6  9563 1 1   8 LYS HZ2  H   2.879  10.929 -58.406 1.00 . A A .   8 LYS HZ2  1 1 
        6  9564 1 1   8 LYS HZ3  H   3.446  11.093 -56.821 1.00 . A A .   8 LYS HZ3  1 1 
        6  9565 1 1   8 LYS N    N  -1.726  12.144 -60.336 1.00 . A A .   8 LYS N    1 1 
        6  9566 1 1   8 LYS NZ   N   2.799  11.488 -57.532 1.00 . A A .   8 LYS NZ   1 1 
        6  9567 1 1   8 LYS O    O  -3.734  13.133 -58.552 1.00 . A A .   8 LYS O    1 1 
        6  9568 1 1   9 ASN C    C  -6.792  11.292 -57.569 1.00 . A A .   9 ASN C    1 1 
        6  9569 1 1   9 ASN CA   C  -6.242  11.983 -58.813 1.00 . A A .   9 ASN CA   1 1 
        6  9570 1 1   9 ASN CB   C  -7.262  11.899 -59.950 1.00 . A A .   9 ASN CB   1 1 
        6  9571 1 1   9 ASN CG   C  -8.250  13.050 -59.926 1.00 . A A .   9 ASN CG   1 1 
        6  9572 1 1   9 ASN H    H  -4.981  10.492 -59.633 1.00 . A A .   9 ASN H    1 1 
        6  9573 1 1   9 ASN HA   H  -6.057  13.020 -58.583 1.00 . A A .   9 ASN HA   1 1 
        6  9574 1 1   9 ASN HB2  H  -6.731  11.909 -60.902 1.00 . A A .   9 ASN HB2  1 1 
        6  9575 1 1   9 ASN HB3  H  -7.812  10.974 -59.865 1.00 . A A .   9 ASN HB3  1 1 
        6  9576 1 1   9 ASN HD21 H  -8.661  12.770 -61.851 1.00 . A A .   9 ASN HD21 1 1 
        6  9577 1 1   9 ASN HD22 H  -9.515  14.058 -61.080 1.00 . A A .   9 ASN HD22 1 1 
        6  9578 1 1   9 ASN N    N  -4.977  11.383 -59.224 1.00 . A A .   9 ASN N    1 1 
        6  9579 1 1   9 ASN ND2  N  -8.872  13.320 -61.068 1.00 . A A .   9 ASN ND2  1 1 
        6  9580 1 1   9 ASN O    O  -7.024  10.083 -57.567 1.00 . A A .   9 ASN O    1 1 
        6  9581 1 1   9 ASN OD1  O  -8.451  13.687 -58.892 1.00 . A A .   9 ASN OD1  1 1 
        6  9582 1 1  10 LYS C    C  -8.733  12.340 -54.790 1.00 . A A .  10 LYS C    1 1 
        6  9583 1 1  10 LYS CA   C  -7.525  11.536 -55.260 1.00 . A A .  10 LYS CA   1 1 
        6  9584 1 1  10 LYS CB   C  -6.439  11.549 -54.182 1.00 . A A .  10 LYS CB   1 1 
        6  9585 1 1  10 LYS CD   C  -4.980   9.517 -54.412 1.00 . A A .  10 LYS CD   1 1 
        6  9586 1 1  10 LYS CE   C  -4.195   8.545 -53.544 1.00 . A A .  10 LYS CE   1 1 
        6  9587 1 1  10 LYS CG   C  -6.110  10.170 -53.634 1.00 . A A .  10 LYS CG   1 1 
        6  9588 1 1  10 LYS H    H  -6.795  13.027 -56.575 1.00 . A A .  10 LYS H    1 1 
        6  9589 1 1  10 LYS HA   H  -7.833  10.517 -55.438 1.00 . A A .  10 LYS HA   1 1 
        6  9590 1 1  10 LYS HB2  H  -5.533  11.984 -54.603 1.00 . A A .  10 LYS HB2  1 1 
        6  9591 1 1  10 LYS HB3  H  -6.772  12.167 -53.361 1.00 . A A .  10 LYS HB3  1 1 
        6  9592 1 1  10 LYS HD2  H  -5.396   8.979 -55.264 1.00 . A A .  10 LYS HD2  1 1 
        6  9593 1 1  10 LYS HD3  H  -4.310  10.287 -54.770 1.00 . A A .  10 LYS HD3  1 1 
        6  9594 1 1  10 LYS HE2  H  -4.625   8.536 -52.542 1.00 . A A .  10 LYS HE2  1 1 
        6  9595 1 1  10 LYS HE3  H  -4.276   7.556 -53.971 1.00 . A A .  10 LYS HE3  1 1 
        6  9596 1 1  10 LYS HG2  H  -5.819  10.260 -52.588 1.00 . A A .  10 LYS HG2  1 1 
        6  9597 1 1  10 LYS HG3  H  -6.991   9.545 -53.705 1.00 . A A .  10 LYS HG3  1 1 
        6  9598 1 1  10 LYS HZ1  H  -2.440   8.884 -52.463 1.00 . A A .  10 LYS HZ1  1 1 
        6  9599 1 1  10 LYS HZ2  H  -2.614   9.882 -53.818 1.00 . A A .  10 LYS HZ2  1 1 
        6  9600 1 1  10 LYS HZ3  H  -2.180   8.259 -54.014 1.00 . A A .  10 LYS HZ3  1 1 
        6  9601 1 1  10 LYS N    N  -7.001  12.070 -56.512 1.00 . A A .  10 LYS N    1 1 
        6  9602 1 1  10 LYS NZ   N  -2.757   8.917 -53.453 1.00 . A A .  10 LYS NZ   1 1 
        6  9603 1 1  10 LYS O    O  -9.047  13.390 -55.349 1.00 . A A .  10 LYS O    1 1 
        6  9604 1 1  11 GLY C    C -10.654  12.447 -51.718 1.00 . A A .  11 GLY C    1 1 
        6  9605 1 1  11 GLY CA   C -10.570  12.527 -53.229 1.00 . A A .  11 GLY CA   1 1 
        6  9606 1 1  11 GLY H    H  -9.109  11.000 -53.351 1.00 . A A .  11 GLY H    1 1 
        6  9607 1 1  11 GLY HA2  H -10.527  13.565 -53.523 1.00 . A A .  11 GLY HA2  1 1 
        6  9608 1 1  11 GLY HA3  H -11.458  12.081 -53.652 1.00 . A A .  11 GLY HA3  1 1 
        6  9609 1 1  11 GLY N    N  -9.406  11.840 -53.758 1.00 . A A .  11 GLY N    1 1 
        6  9610 1 1  11 GLY O    O  -9.708  12.018 -51.058 1.00 . A A .  11 GLY O    1 1 
        6  9611 1 1  12 GLY C    C -13.300  13.419 -49.297 1.00 . A A .  12 GLY C    1 1 
        6  9612 1 1  12 GLY CA   C -11.971  12.832 -49.726 1.00 . A A .  12 GLY CA   1 1 
        6  9613 1 1  12 GLY H    H -12.510  13.196 -51.742 1.00 . A A .  12 GLY H    1 1 
        6  9614 1 1  12 GLY HA2  H -11.917  11.807 -49.390 1.00 . A A .  12 GLY HA2  1 1 
        6  9615 1 1  12 GLY HA3  H -11.175  13.395 -49.263 1.00 . A A .  12 GLY HA3  1 1 
        6  9616 1 1  12 GLY N    N -11.790  12.864 -51.166 1.00 . A A .  12 GLY N    1 1 
        6  9617 1 1  12 GLY O    O -14.101  13.842 -50.132 1.00 . A A .  12 GLY O    1 1 
        6  9618 1 1  13 LYS C    C -14.768  13.956 -45.923 1.00 . A A .  13 LYS C    1 1 
        6  9619 1 1  13 LYS CA   C -14.780  13.985 -47.449 1.00 . A A .  13 LYS CA   1 1 
        6  9620 1 1  13 LYS CB   C -15.977  13.192 -47.976 1.00 . A A .  13 LYS CB   1 1 
        6  9621 1 1  13 LYS CD   C -17.595  13.305 -49.894 1.00 . A A .  13 LYS CD   1 1 
        6  9622 1 1  13 LYS CE   C -19.115  13.298 -49.838 1.00 . A A .  13 LYS CE   1 1 
        6  9623 1 1  13 LYS CG   C -16.998  14.044 -48.708 1.00 . A A .  13 LYS CG   1 1 
        6  9624 1 1  13 LYS H    H -12.861  13.094 -47.374 1.00 . A A .  13 LYS H    1 1 
        6  9625 1 1  13 LYS HA   H -14.867  15.011 -47.777 1.00 . A A .  13 LYS HA   1 1 
        6  9626 1 1  13 LYS HB2  H -15.614  12.421 -48.655 1.00 . A A .  13 LYS HB2  1 1 
        6  9627 1 1  13 LYS HB3  H -16.472  12.713 -47.142 1.00 . A A .  13 LYS HB3  1 1 
        6  9628 1 1  13 LYS HD2  H -17.273  13.788 -50.816 1.00 . A A .  13 LYS HD2  1 1 
        6  9629 1 1  13 LYS HD3  H -17.239  12.283 -49.885 1.00 . A A .  13 LYS HD3  1 1 
        6  9630 1 1  13 LYS HE2  H -19.496  12.598 -50.582 1.00 . A A .  13 LYS HE2  1 1 
        6  9631 1 1  13 LYS HE3  H -19.426  12.973 -48.856 1.00 . A A .  13 LYS HE3  1 1 
        6  9632 1 1  13 LYS HG2  H -17.796  14.318 -48.018 1.00 . A A .  13 LYS HG2  1 1 
        6  9633 1 1  13 LYS HG3  H -16.514  14.943 -49.064 1.00 . A A .  13 LYS HG3  1 1 
        6  9634 1 1  13 LYS HZ1  H -20.687  14.674 -49.829 1.00 . A A .  13 LYS HZ1  1 1 
        6  9635 1 1  13 LYS HZ2  H -19.609  14.874 -51.117 1.00 . A A .  13 LYS HZ2  1 1 
        6  9636 1 1  13 LYS HZ3  H -19.168  15.367 -49.560 1.00 . A A .  13 LYS HZ3  1 1 
        6  9637 1 1  13 LYS N    N -13.538  13.445 -47.990 1.00 . A A .  13 LYS N    1 1 
        6  9638 1 1  13 LYS NZ   N -19.685  14.649 -50.105 1.00 . A A .  13 LYS NZ   1 1 
        6  9639 1 1  13 LYS O    O -13.834  13.439 -45.311 1.00 . A A .  13 LYS O    1 1 
        6  9640 1 1  14 GLY C    C -15.014  15.599 -43.250 1.00 . A A .  14 GLY C    1 1 
        6  9641 1 1  14 GLY CA   C -15.901  14.536 -43.868 1.00 . A A .  14 GLY CA   1 1 
        6  9642 1 1  14 GLY H    H -16.526  14.909 -45.857 1.00 . A A .  14 GLY H    1 1 
        6  9643 1 1  14 GLY HA2  H -16.925  14.727 -43.585 1.00 . A A .  14 GLY HA2  1 1 
        6  9644 1 1  14 GLY HA3  H -15.606  13.570 -43.484 1.00 . A A .  14 GLY HA3  1 1 
        6  9645 1 1  14 GLY N    N -15.811  14.512 -45.317 1.00 . A A .  14 GLY N    1 1 
        6  9646 1 1  14 GLY O    O -13.793  15.561 -43.397 1.00 . A A .  14 GLY O    1 1 
        6  9647 1 1  15 GLY C    C -15.545  18.146 -40.676 1.00 . A A .  15 GLY C    1 1 
        6  9648 1 1  15 GLY CA   C -14.873  17.618 -41.928 1.00 . A A .  15 GLY CA   1 1 
        6  9649 1 1  15 GLY H    H -16.606  16.532 -42.474 1.00 . A A .  15 GLY H    1 1 
        6  9650 1 1  15 GLY HA2  H -13.894  17.245 -41.669 1.00 . A A .  15 GLY HA2  1 1 
        6  9651 1 1  15 GLY HA3  H -14.763  18.431 -42.632 1.00 . A A .  15 GLY HA3  1 1 
        6  9652 1 1  15 GLY N    N -15.629  16.553 -42.558 1.00 . A A .  15 GLY N    1 1 
        6  9653 1 1  15 GLY O    O -15.880  19.326 -40.592 1.00 . A A .  15 GLY O    1 1 
        6  9654 1 1  16 ALA C    C -15.731  16.938 -37.260 1.00 . A A .  16 ALA C    1 1 
        6  9655 1 1  16 ALA CA   C -16.379  17.649 -38.444 1.00 . A A .  16 ALA CA   1 1 
        6  9656 1 1  16 ALA CB   C -17.869  17.346 -38.493 1.00 . A A .  16 ALA CB   1 1 
        6  9657 1 1  16 ALA H    H -15.453  16.339 -39.824 1.00 . A A .  16 ALA H    1 1 
        6  9658 1 1  16 ALA HA   H -16.257  18.716 -38.320 1.00 . A A .  16 ALA HA   1 1 
        6  9659 1 1  16 ALA HB1  H -18.292  17.459 -37.506 1.00 . A A .  16 ALA HB1  1 1 
        6  9660 1 1  16 ALA HB2  H -18.354  18.029 -39.174 1.00 . A A .  16 ALA HB2  1 1 
        6  9661 1 1  16 ALA HB3  H -18.019  16.332 -38.834 1.00 . A A .  16 ALA HB3  1 1 
        6  9662 1 1  16 ALA N    N -15.743  17.266 -39.699 1.00 . A A .  16 ALA N    1 1 
        6  9663 1 1  16 ALA O    O -16.411  16.286 -36.467 1.00 . A A .  16 ALA O    1 1 
        6  9664 1 1  17 ASP C    C -13.758  14.915 -36.157 1.00 . A A .  17 ASP C    1 1 
        6  9665 1 1  17 ASP CA   C -13.674  16.436 -36.061 1.00 . A A .  17 ASP CA   1 1 
        6  9666 1 1  17 ASP CB   C -14.213  16.905 -34.709 1.00 . A A .  17 ASP CB   1 1 
        6  9667 1 1  17 ASP CG   C -14.947  15.805 -33.966 1.00 . A A .  17 ASP CG   1 1 
        6  9668 1 1  17 ASP H    H -13.927  17.598 -37.812 1.00 . A A .  17 ASP H    1 1 
        6  9669 1 1  17 ASP HA   H -12.640  16.732 -36.149 1.00 . A A .  17 ASP HA   1 1 
        6  9670 1 1  17 ASP HB2  H -13.381  17.252 -34.097 1.00 . A A .  17 ASP HB2  1 1 
        6  9671 1 1  17 ASP HB3  H -14.898  17.725 -34.867 1.00 . A A .  17 ASP HB3  1 1 
        6  9672 1 1  17 ASP N    N -14.414  17.065 -37.148 1.00 . A A .  17 ASP N    1 1 
        6  9673 1 1  17 ASP O    O -14.706  14.370 -36.721 1.00 . A A .  17 ASP O    1 1 
        6  9674 1 1  17 ASP OD1  O -14.273  14.909 -33.415 1.00 . A A .  17 ASP OD1  1 1 
        6  9675 1 1  17 ASP OD2  O -16.195  15.842 -33.933 1.00 . A A .  17 ASP OD2  1 1 
        6  9676 1 1  18 CYS C    C -13.311  12.198 -34.346 1.00 . A A .  18 CYS C    1 1 
        6  9677 1 1  18 CYS CA   C -12.718  12.780 -35.626 1.00 . A A .  18 CYS CA   1 1 
        6  9678 1 1  18 CYS CB   C -11.279  12.292 -35.800 1.00 . A A .  18 CYS CB   1 1 
        6  9679 1 1  18 CYS H    H -12.031  14.728 -35.167 1.00 . A A .  18 CYS H    1 1 
        6  9680 1 1  18 CYS HA   H -13.307  12.444 -36.466 1.00 . A A .  18 CYS HA   1 1 
        6  9681 1 1  18 CYS HB2  H -10.656  13.140 -36.084 1.00 . A A .  18 CYS HB2  1 1 
        6  9682 1 1  18 CYS HB3  H -10.921  11.902 -34.858 1.00 . A A .  18 CYS HB3  1 1 
        6  9683 1 1  18 CYS HG   H -12.281  10.474 -37.356 1.00 . A A .  18 CYS HG   1 1 
        6  9684 1 1  18 CYS N    N -12.760  14.236 -35.602 1.00 . A A .  18 CYS N    1 1 
        6  9685 1 1  18 CYS O    O -12.739  12.337 -33.266 1.00 . A A .  18 CYS O    1 1 
        6  9686 1 1  18 CYS SG   S -11.084  10.983 -37.052 1.00 . A A .  18 CYS SG   1 1 
        6  9687 1 1  19 ALA C    C -14.175  10.060 -32.538 1.00 . A A .  19 ALA C    1 1 
        6  9688 1 1  19 ALA CA   C -15.133  10.941 -33.333 1.00 . A A .  19 ALA CA   1 1 
        6  9689 1 1  19 ALA CB   C -16.338  10.135 -33.793 1.00 . A A .  19 ALA CB   1 1 
        6  9690 1 1  19 ALA H    H -14.869  11.468 -35.365 1.00 . A A .  19 ALA H    1 1 
        6  9691 1 1  19 ALA HA   H -15.486  11.739 -32.693 1.00 . A A .  19 ALA HA   1 1 
        6  9692 1 1  19 ALA HB1  H -17.241  10.585 -33.405 1.00 . A A .  19 ALA HB1  1 1 
        6  9693 1 1  19 ALA HB2  H -16.374  10.125 -34.872 1.00 . A A .  19 ALA HB2  1 1 
        6  9694 1 1  19 ALA HB3  H -16.254   9.122 -33.425 1.00 . A A .  19 ALA HB3  1 1 
        6  9695 1 1  19 ALA N    N -14.463  11.547 -34.477 1.00 . A A .  19 ALA N    1 1 
        6  9696 1 1  19 ALA O    O -13.862  10.352 -31.385 1.00 . A A .  19 ALA O    1 1 
        6  9697 1 1  20 GLU C    C -11.368   8.269 -33.012 1.00 . A A .  20 GLU C    1 1 
        6  9698 1 1  20 GLU CA   C -12.795   8.056 -32.512 1.00 . A A .  20 GLU CA   1 1 
        6  9699 1 1  20 GLU CB   C -13.225   6.610 -32.764 1.00 . A A .  20 GLU CB   1 1 
        6  9700 1 1  20 GLU CD   C -13.065   4.734 -31.081 1.00 . A A .  20 GLU CD   1 1 
        6  9701 1 1  20 GLU CG   C -12.327   5.583 -32.098 1.00 . A A .  20 GLU CG   1 1 
        6  9702 1 1  20 GLU H    H -14.001   8.801 -34.083 1.00 . A A .  20 GLU H    1 1 
        6  9703 1 1  20 GLU HA   H -12.823   8.250 -31.451 1.00 . A A .  20 GLU HA   1 1 
        6  9704 1 1  20 GLU HB2  H -14.242   6.479 -32.393 1.00 . A A .  20 GLU HB2  1 1 
        6  9705 1 1  20 GLU HB3  H -13.219   6.426 -33.829 1.00 . A A .  20 GLU HB3  1 1 
        6  9706 1 1  20 GLU HG2  H -11.907   4.931 -32.865 1.00 . A A .  20 GLU HG2  1 1 
        6  9707 1 1  20 GLU HG3  H -11.520   6.098 -31.598 1.00 . A A .  20 GLU HG3  1 1 
        6  9708 1 1  20 GLU N    N -13.715   8.981 -33.164 1.00 . A A .  20 GLU N    1 1 
        6  9709 1 1  20 GLU O    O -10.933   7.628 -33.969 1.00 . A A .  20 GLU O    1 1 
        6  9710 1 1  20 GLU OE1  O -13.874   5.298 -30.314 1.00 . A A .  20 GLU OE1  1 1 
        6  9711 1 1  20 GLU OE2  O -12.832   3.508 -31.049 1.00 . A A .  20 GLU OE2  1 1 
        6  9712 1 1  21 TRP C    C  -8.385   8.234 -32.580 1.00 . A A .  21 TRP C    1 1 
        6  9713 1 1  21 TRP CA   C  -9.269   9.467 -32.734 1.00 . A A .  21 TRP CA   1 1 
        6  9714 1 1  21 TRP CB   C  -8.721  10.612 -31.881 1.00 . A A .  21 TRP CB   1 1 
        6  9715 1 1  21 TRP CD1  C -10.230  12.659 -31.563 1.00 . A A .  21 TRP CD1  1 1 
        6  9716 1 1  21 TRP CD2  C  -8.946  12.739 -33.397 1.00 . A A .  21 TRP CD2  1 1 
        6  9717 1 1  21 TRP CE2  C  -9.722  13.913 -33.339 1.00 . A A .  21 TRP CE2  1 1 
        6  9718 1 1  21 TRP CE3  C  -8.062  12.567 -34.464 1.00 . A A .  21 TRP CE3  1 1 
        6  9719 1 1  21 TRP CG   C  -9.286  11.950 -32.250 1.00 . A A .  21 TRP CG   1 1 
        6  9720 1 1  21 TRP CH2  C  -8.762  14.713 -35.344 1.00 . A A .  21 TRP CH2  1 1 
        6  9721 1 1  21 TRP CZ2  C  -9.638  14.909 -34.309 1.00 . A A .  21 TRP CZ2  1 1 
        6  9722 1 1  21 TRP CZ3  C  -7.980  13.555 -35.427 1.00 . A A .  21 TRP CZ3  1 1 
        6  9723 1 1  21 TRP H    H -11.049   9.648 -31.600 1.00 . A A .  21 TRP H    1 1 
        6  9724 1 1  21 TRP HA   H  -9.267   9.769 -33.771 1.00 . A A .  21 TRP HA   1 1 
        6  9725 1 1  21 TRP HB2  H  -8.948  10.411 -30.834 1.00 . A A .  21 TRP HB2  1 1 
        6  9726 1 1  21 TRP HB3  H  -7.648  10.660 -32.001 1.00 . A A .  21 TRP HB3  1 1 
        6  9727 1 1  21 TRP HD1  H -10.689  12.327 -30.644 1.00 . A A .  21 TRP HD1  1 1 
        6  9728 1 1  21 TRP HE1  H -11.136  14.521 -31.914 1.00 . A A .  21 TRP HE1  1 1 
        6  9729 1 1  21 TRP HE3  H  -7.450  11.680 -34.545 1.00 . A A .  21 TRP HE3  1 1 
        6  9730 1 1  21 TRP HH2  H  -8.667  15.459 -36.119 1.00 . A A .  21 TRP HH2  1 1 
        6  9731 1 1  21 TRP HZ2  H -10.233  15.807 -34.260 1.00 . A A .  21 TRP HZ2  1 1 
        6  9732 1 1  21 TRP HZ3  H  -7.301  13.439 -36.261 1.00 . A A .  21 TRP HZ3  1 1 
        6  9733 1 1  21 TRP N    N -10.647   9.170 -32.357 1.00 . A A .  21 TRP N    1 1 
        6  9734 1 1  21 TRP NE1  N -10.495  13.841 -32.211 1.00 . A A .  21 TRP NE1  1 1 
        6  9735 1 1  21 TRP O    O  -8.250   7.688 -31.485 1.00 . A A .  21 TRP O    1 1 
        6  9736 1 1  22 LEU C    C  -5.448   7.042 -33.819 1.00 . A A .  22 LEU C    1 1 
        6  9737 1 1  22 LEU CA   C  -6.910   6.632 -33.670 1.00 . A A .  22 LEU CA   1 1 
        6  9738 1 1  22 LEU CB   C  -7.299   5.668 -34.792 1.00 . A A .  22 LEU CB   1 1 
        6  9739 1 1  22 LEU CD1  C  -6.529   5.584 -37.176 1.00 . A A .  22 LEU CD1  1 1 
        6  9740 1 1  22 LEU CD2  C  -8.892   6.213 -36.650 1.00 . A A .  22 LEU CD2  1 1 
        6  9741 1 1  22 LEU CG   C  -7.444   6.283 -36.185 1.00 . A A .  22 LEU CG   1 1 
        6  9742 1 1  22 LEU H    H  -7.929   8.279 -34.525 1.00 . A A .  22 LEU H    1 1 
        6  9743 1 1  22 LEU HA   H  -7.037   6.135 -32.719 1.00 . A A .  22 LEU HA   1 1 
        6  9744 1 1  22 LEU HB2  H  -6.547   4.880 -34.842 1.00 . A A .  22 LEU HB2  1 1 
        6  9745 1 1  22 LEU HB3  H  -8.246   5.218 -34.527 1.00 . A A .  22 LEU HB3  1 1 
        6  9746 1 1  22 LEU HD11 H  -6.743   5.935 -38.173 1.00 . A A .  22 LEU HD11 1 1 
        6  9747 1 1  22 LEU HD12 H  -6.694   4.518 -37.127 1.00 . A A .  22 LEU HD12 1 1 
        6  9748 1 1  22 LEU HD13 H  -5.500   5.799 -36.929 1.00 . A A .  22 LEU HD13 1 1 
        6  9749 1 1  22 LEU HD21 H  -9.489   6.902 -36.073 1.00 . A A .  22 LEU HD21 1 1 
        6  9750 1 1  22 LEU HD22 H  -9.265   5.209 -36.512 1.00 . A A .  22 LEU HD22 1 1 
        6  9751 1 1  22 LEU HD23 H  -8.946   6.477 -37.697 1.00 . A A .  22 LEU HD23 1 1 
        6  9752 1 1  22 LEU HG   H  -7.157   7.325 -36.142 1.00 . A A .  22 LEU HG   1 1 
        6  9753 1 1  22 LEU N    N  -7.783   7.801 -33.683 1.00 . A A .  22 LEU N    1 1 
        6  9754 1 1  22 LEU O    O  -5.076   7.707 -34.787 1.00 . A A .  22 LEU O    1 1 
        6  9755 1 1  23 TYR C    C  -2.357   5.699 -32.961 1.00 . A A .  23 TYR