NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
496445 2l30 17157 cing 4-filtered-FRED STAR entry full 1659


data_FRED_restraints_with_modified_coordinates_PDB_code_2l30

# This FRED archive file contains, for PDB entry <2l30>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2l30
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2l30
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all other bound"
    _Assembly.Molecular_mass        12176.03

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Poly__ADP_ribose__polymerase_1 A . 1 1 
       2 . 2 $ZINC_ION                       B . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       2 2 ZN 1 ZN 1 1 
    stop_

save_


save_Poly__ADP_ribose__polymerase_1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Poly  ADP ribose  polymerase 1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEK
    _Entity.Number_of_monomers           108

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 ALA . 1 1 
         3 GLU . 1 1 
         4 SER . 1 1 
         5 SER . 1 1 
         6 ASP . 1 1 
         7 LYS . 1 1 
         8 LEU . 1 1 
         9 TYR . 1 1 
        10 ARG . 1 1 
        11 VAL . 1 1 
        12 GLU . 1 1 
        13 TYR . 1 1 
        14 ALA . 1 1 
        15 LYS . 1 1 
        16 SER . 1 1 
        17 GLY . 1 1 
        18 ARG . 1 1 
        19 ALA . 1 1 
        20 SER . 1 1 
        21 CYS . 1 1 
        22 LYS . 1 1 
        23 LYS . 1 1 
        24 CYS . 1 1 
        25 SER . 1 1 
        26 GLU . 1 1 
        27 SER . 1 1 
        28 ILE . 1 1 
        29 PRO . 1 1 
        30 LYS . 1 1 
        31 ASP . 1 1 
        32 SER . 1 1 
        33 LEU . 1 1 
        34 ARG . 1 1 
        35 MET . 1 1 
        36 ALA . 1 1 
        37 ILE . 1 1 
        38 MET . 1 1 
        39 VAL . 1 1 
        40 GLN . 1 1 
        41 SER . 1 1 
        42 PRO . 1 1 
        43 MET . 1 1 
        44 PHE . 1 1 
        45 ASP . 1 1 
        46 GLY . 1 1 
        47 LYS . 1 1 
        48 VAL . 1 1 
        49 PRO . 1 1 
        50 HIS . 1 1 
        51 TRP . 1 1 
        52 TYR . 1 1 
        53 HIS . 1 1 
        54 PHE . 1 1 
        55 SER . 1 1 
        56 CYS . 1 1 
        57 PHE . 1 1 
        58 TRP . 1 1 
        59 LYS . 1 1 
        60 VAL . 1 1 
        61 GLY . 1 1 
        62 HIS . 1 1 
        63 SER . 1 1 
        64 ILE . 1 1 
        65 ARG . 1 1 
        66 HIS . 1 1 
        67 PRO . 1 1 
        68 ASP . 1 1 
        69 VAL . 1 1 
        70 GLU . 1 1 
        71 VAL . 1 1 
        72 ASP . 1 1 
        73 GLY . 1 1 
        74 PHE . 1 1 
        75 SER . 1 1 
        76 GLU . 1 1 
        77 LEU . 1 1 
        78 ARG . 1 1 
        79 TRP . 1 1 
        80 ASP . 1 1 
        81 ASP . 1 1 
        82 GLN . 1 1 
        83 GLN . 1 1 
        84 LYS . 1 1 
        85 VAL . 1 1 
        86 LYS . 1 1 
        87 LYS . 1 1 
        88 THR . 1 1 
        89 ALA . 1 1 
        90 GLU . 1 1 
        91 ALA . 1 1 
        92 GLY . 1 1 
        93 GLY . 1 1 
        94 VAL . 1 1 
        95 THR . 1 1 
        96 GLY . 1 1 
        97 LYS . 1 1 
        98 GLY . 1 1 
        99 GLN . 1 1 
       100 ASP . 1 1 
       101 GLY . 1 1 
       102 ILE . 1 1 
       103 GLY . 1 1 
       104 SER . 1 1 
       105 LYS . 1 1 
       106 ALA . 1 1 
       107 GLU . 1 1 
       108 LYS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       ALA   2   2 1 1 
       GLU   3   3 1 1 
       SER   4   4 1 1 
       SER   5   5 1 1 
       ASP   6   6 1 1 
       LYS   7   7 1 1 
       LEU   8   8 1 1 
       TYR   9   9 1 1 
       ARG  10  10 1 1 
       VAL  11  11 1 1 
       GLU  12  12 1 1 
       TYR  13  13 1 1 
       ALA  14  14 1 1 
       LYS  15  15 1 1 
       SER  16  16 1 1 
       GLY  17  17 1 1 
       ARG  18  18 1 1 
       ALA  19  19 1 1 
       SER  20  20 1 1 
       CYS  21  21 1 1 
       LYS  22  22 1 1 
       LYS  23  23 1 1 
       CYS  24  24 1 1 
       SER  25  25 1 1 
       GLU  26  26 1 1 
       SER  27  27 1 1 
       ILE  28  28 1 1 
       PRO  29  29 1 1 
       LYS  30  30 1 1 
       ASP  31  31 1 1 
       SER  32  32 1 1 
       LEU  33  33 1 1 
       ARG  34  34 1 1 
       MET  35  35 1 1 
       ALA  36  36 1 1 
       ILE  37  37 1 1 
       MET  38  38 1 1 
       VAL  39  39 1 1 
       GLN  40  40 1 1 
       SER  41  41 1 1 
       PRO  42  42 1 1 
       MET  43  43 1 1 
       PHE  44  44 1 1 
       ASP  45  45 1 1 
       GLY  46  46 1 1 
       LYS  47  47 1 1 
       VAL  48  48 1 1 
       PRO  49  49 1 1 
       HIS  50  50 1 1 
       TRP  51  51 1 1 
       TYR  52  52 1 1 
       HIS  53  53 1 1 
       PHE  54  54 1 1 
       SER  55  55 1 1 
       CYS  56  56 1 1 
       PHE  57  57 1 1 
       TRP  58  58 1 1 
       LYS  59  59 1 1 
       VAL  60  60 1 1 
       GLY  61  61 1 1 
       HIS  62  62 1 1 
       SER  63  63 1 1 
       ILE  64  64 1 1 
       ARG  65  65 1 1 
       HIS  66  66 1 1 
       PRO  67  67 1 1 
       ASP  68  68 1 1 
       VAL  69  69 1 1 
       GLU  70  70 1 1 
       VAL  71  71 1 1 
       ASP  72  72 1 1 
       GLY  73  73 1 1 
       PHE  74  74 1 1 
       SER  75  75 1 1 
       GLU  76  76 1 1 
       LEU  77  77 1 1 
       ARG  78  78 1 1 
       TRP  79  79 1 1 
       ASP  80  80 1 1 
       ASP  81  81 1 1 
       GLN  82  82 1 1 
       GLN  83  83 1 1 
       LYS  84  84 1 1 
       VAL  85  85 1 1 
       LYS  86  86 1 1 
       LYS  87  87 1 1 
       THR  88  88 1 1 
       ALA  89  89 1 1 
       GLU  90  90 1 1 
       ALA  91  91 1 1 
       GLY  92  92 1 1 
       GLY  93  93 1 1 
       VAL  94  94 1 1 
       THR  95  95 1 1 
       GLY  96  96 1 1 
       LYS  97  97 1 1 
       GLY  98  98 1 1 
       GLN  99  99 1 1 
       ASP 100 100 1 1 
       GLY 101 101 1 1 
       ILE 102 102 1 1 
       GLY 103 103 1 1 
       SER 104 104 1 1 
       LYS 105 105 1 1 
       ALA 106 106 1 1 
       GLU 107 107 1 1 
       LYS 108 108 1 1 
    stop_

save_


save_ZINC_ION
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           2
    _Entity.Name         "ZINC ION"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 ZN $ZN 1 2 
    stop_

save_


save_ZN
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           ZN
    _Chem_comp.Type         non-polymer

save_


save_AMBER_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   3 GLU HA  2l30_ambr001   3 GLU HA   1 1 
          1 1 2 1 1   4 SER QB  2l30_ambr001   4 SER HB2  1 1 
          2 1 1 1 1   3 GLU QB  2l30_ambr001   3 GLU HB2  1 1 
          2 1 2 1 1   4 SER H   2l30_ambr001   4 GLU H    1 1 
          3 1 1 1 1   5 SER H   2l30_ambr001   5 SER H    1 1 
          3 1 2 1 1   6 ASP HA  2l30_ambr001   6 ASP HA   1 1 
          4 1 1 1 1   5 SER H   2l30_ambr001   5 SER H    1 1 
          4 1 2 1 1   7 LYS QE  2l30_ambr001   7 LYS HE2  1 1 
          5 1 1 1 1   5 SER HA  2l30_ambr001   5 SER HA   1 1 
          5 1 2 1 1   6 ASP HA  2l30_ambr001   6 ASP HA   1 1 
          6 1 1 1 1   5 SER HA  2l30_ambr001   5 SER HA   1 1 
          6 1 2 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
          7 1 1 1 1   5 SER HA  2l30_ambr001   5 SER HA   1 1 
          7 1 2 1 1   7 LYS QE  2l30_ambr001   7 LYS HE2  1 1 
          8 1 1 1 1   5 SER HA  2l30_ambr001   5 SER HA   1 1 
          8 1 2 1 1   7 LYS QG  2l30_ambr001   7 LYS HG2  1 1 
          9 1 1 1 1   5 SER QB  2l30_ambr001   5 SER HB2  1 1 
          9 1 2 1 1   7 LYS H   2l30_ambr001   7 SER H    1 1 
         10 1 1 1 1   5 SER QB  2l30_ambr001   5 SER HB2  1 1 
         10 1 2 1 1  47 LYS QB  2l30_ambr001  47 SER HB2  1 1 
         11 1 1 1 1   5 SER QB  2l30_ambr001   5 SER HB2  1 1 
         11 1 2 1 1  47 LYS QG  2l30_ambr001  47 SER HG2  1 1 
         12 1 1 1 1   6 ASP H   2l30_ambr001   6 ASP H    1 1 
         12 1 2 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         13 1 1 1 1   6 ASP H   2l30_ambr001   6 ASP H    1 1 
         13 1 2 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         14 1 1 1 1   6 ASP HA  2l30_ambr001   6 ASP HA   1 1 
         14 1 2 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         15 1 1 1 1   6 ASP HA  2l30_ambr001   6 ASP HA   1 1 
         15 1 2 1 1   7 LYS QE  2l30_ambr001   7 LYS HE2  1 1 
         16 1 1 1 1   6 ASP HA  2l30_ambr001   6 ASP HA   1 1 
         16 1 2 1 1   7 LYS QG  2l30_ambr001   7 LYS HG2  1 1 
         17 1 1 1 1   6 ASP QB  2l30_ambr001   6 ASP HB2  1 1 
         17 1 2 1 1   7 LYS H   2l30_ambr001   7 ASP H    1 1 
         18 1 1 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         18 1 2 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         19 1 1 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         19 1 2 1 1   7 LYS QE  2l30_ambr001   7 LYS HE2  1 1 
         20 1 1 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         20 1 2 1 1   7 LYS QG  2l30_ambr001   7 LYS HG2  1 1 
         21 1 1 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         21 1 2 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         22 1 1 1 1   7 LYS H   2l30_ambr001   7 LYS H    1 1 
         22 1 2 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         23 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         23 1 2 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         24 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         24 1 2 1 1   7 LYS QG  2l30_ambr001   7 LYS HG2  1 1 
         25 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         25 1 2 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         26 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         26 1 2 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         27 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         27 1 2 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         28 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         28 1 2 1 1   8 LEU HG  2l30_ambr001   8 LEU HG   1 1 
         29 1 1 1 1   7 LYS HA  2l30_ambr001   7 LYS HA   1 1 
         29 1 2 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         30 1 1 1 1   7 LYS QB  2l30_ambr001   7 LYS HB2  1 1 
         30 1 2 1 1   8 LEU H   2l30_ambr001   8 LYS H    1 1 
         31 1 1 1 1   7 LYS QB  2l30_ambr001   7 LYS HB2  1 1 
         31 1 2 1 1   8 LEU HA  2l30_ambr001   8 LYS HA   1 1 
         32 1 1 1 1   7 LYS QB  2l30_ambr001   7 LYS HB2  1 1 
         32 1 2 1 1   9 TYR H   2l30_ambr001   9 LYS H    1 1 
         33 1 1 1 1   7 LYS QB  2l30_ambr001   7 LYS HB2  1 1 
         33 1 2 1 1  72 ASP H   2l30_ambr001  72 LYS H    1 1 
         34 1 1 1 1   7 LYS QB  2l30_ambr001   7 LYS HB2  1 1 
         34 1 2 1 1  72 ASP QB  2l30_ambr001  72 LYS HB2  1 1 
         35 1 1 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         35 1 2 1 1   8 LEU H   2l30_ambr001   8 LYS H    1 1 
         36 1 1 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         36 1 2 1 1   9 TYR H   2l30_ambr001   9 LYS H    1 1 
         37 1 1 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         37 1 2 1 1  72 ASP H   2l30_ambr001  72 LYS H    1 1 
         38 1 1 1 1   7 LYS QD  2l30_ambr001   7 LYS HD2  1 1 
         38 1 2 1 1  72 ASP QB  2l30_ambr001  72 LYS HB2  1 1 
         39 1 1 1 1   7 LYS QE  2l30_ambr001   7 LYS HE2  1 1 
         39 1 2 1 1  72 ASP QB  2l30_ambr001  72 LYS HB2  1 1 
         40 1 1 1 1   7 LYS QG  2l30_ambr001   7 LYS HG2  1 1 
         40 1 2 1 1   8 LEU H   2l30_ambr001   8 LYS H    1 1 
         41 1 1 1 1   7 LYS QG  2l30_ambr001   7 LYS HG2  1 1 
         41 1 2 1 1  72 ASP QB  2l30_ambr001  72 LYS HB2  1 1 
         42 1 1 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         42 1 2 1 1   8 LEU HG  2l30_ambr001   8 LEU HG   1 1 
         43 1 1 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         43 1 2 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         44 1 1 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         44 1 2 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         45 1 1 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         45 1 2 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
         46 1 1 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         46 1 2 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
         47 1 1 1 1   8 LEU H   2l30_ambr001   8 LEU H    1 1 
         47 1 2 1 1  70 GLU HA  2l30_ambr001  70 GLU HA   1 1 
         48 1 1 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         48 1 2 1 1   8 LEU HG  2l30_ambr001   8 LEU HG   1 1 
         49 1 1 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         49 1 2 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
         50 1 1 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         50 1 2 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
         51 1 1 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         51 1 2 1 1  38 MET QB  2l30_ambr001  38 MET HB2  1 1 
         52 1 1 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         52 1 2 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
         53 1 1 1 1   8 LEU HA  2l30_ambr001   8 LEU HA   1 1 
         53 1 2 1 1  38 MET QG  2l30_ambr001  38 MET HG2  1 1 
         54 1 1 1 1   8 LEU QB  2l30_ambr001   8 LEU HB2  1 1 
         54 1 2 1 1   9 TYR H   2l30_ambr001   9 LEU H    1 1 
         55 1 1 1 1   8 LEU QB  2l30_ambr001   8 LEU HB2  1 1 
         55 1 2 1 1   9 TYR QD  2l30_ambr001   9 LEU HD1  1 1 
         56 1 1 1 1   8 LEU QB  2l30_ambr001   8 LEU HB2  1 1 
         56 1 2 1 1   9 TYR QE  2l30_ambr001   9 LEU HE1  1 1 
         57 1 1 1 1   8 LEU QB  2l30_ambr001   8 LEU HB2  1 1 
         57 1 2 1 1  38 MET H   2l30_ambr001  38 LEU H    1 1 
         58 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         58 1 2 1 1   9 TYR H   2l30_ambr001   9 LEU H    1 1 
         59 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         59 1 2 1 1   9 TYR QB  2l30_ambr001   9 LEU HB2  1 1 
         60 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         60 1 2 1 1   9 TYR QD  2l30_ambr001   9 LEU HD1  1 1 
         61 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         61 1 2 1 1   9 TYR QE  2l30_ambr001   9 LEU HE1  1 1 
         62 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         62 1 2 1 1  64 ILE MD  2l30_ambr001  64 LEU HD11 1 1 
         63 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         63 1 2 1 1  64 ILE MG  2l30_ambr001  64 LEU HG21 1 1 
         64 1 1 1 1   8 LEU QD  2l30_ambr001   8 LEU HD11 1 1 
         64 1 2 1 1  70 GLU QG  2l30_ambr001  70 LEU HG2  1 1 
         65 1 1 1 1   8 LEU HG  2l30_ambr001   8 LEU HG   1 1 
         65 1 2 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         66 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         66 1 2 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
         67 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         67 1 2 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
         68 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         68 1 2 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
         69 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         69 1 2 1 1  37 ILE QG  2l30_ambr001  37 ILE HG12 1 1 
         70 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         70 1 2 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
         71 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         71 1 2 1 1  70 GLU HA  2l30_ambr001  70 GLU HA   1 1 
         72 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         72 1 2 1 1  70 GLU QB  2l30_ambr001  70 GLU HB2  1 1 
         73 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         73 1 2 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
         74 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         74 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
         75 1 1 1 1   9 TYR H   2l30_ambr001   9 TYR H    1 1 
         75 1 2 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
         76 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         76 1 2 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
         77 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         77 1 2 1 1   9 TYR QE  2l30_ambr001   9 TYR HE1  1 1 
         78 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         78 1 2 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
         79 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         79 1 2 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
         80 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         80 1 2 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
         81 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         81 1 2 1 1  37 ILE HA  2l30_ambr001  37 ILE HA   1 1 
         82 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         82 1 2 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
         83 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         83 1 2 1 1  37 ILE QG  2l30_ambr001  37 ILE HG12 1 1 
         84 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         84 1 2 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
         85 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         85 1 2 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
         86 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         86 1 2 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
         87 1 1 1 1   9 TYR HA  2l30_ambr001   9 TYR HA   1 1 
         87 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
         88 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         88 1 2 1 1  10 ARG H   2l30_ambr001  10 TYR H    1 1 
         89 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         89 1 2 1 1  35 MET ME  2l30_ambr001  35 TYR HE1  1 1 
         90 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         90 1 2 1 1  37 ILE MD  2l30_ambr001  37 TYR HD11 1 1 
         91 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         91 1 2 1 1  37 ILE QG  2l30_ambr001  37 TYR HG12 1 1 
         92 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         92 1 2 1 1  64 ILE MD  2l30_ambr001  64 TYR HD11 1 1 
         93 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         93 1 2 1 1  70 GLU QB  2l30_ambr001  70 TYR HB2  1 1 
         94 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         94 1 2 1 1  71 VAL HA  2l30_ambr001  71 TYR HA   1 1 
         95 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         95 1 2 1 1  71 VAL HB  2l30_ambr001  71 TYR HB   1 1 
         96 1 1 1 1   9 TYR QB  2l30_ambr001   9 TYR HB2  1 1 
         96 1 2 1 1  71 VAL QG  2l30_ambr001  71 TYR HG11 1 1 
         97 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
         97 1 2 1 1  10 ARG H   2l30_ambr001  10 TYR H    1 1 
         98 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
         98 1 2 1 1  37 ILE HA  2l30_ambr001  37 TYR HA   1 1 
         99 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
         99 1 2 1 1  37 ILE MD  2l30_ambr001  37 TYR HD11 1 1 
        100 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
        100 1 2 1 1  37 ILE QG  2l30_ambr001  37 TYR HG12 1 1 
        101 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
        101 1 2 1 1  38 MET H   2l30_ambr001  38 TYR H    1 1 
        102 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
        102 1 2 1 1  57 PHE HZ  2l30_ambr001  57 TYR HZ   1 1 
        103 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
        103 1 2 1 1  64 ILE MD  2l30_ambr001  64 TYR HD11 1 1 
        104 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
        104 1 2 1 1  64 ILE QG  2l30_ambr001  64 TYR HG12 1 1 
        105 1 1 1 1   9 TYR QD  2l30_ambr001   9 TYR HD1  1 1 
        105 1 2 1 1  70 GLU QB  2l30_ambr001  70 TYR HB2  1 1 
        106 1 1 1 1   9 TYR QE  2l30_ambr001   9 TYR HE1  1 1 
        106 1 2 1 1  37 ILE QG  2l30_ambr001  37 TYR HG12 1 1 
        107 1 1 1 1   9 TYR QE  2l30_ambr001   9 TYR HE1  1 1 
        107 1 2 1 1  57 PHE HZ  2l30_ambr001  57 TYR HZ   1 1 
        108 1 1 1 1   9 TYR QE  2l30_ambr001   9 TYR HE1  1 1 
        108 1 2 1 1  64 ILE HA  2l30_ambr001  64 TYR HA   1 1 
        109 1 1 1 1   9 TYR QE  2l30_ambr001   9 TYR HE1  1 1 
        109 1 2 1 1  64 ILE QG  2l30_ambr001  64 TYR HG12 1 1 
        110 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        110 1 2 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        111 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        111 1 2 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        112 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        112 1 2 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        113 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        113 1 2 1 1  36 ALA H   2l30_ambr001  36 ALA H    1 1 
        114 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        114 1 2 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        115 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        115 1 2 1 1  37 ILE HA  2l30_ambr001  37 ILE HA   1 1 
        116 1 1 1 1  10 ARG H   2l30_ambr001  10 ARG H    1 1 
        116 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
        117 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        117 1 2 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        118 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        118 1 2 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        119 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        119 1 2 1 1  11 VAL HB  2l30_ambr001  11 VAL HB   1 1 
        120 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        120 1 2 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        121 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        121 1 2 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        122 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        122 1 2 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
        123 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        123 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
        124 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        124 1 2 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
        125 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        125 1 2 1 1  72 ASP HA  2l30_ambr001  72 ASP HA   1 1 
        126 1 1 1 1  10 ARG HA  2l30_ambr001  10 ARG HA   1 1 
        126 1 2 1 1  72 ASP QB  2l30_ambr001  72 ASP HB2  1 1 
        127 1 1 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
        127 1 2 1 1  11 VAL H   2l30_ambr001  11 ARG H    1 1 
        128 1 1 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
        128 1 2 1 1  36 ALA H   2l30_ambr001  36 ARG H    1 1 
        129 1 1 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
        129 1 2 1 1  36 ALA MB  2l30_ambr001  36 ARG HB1  1 1 
        130 1 1 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
        130 1 2 1 1  51 TRP HH2 2l30_ambr001  51 ARG HH2  1 1 
        131 1 1 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
        131 1 2 1 1  72 ASP H   2l30_ambr001  72 ARG H    1 1 
        132 1 1 1 1  10 ARG QB  2l30_ambr001  10 ARG HB2  1 1 
        132 1 2 1 1  72 ASP QB  2l30_ambr001  72 ARG HB2  1 1 
        133 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        133 1 2 1 1  11 VAL H   2l30_ambr001  11 ARG H    1 1 
        134 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        134 1 2 1 1  11 VAL QG  2l30_ambr001  11 ARG HG11 1 1 
        135 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        135 1 2 1 1  36 ALA MB  2l30_ambr001  36 ARG HB1  1 1 
        136 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        136 1 2 1 1  51 TRP HH2 2l30_ambr001  51 ARG HH2  1 1 
        137 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        137 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 ARG HZ3  1 1 
        138 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        138 1 2 1 1  71 VAL HA  2l30_ambr001  71 ARG HA   1 1 
        139 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        139 1 2 1 1  71 VAL QG  2l30_ambr001  71 ARG HG11 1 1 
        140 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        140 1 2 1 1  72 ASP H   2l30_ambr001  72 ARG H    1 1 
        141 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        141 1 2 1 1  72 ASP QB  2l30_ambr001  72 ARG HB2  1 1 
        142 1 1 1 1  10 ARG QD  2l30_ambr001  10 ARG HD2  1 1 
        142 1 2 1 1  73 GLY H   2l30_ambr001  73 ARG H    1 1 
        143 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        143 1 2 1 1  11 VAL H   2l30_ambr001  11 ARG H    1 1 
        144 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        144 1 2 1 1  11 VAL HB  2l30_ambr001  11 ARG HB   1 1 
        145 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        145 1 2 1 1  11 VAL QG  2l30_ambr001  11 ARG HG11 1 1 
        146 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        146 1 2 1 1  12 GLU H   2l30_ambr001  12 ARG H    1 1 
        147 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        147 1 2 1 1  12 GLU QB  2l30_ambr001  12 ARG HB2  1 1 
        148 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        148 1 2 1 1  12 GLU QG  2l30_ambr001  12 ARG HG2  1 1 
        149 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        149 1 2 1 1  36 ALA MB  2l30_ambr001  36 ARG HB1  1 1 
        150 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        150 1 2 1 1  51 TRP HA  2l30_ambr001  51 ARG HA   1 1 
        151 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        151 1 2 1 1  51 TRP HH2 2l30_ambr001  51 ARG HH2  1 1 
        152 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        152 1 2 1 1  51 TRP HZ2 2l30_ambr001  51 ARG HZ2  1 1 
        153 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        153 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 ARG HZ3  1 1 
        154 1 1 1 1  10 ARG QG  2l30_ambr001  10 ARG HG2  1 1 
        154 1 2 1 1  72 ASP QB  2l30_ambr001  72 ARG HB2  1 1 
        155 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        155 1 2 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        156 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        156 1 2 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        157 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        157 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 TRP HZ3  1 1 
        158 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        158 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
        159 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        159 1 2 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
        160 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        160 1 2 1 1  73 GLY H   2l30_ambr001  73 GLY H    1 1 
        161 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        161 1 2 1 1  73 GLY QA  2l30_ambr001  73 GLY HA2  1 1 
        162 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        162 1 2 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
        163 1 1 1 1  11 VAL H   2l30_ambr001  11 VAL H    1 1 
        163 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        164 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        164 1 2 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        165 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        165 1 2 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        166 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        166 1 2 1 1  12 GLU QG  2l30_ambr001  12 GLU HG2  1 1 
        167 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        167 1 2 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        168 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        168 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        169 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        169 1 2 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        170 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        170 1 2 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        171 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        171 1 2 1 1  35 MET QB  2l30_ambr001  35 MET HB2  1 1 
        172 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        172 1 2 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        173 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        173 1 2 1 1  36 ALA H   2l30_ambr001  36 ALA H    1 1 
        174 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        174 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 TRP HZ3  1 1 
        175 1 1 1 1  11 VAL HA  2l30_ambr001  11 VAL HA   1 1 
        175 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        176 1 1 1 1  11 VAL HB  2l30_ambr001  11 VAL HB   1 1 
        176 1 2 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        177 1 1 1 1  11 VAL HB  2l30_ambr001  11 VAL HB   1 1 
        177 1 2 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        178 1 1 1 1  11 VAL HB  2l30_ambr001  11 VAL HB   1 1 
        178 1 2 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
        179 1 1 1 1  11 VAL HB  2l30_ambr001  11 VAL HB   1 1 
        179 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
        180 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        180 1 2 1 1  12 GLU H   2l30_ambr001  12 VAL H    1 1 
        181 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        181 1 2 1 1  12 GLU HA  2l30_ambr001  12 VAL HA   1 1 
        182 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        182 1 2 1 1  12 GLU QB  2l30_ambr001  12 VAL HB2  1 1 
        183 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        183 1 2 1 1  13 TYR H   2l30_ambr001  13 VAL H    1 1 
        184 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        184 1 2 1 1  33 LEU QD  2l30_ambr001  33 VAL HD11 1 1 
        185 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        185 1 2 1 1  33 LEU HG  2l30_ambr001  33 VAL HG   1 1 
        186 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        186 1 2 1 1  34 ARG H   2l30_ambr001  34 VAL H    1 1 
        187 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        187 1 2 1 1  35 MET HA  2l30_ambr001  35 VAL HA   1 1 
        188 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        188 1 2 1 1  35 MET QG  2l30_ambr001  35 VAL HG2  1 1 
        189 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        189 1 2 1 1  36 ALA H   2l30_ambr001  36 VAL H    1 1 
        190 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        190 1 2 1 1  54 PHE HA  2l30_ambr001  54 VAL HA   1 1 
        191 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        191 1 2 1 1  54 PHE QD  2l30_ambr001  54 VAL HD1  1 1 
        192 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        192 1 2 1 1  54 PHE QE  2l30_ambr001  54 VAL HE1  1 1 
        193 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        193 1 2 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
        194 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        194 1 2 1 1  73 GLY QA  2l30_ambr001  73 VAL HA2  1 1 
        195 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        195 1 2 1 1  74 PHE H   2l30_ambr001  74 VAL H    1 1 
        196 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        196 1 2 1 1  74 PHE HA  2l30_ambr001  74 VAL HA   1 1 
        197 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        197 1 2 1 1  74 PHE QB  2l30_ambr001  74 VAL HB2  1 1 
        198 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        198 1 2 1 1  74 PHE QD  2l30_ambr001  74 VAL HD1  1 1 
        199 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        199 1 2 1 1  75 SER H   2l30_ambr001  75 VAL H    1 1 
        200 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        200 1 2 1 1  76 GLU H   2l30_ambr001  76 VAL H    1 1 
        201 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        201 1 2 1 1  77 LEU H   2l30_ambr001  77 VAL H    1 1 
        202 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        202 1 2 1 1  77 LEU QD  2l30_ambr001  77 VAL HD11 1 1 
        203 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        203 1 2 1 1  77 LEU HG  2l30_ambr001  77 VAL HG   1 1 
        204 1 1 1 1  11 VAL QG  2l30_ambr001  11 VAL HG11 1 1 
        204 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
        205 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        205 1 2 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        206 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        206 1 2 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        207 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        207 1 2 1 1  33 LEU HA  2l30_ambr001  33 LEU HA   1 1 
        208 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        208 1 2 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        209 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        209 1 2 1 1  33 LEU HG  2l30_ambr001  33 LEU HG   1 1 
        210 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        210 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        211 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        211 1 2 1 1  34 ARG QG  2l30_ambr001  34 ARG HG2  1 1 
        212 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        212 1 2 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        213 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        213 1 2 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        214 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        214 1 2 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        215 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        215 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 TRP HZ3  1 1 
        216 1 1 1 1  12 GLU H   2l30_ambr001  12 GLU H    1 1 
        216 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        217 1 1 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        217 1 2 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        218 1 1 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        218 1 2 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        219 1 1 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        219 1 2 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        220 1 1 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        220 1 2 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        221 1 1 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        221 1 2 1 1  76 GLU QB  2l30_ambr001  76 GLU HB2  1 1 
        222 1 1 1 1  12 GLU HA  2l30_ambr001  12 GLU HA   1 1 
        222 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        223 1 1 1 1  12 GLU QB  2l30_ambr001  12 GLU HB2  1 1 
        223 1 2 1 1  13 TYR H   2l30_ambr001  13 GLU H    1 1 
        224 1 1 1 1  12 GLU QB  2l30_ambr001  12 GLU HB2  1 1 
        224 1 2 1 1  51 TRP HH2 2l30_ambr001  51 GLU HH2  1 1 
        225 1 1 1 1  12 GLU QG  2l30_ambr001  12 GLU HG2  1 1 
        225 1 2 1 1  13 TYR H   2l30_ambr001  13 GLU H    1 1 
        226 1 1 1 1  12 GLU QG  2l30_ambr001  12 GLU HG2  1 1 
        226 1 2 1 1  14 ALA HA  2l30_ambr001  14 GLU HA   1 1 
        227 1 1 1 1  12 GLU QG  2l30_ambr001  12 GLU HG2  1 1 
        227 1 2 1 1  51 TRP HH2 2l30_ambr001  51 GLU HH2  1 1 
        228 1 1 1 1  12 GLU QG  2l30_ambr001  12 GLU HG2  1 1 
        228 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 GLU HZ3  1 1 
        229 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        229 1 2 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        230 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        230 1 2 1 1  14 ALA H   2l30_ambr001  14 ALA H    1 1 
        231 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        231 1 2 1 1  33 LEU HA  2l30_ambr001  33 LEU HA   1 1 
        232 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        232 1 2 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        233 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        233 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        234 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        234 1 2 1 1  76 GLU QB  2l30_ambr001  76 GLU HB2  1 1 
        235 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        235 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        236 1 1 1 1  13 TYR H   2l30_ambr001  13 TYR H    1 1 
        236 1 2 1 1  77 LEU HG  2l30_ambr001  77 LEU HG   1 1 
        237 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        237 1 2 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        238 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        238 1 2 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        239 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        239 1 2 1 1  14 ALA H   2l30_ambr001  14 ALA H    1 1 
        240 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        240 1 2 1 1  14 ALA HA  2l30_ambr001  14 ALA HA   1 1 
        241 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        241 1 2 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        242 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        242 1 2 1 1  33 LEU HA  2l30_ambr001  33 LEU HA   1 1 
        243 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        243 1 2 1 1  33 LEU QB  2l30_ambr001  33 LEU HB2  1 1 
        244 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        244 1 2 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        245 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        245 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        246 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        246 1 2 1 1  34 ARG QG  2l30_ambr001  34 ARG HG2  1 1 
        247 1 1 1 1  13 TYR HA  2l30_ambr001  13 TYR HA   1 1 
        247 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        248 1 1 1 1  13 TYR QB  2l30_ambr001  13 TYR HB2  1 1 
        248 1 2 1 1  14 ALA H   2l30_ambr001  14 TYR H    1 1 
        249 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        249 1 2 1 1  14 ALA H   2l30_ambr001  14 TYR H    1 1 
        250 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        250 1 2 1 1  14 ALA MB  2l30_ambr001  14 TYR HB1  1 1 
        251 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        251 1 2 1 1  33 LEU HA  2l30_ambr001  33 TYR HA   1 1 
        252 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        252 1 2 1 1  33 LEU QB  2l30_ambr001  33 TYR HB2  1 1 
        253 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        253 1 2 1 1  33 LEU QD  2l30_ambr001  33 TYR HD11 1 1 
        254 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        254 1 2 1 1  77 LEU HA  2l30_ambr001  77 TYR HA   1 1 
        255 1 1 1 1  13 TYR QD  2l30_ambr001  13 TYR HD1  1 1 
        255 1 2 1 1  77 LEU QD  2l30_ambr001  77 TYR HD11 1 1 
        256 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        256 1 2 1 1  33 LEU HA  2l30_ambr001  33 TYR HA   1 1 
        257 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        257 1 2 1 1  33 LEU QB  2l30_ambr001  33 TYR HB2  1 1 
        258 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        258 1 2 1 1  33 LEU QD  2l30_ambr001  33 TYR HD11 1 1 
        259 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        259 1 2 1 1  77 LEU HA  2l30_ambr001  77 TYR HA   1 1 
        260 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        260 1 2 1 1  77 LEU QB  2l30_ambr001  77 TYR HB2  1 1 
        261 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        261 1 2 1 1  77 LEU QD  2l30_ambr001  77 TYR HD11 1 1 
        262 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        262 1 2 1 1  77 LEU HG  2l30_ambr001  77 TYR HG   1 1 
        263 1 1 1 1  13 TYR QE  2l30_ambr001  13 TYR HE1  1 1 
        263 1 2 1 1  78 ARG H   2l30_ambr001  78 TYR H    1 1 
        264 1 1 1 1  14 ALA H   2l30_ambr001  14 ALA H    1 1 
        264 1 2 1 1  32 SER H   2l30_ambr001  32 SER H    1 1 
        265 1 1 1 1  14 ALA H   2l30_ambr001  14 ALA H    1 1 
        265 1 2 1 1  32 SER HA  2l30_ambr001  32 SER HA   1 1 
        266 1 1 1 1  14 ALA H   2l30_ambr001  14 ALA H    1 1 
        266 1 2 1 1  33 LEU HA  2l30_ambr001  33 LEU HA   1 1 
        267 1 1 1 1  14 ALA HA  2l30_ambr001  14 ALA HA   1 1 
        267 1 2 1 1  16 SER H   2l30_ambr001  16 SER H    1 1 
        268 1 1 1 1  14 ALA HA  2l30_ambr001  14 ALA HA   1 1 
        268 1 2 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        269 1 1 1 1  14 ALA HA  2l30_ambr001  14 ALA HA   1 1 
        269 1 2 1 1  34 ARG QG  2l30_ambr001  34 ARG HG2  1 1 
        270 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        270 1 2 1 1  15 LYS H   2l30_ambr001  15 ALA H    1 1 
        271 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        271 1 2 1 1  16 SER H   2l30_ambr001  16 ALA H    1 1 
        272 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        272 1 2 1 1  28 ILE MG  2l30_ambr001  28 ALA HG21 1 1 
        273 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        273 1 2 1 1  30 LYS H   2l30_ambr001  30 ALA H    1 1 
        274 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        274 1 2 1 1  30 LYS HA  2l30_ambr001  30 ALA HA   1 1 
        275 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        275 1 2 1 1  30 LYS QB  2l30_ambr001  30 ALA HB2  1 1 
        276 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        276 1 2 1 1  31 ASP H   2l30_ambr001  31 ALA H    1 1 
        277 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        277 1 2 1 1  31 ASP HA  2l30_ambr001  31 ALA HA   1 1 
        278 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        278 1 2 1 1  32 SER H   2l30_ambr001  32 ALA H    1 1 
        279 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        279 1 2 1 1  32 SER HA  2l30_ambr001  32 ALA HA   1 1 
        280 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        280 1 2 1 1  32 SER QB  2l30_ambr001  32 ALA HB2  1 1 
        281 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        281 1 2 1 1  33 LEU HA  2l30_ambr001  33 ALA HA   1 1 
        282 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        282 1 2 1 1  34 ARG QD  2l30_ambr001  34 ALA HD2  1 1 
        283 1 1 1 1  14 ALA MB  2l30_ambr001  14 ALA HB1  1 1 
        283 1 2 1 1  34 ARG QG  2l30_ambr001  34 ALA HG2  1 1 
        284 1 1 1 1  15 LYS H   2l30_ambr001  15 LYS H    1 1 
        284 1 2 1 1  15 LYS QD  2l30_ambr001  15 LYS HD2  1 1 
        285 1 1 1 1  15 LYS H   2l30_ambr001  15 LYS H    1 1 
        285 1 2 1 1  16 SER H   2l30_ambr001  16 SER H    1 1 
        286 1 1 1 1  15 LYS H   2l30_ambr001  15 LYS H    1 1 
        286 1 2 1 1  16 SER QB  2l30_ambr001  16 SER HB2  1 1 
        287 1 1 1 1  15 LYS HA  2l30_ambr001  15 LYS HA   1 1 
        287 1 2 1 1  15 LYS QD  2l30_ambr001  15 LYS HD2  1 1 
        288 1 1 1 1  15 LYS HA  2l30_ambr001  15 LYS HA   1 1 
        288 1 2 1 1  15 LYS QE  2l30_ambr001  15 LYS HE2  1 1 
        289 1 1 1 1  15 LYS HA  2l30_ambr001  15 LYS HA   1 1 
        289 1 2 1 1  15 LYS QG  2l30_ambr001  15 LYS HG2  1 1 
        290 1 1 1 1  15 LYS QB  2l30_ambr001  15 LYS HB2  1 1 
        290 1 2 1 1  16 SER QB  2l30_ambr001  16 LYS HB2  1 1 
        291 1 1 1 1  15 LYS QG  2l30_ambr001  15 LYS HG2  1 1 
        291 1 2 1 1  16 SER H   2l30_ambr001  16 LYS H    1 1 
        292 1 1 1 1  16 SER H   2l30_ambr001  16 SER H    1 1 
        292 1 2 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        293 1 1 1 1  16 SER H   2l30_ambr001  16 SER H    1 1 
        293 1 2 1 1  30 LYS QG  2l30_ambr001  30 LYS HG2  1 1 
        294 1 1 1 1  16 SER H   2l30_ambr001  16 SER H    1 1 
        294 1 2 1 1  31 ASP H   2l30_ambr001  31 ASP H    1 1 
        295 1 1 1 1  16 SER HA  2l30_ambr001  16 SER HA   1 1 
        295 1 2 1 1  30 LYS H   2l30_ambr001  30 LYS H    1 1 
        296 1 1 1 1  16 SER HA  2l30_ambr001  16 SER HA   1 1 
        296 1 2 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        297 1 1 1 1  16 SER HA  2l30_ambr001  16 SER HA   1 1 
        297 1 2 1 1  30 LYS QB  2l30_ambr001  30 LYS HB2  1 1 
        298 1 1 1 1  16 SER HA  2l30_ambr001  16 SER HA   1 1 
        298 1 2 1 1  30 LYS QD  2l30_ambr001  30 LYS HD2  1 1 
        299 1 1 1 1  16 SER HA  2l30_ambr001  16 SER HA   1 1 
        299 1 2 1 1  30 LYS QE  2l30_ambr001  30 LYS HE2  1 1 
        300 1 1 1 1  16 SER HA  2l30_ambr001  16 SER HA   1 1 
        300 1 2 1 1  30 LYS QG  2l30_ambr001  30 LYS HG2  1 1 
        301 1 1 1 1  16 SER QB  2l30_ambr001  16 SER HB2  1 1 
        301 1 2 1 1  18 ARG QD  2l30_ambr001  18 SER HD2  1 1 
        302 1 1 1 1  16 SER QB  2l30_ambr001  16 SER HB2  1 1 
        302 1 2 1 1  18 ARG QG  2l30_ambr001  18 SER HG2  1 1 
        303 1 1 1 1  17 GLY QA  2l30_ambr001  17 GLY HA2  1 1 
        303 1 2 1 1  18 ARG HA  2l30_ambr001  18 GLY HA   1 1 
        304 1 1 1 1  17 GLY QA  2l30_ambr001  17 GLY HA2  1 1 
        304 1 2 1 1  29 PRO HA  2l30_ambr001  29 GLY HA   1 1 
        305 1 1 1 1  17 GLY QA  2l30_ambr001  17 GLY HA2  1 1 
        305 1 2 1 1  30 LYS H   2l30_ambr001  30 GLY H    1 1 
        306 1 1 1 1  17 GLY QA  2l30_ambr001  17 GLY HA2  1 1 
        306 1 2 1 1  30 LYS QB  2l30_ambr001  30 GLY HB2  1 1 
        307 1 1 1 1  17 GLY QA  2l30_ambr001  17 GLY HA2  1 1 
        307 1 2 1 1  30 LYS QD  2l30_ambr001  30 GLY HD2  1 1 
        308 1 1 1 1  18 ARG H   2l30_ambr001  18 ARG H    1 1 
        308 1 2 1 1  19 ALA H   2l30_ambr001  19 ALA H    1 1 
        309 1 1 1 1  18 ARG H   2l30_ambr001  18 ARG H    1 1 
        309 1 2 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        310 1 1 1 1  18 ARG HA  2l30_ambr001  18 ARG HA   1 1 
        310 1 2 1 1  18 ARG QD  2l30_ambr001  18 ARG HD2  1 1 
        311 1 1 1 1  18 ARG QB  2l30_ambr001  18 ARG HB2  1 1 
        311 1 2 1 1  19 ALA H   2l30_ambr001  19 ARG H    1 1 
        312 1 1 1 1  18 ARG QD  2l30_ambr001  18 ARG HD2  1 1 
        312 1 2 1 1  19 ALA H   2l30_ambr001  19 ARG H    1 1 
        313 1 1 1 1  18 ARG QG  2l30_ambr001  18 ARG HG2  1 1 
        313 1 2 1 1  19 ALA H   2l30_ambr001  19 ARG H    1 1 
        314 1 1 1 1  19 ALA H   2l30_ambr001  19 ALA H    1 1 
        314 1 2 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        315 1 1 1 1  19 ALA H   2l30_ambr001  19 ALA H    1 1 
        315 1 2 1 1  28 ILE HB  2l30_ambr001  28 ILE HB   1 1 
        316 1 1 1 1  19 ALA HA  2l30_ambr001  19 ALA HA   1 1 
        316 1 2 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        317 1 1 1 1  19 ALA HA  2l30_ambr001  19 ALA HA   1 1 
        317 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        318 1 1 1 1  19 ALA HA  2l30_ambr001  19 ALA HA   1 1 
        318 1 2 1 1  51 TRP HD1 2l30_ambr001  51 TRP HD1  1 1 
        319 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        319 1 2 1 1  20 SER H   2l30_ambr001  20 ALA H    1 1 
        320 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        320 1 2 1 1  28 ILE HB  2l30_ambr001  28 ALA HB   1 1 
        321 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        321 1 2 1 1  28 ILE MD  2l30_ambr001  28 ALA HD11 1 1 
        322 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        322 1 2 1 1  28 ILE MG  2l30_ambr001  28 ALA HG21 1 1 
        323 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        323 1 2 1 1  51 TRP H   2l30_ambr001  51 ALA H    1 1 
        324 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        324 1 2 1 1  51 TRP QB  2l30_ambr001  51 ALA HB2  1 1 
        325 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        325 1 2 1 1  51 TRP HD1 2l30_ambr001  51 ALA HD1  1 1 
        326 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        326 1 2 1 1  51 TRP HE1 2l30_ambr001  51 ALA HE1  1 1 
        327 1 1 1 1  19 ALA MB  2l30_ambr001  19 ALA HB1  1 1 
        327 1 2 1 1  51 TRP HZ2 2l30_ambr001  51 ALA HZ2  1 1 
        328 1 1 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        328 1 2 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        329 1 1 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        329 1 2 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        330 1 1 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        330 1 2 1 1  28 ILE HB  2l30_ambr001  28 ILE HB   1 1 
        331 1 1 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        331 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        332 1 1 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        332 1 2 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        333 1 1 1 1  20 SER H   2l30_ambr001  20 SER H    1 1 
        333 1 2 1 1  51 TRP HD1 2l30_ambr001  51 TRP HD1  1 1 
        334 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        334 1 2 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        335 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        335 1 2 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        336 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        336 1 2 1 1  27 SER HA  2l30_ambr001  27 SER HA   1 1 
        337 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        337 1 2 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        338 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        338 1 2 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        339 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        339 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        340 1 1 1 1  20 SER HA  2l30_ambr001  20 SER HA   1 1 
        340 1 2 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        341 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        341 1 2 1 1  21 CYS H   2l30_ambr001  21 SER HN   1 1 
        342 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        342 1 2 1 1  21 CYS QB  2l30_ambr001  21 SER HB2  1 1 
        343 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        343 1 2 1 1  22 LYS QD  2l30_ambr001  22 SER HD2  1 1 
        344 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        344 1 2 1 1  27 SER HA  2l30_ambr001  27 SER HA   1 1 
        345 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        345 1 2 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        346 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        346 1 2 1 1  28 ILE H   2l30_ambr001  28 SER H    1 1 
        347 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        347 1 2 1 1  28 ILE MD  2l30_ambr001  28 SER HD11 1 1 
        348 1 1 1 1  20 SER QB  2l30_ambr001  20 SER HB2  1 1 
        348 1 2 1 1  28 ILE QG  2l30_ambr001  28 SER HG12 1 1 
        349 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        349 1 2 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        350 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        350 1 2 1 1  25 SER HA  2l30_ambr001  25 SER HA   1 1 
        351 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        351 1 2 1 1  26 GLU H   2l30_ambr001  26 GLU H    1 1 
        352 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        352 1 2 1 1  26 GLU QB  2l30_ambr001  26 GLU HB2  1 1 
        353 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        353 1 2 1 1  27 SER HA  2l30_ambr001  27 SER HA   1 1 
        354 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        354 1 2 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        355 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        355 1 2 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        356 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        356 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        357 1 1 1 1  21 CYS H   2l30_ambr001  21 CYM HN   1 1 
        357 1 2 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        358 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        358 1 2 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        359 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        359 1 2 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        360 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        360 1 2 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        361 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        361 1 2 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        362 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        362 1 2 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        363 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        363 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        364 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        364 1 2 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        365 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        365 1 2 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        366 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        366 1 2 1 1  52 TYR HA  2l30_ambr001  52 TYR HA   1 1 
        367 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        367 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        368 1 1 1 1  21 CYS HA  2l30_ambr001  21 CYM HA   1 1 
        368 1 2 1 1  53 HIS H   2l30_ambr001  53 HIE H    1 1 
        369 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        369 1 2 1 1  22 LYS H   2l30_ambr001  22 CYM H    1 1 
        370 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        370 1 2 1 1  22 LYS HA  2l30_ambr001  22 CYM HA   1 1 
        371 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        371 1 2 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        372 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        372 1 2 1 1  25 SER H   2l30_ambr001  25 CYM H    1 1 
        373 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        373 1 2 1 1  25 SER HA  2l30_ambr001  25 CYM HA   1 1 
        374 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        374 1 2 1 1  26 GLU H   2l30_ambr001  26 CYM H    1 1 
        375 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        375 1 2 1 1  26 GLU QB  2l30_ambr001  26 CYM HB2  1 1 
        376 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        376 1 2 1 1  27 SER H   2l30_ambr001  27 CYM H    1 1 
        377 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        377 1 2 1 1  27 SER HA  2l30_ambr001  27 CYM HA   1 1 
        378 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        378 1 2 1 1  27 SER QB  2l30_ambr001  27 CYM HB2  1 1 
        379 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        379 1 2 1 1  28 ILE MD  2l30_ambr001  28 CYM HD11 1 1 
        380 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        380 1 2 1 1  28 ILE QG  2l30_ambr001  28 CYM HG12 1 1 
        381 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        381 1 2 1 1  28 ILE MG  2l30_ambr001  28 CYM HG21 1 1 
        382 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        382 1 2 1 1  52 TYR HA  2l30_ambr001  52 CYM HA   1 1 
        383 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        383 1 2 1 1  53 HIS H   2l30_ambr001  53 CYM H    1 1 
        384 1 1 1 1  21 CYS QB  2l30_ambr001  21 CYM HB2  1 1 
        384 1 2 1 1  53 HIS HE1 2l30_ambr001  53 CYM HE1  1 1 
        385 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        385 1 2 1 1  22 LYS QD  2l30_ambr001  22 LYS HD2  1 1 
        386 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        386 1 2 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        387 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        387 1 2 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        388 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        388 1 2 1 1  25 SER H   2l30_ambr001  25 SER H    1 1 
        389 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        389 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        390 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        390 1 2 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        391 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        391 1 2 1 1  52 TYR HA  2l30_ambr001  52 TYR HA   1 1 
        392 1 1 1 1  22 LYS H   2l30_ambr001  22 LYS H    1 1 
        392 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        393 1 1 1 1  22 LYS HA  2l30_ambr001  22 LYS HA   1 1 
        393 1 2 1 1  22 LYS QD  2l30_ambr001  22 LYS HD2  1 1 
        394 1 1 1 1  22 LYS HA  2l30_ambr001  22 LYS HA   1 1 
        394 1 2 1 1  22 LYS QE  2l30_ambr001  22 LYS HE2  1 1 
        395 1 1 1 1  22 LYS HA  2l30_ambr001  22 LYS HA   1 1 
        395 1 2 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        396 1 1 1 1  22 LYS HA  2l30_ambr001  22 LYS HA   1 1 
        396 1 2 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        397 1 1 1 1  22 LYS HA  2l30_ambr001  22 LYS HA   1 1 
        397 1 2 1 1  25 SER H   2l30_ambr001  25 SER H    1 1 
        398 1 1 1 1  22 LYS HA  2l30_ambr001  22 LYS HA   1 1 
        398 1 2 1 1  25 SER HA  2l30_ambr001  25 SER HA   1 1 
        399 1 1 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        399 1 2 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        400 1 1 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        400 1 2 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        401 1 1 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        401 1 2 1 1  50 HIS HA  2l30_ambr001  50 LYS HA   1 1 
        402 1 1 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        402 1 2 1 1  50 HIS QB  2l30_ambr001  50 LYS HB2  1 1 
        403 1 1 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        403 1 2 1 1  50 HIS HE1 2l30_ambr001  50 LYS HE1  1 1 
        404 1 1 1 1  22 LYS QB  2l30_ambr001  22 LYS HB2  1 1 
        404 1 2 1 1  52 TYR QE  2l30_ambr001  52 LYS HE1  1 1 
        405 1 1 1 1  22 LYS QD  2l30_ambr001  22 LYS HD2  1 1 
        405 1 2 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        406 1 1 1 1  22 LYS QD  2l30_ambr001  22 LYS HD2  1 1 
        406 1 2 1 1  50 HIS HD2 2l30_ambr001  50 LYS HD2  1 1 
        407 1 1 1 1  22 LYS QD  2l30_ambr001  22 LYS HD2  1 1 
        407 1 2 1 1  51 TRP H   2l30_ambr001  51 LYS H    1 1 
        408 1 1 1 1  22 LYS QE  2l30_ambr001  22 LYS HE2  1 1 
        408 1 2 1 1  50 HIS QB  2l30_ambr001  50 LYS HB2  1 1 
        409 1 1 1 1  22 LYS QE  2l30_ambr001  22 LYS HE2  1 1 
        409 1 2 1 1  50 HIS HD2 2l30_ambr001  50 LYS HD2  1 1 
        410 1 1 1 1  22 LYS QE  2l30_ambr001  22 LYS HE2  1 1 
        410 1 2 1 1  50 HIS HE1 2l30_ambr001  50 LYS HE1  1 1 
        411 1 1 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        411 1 2 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        412 1 1 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        412 1 2 1 1  50 HIS HA  2l30_ambr001  50 LYS HA   1 1 
        413 1 1 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        413 1 2 1 1  50 HIS HD2 2l30_ambr001  50 LYS HD2  1 1 
        414 1 1 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        414 1 2 1 1  51 TRP H   2l30_ambr001  51 LYS H    1 1 
        415 1 1 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        415 1 2 1 1  52 TYR H   2l30_ambr001  52 LYS H    1 1 
        416 1 1 1 1  22 LYS QG  2l30_ambr001  22 LYS HG2  1 1 
        416 1 2 1 1  52 TYR QB  2l30_ambr001  52 LYS HB2  1 1 
        417 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        417 1 2 1 1  23 LYS QD  2l30_ambr001  23 LYS HD2  1 1 
        418 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        418 1 2 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        419 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        419 1 2 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        420 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        420 1 2 1 1  24 CYS QB  2l30_ambr001  24 CYM HB2  1 1 
        421 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        421 1 2 1 1  25 SER H   2l30_ambr001  25 SER H    1 1 
        422 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        422 1 2 1 1  52 TYR QB  2l30_ambr001  52 TYR HB2  1 1 
        423 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        423 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        424 1 1 1 1  23 LYS H   2l30_ambr001  23 LYS H    1 1 
        424 1 2 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        425 1 1 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        425 1 2 1 1  23 LYS QD  2l30_ambr001  23 LYS HD2  1 1 
        426 1 1 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        426 1 2 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        427 1 1 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        427 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        428 1 1 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        428 1 2 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        429 1 1 1 1  23 LYS HA  2l30_ambr001  23 LYS HA   1 1 
        429 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
        430 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        430 1 2 1 1  24 CYS H   2l30_ambr001  24 LYS HN   1 1 
        431 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        431 1 2 1 1  52 TYR QB  2l30_ambr001  52 LYS HB2  1 1 
        432 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        432 1 2 1 1  52 TYR QD  2l30_ambr001  52 LYS HD1  1 1 
        433 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        433 1 2 1 1  52 TYR QE  2l30_ambr001  52 LYS HE1  1 1 
        434 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        434 1 2 1 1  56 CYS HA  2l30_ambr001  56 LYS HA   1 1 
        435 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        435 1 2 1 1  56 CYS QB  2l30_ambr001  56 LYS HB2  1 1 
        436 1 1 1 1  23 LYS QB  2l30_ambr001  23 LYS HB2  1 1 
        436 1 2 1 1  60 VAL QG  2l30_ambr001  60 LYS HG11 1 1 
        437 1 1 1 1  23 LYS QD  2l30_ambr001  23 LYS HD2  1 1 
        437 1 2 1 1  24 CYS H   2l30_ambr001  24 LYS HN   1 1 
        438 1 1 1 1  23 LYS QD  2l30_ambr001  23 LYS HD2  1 1 
        438 1 2 1 1  60 VAL HA  2l30_ambr001  60 LYS HA   1 1 
        439 1 1 1 1  23 LYS QD  2l30_ambr001  23 LYS HD2  1 1 
        439 1 2 1 1  60 VAL QG  2l30_ambr001  60 LYS HG11 1 1 
        440 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        440 1 2 1 1  24 CYS H   2l30_ambr001  24 LYS HN   1 1 
        441 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        441 1 2 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
        442 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        442 1 2 1 1  59 LYS HA  2l30_ambr001  59 LYS HA   1 1 
        443 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        443 1 2 1 1  59 LYS QB  2l30_ambr001  59 LYS HB2  1 1 
        444 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        444 1 2 1 1  59 LYS QD  2l30_ambr001  59 LYS HD2  1 1 
        445 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        445 1 2 1 1  60 VAL H   2l30_ambr001  60 LYS H    1 1 
        446 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        446 1 2 1 1  60 VAL HA  2l30_ambr001  60 LYS HA   1 1 
        447 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        447 1 2 1 1  60 VAL HB  2l30_ambr001  60 LYS HB   1 1 
        448 1 1 1 1  23 LYS QE  2l30_ambr001  23 LYS HE2  1 1 
        448 1 2 1 1  60 VAL QG  2l30_ambr001  60 LYS HG11 1 1 
        449 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        449 1 2 1 1  24 CYS H   2l30_ambr001  24 LYS HN   1 1 
        450 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        450 1 2 1 1  24 CYS HA  2l30_ambr001  24 LYS HA   1 1 
        451 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        451 1 2 1 1  24 CYS QB  2l30_ambr001  24 LYS HB2  1 1 
        452 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        452 1 2 1 1  52 TYR QD  2l30_ambr001  52 LYS HD1  1 1 
        453 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        453 1 2 1 1  56 CYS QB  2l30_ambr001  56 LYS HB2  1 1 
        454 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        454 1 2 1 1  57 PHE H   2l30_ambr001  57 LYS H    1 1 
        455 1 1 1 1  23 LYS QG  2l30_ambr001  23 LYS HG2  1 1 
        455 1 2 1 1  60 VAL QG  2l30_ambr001  60 LYS HG11 1 1 
        456 1 1 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        456 1 2 1 1  25 SER HA  2l30_ambr001  25 SER HA   1 1 
        457 1 1 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        457 1 2 1 1  26 GLU H   2l30_ambr001  26 GLU H    1 1 
        458 1 1 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        458 1 2 1 1  26 GLU QG  2l30_ambr001  26 GLU HG2  1 1 
        459 1 1 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        459 1 2 1 1  52 TYR QB  2l30_ambr001  52 TYR HB2  1 1 
        460 1 1 1 1  24 CYS H   2l30_ambr001  24 CYM HN   1 1 
        460 1 2 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        461 1 1 1 1  24 CYS HA  2l30_ambr001  24 CYM HA   1 1 
        461 1 2 1 1  25 SER QB  2l30_ambr001  25 SER HB2  1 1 
        462 1 1 1 1  24 CYS QB  2l30_ambr001  24 CYM HB2  1 1 
        462 1 2 1 1  26 GLU QG  2l30_ambr001  26 CYM HG2  1 1 
        463 1 1 1 1  25 SER H   2l30_ambr001  25 SER H    1 1 
        463 1 2 1 1  25 SER HA  2l30_ambr001  25 SER HA   1 1 
        464 1 1 1 1  25 SER H   2l30_ambr001  25 SER H    1 1 
        464 1 2 1 1  26 GLU H   2l30_ambr001  26 GLU H    1 1 
        465 1 1 1 1  25 SER HA  2l30_ambr001  25 SER HA   1 1 
        465 1 2 1 1  26 GLU QG  2l30_ambr001  26 GLU HG2  1 1 
        466 1 1 1 1  25 SER QB  2l30_ambr001  25 SER HB2  1 1 
        466 1 2 1 1  26 GLU H   2l30_ambr001  26 SER H    1 1 
        467 1 1 1 1  26 GLU H   2l30_ambr001  26 GLU H    1 1 
        467 1 2 1 1  26 GLU QG  2l30_ambr001  26 GLU HG2  1 1 
        468 1 1 1 1  26 GLU H   2l30_ambr001  26 GLU H    1 1 
        468 1 2 1 1  27 SER H   2l30_ambr001  27 SER H    1 1 
        469 1 1 1 1  26 GLU HA  2l30_ambr001  26 GLU HA   1 1 
        469 1 2 1 1  27 SER H   2l30_ambr001  27 SER H    1 1 
        470 1 1 1 1  26 GLU QB  2l30_ambr001  26 GLU HB2  1 1 
        470 1 2 1 1  27 SER H   2l30_ambr001  27 GLU H    1 1 
        471 1 1 1 1  26 GLU QB  2l30_ambr001  26 GLU HB2  1 1 
        471 1 2 1 1  27 SER HA  2l30_ambr001  27 GLU HA   1 1 
        472 1 1 1 1  26 GLU QB  2l30_ambr001  26 GLU HB2  1 1 
        472 1 2 1 1  27 SER QB  2l30_ambr001  27 GLU HB2  1 1 
        473 1 1 1 1  26 GLU QB  2l30_ambr001  26 GLU HB2  1 1 
        473 1 2 1 1  53 HIS HE1 2l30_ambr001  53 GLU HE1  1 1 
        474 1 1 1 1  26 GLU QG  2l30_ambr001  26 GLU HG2  1 1 
        474 1 2 1 1  53 HIS HE1 2l30_ambr001  53 GLU HE1  1 1 
        475 1 1 1 1  27 SER H   2l30_ambr001  27 SER H    1 1 
        475 1 2 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        476 1 1 1 1  27 SER H   2l30_ambr001  27 SER H    1 1 
        476 1 2 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        477 1 1 1 1  27 SER H   2l30_ambr001  27 SER H    1 1 
        477 1 2 1 1  28 ILE HA  2l30_ambr001  28 ILE HA   1 1 
        478 1 1 1 1  27 SER HA  2l30_ambr001  27 SER HA   1 1 
        478 1 2 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        479 1 1 1 1  27 SER HA  2l30_ambr001  27 SER HA   1 1 
        479 1 2 1 1  28 ILE HB  2l30_ambr001  28 ILE HB   1 1 
        480 1 1 1 1  27 SER HA  2l30_ambr001  27 SER HA   1 1 
        480 1 2 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        481 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        481 1 2 1 1  28 ILE H   2l30_ambr001  28 SER H    1 1 
        482 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        482 1 2 1 1  28 ILE HA  2l30_ambr001  28 SER HA   1 1 
        483 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        483 1 2 1 1  28 ILE QG  2l30_ambr001  28 SER HG12 1 1 
        484 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        484 1 2 1 1 102 ILE HA  2l30_ambr001 102 SER HA   1 1 
        485 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        485 1 2 1 1 102 ILE MD  2l30_ambr001 102 SER HD11 1 1 
        486 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        486 1 2 1 1 102 ILE MG  2l30_ambr001 102 SER HG21 1 1 
        487 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        487 1 2 1 1 103 GLY H   2l30_ambr001 103 SER H    1 1 
        488 1 1 1 1  27 SER QB  2l30_ambr001  27 SER HB2  1 1 
        488 1 2 1 1 103 GLY QA  2l30_ambr001 103 SER HA2  1 1 
        489 1 1 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        489 1 2 1 1  28 ILE HB  2l30_ambr001  28 ILE HB   1 1 
        490 1 1 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        490 1 2 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        491 1 1 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        491 1 2 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        492 1 1 1 1  28 ILE H   2l30_ambr001  28 ILE H    1 1 
        492 1 2 1 1  29 PRO QD  2l30_ambr001  29 PRO HD2  1 1 
        493 1 1 1 1  28 ILE HA  2l30_ambr001  28 ILE HA   1 1 
        493 1 2 1 1  29 PRO QG  2l30_ambr001  29 PRO HG2  1 1 
        494 1 1 1 1  28 ILE HA  2l30_ambr001  28 ILE HA   1 1 
        494 1 2 1 1  53 HIS HD2 2l30_ambr001  53 HIE HD2  1 1 
        495 1 1 1 1  28 ILE HB  2l30_ambr001  28 ILE HB   1 1 
        495 1 2 1 1  53 HIS HD2 2l30_ambr001  53 HIE HD2  1 1 
        496 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        496 1 2 1 1  34 ARG HA  2l30_ambr001  34 ILE HA   1 1 
        497 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        497 1 2 1 1  34 ARG QB  2l30_ambr001  34 ILE HB2  1 1 
        498 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        498 1 2 1 1  34 ARG QD  2l30_ambr001  34 ILE HD2  1 1 
        499 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        499 1 2 1 1  35 MET H   2l30_ambr001  35 ILE H    1 1 
        500 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        500 1 2 1 1  51 TRP H   2l30_ambr001  51 ILE H    1 1 
        501 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        501 1 2 1 1  51 TRP HA  2l30_ambr001  51 ILE HA   1 1 
        502 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        502 1 2 1 1  51 TRP QB  2l30_ambr001  51 ILE HB2  1 1 
        503 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        503 1 2 1 1  51 TRP HD1 2l30_ambr001  51 ILE HD1  1 1 
        504 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        504 1 2 1 1  51 TRP HE3 2l30_ambr001  51 ILE HE3  1 1 
        505 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        505 1 2 1 1  52 TYR H   2l30_ambr001  52 ILE H    1 1 
        506 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        506 1 2 1 1  52 TYR HA  2l30_ambr001  52 ILE HA   1 1 
        507 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        507 1 2 1 1  52 TYR QD  2l30_ambr001  52 ILE HD1  1 1 
        508 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        508 1 2 1 1  53 HIS H   2l30_ambr001  53 ILE H    1 1 
        509 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        509 1 2 1 1  53 HIS HA  2l30_ambr001  53 ILE HA   1 1 
        510 1 1 1 1  28 ILE MD  2l30_ambr001  28 ILE HD11 1 1 
        510 1 2 1 1  53 HIS HD2 2l30_ambr001  53 ILE HD2  1 1 
        511 1 1 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        511 1 2 1 1  52 TYR H   2l30_ambr001  52 ILE H    1 1 
        512 1 1 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        512 1 2 1 1  52 TYR HA  2l30_ambr001  52 ILE HA   1 1 
        513 1 1 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        513 1 2 1 1  53 HIS H   2l30_ambr001  53 ILE H    1 1 
        514 1 1 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        514 1 2 1 1  53 HIS HA  2l30_ambr001  53 ILE HA   1 1 
        515 1 1 1 1  28 ILE QG  2l30_ambr001  28 ILE HG12 1 1 
        515 1 2 1 1  53 HIS HD2 2l30_ambr001  53 ILE HD2  1 1 
        516 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        516 1 2 1 1  29 PRO QB  2l30_ambr001  29 ILE HB2  1 1 
        517 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        517 1 2 1 1  29 PRO QD  2l30_ambr001  29 ILE HD2  1 1 
        518 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        518 1 2 1 1  29 PRO QG  2l30_ambr001  29 ILE HG2  1 1 
        519 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        519 1 2 1 1  32 SER QB  2l30_ambr001  32 ILE HB2  1 1 
        520 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        520 1 2 1 1  33 LEU H   2l30_ambr001  33 ILE H    1 1 
        521 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        521 1 2 1 1  34 ARG H   2l30_ambr001  34 ILE H    1 1 
        522 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        522 1 2 1 1  34 ARG HA  2l30_ambr001  34 ILE HA   1 1 
        523 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        523 1 2 1 1  34 ARG QB  2l30_ambr001  34 ILE HB2  1 1 
        524 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        524 1 2 1 1  34 ARG QD  2l30_ambr001  34 ILE HD2  1 1 
        525 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        525 1 2 1 1  34 ARG QG  2l30_ambr001  34 ILE HG2  1 1 
        526 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        526 1 2 1 1  35 MET H   2l30_ambr001  35 ILE H    1 1 
        527 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        527 1 2 1 1  51 TRP HE3 2l30_ambr001  51 ILE HE3  1 1 
        528 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        528 1 2 1 1  53 HIS HA  2l30_ambr001  53 ILE HA   1 1 
        529 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        529 1 2 1 1  53 HIS HD2 2l30_ambr001  53 ILE HD2  1 1 
        530 1 1 1 1  28 ILE MG  2l30_ambr001  28 ILE HG21 1 1 
        530 1 2 1 1  54 PHE H   2l30_ambr001  54 ILE H    1 1 
        531 1 1 1 1  29 PRO HA  2l30_ambr001  29 PRO HA   1 1 
        531 1 2 1 1  30 LYS H   2l30_ambr001  30 LYS H    1 1 
        532 1 1 1 1  29 PRO HA  2l30_ambr001  29 PRO HA   1 1 
        532 1 2 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        533 1 1 1 1  29 PRO QB  2l30_ambr001  29 PRO HB2  1 1 
        533 1 2 1 1  30 LYS H   2l30_ambr001  30 PRO H    1 1 
        534 1 1 1 1  29 PRO QD  2l30_ambr001  29 PRO HD2  1 1 
        534 1 2 1 1  53 HIS HD2 2l30_ambr001  53 PRO HD2  1 1 
        535 1 1 1 1  29 PRO QG  2l30_ambr001  29 PRO HG2  1 1 
        535 1 2 1 1  30 LYS H   2l30_ambr001  30 PRO H    1 1 
        536 1 1 1 1  29 PRO QG  2l30_ambr001  29 PRO HG2  1 1 
        536 1 2 1 1  32 SER QB  2l30_ambr001  32 PRO HB2  1 1 
        537 1 1 1 1  29 PRO QG  2l30_ambr001  29 PRO HG2  1 1 
        537 1 2 1 1  53 HIS HD2 2l30_ambr001  53 PRO HD2  1 1 
        538 1 1 1 1  30 LYS H   2l30_ambr001  30 LYS H    1 1 
        538 1 2 1 1  30 LYS QD  2l30_ambr001  30 LYS HD2  1 1 
        539 1 1 1 1  30 LYS H   2l30_ambr001  30 LYS H    1 1 
        539 1 2 1 1  31 ASP H   2l30_ambr001  31 ASP H    1 1 
        540 1 1 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        540 1 2 1 1  30 LYS QE  2l30_ambr001  30 LYS HE2  1 1 
        541 1 1 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        541 1 2 1 1  31 ASP H   2l30_ambr001  31 ASP H    1 1 
        542 1 1 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        542 1 2 1 1  31 ASP HA  2l30_ambr001  31 ASP HA   1 1 
        543 1 1 1 1  30 LYS HA  2l30_ambr001  30 LYS HA   1 1 
        543 1 2 1 1  31 ASP QB  2l30_ambr001  31 ASP HB2  1 1 
        544 1 1 1 1  30 LYS QB  2l30_ambr001  30 LYS HB2  1 1 
        544 1 2 1 1  31 ASP H   2l30_ambr001  31 LYS H    1 1 
        545 1 1 1 1  30 LYS QG  2l30_ambr001  30 LYS HG2  1 1 
        545 1 2 1 1  31 ASP H   2l30_ambr001  31 LYS H    1 1 
        546 1 1 1 1  30 LYS QG  2l30_ambr001  30 LYS HG2  1 1 
        546 1 2 1 1  31 ASP HA  2l30_ambr001  31 LYS HA   1 1 
        547 1 1 1 1  31 ASP H   2l30_ambr001  31 ASP H    1 1 
        547 1 2 1 1  32 SER H   2l30_ambr001  32 SER H    1 1 
        548 1 1 1 1  31 ASP QB  2l30_ambr001  31 ASP HB2  1 1 
        548 1 2 1 1  32 SER H   2l30_ambr001  32 ASP H    1 1 
        549 1 1 1 1  32 SER H   2l30_ambr001  32 SER H    1 1 
        549 1 2 1 1  33 LEU H   2l30_ambr001  33 LEU H    1 1 
        550 1 1 1 1  32 SER H   2l30_ambr001  32 SER H    1 1 
        550 1 2 1 1  33 LEU HA  2l30_ambr001  33 LEU HA   1 1 
        551 1 1 1 1  32 SER HA  2l30_ambr001  32 SER HA   1 1 
        551 1 2 1 1  33 LEU H   2l30_ambr001  33 LEU H    1 1 
        552 1 1 1 1  32 SER HA  2l30_ambr001  32 SER HA   1 1 
        552 1 2 1 1  33 LEU QB  2l30_ambr001  33 LEU HB2  1 1 
        553 1 1 1 1  32 SER QB  2l30_ambr001  32 SER HB2  1 1 
        553 1 2 1 1  33 LEU H   2l30_ambr001  33 SER H    1 1 
        554 1 1 1 1  33 LEU H   2l30_ambr001  33 LEU H    1 1 
        554 1 2 1 1  33 LEU HG  2l30_ambr001  33 LEU HG   1 1 
        555 1 1 1 1  33 LEU H   2l30_ambr001  33 LEU H    1 1 
        555 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        556 1 1 1 1  33 LEU HA  2l30_ambr001  33 LEU HA   1 1 
        556 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        557 1 1 1 1  33 LEU QB  2l30_ambr001  33 LEU HB2  1 1 
        557 1 2 1 1  34 ARG H   2l30_ambr001  34 LEU H    1 1 
        558 1 1 1 1  33 LEU QB  2l30_ambr001  33 LEU HB2  1 1 
        558 1 2 1 1  34 ARG HA  2l30_ambr001  34 LEU HA   1 1 
        559 1 1 1 1  33 LEU QB  2l30_ambr001  33 LEU HB2  1 1 
        559 1 2 1 1  54 PHE QB  2l30_ambr001  54 LEU HB2  1 1 
        560 1 1 1 1  33 LEU QB  2l30_ambr001  33 LEU HB2  1 1 
        560 1 2 1 1  54 PHE QD  2l30_ambr001  54 LEU HD1  1 1 
        561 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        561 1 2 1 1  34 ARG H   2l30_ambr001  34 LEU H    1 1 
        562 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        562 1 2 1 1  35 MET HA  2l30_ambr001  35 LEU HA   1 1 
        563 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        563 1 2 1 1  35 MET QG  2l30_ambr001  35 LEU HG2  1 1 
        564 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        564 1 2 1 1  54 PHE HA  2l30_ambr001  54 LEU HA   1 1 
        565 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        565 1 2 1 1  54 PHE QB  2l30_ambr001  54 LEU HB2  1 1 
        566 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        566 1 2 1 1  54 PHE QD  2l30_ambr001  54 LEU HD1  1 1 
        567 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        567 1 2 1 1  54 PHE QE  2l30_ambr001  54 LEU HE1  1 1 
        568 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        568 1 2 1 1  77 LEU HA  2l30_ambr001  77 LEU HA   1 1 
        569 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        569 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        570 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        570 1 2 1 1  78 ARG H   2l30_ambr001  78 LEU H    1 1 
        571 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        571 1 2 1 1  81 ASP QB  2l30_ambr001  81 LEU HB2  1 1 
        572 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        572 1 2 1 1  84 LYS QD  2l30_ambr001  84 LEU HD2  1 1 
        573 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        573 1 2 1 1  84 LYS QE  2l30_ambr001  84 LEU HE2  1 1 
        574 1 1 1 1  33 LEU QD  2l30_ambr001  33 LEU HD11 1 1 
        574 1 2 1 1  85 VAL QG  2l30_ambr001  85 LEU HG11 1 1 
        575 1 1 1 1  33 LEU HG  2l30_ambr001  33 LEU HG   1 1 
        575 1 2 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        576 1 1 1 1  33 LEU HG  2l30_ambr001  33 LEU HG   1 1 
        576 1 2 1 1  54 PHE HA  2l30_ambr001  54 PHE HA   1 1 
        577 1 1 1 1  33 LEU HG  2l30_ambr001  33 LEU HG   1 1 
        577 1 2 1 1  54 PHE QB  2l30_ambr001  54 PHE HB2  1 1 
        578 1 1 1 1  33 LEU HG  2l30_ambr001  33 LEU HG   1 1 
        578 1 2 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        579 1 1 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        579 1 2 1 1  34 ARG QG  2l30_ambr001  34 ARG HG2  1 1 
        580 1 1 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        580 1 2 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        581 1 1 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        581 1 2 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        582 1 1 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        582 1 2 1 1  54 PHE HA  2l30_ambr001  54 PHE HA   1 1 
        583 1 1 1 1  34 ARG H   2l30_ambr001  34 ARG H    1 1 
        583 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
        584 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        584 1 2 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        585 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        585 1 2 1 1  35 MET QB  2l30_ambr001  35 MET HB2  1 1 
        586 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        586 1 2 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        587 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        587 1 2 1 1  51 TRP HE3 2l30_ambr001  51 TRP HE3  1 1 
        588 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        588 1 2 1 1  53 HIS HA  2l30_ambr001  53 HIE HA   1 1 
        589 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        589 1 2 1 1  54 PHE H   2l30_ambr001  54 PHE H    1 1 
        590 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        590 1 2 1 1  54 PHE HA  2l30_ambr001  54 PHE HA   1 1 
        591 1 1 1 1  34 ARG HA  2l30_ambr001  34 ARG HA   1 1 
        591 1 2 1 1  54 PHE QB  2l30_ambr001  54 PHE HB2  1 1 
        592 1 1 1 1  34 ARG QB  2l30_ambr001  34 ARG HB2  1 1 
        592 1 2 1 1  35 MET H   2l30_ambr001  35 ARG H    1 1 
        593 1 1 1 1  34 ARG QB  2l30_ambr001  34 ARG HB2  1 1 
        593 1 2 1 1  51 TRP HE3 2l30_ambr001  51 ARG HE3  1 1 
        594 1 1 1 1  34 ARG QB  2l30_ambr001  34 ARG HB2  1 1 
        594 1 2 1 1  54 PHE HA  2l30_ambr001  54 ARG HA   1 1 
        595 1 1 1 1  34 ARG QD  2l30_ambr001  34 ARG HD2  1 1 
        595 1 2 1 1  51 TRP QB  2l30_ambr001  51 ARG HB2  1 1 
        596 1 1 1 1  34 ARG QD  2l30_ambr001  34 ARG HD2  1 1 
        596 1 2 1 1  51 TRP HE3 2l30_ambr001  51 ARG HE3  1 1 
        597 1 1 1 1  34 ARG QG  2l30_ambr001  34 ARG HG2  1 1 
        597 1 2 1 1  51 TRP HE3 2l30_ambr001  51 ARG HE3  1 1 
        598 1 1 1 1  34 ARG QG  2l30_ambr001  34 ARG HG2  1 1 
        598 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 ARG HZ3  1 1 
        599 1 1 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        599 1 2 1 1  36 ALA H   2l30_ambr001  36 ALA H    1 1 
        600 1 1 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        600 1 2 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        601 1 1 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        601 1 2 1 1  51 TRP HE3 2l30_ambr001  51 TRP HE3  1 1 
        602 1 1 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        602 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 TRP HZ3  1 1 
        603 1 1 1 1  35 MET H   2l30_ambr001  35 MET H    1 1 
        603 1 2 1 1  52 TYR H   2l30_ambr001  52 TYR H    1 1 
        604 1 1 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        604 1 2 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        605 1 1 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        605 1 2 1 1  36 ALA H   2l30_ambr001  36 ALA H    1 1 
        606 1 1 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        606 1 2 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        607 1 1 1 1  35 MET HA  2l30_ambr001  35 MET HA   1 1 
        607 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 TRP HZ3  1 1 
        608 1 1 1 1  35 MET QB  2l30_ambr001  35 MET HB2  1 1 
        608 1 2 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        609 1 1 1 1  35 MET QB  2l30_ambr001  35 MET HB2  1 1 
        609 1 2 1 1  36 ALA H   2l30_ambr001  36 MET H    1 1 
        610 1 1 1 1  35 MET QB  2l30_ambr001  35 MET HB2  1 1 
        610 1 2 1 1  54 PHE HA  2l30_ambr001  54 MET HA   1 1 
        611 1 1 1 1  35 MET QB  2l30_ambr001  35 MET HB2  1 1 
        611 1 2 1 1  57 PHE QB  2l30_ambr001  57 MET HB2  1 1 
        612 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        612 1 2 1 1  36 ALA H   2l30_ambr001  36 MET H    1 1 
        613 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        613 1 2 1 1  57 PHE HA  2l30_ambr001  57 MET HA   1 1 
        614 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        614 1 2 1 1  57 PHE QE  2l30_ambr001  57 MET HE1  1 1 
        615 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        615 1 2 1 1  57 PHE HZ  2l30_ambr001  57 MET HZ   1 1 
        616 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        616 1 2 1 1  58 TRP H   2l30_ambr001  58 MET H    1 1 
        617 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        617 1 2 1 1  58 TRP HE1 2l30_ambr001  58 MET HE1  1 1 
        618 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        618 1 2 1 1  58 TRP HH2 2l30_ambr001  58 MET HH2  1 1 
        619 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        619 1 2 1 1  58 TRP HZ2 2l30_ambr001  58 MET HZ2  1 1 
        620 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        620 1 2 1 1  64 ILE MD  2l30_ambr001  64 MET HD11 1 1 
        621 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        621 1 2 1 1  64 ILE MG  2l30_ambr001  64 MET HG21 1 1 
        622 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        622 1 2 1 1  71 VAL HA  2l30_ambr001  71 MET HA   1 1 
        623 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        623 1 2 1 1  71 VAL HB  2l30_ambr001  71 MET HB   1 1 
        624 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        624 1 2 1 1  71 VAL QG  2l30_ambr001  71 MET HG11 1 1 
        625 1 1 1 1  35 MET ME  2l30_ambr001  35 MET HE1  1 1 
        625 1 2 1 1  85 VAL QG  2l30_ambr001  85 MET HG11 1 1 
        626 1 1 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        626 1 2 1 1  36 ALA H   2l30_ambr001  36 MET H    1 1 
        627 1 1 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        627 1 2 1 1  54 PHE HA  2l30_ambr001  54 MET HA   1 1 
        628 1 1 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        628 1 2 1 1  54 PHE QD  2l30_ambr001  54 MET HD1  1 1 
        629 1 1 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        629 1 2 1 1  57 PHE QB  2l30_ambr001  57 MET HB2  1 1 
        630 1 1 1 1  35 MET QG  2l30_ambr001  35 MET HG2  1 1 
        630 1 2 1 1  71 VAL QG  2l30_ambr001  71 MET HG11 1 1 
        631 1 1 1 1  36 ALA H   2l30_ambr001  36 ALA H    1 1 
        631 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 TRP HZ3  1 1 
        632 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        632 1 2 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        633 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        633 1 2 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        634 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        634 1 2 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        635 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        635 1 2 1 1  50 HIS HA  2l30_ambr001  50 HIE HA   1 1 
        636 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        636 1 2 1 1  51 TRP HA  2l30_ambr001  51 TRP HA   1 1 
        637 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        637 1 2 1 1  51 TRP HE3 2l30_ambr001  51 TRP HE3  1 1 
        638 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        638 1 2 1 1  52 TYR H   2l30_ambr001  52 TYR H    1 1 
        639 1 1 1 1  36 ALA HA  2l30_ambr001  36 ALA HA   1 1 
        639 1 2 1 1  52 TYR QE  2l30_ambr001  52 TYR HE1  1 1 
        640 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        640 1 2 1 1  37 ILE H   2l30_ambr001  37 ALA H    1 1 
        641 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        641 1 2 1 1  37 ILE HB  2l30_ambr001  37 ALA HB   1 1 
        642 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        642 1 2 1 1  37 ILE MG  2l30_ambr001  37 ALA HG21 1 1 
        643 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        643 1 2 1 1  38 MET ME  2l30_ambr001  38 ALA HE1  1 1 
        644 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        644 1 2 1 1  49 PRO HA  2l30_ambr001  49 ALA HA   1 1 
        645 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        645 1 2 1 1  49 PRO QB  2l30_ambr001  49 ALA HB2  1 1 
        646 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        646 1 2 1 1  49 PRO QD  2l30_ambr001  49 ALA HD2  1 1 
        647 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        647 1 2 1 1  49 PRO QG  2l30_ambr001  49 ALA HG2  1 1 
        648 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        648 1 2 1 1  50 HIS H   2l30_ambr001  50 ALA H    1 1 
        649 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        649 1 2 1 1  51 TRP H   2l30_ambr001  51 ALA H    1 1 
        650 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        650 1 2 1 1  51 TRP HA  2l30_ambr001  51 ALA HA   1 1 
        651 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        651 1 2 1 1  51 TRP HD1 2l30_ambr001  51 ALA HD1  1 1 
        652 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        652 1 2 1 1  51 TRP HE1 2l30_ambr001  51 ALA HE1  1 1 
        653 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        653 1 2 1 1  51 TRP HE3 2l30_ambr001  51 ALA HE3  1 1 
        654 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        654 1 2 1 1  51 TRP HH2 2l30_ambr001  51 ALA HH2  1 1 
        655 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        655 1 2 1 1  51 TRP HZ2 2l30_ambr001  51 ALA HZ2  1 1 
        656 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        656 1 2 1 1  51 TRP HZ3 2l30_ambr001  51 ALA HZ3  1 1 
        657 1 1 1 1  36 ALA MB  2l30_ambr001  36 ALA HB1  1 1 
        657 1 2 1 1  52 TYR H   2l30_ambr001  52 ALA H    1 1 
        658 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        658 1 2 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        659 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        659 1 2 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        660 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        660 1 2 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        661 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        661 1 2 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        662 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        662 1 2 1 1  49 PRO HA  2l30_ambr001  49 PRO HA   1 1 
        663 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        663 1 2 1 1  49 PRO QB  2l30_ambr001  49 PRO HB2  1 1 
        664 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        664 1 2 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        665 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        665 1 2 1 1  50 HIS QB  2l30_ambr001  50 HIE HB2  1 1 
        666 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        666 1 2 1 1  50 HIS HD2 2l30_ambr001  50 HIE HD2  1 1 
        667 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        667 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        668 1 1 1 1  37 ILE H   2l30_ambr001  37 ILE H    1 1 
        668 1 2 1 1  52 TYR QE  2l30_ambr001  52 TYR HE1  1 1 
        669 1 1 1 1  37 ILE HA  2l30_ambr001  37 ILE HA   1 1 
        669 1 2 1 1  37 ILE QG  2l30_ambr001  37 ILE HG12 1 1 
        670 1 1 1 1  37 ILE HA  2l30_ambr001  37 ILE HA   1 1 
        670 1 2 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        671 1 1 1 1  37 ILE HA  2l30_ambr001  37 ILE HA   1 1 
        671 1 2 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        672 1 1 1 1  37 ILE HA  2l30_ambr001  37 ILE HA   1 1 
        672 1 2 1 1  38 MET QB  2l30_ambr001  38 MET HB2  1 1 
        673 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        673 1 2 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        674 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        674 1 2 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        675 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        675 1 2 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        676 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        676 1 2 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        677 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        677 1 2 1 1  50 HIS QB  2l30_ambr001  50 HIE HB2  1 1 
        678 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        678 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        679 1 1 1 1  37 ILE HB  2l30_ambr001  37 ILE HB   1 1 
        679 1 2 1 1  52 TYR QE  2l30_ambr001  52 TYR HE1  1 1 
        680 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        680 1 2 1 1  38 MET H   2l30_ambr001  38 ILE H    1 1 
        681 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        681 1 2 1 1  50 HIS H   2l30_ambr001  50 ILE H    1 1 
        682 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        682 1 2 1 1  50 HIS QB  2l30_ambr001  50 ILE HB2  1 1 
        683 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        683 1 2 1 1  52 TYR QE  2l30_ambr001  52 ILE HE1  1 1 
        684 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        684 1 2 1 1  57 PHE QE  2l30_ambr001  57 ILE HE1  1 1 
        685 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        685 1 2 1 1  57 PHE HZ  2l30_ambr001  57 ILE HZ   1 1 
        686 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        686 1 2 1 1  60 VAL HB  2l30_ambr001  60 ILE HB   1 1 
        687 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        687 1 2 1 1  60 VAL QG  2l30_ambr001  60 ILE HG11 1 1 
        688 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        688 1 2 1 1  62 HIS QB  2l30_ambr001  62 ILE HB2  1 1 
        689 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        689 1 2 1 1  62 HIS HD2 2l30_ambr001  62 ILE HD2  1 1 
        690 1 1 1 1  37 ILE MD  2l30_ambr001  37 ILE HD11 1 1 
        690 1 2 1 1  62 HIS HE1 2l30_ambr001  62 ILE HE1  1 1 
        691 1 1 1 1  37 ILE QG  2l30_ambr001  37 ILE HG12 1 1 
        691 1 2 1 1  38 MET H   2l30_ambr001  38 ILE H    1 1 
        692 1 1 1 1  37 ILE QG  2l30_ambr001  37 ILE HG12 1 1 
        692 1 2 1 1  57 PHE HZ  2l30_ambr001  57 ILE HZ   1 1 
        693 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        693 1 2 1 1  38 MET H   2l30_ambr001  38 ILE H    1 1 
        694 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        694 1 2 1 1  38 MET HA  2l30_ambr001  38 ILE HA   1 1 
        695 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        695 1 2 1 1  38 MET ME  2l30_ambr001  38 ILE HE1  1 1 
        696 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        696 1 2 1 1  39 VAL H   2l30_ambr001  39 ILE H    1 1 
        697 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        697 1 2 1 1  39 VAL QG  2l30_ambr001  39 ILE HG11 1 1 
        698 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        698 1 2 1 1  49 PRO HA  2l30_ambr001  49 ILE HA   1 1 
        699 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        699 1 2 1 1  50 HIS H   2l30_ambr001  50 ILE H    1 1 
        700 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        700 1 2 1 1  50 HIS QB  2l30_ambr001  50 ILE HB2  1 1 
        701 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        701 1 2 1 1  50 HIS HD2 2l30_ambr001  50 ILE HD2  1 1 
        702 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        702 1 2 1 1  52 TYR QE  2l30_ambr001  52 ILE HE1  1 1 
        703 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        703 1 2 1 1  60 VAL QG  2l30_ambr001  60 ILE HG11 1 1 
        704 1 1 1 1  37 ILE MG  2l30_ambr001  37 ILE HG21 1 1 
        704 1 2 1 1  62 HIS HE1 2l30_ambr001  62 ILE HE1  1 1 
        705 1 1 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        705 1 2 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        706 1 1 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        706 1 2 1 1  38 MET QG  2l30_ambr001  38 MET HG2  1 1 
        707 1 1 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        707 1 2 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        708 1 1 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        708 1 2 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        709 1 1 1 1  38 MET H   2l30_ambr001  38 MET H    1 1 
        709 1 2 1 1  49 PRO HA  2l30_ambr001  49 PRO HA   1 1 
        710 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        710 1 2 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        711 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        711 1 2 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        712 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        712 1 2 1 1  39 VAL HB  2l30_ambr001  39 VAL HB   1 1 
        713 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        713 1 2 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        714 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        714 1 2 1 1  49 PRO HA  2l30_ambr001  49 PRO HA   1 1 
        715 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        715 1 2 1 1  49 PRO QB  2l30_ambr001  49 PRO HB2  1 1 
        716 1 1 1 1  38 MET HA  2l30_ambr001  38 MET HA   1 1 
        716 1 2 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        717 1 1 1 1  38 MET QB  2l30_ambr001  38 MET HB2  1 1 
        717 1 2 1 1  39 VAL H   2l30_ambr001  39 MET H    1 1 
        718 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        718 1 2 1 1  39 VAL H   2l30_ambr001  39 MET H    1 1 
        719 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        719 1 2 1 1  47 LYS QB  2l30_ambr001  47 MET HB2  1 1 
        720 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        720 1 2 1 1  47 LYS QE  2l30_ambr001  47 MET HE2  1 1 
        721 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        721 1 2 1 1  48 VAL H   2l30_ambr001  48 MET H    1 1 
        722 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        722 1 2 1 1  48 VAL HA  2l30_ambr001  48 MET HA   1 1 
        723 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        723 1 2 1 1  48 VAL HB  2l30_ambr001  48 MET HB   1 1 
        724 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        724 1 2 1 1  49 PRO HA  2l30_ambr001  49 MET HA   1 1 
        725 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        725 1 2 1 1  49 PRO QB  2l30_ambr001  49 MET HB2  1 1 
        726 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        726 1 2 1 1  49 PRO QD  2l30_ambr001  49 MET HD2  1 1 
        727 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        727 1 2 1 1  49 PRO QG  2l30_ambr001  49 MET HG2  1 1 
        728 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        728 1 2 1 1  50 HIS H   2l30_ambr001  50 MET H    1 1 
        729 1 1 1 1  38 MET ME  2l30_ambr001  38 MET HE1  1 1 
        729 1 2 1 1  50 HIS HD2 2l30_ambr001  50 MET HD2  1 1 
        730 1 1 1 1  38 MET QG  2l30_ambr001  38 MET HG2  1 1 
        730 1 2 1 1  47 LYS QB  2l30_ambr001  47 MET HB2  1 1 
        731 1 1 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        731 1 2 1 1  39 VAL HB  2l30_ambr001  39 VAL HB   1 1 
        732 1 1 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        732 1 2 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        733 1 1 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        733 1 2 1 1  47 LYS QB  2l30_ambr001  47 LYS HB2  1 1 
        734 1 1 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        734 1 2 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        735 1 1 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        735 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        736 1 1 1 1  39 VAL H   2l30_ambr001  39 VAL H    1 1 
        736 1 2 1 1  49 PRO HA  2l30_ambr001  49 PRO HA   1 1 
        737 1 1 1 1  39 VAL HA  2l30_ambr001  39 VAL HA   1 1 
        737 1 2 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        738 1 1 1 1  39 VAL HA  2l30_ambr001  39 VAL HA   1 1 
        738 1 2 1 1  40 GLN QG  2l30_ambr001  40 GLN HG2  1 1 
        739 1 1 1 1  39 VAL HA  2l30_ambr001  39 VAL HA   1 1 
        739 1 2 1 1  47 LYS QD  2l30_ambr001  47 LYS HD2  1 1 
        740 1 1 1 1  39 VAL HA  2l30_ambr001  39 VAL HA   1 1 
        740 1 2 1 1  47 LYS QE  2l30_ambr001  47 LYS HE2  1 1 
        741 1 1 1 1  39 VAL HA  2l30_ambr001  39 VAL HA   1 1 
        741 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        742 1 1 1 1  39 VAL HB  2l30_ambr001  39 VAL HB   1 1 
        742 1 2 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        743 1 1 1 1  39 VAL HB  2l30_ambr001  39 VAL HB   1 1 
        743 1 2 1 1  40 GLN QG  2l30_ambr001  40 GLN HG2  1 1 
        744 1 1 1 1  39 VAL HB  2l30_ambr001  39 VAL HB   1 1 
        744 1 2 1 1  50 HIS HE1 2l30_ambr001  50 HIE HE1  1 1 
        745 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        745 1 2 1 1  40 GLN H   2l30_ambr001  40 VAL H    1 1 
        746 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        746 1 2 1 1  40 GLN HA  2l30_ambr001  40 VAL HA   1 1 
        747 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        747 1 2 1 1  40 GLN QB  2l30_ambr001  40 VAL HB2  1 1 
        748 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        748 1 2 1 1  40 GLN QG  2l30_ambr001  40 VAL HG2  1 1 
        749 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        749 1 2 1 1  41 SER H   2l30_ambr001  41 VAL H    1 1 
        750 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        750 1 2 1 1  41 SER HA  2l30_ambr001  41 VAL HA   1 1 
        751 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        751 1 2 1 1  47 LYS QD  2l30_ambr001  47 VAL HD2  1 1 
        752 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        752 1 2 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        753 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        753 1 2 1 1  48 VAL HB  2l30_ambr001  48 VAL HB   1 1 
        754 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        754 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        755 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        755 1 2 1 1  50 HIS H   2l30_ambr001  50 VAL H    1 1 
        756 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        756 1 2 1 1  50 HIS QB  2l30_ambr001  50 VAL HB2  1 1 
        757 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        757 1 2 1 1  50 HIS HD2 2l30_ambr001  50 VAL HD2  1 1 
        758 1 1 1 1  39 VAL QG  2l30_ambr001  39 VAL HG11 1 1 
        758 1 2 1 1  50 HIS HE1 2l30_ambr001  50 VAL HE1  1 1 
        759 1 1 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        759 1 2 1 1  40 GLN QB  2l30_ambr001  40 GLN HB2  1 1 
        760 1 1 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        760 1 2 1 1  40 GLN QG  2l30_ambr001  40 GLN HG2  1 1 
        761 1 1 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        761 1 2 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        762 1 1 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        762 1 2 1 1  47 LYS QB  2l30_ambr001  47 LYS HB2  1 1 
        763 1 1 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        763 1 2 1 1  47 LYS QD  2l30_ambr001  47 LYS HD2  1 1 
        764 1 1 1 1  40 GLN H   2l30_ambr001  40 GLN H    1 1 
        764 1 2 1 1  47 LYS QE  2l30_ambr001  47 LYS HE2  1 1 
        765 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        765 1 2 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        766 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        766 1 2 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        767 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        767 1 2 1 1  47 LYS HA  2l30_ambr001  47 LYS HA   1 1 
        768 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        768 1 2 1 1  47 LYS QB  2l30_ambr001  47 LYS HB2  1 1 
        769 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        769 1 2 1 1  47 LYS QD  2l30_ambr001  47 LYS HD2  1 1 
        770 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        770 1 2 1 1  47 LYS QE  2l30_ambr001  47 LYS HE2  1 1 
        771 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        771 1 2 1 1  47 LYS QG  2l30_ambr001  47 LYS HG2  1 1 
        772 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        772 1 2 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        773 1 1 1 1  40 GLN HA  2l30_ambr001  40 GLN HA   1 1 
        773 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        774 1 1 1 1  40 GLN QB  2l30_ambr001  40 GLN HB2  1 1 
        774 1 2 1 1  41 SER H   2l30_ambr001  41 GLN H    1 1 
        775 1 1 1 1  40 GLN QB  2l30_ambr001  40 GLN HB2  1 1 
        775 1 2 1 1  47 LYS HA  2l30_ambr001  47 GLN HA   1 1 
        776 1 1 1 1  40 GLN QB  2l30_ambr001  40 GLN HB2  1 1 
        776 1 2 1 1  47 LYS QD  2l30_ambr001  47 GLN HD2  1 1 
        777 1 1 1 1  40 GLN QB  2l30_ambr001  40 GLN HB2  1 1 
        777 1 2 1 1  47 LYS QE  2l30_ambr001  47 GLN HE2  1 1 
        778 1 1 1 1  40 GLN QB  2l30_ambr001  40 GLN HB2  1 1 
        778 1 2 1 1  47 LYS QG  2l30_ambr001  47 GLN HG2  1 1 
        779 1 1 1 1  40 GLN QG  2l30_ambr001  40 GLN HG2  1 1 
        779 1 2 1 1  47 LYS QD  2l30_ambr001  47 GLN HD2  1 1 
        780 1 1 1 1  40 GLN QG  2l30_ambr001  40 GLN HG2  1 1 
        780 1 2 1 1  47 LYS QE  2l30_ambr001  47 GLN HE2  1 1 
        781 1 1 1 1  40 GLN QG  2l30_ambr001  40 GLN HG2  1 1 
        781 1 2 1 1  47 LYS QG  2l30_ambr001  47 GLN HG2  1 1 
        782 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        782 1 2 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        783 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        783 1 2 1 1  42 PRO QD  2l30_ambr001  42 PRO HD2  1 1 
        784 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        784 1 2 1 1  43 MET H   2l30_ambr001  43 MET H    1 1 
        785 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        785 1 2 1 1  44 PHE H   2l30_ambr001  44 PHE H    1 1 
        786 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        786 1 2 1 1  46 GLY H   2l30_ambr001  46 GLY H    1 1 
        787 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        787 1 2 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        788 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        788 1 2 1 1  47 LYS QD  2l30_ambr001  47 LYS HD2  1 1 
        789 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        789 1 2 1 1  47 LYS QG  2l30_ambr001  47 LYS HG2  1 1 
        790 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        790 1 2 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        791 1 1 1 1  41 SER H   2l30_ambr001  41 SER H    1 1 
        791 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        792 1 1 1 1  41 SER HA  2l30_ambr001  41 SER HA   1 1 
        792 1 2 1 1  42 PRO HA  2l30_ambr001  42 PRO HA   1 1 
        793 1 1 1 1  41 SER HA  2l30_ambr001  41 SER HA   1 1 
        793 1 2 1 1  42 PRO QB  2l30_ambr001  42 PRO HB2  1 1 
        794 1 1 1 1  41 SER HA  2l30_ambr001  41 SER HA   1 1 
        794 1 2 1 1  42 PRO QD  2l30_ambr001  42 PRO HD2  1 1 
        795 1 1 1 1  41 SER HA  2l30_ambr001  41 SER HA   1 1 
        795 1 2 1 1  43 MET ME  2l30_ambr001  43 MET HE1  1 1 
        796 1 1 1 1  41 SER HA  2l30_ambr001  41 SER HA   1 1 
        796 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        797 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        797 1 2 1 1  42 PRO QD  2l30_ambr001  42 SER HD2  1 1 
        798 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        798 1 2 1 1  43 MET H   2l30_ambr001  43 SER H    1 1 
        799 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        799 1 2 1 1  43 MET QB  2l30_ambr001  43 SER HB2  1 1 
        800 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        800 1 2 1 1  44 PHE H   2l30_ambr001  44 SER H    1 1 
        801 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        801 1 2 1 1  44 PHE HA  2l30_ambr001  44 SER HA   1 1 
        802 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        802 1 2 1 1  44 PHE QB  2l30_ambr001  44 SER HB2  1 1 
        803 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        803 1 2 1 1  44 PHE QD  2l30_ambr001  44 SER HD1  1 1 
        804 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        804 1 2 1 1  45 ASP H   2l30_ambr001  45 SER H    1 1 
        805 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        805 1 2 1 1  46 GLY H   2l30_ambr001  46 SER H    1 1 
        806 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        806 1 2 1 1  47 LYS HA  2l30_ambr001  47 SER HA   1 1 
        807 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        807 1 2 1 1  48 VAL H   2l30_ambr001  48 SER H    1 1 
        808 1 1 1 1  41 SER QB  2l30_ambr001  41 SER HB2  1 1 
        808 1 2 1 1  48 VAL QG  2l30_ambr001  48 SER HG11 1 1 
        809 1 1 1 1  42 PRO HA  2l30_ambr001  42 PRO HA   1 1 
        809 1 2 1 1  44 PHE H   2l30_ambr001  44 PHE H    1 1 
        810 1 1 1 1  42 PRO QB  2l30_ambr001  42 PRO HB2  1 1 
        810 1 2 1 1  43 MET H   2l30_ambr001  43 PRO H    1 1 
        811 1 1 1 1  42 PRO QD  2l30_ambr001  42 PRO HD2  1 1 
        811 1 2 1 1  43 MET H   2l30_ambr001  43 PRO H    1 1 
        812 1 1 1 1  42 PRO QD  2l30_ambr001  42 PRO HD2  1 1 
        812 1 2 1 1  43 MET ME  2l30_ambr001  43 PRO HE1  1 1 
        813 1 1 1 1  42 PRO QD  2l30_ambr001  42 PRO HD2  1 1 
        813 1 2 1 1  48 VAL QG  2l30_ambr001  48 PRO HG11 1 1 
        814 1 1 1 1  42 PRO QG  2l30_ambr001  42 PRO HG2  1 1 
        814 1 2 1 1  43 MET H   2l30_ambr001  43 PRO H    1 1 
        815 1 1 1 1  43 MET H   2l30_ambr001  43 MET H    1 1 
        815 1 2 1 1  44 PHE H   2l30_ambr001  44 PHE H    1 1 
        816 1 1 1 1  43 MET HA  2l30_ambr001  43 MET HA   1 1 
        816 1 2 1 1  43 MET ME  2l30_ambr001  43 MET HE1  1 1 
        817 1 1 1 1  43 MET HA  2l30_ambr001  43 MET HA   1 1 
        817 1 2 1 1  44 PHE QB  2l30_ambr001  44 PHE HB2  1 1 
        818 1 1 1 1  43 MET QB  2l30_ambr001  43 MET HB2  1 1 
        818 1 2 1 1  44 PHE H   2l30_ambr001  44 MET H    1 1 
        819 1 1 1 1  43 MET QB  2l30_ambr001  43 MET HB2  1 1 
        819 1 2 1 1  44 PHE QB  2l30_ambr001  44 MET HB2  1 1 
        820 1 1 1 1  43 MET ME  2l30_ambr001  43 MET HE1  1 1 
        820 1 2 1 1  44 PHE H   2l30_ambr001  44 MET H    1 1 
        821 1 1 1 1  43 MET ME  2l30_ambr001  43 MET HE1  1 1 
        821 1 2 1 1  48 VAL QG  2l30_ambr001  48 MET HG11 1 1 
        822 1 1 1 1  43 MET QG  2l30_ambr001  43 MET HG2  1 1 
        822 1 2 1 1  44 PHE H   2l30_ambr001  44 MET H    1 1 
        823 1 1 1 1  44 PHE H   2l30_ambr001  44 PHE H    1 1 
        823 1 2 1 1  45 ASP H   2l30_ambr001  45 ASP H    1 1 
        824 1 1 1 1  44 PHE H   2l30_ambr001  44 PHE H    1 1 
        824 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        825 1 1 1 1  44 PHE HA  2l30_ambr001  44 PHE HA   1 1 
        825 1 2 1 1  45 ASP H   2l30_ambr001  45 ASP H    1 1 
        826 1 1 1 1  44 PHE HA  2l30_ambr001  44 PHE HA   1 1 
        826 1 2 1 1  46 GLY H   2l30_ambr001  46 GLY H    1 1 
        827 1 1 1 1  44 PHE QB  2l30_ambr001  44 PHE HB2  1 1 
        827 1 2 1 1  45 ASP H   2l30_ambr001  45 PHE H    1 1 
        828 1 1 1 1  44 PHE QB  2l30_ambr001  44 PHE HB2  1 1 
        828 1 2 1 1  46 GLY H   2l30_ambr001  46 PHE H    1 1 
        829 1 1 1 1  44 PHE QB  2l30_ambr001  44 PHE HB2  1 1 
        829 1 2 1 1  48 VAL QG  2l30_ambr001  48 PHE HG11 1 1 
        830 1 1 1 1  44 PHE QD  2l30_ambr001  44 PHE HD1  1 1 
        830 1 2 1 1  46 GLY QA  2l30_ambr001  46 PHE HA2  1 1 
        831 1 1 1 1  44 PHE QD  2l30_ambr001  44 PHE HD1  1 1 
        831 1 2 1 1  48 VAL QG  2l30_ambr001  48 PHE HG11 1 1 
        832 1 1 1 1  44 PHE QE  2l30_ambr001  44 PHE HE1  1 1 
        832 1 2 1 1  46 GLY QA  2l30_ambr001  46 PHE HA2  1 1 
        833 1 1 1 1  44 PHE QE  2l30_ambr001  44 PHE HE1  1 1 
        833 1 2 1 1  48 VAL QG  2l30_ambr001  48 PHE HG11 1 1 
        834 1 1 1 1  44 PHE HZ  2l30_ambr001  44 PHE HZ   1 1 
        834 1 2 1 1  45 ASP H   2l30_ambr001  45 ASP H    1 1 
        835 1 1 1 1  45 ASP H   2l30_ambr001  45 ASP H    1 1 
        835 1 2 1 1  46 GLY H   2l30_ambr001  46 GLY H    1 1 
        836 1 1 1 1  45 ASP H   2l30_ambr001  45 ASP H    1 1 
        836 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        837 1 1 1 1  45 ASP HA  2l30_ambr001  45 ASP HA   1 1 
        837 1 2 1 1  46 GLY H   2l30_ambr001  46 GLY H    1 1 
        838 1 1 1 1  45 ASP HA  2l30_ambr001  45 ASP HA   1 1 
        838 1 2 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        839 1 1 1 1  45 ASP QB  2l30_ambr001  45 ASP HB2  1 1 
        839 1 2 1 1  46 GLY H   2l30_ambr001  46 ASP H    1 1 
        840 1 1 1 1  45 ASP QB  2l30_ambr001  45 ASP HB2  1 1 
        840 1 2 1 1  46 GLY QA  2l30_ambr001  46 ASP HA2  1 1 
        841 1 1 1 1  46 GLY H   2l30_ambr001  46 GLY H    1 1 
        841 1 2 1 1  47 LYS H   2l30_ambr001  47 LYS H    1 1 
        842 1 1 1 1  46 GLY H   2l30_ambr001  46 GLY H    1 1 
        842 1 2 1 1  47 LYS QG  2l30_ambr001  47 LYS HG2  1 1 
        843 1 1 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        843 1 2 1 1  47 LYS H   2l30_ambr001  47 GLY H    1 1 
        844 1 1 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        844 1 2 1 1  47 LYS QB  2l30_ambr001  47 GLY HB2  1 1 
        845 1 1 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        845 1 2 1 1  47 LYS QD  2l30_ambr001  47 GLY HD2  1 1 
        846 1 1 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        846 1 2 1 1  47 LYS QG  2l30_ambr001  47 GLY HG2  1 1 
        847 1 1 1 1  46 GLY QA  2l30_ambr001  46 GLY HA2  1 1 
        847 1 2 1 1  48 VAL QG  2l30_ambr001  48 GLY HG11 1 1 
        848 1 1 1 1  47 LYS H   2l30_ambr001  47 LYS H    1 1 
        848 1 2 1 1  47 LYS QE  2l30_ambr001  47 LYS HE2  1 1 
        849 1 1 1 1  47 LYS H   2l30_ambr001  47 LYS H    1 1 
        849 1 2 1 1  47 LYS QG  2l30_ambr001  47 LYS HG2  1 1 
        850 1 1 1 1  47 LYS H   2l30_ambr001  47 LYS H    1 1 
        850 1 2 1 1  48 VAL HA  2l30_ambr001  48 VAL HA   1 1 
        851 1 1 1 1  47 LYS QB  2l30_ambr001  47 LYS HB2  1 1 
        851 1 2 1 1  48 VAL H   2l30_ambr001  48 LYS H    1 1 
        852 1 1 1 1  47 LYS QB  2l30_ambr001  47 LYS HB2  1 1 
        852 1 2 1 1  48 VAL HA  2l30_ambr001  48 LYS HA   1 1 
        853 1 1 1 1  47 LYS QD  2l30_ambr001  47 LYS HD2  1 1 
        853 1 2 1 1  48 VAL H   2l30_ambr001  48 LYS H    1 1 
        854 1 1 1 1  47 LYS QD  2l30_ambr001  47 LYS HD2  1 1 
        854 1 2 1 1  48 VAL QG  2l30_ambr001  48 LYS HG11 1 1 
        855 1 1 1 1  47 LYS QG  2l30_ambr001  47 LYS HG2  1 1 
        855 1 2 1 1  48 VAL H   2l30_ambr001  48 LYS H    1 1 
        856 1 1 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        856 1 2 1 1  48 VAL HB  2l30_ambr001  48 VAL HB   1 1 
        857 1 1 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        857 1 2 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        858 1 1 1 1  48 VAL H   2l30_ambr001  48 VAL H    1 1 
        858 1 2 1 1  49 PRO QD  2l30_ambr001  49 PRO HD2  1 1 
        859 1 1 1 1  48 VAL HA  2l30_ambr001  48 VAL HA   1 1 
        859 1 2 1 1  49 PRO QD  2l30_ambr001  49 PRO HD2  1 1 
        860 1 1 1 1  48 VAL HA  2l30_ambr001  48 VAL HA   1 1 
        860 1 2 1 1  49 PRO QG  2l30_ambr001  49 PRO HG2  1 1 
        861 1 1 1 1  48 VAL HB  2l30_ambr001  48 VAL HB   1 1 
        861 1 2 1 1  49 PRO QD  2l30_ambr001  49 PRO HD2  1 1 
        862 1 1 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        862 1 2 1 1  49 PRO HA  2l30_ambr001  49 VAL HA   1 1 
        863 1 1 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        863 1 2 1 1  49 PRO QD  2l30_ambr001  49 VAL HD2  1 1 
        864 1 1 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        864 1 2 1 1  49 PRO QG  2l30_ambr001  49 VAL HG2  1 1 
        865 1 1 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        865 1 2 1 1  50 HIS HD2 2l30_ambr001  50 VAL HD2  1 1 
        866 1 1 1 1  48 VAL QG  2l30_ambr001  48 VAL HG11 1 1 
        866 1 2 1 1  50 HIS HE1 2l30_ambr001  50 VAL HE1  1 1 
        867 1 1 1 1  49 PRO HA  2l30_ambr001  49 PRO HA   1 1 
        867 1 2 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        868 1 1 1 1  49 PRO QB  2l30_ambr001  49 PRO HB2  1 1 
        868 1 2 1 1  50 HIS H   2l30_ambr001  50 PRO H    1 1 
        869 1 1 1 1  49 PRO QB  2l30_ambr001  49 PRO HB2  1 1 
        869 1 2 1 1  51 TRP HD1 2l30_ambr001  51 PRO HD1  1 1 
        870 1 1 1 1  49 PRO QB  2l30_ambr001  49 PRO HB2  1 1 
        870 1 2 1 1  51 TRP HE1 2l30_ambr001  51 PRO HE1  1 1 
        871 1 1 1 1  49 PRO QB  2l30_ambr001  49 PRO HB2  1 1 
        871 1 2 1 1  51 TRP HZ2 2l30_ambr001  51 PRO HZ2  1 1 
        872 1 1 1 1  49 PRO QD  2l30_ambr001  49 PRO HD2  1 1 
        872 1 2 1 1  51 TRP HE1 2l30_ambr001  51 PRO HE1  1 1 
        873 1 1 1 1  49 PRO QG  2l30_ambr001  49 PRO HG2  1 1 
        873 1 2 1 1  51 TRP HD1 2l30_ambr001  51 PRO HD1  1 1 
        874 1 1 1 1  49 PRO QG  2l30_ambr001  49 PRO HG2  1 1 
        874 1 2 1 1  51 TRP HE1 2l30_ambr001  51 PRO HE1  1 1 
        875 1 1 1 1  49 PRO QG  2l30_ambr001  49 PRO HG2  1 1 
        875 1 2 1 1  51 TRP HZ2 2l30_ambr001  51 PRO HZ2  1 1 
        876 1 1 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        876 1 2 1 1  50 HIS HD2 2l30_ambr001  50 HIE HD2  1 1 
        877 1 1 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        877 1 2 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        878 1 1 1 1  50 HIS H   2l30_ambr001  50 HIE H    1 1 
        878 1 2 1 1  52 TYR QE  2l30_ambr001  52 TYR HE1  1 1 
        879 1 1 1 1  50 HIS HA  2l30_ambr001  50 HIE HA   1 1 
        879 1 2 1 1  50 HIS HD2 2l30_ambr001  50 HIE HD2  1 1 
        880 1 1 1 1  50 HIS HA  2l30_ambr001  50 HIE HA   1 1 
        880 1 2 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        881 1 1 1 1  50 HIS HA  2l30_ambr001  50 HIE HA   1 1 
        881 1 2 1 1  51 TRP HD1 2l30_ambr001  51 TRP HD1  1 1 
        882 1 1 1 1  50 HIS QB  2l30_ambr001  50 HIE HB2  1 1 
        882 1 2 1 1  52 TYR QE  2l30_ambr001  52 HIE HE1  1 1 
        883 1 1 1 1  50 HIS HD2 2l30_ambr001  50 HIE HD2  1 1 
        883 1 2 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        884 1 1 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        884 1 2 1 1  51 TRP HD1 2l30_ambr001  51 TRP HD1  1 1 
        885 1 1 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        885 1 2 1 1  52 TYR H   2l30_ambr001  52 TYR H    1 1 
        886 1 1 1 1  51 TRP H   2l30_ambr001  51 TRP H    1 1 
        886 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        887 1 1 1 1  51 TRP HA  2l30_ambr001  51 TRP HA   1 1 
        887 1 2 1 1  51 TRP HE3 2l30_ambr001  51 TRP HE3  1 1 
        888 1 1 1 1  51 TRP HA  2l30_ambr001  51 TRP HA   1 1 
        888 1 2 1 1  52 TYR H   2l30_ambr001  52 TYR H    1 1 
        889 1 1 1 1  51 TRP HA  2l30_ambr001  51 TRP HA   1 1 
        889 1 2 1 1  52 TYR QB  2l30_ambr001  52 TYR HB2  1 1 
        890 1 1 1 1  51 TRP HA  2l30_ambr001  51 TRP HA   1 1 
        890 1 2 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        891 1 1 1 1  51 TRP QB  2l30_ambr001  51 TRP HB2  1 1 
        891 1 2 1 1  52 TYR H   2l30_ambr001  52 TRP H    1 1 
        892 1 1 1 1  51 TRP HE3 2l30_ambr001  51 TRP HE3  1 1 
        892 1 2 1 1  52 TYR H   2l30_ambr001  52 TYR H    1 1 
        893 1 1 1 1  52 TYR HA  2l30_ambr001  52 TYR HA   1 1 
        893 1 2 1 1  53 HIS H   2l30_ambr001  53 HIE H    1 1 
        894 1 1 1 1  52 TYR QB  2l30_ambr001  52 TYR HB2  1 1 
        894 1 2 1 1  53 HIS H   2l30_ambr001  53 TYR H    1 1 
        895 1 1 1 1  52 TYR QB  2l30_ambr001  52 TYR HB2  1 1 
        895 1 2 1 1  56 CYS QB  2l30_ambr001  56 TYR HB2  1 1 
        896 1 1 1 1  52 TYR QB  2l30_ambr001  52 TYR HB2  1 1 
        896 1 2 1 1  57 PHE HA  2l30_ambr001  57 TYR HA   1 1 
        897 1 1 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        897 1 2 1 1  56 CYS QB  2l30_ambr001  56 TYR HB2  1 1 
        898 1 1 1 1  52 TYR QD  2l30_ambr001  52 TYR HD1  1 1 
        898 1 2 1 1  60 VAL QG  2l30_ambr001  60 TYR HG11 1 1 
        899 1 1 1 1  52 TYR QE  2l30_ambr001  52 TYR HE1  1 1 
        899 1 2 1 1  57 PHE HA  2l30_ambr001  57 TYR HA   1 1 
        900 1 1 1 1  52 TYR QE  2l30_ambr001  52 TYR HE1  1 1 
        900 1 2 1 1  60 VAL QG  2l30_ambr001  60 TYR HG11 1 1 
        901 1 1 1 1  53 HIS H   2l30_ambr001  53 HIE H    1 1 
        901 1 2 1 1  56 CYS H   2l30_ambr001  56 CYM HN   1 1 
        902 1 1 1 1  53 HIS H   2l30_ambr001  53 HIE H    1 1 
        902 1 2 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        903 1 1 1 1  53 HIS HA  2l30_ambr001  53 HIE HA   1 1 
        903 1 2 1 1  53 HIS HD2 2l30_ambr001  53 HIE HD2  1 1 
        904 1 1 1 1  53 HIS HA  2l30_ambr001  53 HIE HA   1 1 
        904 1 2 1 1  54 PHE H   2l30_ambr001  54 PHE H    1 1 
        905 1 1 1 1  53 HIS HA  2l30_ambr001  53 HIE HA   1 1 
        905 1 2 1 1  54 PHE HA  2l30_ambr001  54 PHE HA   1 1 
        906 1 1 1 1  53 HIS HA  2l30_ambr001  53 HIE HA   1 1 
        906 1 2 1 1  54 PHE QB  2l30_ambr001  54 PHE HB2  1 1 
        907 1 1 1 1  53 HIS QB  2l30_ambr001  53 HIE HB2  1 1 
        907 1 2 1 1  54 PHE H   2l30_ambr001  54 HIE H    1 1 
        908 1 1 1 1  53 HIS QB  2l30_ambr001  53 HIE HB2  1 1 
        908 1 2 1 1  55 SER H   2l30_ambr001  55 HIE H    1 1 
        909 1 1 1 1  53 HIS QB  2l30_ambr001  53 HIE HB2  1 1 
        909 1 2 1 1  55 SER QB  2l30_ambr001  55 HIE HB2  1 1 
        910 1 1 1 1  53 HIS QB  2l30_ambr001  53 HIE HB2  1 1 
        910 1 2 1 1  56 CYS H   2l30_ambr001  56 HIE HN   1 1 
        911 1 1 1 1  53 HIS QB  2l30_ambr001  53 HIE HB2  1 1 
        911 1 2 1 1  56 CYS QB  2l30_ambr001  56 HIE HB2  1 1 
        912 1 1 1 1  53 HIS QB  2l30_ambr001  53 HIE HB2  1 1 
        912 1 2 1 1  57 PHE H   2l30_ambr001  57 HIE H    1 1 
        913 1 1 1 1  54 PHE H   2l30_ambr001  54 PHE H    1 1 
        913 1 2 1 1  55 SER H   2l30_ambr001  55 SER H    1 1 
        914 1 1 1 1  54 PHE H   2l30_ambr001  54 PHE H    1 1 
        914 1 2 1 1  56 CYS H   2l30_ambr001  56 CYM HN   1 1 
        915 1 1 1 1  54 PHE HA  2l30_ambr001  54 PHE HA   1 1 
        915 1 2 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        916 1 1 1 1  54 PHE HA  2l30_ambr001  54 PHE HA   1 1 
        916 1 2 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
        917 1 1 1 1  54 PHE QB  2l30_ambr001  54 PHE HB2  1 1 
        917 1 2 1 1  55 SER H   2l30_ambr001  55 PHE H    1 1 
        918 1 1 1 1  54 PHE QB  2l30_ambr001  54 PHE HB2  1 1 
        918 1 2 1 1  55 SER QB  2l30_ambr001  55 PHE HB2  1 1 
        919 1 1 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        919 1 2 1 1  55 SER HA  2l30_ambr001  55 PHE HA   1 1 
        920 1 1 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        920 1 2 1 1  58 TRP HE1 2l30_ambr001  58 PHE HE1  1 1 
        921 1 1 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        921 1 2 1 1  58 TRP HZ2 2l30_ambr001  58 PHE HZ2  1 1 
        922 1 1 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        922 1 2 1 1  84 LYS QD  2l30_ambr001  84 PHE HD2  1 1 
        923 1 1 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        923 1 2 1 1  85 VAL HA  2l30_ambr001  85 PHE HA   1 1 
        924 1 1 1 1  54 PHE QD  2l30_ambr001  54 PHE HD1  1 1 
        924 1 2 1 1  85 VAL QG  2l30_ambr001  85 PHE HG11 1 1 
        925 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        925 1 2 1 1  55 SER HA  2l30_ambr001  55 PHE HA   1 1 
        926 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        926 1 2 1 1  58 TRP HE1 2l30_ambr001  58 PHE HE1  1 1 
        927 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        927 1 2 1 1  58 TRP HZ2 2l30_ambr001  58 PHE HZ2  1 1 
        928 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        928 1 2 1 1  84 LYS QB  2l30_ambr001  84 PHE HB2  1 1 
        929 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        929 1 2 1 1  84 LYS QD  2l30_ambr001  84 PHE HD2  1 1 
        930 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        930 1 2 1 1  84 LYS QE  2l30_ambr001  84 PHE HE2  1 1 
        931 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        931 1 2 1 1  84 LYS QG  2l30_ambr001  84 PHE HG2  1 1 
        932 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        932 1 2 1 1  85 VAL HA  2l30_ambr001  85 PHE HA   1 1 
        933 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        933 1 2 1 1  85 VAL QG  2l30_ambr001  85 PHE HG11 1 1 
        934 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        934 1 2 1 1  88 THR HB  2l30_ambr001  88 PHE HB   1 1 
        935 1 1 1 1  54 PHE QE  2l30_ambr001  54 PHE HE1  1 1 
        935 1 2 1 1  88 THR MG  2l30_ambr001  88 PHE HG21 1 1 
        936 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        936 1 2 1 1  58 TRP HD1 2l30_ambr001  58 TRP HD1  1 1 
        937 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        937 1 2 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
        938 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        938 1 2 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
        939 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        939 1 2 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
        940 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        940 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
        941 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        941 1 2 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
        942 1 1 1 1  54 PHE HZ  2l30_ambr001  54 PHE HZ   1 1 
        942 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
        943 1 1 1 1  55 SER H   2l30_ambr001  55 SER H    1 1 
        943 1 2 1 1  55 SER QB  2l30_ambr001  55 SER HB2  1 1 
        944 1 1 1 1  55 SER H   2l30_ambr001  55 SER H    1 1 
        944 1 2 1 1  56 CYS H   2l30_ambr001  56 CYM HN   1 1 
        945 1 1 1 1  55 SER H   2l30_ambr001  55 SER H    1 1 
        945 1 2 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        946 1 1 1 1  55 SER H   2l30_ambr001  55 SER H    1 1 
        946 1 2 1 1  57 PHE H   2l30_ambr001  57 PHE H    1 1 
        947 1 1 1 1  55 SER HA  2l30_ambr001  55 SER HA   1 1 
        947 1 2 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        948 1 1 1 1  55 SER HA  2l30_ambr001  55 SER HA   1 1 
        948 1 2 1 1  58 TRP QB  2l30_ambr001  58 TRP HB2  1 1 
        949 1 1 1 1  55 SER HA  2l30_ambr001  55 SER HA   1 1 
        949 1 2 1 1  58 TRP HD1 2l30_ambr001  58 TRP HD1  1 1 
        950 1 1 1 1  55 SER HA  2l30_ambr001  55 SER HA   1 1 
        950 1 2 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
        951 1 1 1 1  55 SER HA  2l30_ambr001  55 SER HA   1 1 
        951 1 2 1 1  94 VAL H   2l30_ambr001  94 VAL H    1 1 
        952 1 1 1 1  55 SER HA  2l30_ambr001  55 SER HA   1 1 
        952 1 2 1 1  94 VAL QG  2l30_ambr001  94 VAL HG11 1 1 
        953 1 1 1 1  55 SER QB  2l30_ambr001  55 SER HB2  1 1 
        953 1 2 1 1  56 CYS H   2l30_ambr001  56 SER HN   1 1 
        954 1 1 1 1  56 CYS H   2l30_ambr001  56 CYM HN   1 1 
        954 1 2 1 1  57 PHE H   2l30_ambr001  57 PHE H    1 1 
        955 1 1 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        955 1 2 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        956 1 1 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        956 1 2 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
        957 1 1 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        957 1 2 1 1  59 LYS QB  2l30_ambr001  59 LYS HB2  1 1 
        958 1 1 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        958 1 2 1 1  59 LYS QD  2l30_ambr001  59 LYS HD2  1 1 
        959 1 1 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        959 1 2 1 1  59 LYS QE  2l30_ambr001  59 LYS HE2  1 1 
        960 1 1 1 1  56 CYS HA  2l30_ambr001  56 CYM HA   1 1 
        960 1 2 1 1  59 LYS QG  2l30_ambr001  59 LYS HG2  1 1 
        961 1 1 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        961 1 2 1 1  57 PHE H   2l30_ambr001  57 CYM H    1 1 
        962 1 1 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        962 1 2 1 1  57 PHE QB  2l30_ambr001  57 CYM HB2  1 1 
        963 1 1 1 1  56 CYS QB  2l30_ambr001  56 CYM HB2  1 1 
        963 1 2 1 1  59 LYS QG  2l30_ambr001  59 CYM HG2  1 1 
        964 1 1 1 1  57 PHE H   2l30_ambr001  57 PHE H    1 1 
        964 1 2 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        965 1 1 1 1  57 PHE H   2l30_ambr001  57 PHE H    1 1 
        965 1 2 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
        966 1 1 1 1  57 PHE H   2l30_ambr001  57 PHE H    1 1 
        966 1 2 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
        967 1 1 1 1  57 PHE H   2l30_ambr001  57 PHE H    1 1 
        967 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
        968 1 1 1 1  57 PHE HA  2l30_ambr001  57 PHE HA   1 1 
        968 1 2 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
        969 1 1 1 1  57 PHE HA  2l30_ambr001  57 PHE HA   1 1 
        969 1 2 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
        970 1 1 1 1  57 PHE HA  2l30_ambr001  57 PHE HA   1 1 
        970 1 2 1 1  60 VAL HB  2l30_ambr001  60 VAL HB   1 1 
        971 1 1 1 1  57 PHE HA  2l30_ambr001  57 PHE HA   1 1 
        971 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
        972 1 1 1 1  57 PHE QB  2l30_ambr001  57 PHE HB2  1 1 
        972 1 2 1 1  58 TRP H   2l30_ambr001  58 PHE H    1 1 
        973 1 1 1 1  57 PHE QB  2l30_ambr001  57 PHE HB2  1 1 
        973 1 2 1 1  58 TRP HD1 2l30_ambr001  58 PHE HD1  1 1 
        974 1 1 1 1  57 PHE QB  2l30_ambr001  57 PHE HB2  1 1 
        974 1 2 1 1  58 TRP HE1 2l30_ambr001  58 PHE HE1  1 1 
        975 1 1 1 1  57 PHE QB  2l30_ambr001  57 PHE HB2  1 1 
        975 1 2 1 1  60 VAL QG  2l30_ambr001  60 PHE HG11 1 1 
        976 1 1 1 1  57 PHE QD  2l30_ambr001  57 PHE HD1  1 1 
        976 1 2 1 1  58 TRP H   2l30_ambr001  58 PHE H    1 1 
        977 1 1 1 1  57 PHE QD  2l30_ambr001  57 PHE HD1  1 1 
        977 1 2 1 1  58 TRP QB  2l30_ambr001  58 PHE HB2  1 1 
        978 1 1 1 1  57 PHE QD  2l30_ambr001  57 PHE HD1  1 1 
        978 1 2 1 1  60 VAL H   2l30_ambr001  60 PHE H    1 1 
        979 1 1 1 1  57 PHE QD  2l30_ambr001  57 PHE HD1  1 1 
        979 1 2 1 1  88 THR MG  2l30_ambr001  88 PHE HG21 1 1 
        980 1 1 1 1  57 PHE QE  2l30_ambr001  57 PHE HE1  1 1 
        980 1 2 1 1  58 TRP HA  2l30_ambr001  58 PHE HA   1 1 
        981 1 1 1 1  57 PHE QE  2l30_ambr001  57 PHE HE1  1 1 
        981 1 2 1 1  58 TRP HE3 2l30_ambr001  58 PHE HE3  1 1 
        982 1 1 1 1  57 PHE QE  2l30_ambr001  57 PHE HE1  1 1 
        982 1 2 1 1  64 ILE HB  2l30_ambr001  64 PHE HB   1 1 
        983 1 1 1 1  57 PHE QE  2l30_ambr001  57 PHE HE1  1 1 
        983 1 2 1 1  64 ILE MD  2l30_ambr001  64 PHE HD11 1 1 
        984 1 1 1 1  57 PHE HZ  2l30_ambr001  57 PHE HZ   1 1 
        984 1 2 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
        985 1 1 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        985 1 2 1 1  58 TRP HD1 2l30_ambr001  58 TRP HD1  1 1 
        986 1 1 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        986 1 2 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
        987 1 1 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        987 1 2 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
        988 1 1 1 1  58 TRP H   2l30_ambr001  58 TRP H    1 1 
        988 1 2 1 1  59 LYS QB  2l30_ambr001  59 LYS HB2  1 1 
        989 1 1 1 1  58 TRP HA  2l30_ambr001  58 TRP HA   1 1 
        989 1 2 1 1  58 TRP HE3 2l30_ambr001  58 TRP HE3  1 1 
        990 1 1 1 1  58 TRP HA  2l30_ambr001  58 TRP HA   1 1 
        990 1 2 1 1  58 TRP HZ3 2l30_ambr001  58 TRP HZ3  1 1 
        991 1 1 1 1  58 TRP HA  2l30_ambr001  58 TRP HA   1 1 
        991 1 2 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
        992 1 1 1 1  58 TRP HA  2l30_ambr001  58 TRP HA   1 1 
        992 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
        993 1 1 1 1  58 TRP HA  2l30_ambr001  58 TRP HA   1 1 
        993 1 2 1 1  61 GLY H   2l30_ambr001  61 GLY H    1 1 
        994 1 1 1 1  58 TRP HA  2l30_ambr001  58 TRP HA   1 1 
        994 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
        995 1 1 1 1  58 TRP QB  2l30_ambr001  58 TRP HB2  1 1 
        995 1 2 1 1  59 LYS H   2l30_ambr001  59 TRP H    1 1 
        996 1 1 1 1  58 TRP QB  2l30_ambr001  58 TRP HB2  1 1 
        996 1 2 1 1  88 THR MG  2l30_ambr001  88 TRP HG21 1 1 
        997 1 1 1 1  58 TRP QB  2l30_ambr001  58 TRP HB2  1 1 
        997 1 2 1 1  93 GLY H   2l30_ambr001  93 TRP H    1 1 
        998 1 1 1 1  58 TRP QB  2l30_ambr001  58 TRP HB2  1 1 
        998 1 2 1 1  93 GLY QA  2l30_ambr001  93 TRP HA2  1 1 
        999 1 1 1 1  58 TRP QB  2l30_ambr001  58 TRP HB2  1 1 
        999 1 2 1 1  94 VAL H   2l30_ambr001  94 TRP H    1 1 
       1000 1 1 1 1  58 TRP HD1 2l30_ambr001  58 TRP HD1  1 1 
       1000 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1001 1 1 1 1  58 TRP HD1 2l30_ambr001  58 TRP HD1  1 1 
       1001 1 2 1 1  94 VAL QG  2l30_ambr001  94 VAL HG11 1 1 
       1002 1 1 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
       1002 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1003 1 1 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
       1003 1 2 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1004 1 1 1 1  58 TRP HE1 2l30_ambr001  58 TRP HE1  1 1 
       1004 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1005 1 1 1 1  58 TRP HE3 2l30_ambr001  58 TRP HE3  1 1 
       1005 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1006 1 1 1 1  58 TRP HE3 2l30_ambr001  58 TRP HE3  1 1 
       1006 1 2 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1007 1 1 1 1  58 TRP HE3 2l30_ambr001  58 TRP HE3  1 1 
       1007 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1008 1 1 1 1  58 TRP HE3 2l30_ambr001  58 TRP HE3  1 1 
       1008 1 2 1 1  92 GLY QA  2l30_ambr001  92 GLY HA2  1 1 
       1009 1 1 1 1  58 TRP HE3 2l30_ambr001  58 TRP HE3  1 1 
       1009 1 2 1 1  93 GLY H   2l30_ambr001  93 GLY H    1 1 
       1010 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1010 1 2 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1011 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1011 1 2 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1012 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1012 1 2 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1013 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1013 1 2 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1014 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1014 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1015 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1015 1 2 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1016 1 1 1 1  58 TRP HH2 2l30_ambr001  58 TRP HH2  1 1 
       1016 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1017 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1017 1 2 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1018 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1018 1 2 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1019 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1019 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1020 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1020 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1021 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1021 1 2 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1022 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1022 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1023 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1023 1 2 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1024 1 1 1 1  58 TRP HZ2 2l30_ambr001  58 TRP HZ2  1 1 
       1024 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1025 1 1 1 1  58 TRP HZ3 2l30_ambr001  58 TRP HZ3  1 1 
       1025 1 2 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1026 1 1 1 1  58 TRP HZ3 2l30_ambr001  58 TRP HZ3  1 1 
       1026 1 2 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1027 1 1 1 1  58 TRP HZ3 2l30_ambr001  58 TRP HZ3  1 1 
       1027 1 2 1 1  64 ILE QG  2l30_ambr001  64 ILE HG12 1 1 
       1028 1 1 1 1  58 TRP HZ3 2l30_ambr001  58 TRP HZ3  1 1 
       1028 1 2 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1029 1 1 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
       1029 1 2 1 1  59 LYS QD  2l30_ambr001  59 LYS HD2  1 1 
       1030 1 1 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
       1030 1 2 1 1  59 LYS QG  2l30_ambr001  59 LYS HG2  1 1 
       1031 1 1 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
       1031 1 2 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
       1032 1 1 1 1  59 LYS H   2l30_ambr001  59 LYS H    1 1 
       1032 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1033 1 1 1 1  59 LYS HA  2l30_ambr001  59 LYS HA   1 1 
       1033 1 2 1 1  59 LYS QD  2l30_ambr001  59 LYS HD2  1 1 
       1034 1 1 1 1  59 LYS HA  2l30_ambr001  59 LYS HA   1 1 
       1034 1 2 1 1  59 LYS QE  2l30_ambr001  59 LYS HE2  1 1 
       1035 1 1 1 1  59 LYS HA  2l30_ambr001  59 LYS HA   1 1 
       1035 1 2 1 1  60 VAL HA  2l30_ambr001  60 VAL HA   1 1 
       1036 1 1 1 1  59 LYS HA  2l30_ambr001  59 LYS HA   1 1 
       1036 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1037 1 1 1 1  59 LYS HA  2l30_ambr001  59 LYS HA   1 1 
       1037 1 2 1 1  61 GLY H   2l30_ambr001  61 GLY H    1 1 
       1038 1 1 1 1  59 LYS QB  2l30_ambr001  59 LYS HB2  1 1 
       1038 1 2 1 1  60 VAL H   2l30_ambr001  60 LYS H    1 1 
       1039 1 1 1 1  59 LYS QG  2l30_ambr001  59 LYS HG2  1 1 
       1039 1 2 1 1  60 VAL QG  2l30_ambr001  60 LYS HG11 1 1 
       1040 1 1 1 1  59 LYS QG  2l30_ambr001  59 LYS HG2  1 1 
       1040 1 2 1 1  61 GLY H   2l30_ambr001  61 LYS H    1 1 
       1041 1 1 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
       1041 1 2 1 1  60 VAL HB  2l30_ambr001  60 VAL HB   1 1 
       1042 1 1 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
       1042 1 2 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1043 1 1 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
       1043 1 2 1 1  61 GLY H   2l30_ambr001  61 GLY H    1 1 
       1044 1 1 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
       1044 1 2 1 1  61 GLY QA  2l30_ambr001  61 GLY HA2  1 1 
       1045 1 1 1 1  60 VAL H   2l30_ambr001  60 VAL H    1 1 
       1045 1 2 1 1  62 HIS H   2l30_ambr001  62 HIE H    1 1 
       1046 1 1 1 1  60 VAL HB  2l30_ambr001  60 VAL HB   1 1 
       1046 1 2 1 1  61 GLY H   2l30_ambr001  61 GLY H    1 1 
       1047 1 1 1 1  60 VAL HB  2l30_ambr001  60 VAL HB   1 1 
       1047 1 2 1 1  62 HIS H   2l30_ambr001  62 HIE H    1 1 
       1048 1 1 1 1  60 VAL HB  2l30_ambr001  60 VAL HB   1 1 
       1048 1 2 1 1  62 HIS HD2 2l30_ambr001  62 HIE HD2  1 1 
       1049 1 1 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1049 1 2 1 1  61 GLY H   2l30_ambr001  61 VAL H    1 1 
       1050 1 1 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1050 1 2 1 1  61 GLY QA  2l30_ambr001  61 VAL HA2  1 1 
       1051 1 1 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1051 1 2 1 1  62 HIS H   2l30_ambr001  62 VAL H    1 1 
       1052 1 1 1 1  60 VAL QG  2l30_ambr001  60 VAL HG11 1 1 
       1052 1 2 1 1  62 HIS HD2 2l30_ambr001  62 VAL HD2  1 1 
       1053 1 1 1 1  62 HIS H   2l30_ambr001  62 HIE H    1 1 
       1053 1 2 1 1  62 HIS HD2 2l30_ambr001  62 HIE HD2  1 1 
       1054 1 1 1 1  62 HIS HA  2l30_ambr001  62 HIE HA   1 1 
       1054 1 2 1 1  62 HIS HD2 2l30_ambr001  62 HIE HD2  1 1 
       1055 1 1 1 1  62 HIS HA  2l30_ambr001  62 HIE HA   1 1 
       1055 1 2 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1056 1 1 1 1  62 HIS QB  2l30_ambr001  62 HIE HB2  1 1 
       1056 1 2 1 1  63 SER H   2l30_ambr001  63 HIE H    1 1 
       1057 1 1 1 1  62 HIS QB  2l30_ambr001  62 HIE HB2  1 1 
       1057 1 2 1 1  63 SER HA  2l30_ambr001  63 HIE HA   1 1 
       1058 1 1 1 1  62 HIS QB  2l30_ambr001  62 HIE HB2  1 1 
       1058 1 2 1 1  64 ILE MD  2l30_ambr001  64 HIE HD11 1 1 
       1059 1 1 1 1  62 HIS QB  2l30_ambr001  62 HIE HB2  1 1 
       1059 1 2 1 1  64 ILE QG  2l30_ambr001  64 HIE HG12 1 1 
       1060 1 1 1 1  63 SER H   2l30_ambr001  63 SER H    1 1 
       1060 1 2 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1061 1 1 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1061 1 2 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1062 1 1 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1062 1 2 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1063 1 1 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1063 1 2 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1064 1 1 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1064 1 2 1 1  64 ILE QG  2l30_ambr001  64 ILE HG12 1 1 
       1065 1 1 1 1  63 SER HA  2l30_ambr001  63 SER HA   1 1 
       1065 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1066 1 1 1 1  63 SER QB  2l30_ambr001  63 SER HB2  1 1 
       1066 1 2 1 1  64 ILE H   2l30_ambr001  64 SER H    1 1 
       1067 1 1 1 1  63 SER QB  2l30_ambr001  63 SER HB2  1 1 
       1067 1 2 1 1  64 ILE HA  2l30_ambr001  64 SER HA   1 1 
       1068 1 1 1 1  63 SER QB  2l30_ambr001  63 SER HB2  1 1 
       1068 1 2 1 1  65 ARG QD  2l30_ambr001  65 SER HD2  1 1 
       1069 1 1 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1069 1 2 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1070 1 1 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1070 1 2 1 1  65 ARG H   2l30_ambr001  65 ARG H    1 1 
       1071 1 1 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1071 1 2 1 1  65 ARG HA  2l30_ambr001  65 ARG HA   1 1 
       1072 1 1 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1072 1 2 1 1  65 ARG QD  2l30_ambr001  65 ARG HD2  1 1 
       1073 1 1 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1073 1 2 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1074 1 1 1 1  64 ILE H   2l30_ambr001  64 ILE H    1 1 
       1074 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1075 1 1 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1075 1 2 1 1  65 ARG H   2l30_ambr001  65 ARG H    1 1 
       1076 1 1 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1076 1 2 1 1  65 ARG QD  2l30_ambr001  65 ARG HD2  1 1 
       1077 1 1 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1077 1 2 1 1  66 HIS HD2 2l30_ambr001  66 HIE HD2  1 1 
       1078 1 1 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1078 1 2 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1079 1 1 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1079 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1080 1 1 1 1  64 ILE HA  2l30_ambr001  64 ILE HA   1 1 
       1080 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1081 1 1 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1081 1 2 1 1  65 ARG H   2l30_ambr001  65 ARG H    1 1 
       1082 1 1 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1082 1 2 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1083 1 1 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1083 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1084 1 1 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1084 1 2 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1085 1 1 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1085 1 2 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1086 1 1 1 1  64 ILE HB  2l30_ambr001  64 ILE HB   1 1 
       1086 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1087 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1087 1 2 1 1  67 PRO HA  2l30_ambr001  67 ILE HA   1 1 
       1088 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1088 1 2 1 1  67 PRO QD  2l30_ambr001  67 ILE HD2  1 1 
       1089 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1089 1 2 1 1  67 PRO QG  2l30_ambr001  67 ILE HG2  1 1 
       1090 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1090 1 2 1 1  70 GLU QB  2l30_ambr001  70 ILE HB2  1 1 
       1091 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1091 1 2 1 1  71 VAL H   2l30_ambr001  71 ILE H    1 1 
       1092 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1092 1 2 1 1  71 VAL HA  2l30_ambr001  71 ILE HA   1 1 
       1093 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1093 1 2 1 1  71 VAL HB  2l30_ambr001  71 ILE HB   1 1 
       1094 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1094 1 2 1 1  71 VAL QG  2l30_ambr001  71 ILE HG11 1 1 
       1095 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1095 1 2 1 1  85 VAL QG  2l30_ambr001  85 ILE HG11 1 1 
       1096 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1096 1 2 1 1  89 ALA HA  2l30_ambr001  89 ILE HA   1 1 
       1097 1 1 1 1  64 ILE MD  2l30_ambr001  64 ILE HD11 1 1 
       1097 1 2 1 1  89 ALA MB  2l30_ambr001  89 ILE HB1  1 1 
       1098 1 1 1 1  64 ILE QG  2l30_ambr001  64 ILE HG12 1 1 
       1098 1 2 1 1  65 ARG H   2l30_ambr001  65 ILE H    1 1 
       1099 1 1 1 1  64 ILE QG  2l30_ambr001  64 ILE HG12 1 1 
       1099 1 2 1 1  71 VAL QG  2l30_ambr001  71 ILE HG11 1 1 
       1100 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1100 1 2 1 1  65 ARG H   2l30_ambr001  65 ILE H    1 1 
       1101 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1101 1 2 1 1  65 ARG HA  2l30_ambr001  65 ILE HA   1 1 
       1102 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1102 1 2 1 1  66 HIS H   2l30_ambr001  66 ILE H    1 1 
       1103 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1103 1 2 1 1  66 HIS HA  2l30_ambr001  66 ILE HA   1 1 
       1104 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1104 1 2 1 1  66 HIS QB  2l30_ambr001  66 ILE HB2  1 1 
       1105 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1105 1 2 1 1  66 HIS HD2 2l30_ambr001  66 ILE HD2  1 1 
       1106 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1106 1 2 1 1  67 PRO HA  2l30_ambr001  67 ILE HA   1 1 
       1107 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1107 1 2 1 1  67 PRO QB  2l30_ambr001  67 ILE HB2  1 1 
       1108 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1108 1 2 1 1  67 PRO QD  2l30_ambr001  67 ILE HD2  1 1 
       1109 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1109 1 2 1 1  67 PRO QG  2l30_ambr001  67 ILE HG2  1 1 
       1110 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1110 1 2 1 1  68 ASP H   2l30_ambr001  68 ILE H    1 1 
       1111 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1111 1 2 1 1  70 GLU H   2l30_ambr001  70 ILE H    1 1 
       1112 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1112 1 2 1 1  70 GLU QB  2l30_ambr001  70 ILE HB2  1 1 
       1113 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1113 1 2 1 1  70 GLU QG  2l30_ambr001  70 ILE HG2  1 1 
       1114 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1114 1 2 1 1  71 VAL H   2l30_ambr001  71 ILE H    1 1 
       1115 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1115 1 2 1 1  71 VAL QG  2l30_ambr001  71 ILE HG11 1 1 
       1116 1 1 1 1  64 ILE MG  2l30_ambr001  64 ILE HG21 1 1 
       1116 1 2 1 1  89 ALA MB  2l30_ambr001  89 ILE HB1  1 1 
       1117 1 1 1 1  65 ARG H   2l30_ambr001  65 ARG H    1 1 
       1117 1 2 1 1  65 ARG QD  2l30_ambr001  65 ARG HD2  1 1 
       1118 1 1 1 1  65 ARG H   2l30_ambr001  65 ARG H    1 1 
       1118 1 2 1 1  65 ARG QG  2l30_ambr001  65 ARG HG2  1 1 
       1119 1 1 1 1  65 ARG H   2l30_ambr001  65 ARG H    1 1 
       1119 1 2 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1120 1 1 1 1  65 ARG HA  2l30_ambr001  65 ARG HA   1 1 
       1120 1 2 1 1  65 ARG QD  2l30_ambr001  65 ARG HD2  1 1 
       1121 1 1 1 1  65 ARG HA  2l30_ambr001  65 ARG HA   1 1 
       1121 1 2 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1122 1 1 1 1  65 ARG QB  2l30_ambr001  65 ARG HB2  1 1 
       1122 1 2 1 1  66 HIS H   2l30_ambr001  66 ARG H    1 1 
       1123 1 1 1 1  65 ARG QB  2l30_ambr001  65 ARG HB2  1 1 
       1123 1 2 1 1  66 HIS HD2 2l30_ambr001  66 ARG HD2  1 1 
       1124 1 1 1 1  65 ARG QD  2l30_ambr001  65 ARG HD2  1 1 
       1124 1 2 1 1  66 HIS H   2l30_ambr001  66 ARG H    1 1 
       1125 1 1 1 1  65 ARG QD  2l30_ambr001  65 ARG HD2  1 1 
       1125 1 2 1 1  66 HIS HD2 2l30_ambr001  66 ARG HD2  1 1 
       1126 1 1 1 1  65 ARG QG  2l30_ambr001  65 ARG HG2  1 1 
       1126 1 2 1 1  66 HIS H   2l30_ambr001  66 ARG H    1 1 
       1127 1 1 1 1  65 ARG QG  2l30_ambr001  65 ARG HG2  1 1 
       1127 1 2 1 1  66 HIS HA  2l30_ambr001  66 ARG HA   1 1 
       1128 1 1 1 1  65 ARG QG  2l30_ambr001  65 ARG HG2  1 1 
       1128 1 2 1 1  66 HIS QB  2l30_ambr001  66 ARG HB2  1 1 
       1129 1 1 1 1  65 ARG QG  2l30_ambr001  65 ARG HG2  1 1 
       1129 1 2 1 1  66 HIS HD2 2l30_ambr001  66 ARG HD2  1 1 
       1130 1 1 1 1  65 ARG QG  2l30_ambr001  65 ARG HG2  1 1 
       1130 1 2 1 1  66 HIS HE1 2l30_ambr001  66 ARG HE1  1 1 
       1131 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1131 1 2 1 1  66 HIS HD2 2l30_ambr001  66 HIE HD2  1 1 
       1132 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1132 1 2 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1133 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1133 1 2 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1134 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1134 1 2 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1135 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1135 1 2 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1136 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1136 1 2 1 1  70 GLU QB  2l30_ambr001  70 GLU HB2  1 1 
       1137 1 1 1 1  66 HIS H   2l30_ambr001  66 HIE H    1 1 
       1137 1 2 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1138 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1138 1 2 1 1  66 HIS HD2 2l30_ambr001  66 HIE HD2  1 1 
       1139 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1139 1 2 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1140 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1140 1 2 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1141 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1141 1 2 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1142 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1142 1 2 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1143 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1143 1 2 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1144 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1144 1 2 1 1  69 VAL HB  2l30_ambr001  69 VAL HB   1 1 
       1145 1 1 1 1  66 HIS HA  2l30_ambr001  66 HIE HA   1 1 
       1145 1 2 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1146 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1146 1 2 1 1  67 PRO QD  2l30_ambr001  67 HIE HD2  1 1 
       1147 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1147 1 2 1 1  68 ASP H   2l30_ambr001  68 HIE H    1 1 
       1148 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1148 1 2 1 1  69 VAL H   2l30_ambr001  69 HIE H    1 1 
       1149 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1149 1 2 1 1  69 VAL HB  2l30_ambr001  69 HIE HB   1 1 
       1150 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1150 1 2 1 1  69 VAL QG  2l30_ambr001  69 HIE HG11 1 1 
       1151 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1151 1 2 1 1  70 GLU H   2l30_ambr001  70 HIE H    1 1 
       1152 1 1 1 1  66 HIS QB  2l30_ambr001  66 HIE HB2  1 1 
       1152 1 2 1 1  70 GLU QG  2l30_ambr001  70 HIE HG2  1 1 
       1153 1 1 1 1  66 HIS HD2 2l30_ambr001  66 HIE HD2  1 1 
       1153 1 2 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1154 1 1 1 1  66 HIS HD2 2l30_ambr001  66 HIE HD2  1 1 
       1154 1 2 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1155 1 1 1 1  66 HIS HE1 2l30_ambr001  66 HIE HE1  1 1 
       1155 1 2 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1156 1 1 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1156 1 2 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1157 1 1 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1157 1 2 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1158 1 1 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1158 1 2 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1159 1 1 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1159 1 2 1 1  70 GLU QB  2l30_ambr001  70 GLU HB2  1 1 
       1160 1 1 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1160 1 2 1 1  71 VAL H   2l30_ambr001  71 VAL H    1 1 
       1161 1 1 1 1  67 PRO HA  2l30_ambr001  67 PRO HA   1 1 
       1161 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1162 1 1 1 1  67 PRO QB  2l30_ambr001  67 PRO HB2  1 1 
       1162 1 2 1 1  68 ASP H   2l30_ambr001  68 PRO H    1 1 
       1163 1 1 1 1  67 PRO QB  2l30_ambr001  67 PRO HB2  1 1 
       1163 1 2 1 1  68 ASP HA  2l30_ambr001  68 PRO HA   1 1 
       1164 1 1 1 1  67 PRO QB  2l30_ambr001  67 PRO HB2  1 1 
       1164 1 2 1 1  69 VAL H   2l30_ambr001  69 PRO H    1 1 
       1165 1 1 1 1  67 PRO QB  2l30_ambr001  67 PRO HB2  1 1 
       1165 1 2 1 1  71 VAL H   2l30_ambr001  71 PRO H    1 1 
       1166 1 1 1 1  67 PRO QB  2l30_ambr001  67 PRO HB2  1 1 
       1166 1 2 1 1  71 VAL QG  2l30_ambr001  71 PRO HG11 1 1 
       1167 1 1 1 1  67 PRO QB  2l30_ambr001  67 PRO HB2  1 1 
       1167 1 2 1 1  85 VAL QG  2l30_ambr001  85 PRO HG11 1 1 
       1168 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1168 1 2 1 1  68 ASP H   2l30_ambr001  68 PRO H    1 1 
       1169 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1169 1 2 1 1  68 ASP QB  2l30_ambr001  68 PRO HB2  1 1 
       1170 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1170 1 2 1 1  69 VAL H   2l30_ambr001  69 PRO H    1 1 
       1171 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1171 1 2 1 1  70 GLU H   2l30_ambr001  70 PRO H    1 1 
       1172 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1172 1 2 1 1  71 VAL QG  2l30_ambr001  71 PRO HG11 1 1 
       1173 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1173 1 2 1 1  86 LYS HA  2l30_ambr001  86 PRO HA   1 1 
       1174 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1174 1 2 1 1  86 LYS QB  2l30_ambr001  86 PRO HB2  1 1 
       1175 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1175 1 2 1 1  86 LYS QG  2l30_ambr001  86 PRO HG2  1 1 
       1176 1 1 1 1  67 PRO QD  2l30_ambr001  67 PRO HD2  1 1 
       1176 1 2 1 1  89 ALA MB  2l30_ambr001  89 PRO HB1  1 1 
       1177 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1177 1 2 1 1  68 ASP H   2l30_ambr001  68 PRO H    1 1 
       1178 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1178 1 2 1 1  68 ASP HA  2l30_ambr001  68 PRO HA   1 1 
       1179 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1179 1 2 1 1  69 VAL H   2l30_ambr001  69 PRO H    1 1 
       1180 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1180 1 2 1 1  71 VAL QG  2l30_ambr001  71 PRO HG11 1 1 
       1181 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1181 1 2 1 1  85 VAL QG  2l30_ambr001  85 PRO HG11 1 1 
       1182 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1182 1 2 1 1  86 LYS HA  2l30_ambr001  86 PRO HA   1 1 
       1183 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1183 1 2 1 1  86 LYS QE  2l30_ambr001  86 PRO HE2  1 1 
       1184 1 1 1 1  67 PRO QG  2l30_ambr001  67 PRO HG2  1 1 
       1184 1 2 1 1  89 ALA MB  2l30_ambr001  89 PRO HB1  1 1 
       1185 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1185 1 2 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1186 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1186 1 2 1 1  69 VAL HA  2l30_ambr001  69 VAL HA   1 1 
       1187 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1187 1 2 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1188 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1188 1 2 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1189 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1189 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1190 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1190 1 2 1 1  86 LYS QD  2l30_ambr001  86 LYS HD2  1 1 
       1191 1 1 1 1  68 ASP H   2l30_ambr001  68 ASP H    1 1 
       1191 1 2 1 1  86 LYS QE  2l30_ambr001  86 LYS HE2  1 1 
       1192 1 1 1 1  68 ASP HA  2l30_ambr001  68 ASP HA   1 1 
       1192 1 2 1 1  69 VAL HA  2l30_ambr001  69 VAL HA   1 1 
       1193 1 1 1 1  68 ASP HA  2l30_ambr001  68 ASP HA   1 1 
       1193 1 2 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1194 1 1 1 1  68 ASP HA  2l30_ambr001  68 ASP HA   1 1 
       1194 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1195 1 1 1 1  68 ASP HA  2l30_ambr001  68 ASP HA   1 1 
       1195 1 2 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1196 1 1 1 1  68 ASP HA  2l30_ambr001  68 ASP HA   1 1 
       1196 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1197 1 1 1 1  68 ASP HA  2l30_ambr001  68 ASP HA   1 1 
       1197 1 2 1 1  86 LYS QG  2l30_ambr001  86 LYS HG2  1 1 
       1198 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1198 1 2 1 1  69 VAL H   2l30_ambr001  69 ASP H    1 1 
       1199 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1199 1 2 1 1  69 VAL QG  2l30_ambr001  69 ASP HG11 1 1 
       1200 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1200 1 2 1 1  74 PHE QD  2l30_ambr001  74 ASP HD1  1 1 
       1201 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1201 1 2 1 1  74 PHE QE  2l30_ambr001  74 ASP HE1  1 1 
       1202 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1202 1 2 1 1  74 PHE HZ  2l30_ambr001  74 ASP HZ   1 1 
       1203 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1203 1 2 1 1  86 LYS QD  2l30_ambr001  86 ASP HD2  1 1 
       1204 1 1 1 1  68 ASP QB  2l30_ambr001  68 ASP HB2  1 1 
       1204 1 2 1 1  86 LYS QE  2l30_ambr001  86 ASP HE2  1 1 
       1205 1 1 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1205 1 2 1 1  69 VAL HB  2l30_ambr001  69 VAL HB   1 1 
       1206 1 1 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1206 1 2 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1207 1 1 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1207 1 2 1 1  70 GLU HA  2l30_ambr001  70 GLU HA   1 1 
       1208 1 1 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1208 1 2 1 1  71 VAL H   2l30_ambr001  71 VAL H    1 1 
       1209 1 1 1 1  69 VAL H   2l30_ambr001  69 VAL H    1 1 
       1209 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1210 1 1 1 1  69 VAL HA  2l30_ambr001  69 VAL HA   1 1 
       1210 1 2 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1211 1 1 1 1  69 VAL HB  2l30_ambr001  69 VAL HB   1 1 
       1211 1 2 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1212 1 1 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1212 1 2 1 1  70 GLU H   2l30_ambr001  70 VAL H    1 1 
       1213 1 1 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1213 1 2 1 1  70 GLU HA  2l30_ambr001  70 VAL HA   1 1 
       1214 1 1 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1214 1 2 1 1  70 GLU QB  2l30_ambr001  70 VAL HB2  1 1 
       1215 1 1 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1215 1 2 1 1  70 GLU QG  2l30_ambr001  70 VAL HG2  1 1 
       1216 1 1 1 1  69 VAL QG  2l30_ambr001  69 VAL HG11 1 1 
       1216 1 2 1 1  71 VAL H   2l30_ambr001  71 VAL H    1 1 
       1217 1 1 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1217 1 2 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1218 1 1 1 1  70 GLU H   2l30_ambr001  70 GLU H    1 1 
       1218 1 2 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1219 1 1 1 1  70 GLU HA  2l30_ambr001  70 GLU HA   1 1 
       1219 1 2 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1220 1 1 1 1  70 GLU HA  2l30_ambr001  70 GLU HA   1 1 
       1220 1 2 1 1  72 ASP QB  2l30_ambr001  72 ASP HB2  1 1 
       1221 1 1 1 1  70 GLU QB  2l30_ambr001  70 GLU HB2  1 1 
       1221 1 2 1 1  71 VAL H   2l30_ambr001  71 GLU H    1 1 
       1222 1 1 1 1  70 GLU QB  2l30_ambr001  70 GLU HB2  1 1 
       1222 1 2 1 1  71 VAL QG  2l30_ambr001  71 GLU HG11 1 1 
       1223 1 1 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1223 1 2 1 1  71 VAL H   2l30_ambr001  71 GLU H    1 1 
       1224 1 1 1 1  70 GLU QG  2l30_ambr001  70 GLU HG2  1 1 
       1224 1 2 1 1  71 VAL QG  2l30_ambr001  71 GLU HG11 1 1 
       1225 1 1 1 1  71 VAL H   2l30_ambr001  71 VAL H    1 1 
       1225 1 2 1 1  71 VAL HB  2l30_ambr001  71 VAL HB   1 1 
       1226 1 1 1 1  71 VAL H   2l30_ambr001  71 VAL H    1 1 
       1226 1 2 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
       1227 1 1 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
       1227 1 2 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
       1228 1 1 1 1  71 VAL HA  2l30_ambr001  71 VAL HA   1 1 
       1228 1 2 1 1  72 ASP QB  2l30_ambr001  72 ASP HB2  1 1 
       1229 1 1 1 1  71 VAL HB  2l30_ambr001  71 VAL HB   1 1 
       1229 1 2 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
       1230 1 1 1 1  71 VAL HB  2l30_ambr001  71 VAL HB   1 1 
       1230 1 2 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1231 1 1 1 1  71 VAL HB  2l30_ambr001  71 VAL HB   1 1 
       1231 1 2 1 1  74 PHE QB  2l30_ambr001  74 PHE HB2  1 1 
       1232 1 1 1 1  71 VAL HB  2l30_ambr001  71 VAL HB   1 1 
       1232 1 2 1 1  74 PHE QD  2l30_ambr001  74 PHE HD1  1 1 
       1233 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1233 1 2 1 1  72 ASP H   2l30_ambr001  72 VAL H    1 1 
       1234 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1234 1 2 1 1  72 ASP HA  2l30_ambr001  72 VAL HA   1 1 
       1235 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1235 1 2 1 1  72 ASP QB  2l30_ambr001  72 VAL HB2  1 1 
       1236 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1236 1 2 1 1  73 GLY H   2l30_ambr001  73 VAL H    1 1 
       1237 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1237 1 2 1 1  74 PHE H   2l30_ambr001  74 VAL H    1 1 
       1238 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1238 1 2 1 1  74 PHE HA  2l30_ambr001  74 VAL HA   1 1 
       1239 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1239 1 2 1 1  74 PHE QB  2l30_ambr001  74 VAL HB2  1 1 
       1240 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1240 1 2 1 1  74 PHE QD  2l30_ambr001  74 VAL HD1  1 1 
       1241 1 1 1 1  71 VAL QG  2l30_ambr001  71 VAL HG11 1 1 
       1241 1 2 1 1  75 SER H   2l30_ambr001  75 VAL H    1 1 
       1242 1 1 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
       1242 1 2 1 1  72 ASP QB  2l30_ambr001  72 ASP HB2  1 1 
       1243 1 1 1 1  72 ASP H   2l30_ambr001  72 ASP H    1 1 
       1243 1 2 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1244 1 1 1 1  72 ASP HA  2l30_ambr001  72 ASP HA   1 1 
       1244 1 2 1 1  73 GLY H   2l30_ambr001  73 GLY H    1 1 
       1245 1 1 1 1  72 ASP HA  2l30_ambr001  72 ASP HA   1 1 
       1245 1 2 1 1  73 GLY QA  2l30_ambr001  73 GLY HA2  1 1 
       1246 1 1 1 1  72 ASP HA  2l30_ambr001  72 ASP HA   1 1 
       1246 1 2 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1247 1 1 1 1  72 ASP QB  2l30_ambr001  72 ASP HB2  1 1 
       1247 1 2 1 1  73 GLY H   2l30_ambr001  73 ASP H    1 1 
       1248 1 1 1 1  73 GLY H   2l30_ambr001  73 GLY H    1 1 
       1248 1 2 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1249 1 1 1 1  73 GLY H   2l30_ambr001  73 GLY H    1 1 
       1249 1 2 1 1  76 GLU QG  2l30_ambr001  76 GLU HG2  1 1 
       1250 1 1 1 1  73 GLY QA  2l30_ambr001  73 GLY HA2  1 1 
       1250 1 2 1 1  75 SER H   2l30_ambr001  75 GLY H    1 1 
       1251 1 1 1 1  73 GLY QA  2l30_ambr001  73 GLY HA2  1 1 
       1251 1 2 1 1  76 GLU H   2l30_ambr001  76 GLY H    1 1 
       1252 1 1 1 1  73 GLY QA  2l30_ambr001  73 GLY HA2  1 1 
       1252 1 2 1 1  76 GLU QG  2l30_ambr001  76 GLY HG2  1 1 
       1253 1 1 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1253 1 2 1 1  75 SER H   2l30_ambr001  75 SER H    1 1 
       1254 1 1 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1254 1 2 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1255 1 1 1 1  74 PHE H   2l30_ambr001  74 PHE H    1 1 
       1255 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1256 1 1 1 1  74 PHE HA  2l30_ambr001  74 PHE HA   1 1 
       1256 1 2 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1257 1 1 1 1  74 PHE HA  2l30_ambr001  74 PHE HA   1 1 
       1257 1 2 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1258 1 1 1 1  74 PHE HA  2l30_ambr001  74 PHE HA   1 1 
       1258 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1259 1 1 1 1  74 PHE HA  2l30_ambr001  74 PHE HA   1 1 
       1259 1 2 1 1  77 LEU HG  2l30_ambr001  77 LEU HG   1 1 
       1260 1 1 1 1  74 PHE QB  2l30_ambr001  74 PHE HB2  1 1 
       1260 1 2 1 1  75 SER H   2l30_ambr001  75 PHE H    1 1 
       1261 1 1 1 1  74 PHE QB  2l30_ambr001  74 PHE HB2  1 1 
       1261 1 2 1 1  75 SER HA  2l30_ambr001  75 PHE HA   1 1 
       1262 1 1 1 1  74 PHE QB  2l30_ambr001  74 PHE HB2  1 1 
       1262 1 2 1 1  75 SER QB  2l30_ambr001  75 PHE HB2  1 1 
       1263 1 1 1 1  74 PHE QB  2l30_ambr001  74 PHE HB2  1 1 
       1263 1 2 1 1  77 LEU QD  2l30_ambr001  77 PHE HD11 1 1 
       1264 1 1 1 1  74 PHE QD  2l30_ambr001  74 PHE HD1  1 1 
       1264 1 2 1 1  75 SER HA  2l30_ambr001  75 PHE HA   1 1 
       1265 1 1 1 1  74 PHE QD  2l30_ambr001  74 PHE HD1  1 1 
       1265 1 2 1 1  77 LEU QD  2l30_ambr001  77 PHE HD11 1 1 
       1266 1 1 1 1  74 PHE QD  2l30_ambr001  74 PHE HD1  1 1 
       1266 1 2 1 1  85 VAL HB  2l30_ambr001  85 PHE HB   1 1 
       1267 1 1 1 1  74 PHE QD  2l30_ambr001  74 PHE HD1  1 1 
       1267 1 2 1 1  85 VAL QG  2l30_ambr001  85 PHE HG11 1 1 
       1268 1 1 1 1  74 PHE QD  2l30_ambr001  74 PHE HD1  1 1 
       1268 1 2 1 1  86 LYS QG  2l30_ambr001  86 PHE HG2  1 1 
       1269 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1269 1 2 1 1  82 GLN H   2l30_ambr001  82 PHE H    1 1 
       1270 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1270 1 2 1 1  82 GLN HA  2l30_ambr001  82 PHE HA   1 1 
       1271 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1271 1 2 1 1  82 GLN QB  2l30_ambr001  82 PHE HB2  1 1 
       1272 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1272 1 2 1 1  85 VAL H   2l30_ambr001  85 PHE H    1 1 
       1273 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1273 1 2 1 1  85 VAL HB  2l30_ambr001  85 PHE HB   1 1 
       1274 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1274 1 2 1 1  86 LYS H   2l30_ambr001  86 PHE H    1 1 
       1275 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1275 1 2 1 1  86 LYS QB  2l30_ambr001  86 PHE HB2  1 1 
       1276 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1276 1 2 1 1  86 LYS QD  2l30_ambr001  86 PHE HD2  1 1 
       1277 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1277 1 2 1 1  86 LYS QE  2l30_ambr001  86 PHE HE2  1 1 
       1278 1 1 1 1  74 PHE QE  2l30_ambr001  74 PHE HE1  1 1 
       1278 1 2 1 1  86 LYS QG  2l30_ambr001  86 PHE HG2  1 1 
       1279 1 1 1 1  74 PHE HZ  2l30_ambr001  74 PHE HZ   1 1 
       1279 1 2 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1280 1 1 1 1  74 PHE HZ  2l30_ambr001  74 PHE HZ   1 1 
       1280 1 2 1 1  82 GLN QB  2l30_ambr001  82 GLN HB2  1 1 
       1281 1 1 1 1  74 PHE HZ  2l30_ambr001  74 PHE HZ   1 1 
       1281 1 2 1 1  82 GLN QG  2l30_ambr001  82 GLN HG2  1 1 
       1282 1 1 1 1  74 PHE HZ  2l30_ambr001  74 PHE HZ   1 1 
       1282 1 2 1 1  86 LYS QD  2l30_ambr001  86 LYS HD2  1 1 
       1283 1 1 1 1  74 PHE HZ  2l30_ambr001  74 PHE HZ   1 1 
       1283 1 2 1 1  86 LYS QE  2l30_ambr001  86 LYS HE2  1 1 
       1284 1 1 1 1  74 PHE HZ  2l30_ambr001  74 PHE HZ   1 1 
       1284 1 2 1 1  86 LYS QG  2l30_ambr001  86 LYS HG2  1 1 
       1285 1 1 1 1  75 SER H   2l30_ambr001  75 SER H    1 1 
       1285 1 2 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1286 1 1 1 1  75 SER H   2l30_ambr001  75 SER H    1 1 
       1286 1 2 1 1  76 GLU QG  2l30_ambr001  76 GLU HG2  1 1 
       1287 1 1 1 1  75 SER H   2l30_ambr001  75 SER H    1 1 
       1287 1 2 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1288 1 1 1 1  75 SER HA  2l30_ambr001  75 SER HA   1 1 
       1288 1 2 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1289 1 1 1 1  75 SER QB  2l30_ambr001  75 SER HB2  1 1 
       1289 1 2 1 1  76 GLU H   2l30_ambr001  76 SER H    1 1 
       1290 1 1 1 1  75 SER QB  2l30_ambr001  75 SER HB2  1 1 
       1290 1 2 1 1  76 GLU HA  2l30_ambr001  76 SER HA   1 1 
       1291 1 1 1 1  75 SER QB  2l30_ambr001  75 SER HB2  1 1 
       1291 1 2 1 1  76 GLU QG  2l30_ambr001  76 SER HG2  1 1 
       1292 1 1 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1292 1 2 1 1  76 GLU QG  2l30_ambr001  76 GLU HG2  1 1 
       1293 1 1 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1293 1 2 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1294 1 1 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1294 1 2 1 1  77 LEU QB  2l30_ambr001  77 LEU HB2  1 1 
       1295 1 1 1 1  76 GLU H   2l30_ambr001  76 GLU H    1 1 
       1295 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1296 1 1 1 1  76 GLU HA  2l30_ambr001  76 GLU HA   1 1 
       1296 1 2 1 1  76 GLU QG  2l30_ambr001  76 GLU HG2  1 1 
       1297 1 1 1 1  76 GLU HA  2l30_ambr001  76 GLU HA   1 1 
       1297 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1298 1 1 1 1  76 GLU QB  2l30_ambr001  76 GLU HB2  1 1 
       1298 1 2 1 1  77 LEU H   2l30_ambr001  77 GLU H    1 1 
       1299 1 1 1 1  76 GLU QB  2l30_ambr001  76 GLU HB2  1 1 
       1299 1 2 1 1  77 LEU HA  2l30_ambr001  77 GLU HA   1 1 
       1300 1 1 1 1  76 GLU QG  2l30_ambr001  76 GLU HG2  1 1 
       1300 1 2 1 1  77 LEU H   2l30_ambr001  77 GLU H    1 1 
       1301 1 1 1 1  76 GLU QG  2l30_ambr001  76 GLU HG2  1 1 
       1301 1 2 1 1  77 LEU QD  2l30_ambr001  77 GLU HD11 1 1 
       1302 1 1 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1302 1 2 1 1  77 LEU QB  2l30_ambr001  77 LEU HB2  1 1 
       1303 1 1 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1303 1 2 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1304 1 1 1 1  77 LEU H   2l30_ambr001  77 LEU H    1 1 
       1304 1 2 1 1  77 LEU HG  2l30_ambr001  77 LEU HG   1 1 
       1305 1 1 1 1  77 LEU HA  2l30_ambr001  77 LEU HA   1 1 
       1305 1 2 1 1  78 ARG H   2l30_ambr001  78 ARG H    1 1 
       1306 1 1 1 1  77 LEU QB  2l30_ambr001  77 LEU HB2  1 1 
       1306 1 2 1 1  78 ARG H   2l30_ambr001  78 LEU H    1 1 
       1307 1 1 1 1  77 LEU QB  2l30_ambr001  77 LEU HB2  1 1 
       1307 1 2 1 1  81 ASP H   2l30_ambr001  81 LEU H    1 1 
       1308 1 1 1 1  77 LEU QB  2l30_ambr001  77 LEU HB2  1 1 
       1308 1 2 1 1  81 ASP QB  2l30_ambr001  81 LEU HB2  1 1 
       1309 1 1 1 1  77 LEU QB  2l30_ambr001  77 LEU HB2  1 1 
       1309 1 2 1 1  82 GLN H   2l30_ambr001  82 LEU H    1 1 
       1310 1 1 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1310 1 2 1 1  78 ARG H   2l30_ambr001  78 LEU H    1 1 
       1311 1 1 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1311 1 2 1 1  81 ASP H   2l30_ambr001  81 LEU H    1 1 
       1312 1 1 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1312 1 2 1 1  81 ASP QB  2l30_ambr001  81 LEU HB2  1 1 
       1313 1 1 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1313 1 2 1 1  85 VAL HA  2l30_ambr001  85 LEU HA   1 1 
       1314 1 1 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1314 1 2 1 1  85 VAL HB  2l30_ambr001  85 LEU HB   1 1 
       1315 1 1 1 1  77 LEU QD  2l30_ambr001  77 LEU HD11 1 1 
       1315 1 2 1 1  85 VAL QG  2l30_ambr001  85 LEU HG11 1 1 
       1316 1 1 1 1  77 LEU HG  2l30_ambr001  77 LEU HG   1 1 
       1316 1 2 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1317 1 1 1 1  78 ARG H   2l30_ambr001  78 ARG H    1 1 
       1317 1 2 1 1  78 ARG QD  2l30_ambr001  78 ARG HD2  1 1 
       1318 1 1 1 1  78 ARG H   2l30_ambr001  78 ARG H    1 1 
       1318 1 2 1 1  78 ARG QG  2l30_ambr001  78 ARG HG2  1 1 
       1319 1 1 1 1  78 ARG H   2l30_ambr001  78 ARG H    1 1 
       1319 1 2 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1320 1 1 1 1  78 ARG H   2l30_ambr001  78 ARG H    1 1 
       1320 1 2 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1321 1 1 1 1  78 ARG HA  2l30_ambr001  78 ARG HA   1 1 
       1321 1 2 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1322 1 1 1 1  78 ARG HA  2l30_ambr001  78 ARG HA   1 1 
       1322 1 2 1 1  80 ASP H   2l30_ambr001  80 ASP H    1 1 
       1323 1 1 1 1  78 ARG QB  2l30_ambr001  78 ARG HB2  1 1 
       1323 1 2 1 1  79 TRP H   2l30_ambr001  79 ARG H    1 1 
       1324 1 1 1 1  78 ARG QB  2l30_ambr001  78 ARG HB2  1 1 
       1324 1 2 1 1  79 TRP HZ3 2l30_ambr001  79 ARG HZ3  1 1 
       1325 1 1 1 1  78 ARG QB  2l30_ambr001  78 ARG HB2  1 1 
       1325 1 2 1 1  80 ASP H   2l30_ambr001  80 ARG H    1 1 
       1326 1 1 1 1  78 ARG QB  2l30_ambr001  78 ARG HB2  1 1 
       1326 1 2 1 1  80 ASP QB  2l30_ambr001  80 ARG HB2  1 1 
       1327 1 1 1 1  78 ARG QB  2l30_ambr001  78 ARG HB2  1 1 
       1327 1 2 1 1  81 ASP H   2l30_ambr001  81 ARG H    1 1 
       1328 1 1 1 1  78 ARG QD  2l30_ambr001  78 ARG HD2  1 1 
       1328 1 2 1 1  79 TRP HA  2l30_ambr001  79 ARG HA   1 1 
       1329 1 1 1 1  78 ARG QD  2l30_ambr001  78 ARG HD2  1 1 
       1329 1 2 1 1  79 TRP QB  2l30_ambr001  79 ARG HB2  1 1 
       1330 1 1 1 1  78 ARG QG  2l30_ambr001  78 ARG HG2  1 1 
       1330 1 2 1 1  80 ASP H   2l30_ambr001  80 ARG H    1 1 
       1331 1 1 1 1  79 TRP H   2l30_ambr001  79 TRP H    1 1 
       1331 1 2 1 1  80 ASP H   2l30_ambr001  80 ASP H    1 1 
       1332 1 1 1 1  79 TRP H   2l30_ambr001  79 TRP H    1 1 
       1332 1 2 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1333 1 1 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1333 1 2 1 1  79 TRP HD1 2l30_ambr001  79 TRP HD1  1 1 
       1334 1 1 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1334 1 2 1 1  79 TRP HE3 2l30_ambr001  79 TRP HE3  1 1 
       1335 1 1 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1335 1 2 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1336 1 1 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1336 1 2 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1337 1 1 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1337 1 2 1 1  82 GLN QB  2l30_ambr001  82 GLN HB2  1 1 
       1338 1 1 1 1  79 TRP HA  2l30_ambr001  79 TRP HA   1 1 
       1338 1 2 1 1  82 GLN QG  2l30_ambr001  82 GLN HG2  1 1 
       1339 1 1 1 1  79 TRP QB  2l30_ambr001  79 TRP HB2  1 1 
       1339 1 2 1 1  80 ASP H   2l30_ambr001  80 TRP H    1 1 
       1340 1 1 1 1  79 TRP HD1 2l30_ambr001  79 TRP HD1  1 1 
       1340 1 2 1 1  82 GLN QB  2l30_ambr001  82 GLN HB2  1 1 
       1341 1 1 1 1  79 TRP HE3 2l30_ambr001  79 TRP HE3  1 1 
       1341 1 2 1 1  80 ASP H   2l30_ambr001  80 ASP H    1 1 
       1342 1 1 1 1  79 TRP HE3 2l30_ambr001  79 TRP HE3  1 1 
       1342 1 2 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1343 1 1 1 1  79 TRP HE3 2l30_ambr001  79 TRP HE3  1 1 
       1343 1 2 1 1  80 ASP QB  2l30_ambr001  80 ASP HB2  1 1 
       1344 1 1 1 1  79 TRP HH2 2l30_ambr001  79 TRP HH2  1 1 
       1344 1 2 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1345 1 1 1 1  79 TRP HH2 2l30_ambr001  79 TRP HH2  1 1 
       1345 1 2 1 1  80 ASP QB  2l30_ambr001  80 ASP HB2  1 1 
       1346 1 1 1 1  79 TRP HZ2 2l30_ambr001  79 TRP HZ2  1 1 
       1346 1 2 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1347 1 1 1 1  80 ASP H   2l30_ambr001  80 ASP H    1 1 
       1347 1 2 1 1  80 ASP QB  2l30_ambr001  80 ASP HB2  1 1 
       1348 1 1 1 1  80 ASP H   2l30_ambr001  80 ASP H    1 1 
       1348 1 2 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1349 1 1 1 1  80 ASP H   2l30_ambr001  80 ASP H    1 1 
       1349 1 2 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1350 1 1 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1350 1 2 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1351 1 1 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1351 1 2 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1352 1 1 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1352 1 2 1 1  83 GLN QB  2l30_ambr001  83 GLN HB2  1 1 
       1353 1 1 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1353 1 2 1 1  83 GLN QG  2l30_ambr001  83 GLN HG2  1 1 
       1354 1 1 1 1  80 ASP HA  2l30_ambr001  80 ASP HA   1 1 
       1354 1 2 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1355 1 1 1 1  80 ASP QB  2l30_ambr001  80 ASP HB2  1 1 
       1355 1 2 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1356 1 1 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1356 1 2 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1357 1 1 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1357 1 2 1 1  82 GLN QB  2l30_ambr001  82 GLN HB2  1 1 
       1358 1 1 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1358 1 2 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1359 1 1 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1359 1 2 1 1  83 GLN QG  2l30_ambr001  83 GLN HG2  1 1 
       1360 1 1 1 1  81 ASP H   2l30_ambr001  81 ASP H    1 1 
       1360 1 2 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1361 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1361 1 2 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1362 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1362 1 2 1 1  84 LYS QB  2l30_ambr001  84 LYS HB2  1 1 
       1363 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1363 1 2 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1364 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1364 1 2 1 1  84 LYS QE  2l30_ambr001  84 LYS HE2  1 1 
       1365 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1365 1 2 1 1  84 LYS QG  2l30_ambr001  84 LYS HG2  1 1 
       1366 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1366 1 2 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1367 1 1 1 1  81 ASP HA  2l30_ambr001  81 ASP HA   1 1 
       1367 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1368 1 1 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1368 1 2 1 1  82 GLN H   2l30_ambr001  82 ASP H    1 1 
       1369 1 1 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1369 1 2 1 1  84 LYS H   2l30_ambr001  84 ASP H    1 1 
       1370 1 1 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1370 1 2 1 1  84 LYS QB  2l30_ambr001  84 ASP HB2  1 1 
       1371 1 1 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1371 1 2 1 1  85 VAL H   2l30_ambr001  85 ASP H    1 1 
       1372 1 1 1 1  81 ASP QB  2l30_ambr001  81 ASP HB2  1 1 
       1372 1 2 1 1  85 VAL QG  2l30_ambr001  85 ASP HG11 1 1 
       1373 1 1 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1373 1 2 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1374 1 1 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1374 1 2 1 1  83 GLN QG  2l30_ambr001  83 GLN HG2  1 1 
       1375 1 1 1 1  82 GLN H   2l30_ambr001  82 GLN H    1 1 
       1375 1 2 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1376 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1376 1 2 1 1  83 GLN HA  2l30_ambr001  83 GLN HA   1 1 
       1377 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1377 1 2 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1378 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1378 1 2 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1379 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1379 1 2 1 1  85 VAL HB  2l30_ambr001  85 VAL HB   1 1 
       1380 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1380 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1381 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1381 1 2 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1382 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1382 1 2 1 1  86 LYS QD  2l30_ambr001  86 LYS HD2  1 1 
       1383 1 1 1 1  82 GLN HA  2l30_ambr001  82 GLN HA   1 1 
       1383 1 2 1 1  86 LYS QG  2l30_ambr001  86 LYS HG2  1 1 
       1384 1 1 1 1  82 GLN QB  2l30_ambr001  82 GLN HB2  1 1 
       1384 1 2 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1385 1 1 1 1  82 GLN QG  2l30_ambr001  82 GLN HG2  1 1 
       1385 1 2 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1386 1 1 1 1  82 GLN QG  2l30_ambr001  82 GLN HG2  1 1 
       1386 1 2 1 1  86 LYS QG  2l30_ambr001  86 GLN HG2  1 1 
       1387 1 1 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1387 1 2 1 1  83 GLN QG  2l30_ambr001  83 GLN HG2  1 1 
       1388 1 1 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1388 1 2 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1389 1 1 1 1  83 GLN H   2l30_ambr001  83 GLN H    1 1 
       1389 1 2 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1390 1 1 1 1  83 GLN HA  2l30_ambr001  83 GLN HA   1 1 
       1390 1 2 1 1  84 LYS HA  2l30_ambr001  84 LYS HA   1 1 
       1391 1 1 1 1  83 GLN HA  2l30_ambr001  83 GLN HA   1 1 
       1391 1 2 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1392 1 1 1 1  83 GLN HA  2l30_ambr001  83 GLN HA   1 1 
       1392 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1393 1 1 1 1  83 GLN QB  2l30_ambr001  83 GLN HB2  1 1 
       1393 1 2 1 1  84 LYS H   2l30_ambr001  84 GLN H    1 1 
       1394 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1394 1 2 1 1  84 LYS QB  2l30_ambr001  84 LYS HB2  1 1 
       1395 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1395 1 2 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1396 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1396 1 2 1 1  84 LYS QE  2l30_ambr001  84 LYS HE2  1 1 
       1397 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1397 1 2 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1398 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1398 1 2 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1399 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1399 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1400 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1400 1 2 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1401 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1401 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1402 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1402 1 2 1 1  87 LYS QB  2l30_ambr001  87 LYS HB2  1 1 
       1403 1 1 1 1  84 LYS H   2l30_ambr001  84 LYS H    1 1 
       1403 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1404 1 1 1 1  84 LYS HA  2l30_ambr001  84 LYS HA   1 1 
       1404 1 2 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1405 1 1 1 1  84 LYS HA  2l30_ambr001  84 LYS HA   1 1 
       1405 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1406 1 1 1 1  84 LYS HA  2l30_ambr001  84 LYS HA   1 1 
       1406 1 2 1 1  87 LYS QD  2l30_ambr001  87 LYS HD2  1 1 
       1407 1 1 1 1  84 LYS QB  2l30_ambr001  84 LYS HB2  1 1 
       1407 1 2 1 1  85 VAL H   2l30_ambr001  85 LYS H    1 1 
       1408 1 1 1 1  84 LYS QB  2l30_ambr001  84 LYS HB2  1 1 
       1408 1 2 1 1  85 VAL HA  2l30_ambr001  85 LYS HA   1 1 
       1409 1 1 1 1  84 LYS QB  2l30_ambr001  84 LYS HB2  1 1 
       1409 1 2 1 1  85 VAL QG  2l30_ambr001  85 LYS HG11 1 1 
       1410 1 1 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1410 1 2 1 1  85 VAL H   2l30_ambr001  85 LYS H    1 1 
       1411 1 1 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1411 1 2 1 1  85 VAL HA  2l30_ambr001  85 LYS HA   1 1 
       1412 1 1 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1412 1 2 1 1  85 VAL QG  2l30_ambr001  85 LYS HG11 1 1 
       1413 1 1 1 1  84 LYS QD  2l30_ambr001  84 LYS HD2  1 1 
       1413 1 2 1 1  88 THR HB  2l30_ambr001  88 LYS HB   1 1 
       1414 1 1 1 1  84 LYS QE  2l30_ambr001  84 LYS HE2  1 1 
       1414 1 2 1 1  85 VAL QG  2l30_ambr001  85 LYS HG11 1 1 
       1415 1 1 1 1  84 LYS QG  2l30_ambr001  84 LYS HG2  1 1 
       1415 1 2 1 1  85 VAL QG  2l30_ambr001  85 LYS HG11 1 1 
       1416 1 1 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1416 1 2 1 1  85 VAL HB  2l30_ambr001  85 VAL HB   1 1 
       1417 1 1 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1417 1 2 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1418 1 1 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1418 1 2 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1419 1 1 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1419 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1420 1 1 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1420 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1421 1 1 1 1  85 VAL H   2l30_ambr001  85 VAL H    1 1 
       1421 1 2 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1422 1 1 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1422 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1423 1 1 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1423 1 2 1 1  88 THR HA  2l30_ambr001  88 THR HA   1 1 
       1424 1 1 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1424 1 2 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1425 1 1 1 1  85 VAL HA  2l30_ambr001  85 VAL HA   1 1 
       1425 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1426 1 1 1 1  85 VAL HB  2l30_ambr001  85 VAL HB   1 1 
       1426 1 2 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1427 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1427 1 2 1 1  86 LYS H   2l30_ambr001  86 VAL H    1 1 
       1428 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1428 1 2 1 1  86 LYS HA  2l30_ambr001  86 VAL HA   1 1 
       1429 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1429 1 2 1 1  86 LYS QG  2l30_ambr001  86 VAL HG2  1 1 
       1430 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1430 1 2 1 1  87 LYS H   2l30_ambr001  87 VAL H    1 1 
       1431 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1431 1 2 1 1  88 THR H   2l30_ambr001  88 VAL H    1 1 
       1432 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1432 1 2 1 1  88 THR HB  2l30_ambr001  88 VAL HB   1 1 
       1433 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1433 1 2 1 1  88 THR MG  2l30_ambr001  88 VAL HG21 1 1 
       1434 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1434 1 2 1 1  89 ALA H   2l30_ambr001  89 VAL H    1 1 
       1435 1 1 1 1  85 VAL QG  2l30_ambr001  85 VAL HG11 1 1 
       1435 1 2 1 1  89 ALA MB  2l30_ambr001  89 VAL HB1  1 1 
       1436 1 1 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1436 1 2 1 1  86 LYS QB  2l30_ambr001  86 LYS HB2  1 1 
       1437 1 1 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1437 1 2 1 1  86 LYS QD  2l30_ambr001  86 LYS HD2  1 1 
       1438 1 1 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1438 1 2 1 1  86 LYS QE  2l30_ambr001  86 LYS HE2  1 1 
       1439 1 1 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1439 1 2 1 1  86 LYS QG  2l30_ambr001  86 LYS HG2  1 1 
       1440 1 1 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1440 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1441 1 1 1 1  86 LYS H   2l30_ambr001  86 LYS H    1 1 
       1441 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1442 1 1 1 1  86 LYS HA  2l30_ambr001  86 LYS HA   1 1 
       1442 1 2 1 1  86 LYS QE  2l30_ambr001  86 LYS HE2  1 1 
       1443 1 1 1 1  86 LYS HA  2l30_ambr001  86 LYS HA   1 1 
       1443 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1444 1 1 1 1  86 LYS HA  2l30_ambr001  86 LYS HA   1 1 
       1444 1 2 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1445 1 1 1 1  86 LYS HA  2l30_ambr001  86 LYS HA   1 1 
       1445 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1446 1 1 1 1  86 LYS HA  2l30_ambr001  86 LYS HA   1 1 
       1446 1 2 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1447 1 1 1 1  86 LYS QB  2l30_ambr001  86 LYS HB2  1 1 
       1447 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1448 1 1 1 1  86 LYS QB  2l30_ambr001  86 LYS HB2  1 1 
       1448 1 2 1 1  90 GLU H   2l30_ambr001  90 LYS H    1 1 
       1449 1 1 1 1  86 LYS QG  2l30_ambr001  86 LYS HG2  1 1 
       1449 1 2 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1450 1 1 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1450 1 2 1 1  87 LYS QB  2l30_ambr001  87 LYS HB2  1 1 
       1451 1 1 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1451 1 2 1 1  87 LYS QD  2l30_ambr001  87 LYS HD2  1 1 
       1452 1 1 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1452 1 2 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1453 1 1 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1453 1 2 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1454 1 1 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1454 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1455 1 1 1 1  87 LYS H   2l30_ambr001  87 LYS H    1 1 
       1455 1 2 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1456 1 1 1 1  87 LYS HA  2l30_ambr001  87 LYS HA   1 1 
       1456 1 2 1 1  87 LYS QD  2l30_ambr001  87 LYS HD2  1 1 
       1457 1 1 1 1  87 LYS HA  2l30_ambr001  87 LYS HA   1 1 
       1457 1 2 1 1  87 LYS QE  2l30_ambr001  87 LYS HE2  1 1 
       1458 1 1 1 1  87 LYS HA  2l30_ambr001  87 LYS HA   1 1 
       1458 1 2 1 1  88 THR HA  2l30_ambr001  88 THR HA   1 1 
       1459 1 1 1 1  87 LYS HA  2l30_ambr001  87 LYS HA   1 1 
       1459 1 2 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1460 1 1 1 1  87 LYS HA  2l30_ambr001  87 LYS HA   1 1 
       1460 1 2 1 1  90 GLU QG  2l30_ambr001  90 GLU HG2  1 1 
       1461 1 1 1 1  87 LYS HA  2l30_ambr001  87 LYS HA   1 1 
       1461 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1462 1 1 1 1  87 LYS QB  2l30_ambr001  87 LYS HB2  1 1 
       1462 1 2 1 1  88 THR H   2l30_ambr001  88 LYS H    1 1 
       1463 1 1 1 1  87 LYS QB  2l30_ambr001  87 LYS HB2  1 1 
       1463 1 2 1 1  88 THR HA  2l30_ambr001  88 LYS HA   1 1 
       1464 1 1 1 1  87 LYS QD  2l30_ambr001  87 LYS HD2  1 1 
       1464 1 2 1 1  88 THR H   2l30_ambr001  88 LYS H    1 1 
       1465 1 1 1 1  87 LYS QG  2l30_ambr001  87 LYS HG2  1 1 
       1465 1 2 1 1  88 THR H   2l30_ambr001  88 LYS H    1 1 
       1466 1 1 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1466 1 2 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1467 1 1 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1467 1 2 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1468 1 1 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1468 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1469 1 1 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1469 1 2 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1470 1 1 1 1  88 THR H   2l30_ambr001  88 THR H    1 1 
       1470 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1471 1 1 1 1  88 THR HA  2l30_ambr001  88 THR HA   1 1 
       1471 1 2 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1472 1 1 1 1  88 THR HA  2l30_ambr001  88 THR HA   1 1 
       1472 1 2 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1473 1 1 1 1  88 THR HA  2l30_ambr001  88 THR HA   1 1 
       1473 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1474 1 1 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1474 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1475 1 1 1 1  88 THR HB  2l30_ambr001  88 THR HB   1 1 
       1475 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1476 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1476 1 2 1 1  89 ALA H   2l30_ambr001  89 THR H    1 1 
       1477 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1477 1 2 1 1  89 ALA HA  2l30_ambr001  89 THR HA   1 1 
       1478 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1478 1 2 1 1  89 ALA MB  2l30_ambr001  89 THR HB1  1 1 
       1479 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1479 1 2 1 1  91 ALA MB  2l30_ambr001  91 THR HB1  1 1 
       1480 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1480 1 2 1 1  93 GLY H   2l30_ambr001  93 THR H    1 1 
       1481 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1481 1 2 1 1  93 GLY QA  2l30_ambr001  93 THR HA2  1 1 
       1482 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1482 1 2 1 1  94 VAL H   2l30_ambr001  94 THR H    1 1 
       1483 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1483 1 2 1 1  94 VAL HA  2l30_ambr001  94 THR HA   1 1 
       1484 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1484 1 2 1 1  94 VAL QG  2l30_ambr001  94 THR HG11 1 1 
       1485 1 1 1 1  88 THR MG  2l30_ambr001  88 THR HG21 1 1 
       1485 1 2 1 1  95 THR MG  2l30_ambr001  95 THR HG21 1 1 
       1486 1 1 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1486 1 2 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1487 1 1 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1487 1 2 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1488 1 1 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1488 1 2 1 1  90 GLU HA  2l30_ambr001  90 GLU HA   1 1 
       1489 1 1 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1489 1 2 1 1  90 GLU QB  2l30_ambr001  90 GLU HB2  1 1 
       1490 1 1 1 1  89 ALA H   2l30_ambr001  89 ALA H    1 1 
       1490 1 2 1 1  90 GLU QG  2l30_ambr001  90 GLU HG2  1 1 
       1491 1 1 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1491 1 2 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1492 1 1 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1492 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1493 1 1 1 1  89 ALA HA  2l30_ambr001  89 ALA HA   1 1 
       1493 1 2 1 1  92 GLY H   2l30_ambr001  92 GLY H    1 1 
       1494 1 1 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1494 1 2 1 1  90 GLU H   2l30_ambr001  90 ALA H    1 1 
       1495 1 1 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1495 1 2 1 1  90 GLU HA  2l30_ambr001  90 ALA HA   1 1 
       1496 1 1 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1496 1 2 1 1  90 GLU QB  2l30_ambr001  90 ALA HB2  1 1 
       1497 1 1 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1497 1 2 1 1  90 GLU QG  2l30_ambr001  90 ALA HG2  1 1 
       1498 1 1 1 1  89 ALA MB  2l30_ambr001  89 ALA HB1  1 1 
       1498 1 2 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1499 1 1 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1499 1 2 1 1  90 GLU QB  2l30_ambr001  90 GLU HB2  1 1 
       1500 1 1 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1500 1 2 1 1  90 GLU QG  2l30_ambr001  90 GLU HG2  1 1 
       1501 1 1 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1501 1 2 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1502 1 1 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1502 1 2 1 1  91 ALA HA  2l30_ambr001  91 ALA HA   1 1 
       1503 1 1 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1503 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1504 1 1 1 1  90 GLU H   2l30_ambr001  90 GLU H    1 1 
       1504 1 2 1 1  92 GLY H   2l30_ambr001  92 GLY H    1 1 
       1505 1 1 1 1  90 GLU HA  2l30_ambr001  90 GLU HA   1 1 
       1505 1 2 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1506 1 1 1 1  90 GLU HA  2l30_ambr001  90 GLU HA   1 1 
       1506 1 2 1 1  91 ALA HA  2l30_ambr001  91 ALA HA   1 1 
       1507 1 1 1 1  90 GLU QB  2l30_ambr001  90 GLU HB2  1 1 
       1507 1 2 1 1  91 ALA H   2l30_ambr001  91 GLU H    1 1 
       1508 1 1 1 1  90 GLU QB  2l30_ambr001  90 GLU HB2  1 1 
       1508 1 2 1 1  91 ALA HA  2l30_ambr001  91 GLU HA   1 1 
       1509 1 1 1 1  90 GLU QB  2l30_ambr001  90 GLU HB2  1 1 
       1509 1 2 1 1  91 ALA MB  2l30_ambr001  91 GLU HB1  1 1 
       1510 1 1 1 1  90 GLU QG  2l30_ambr001  90 GLU HG2  1 1 
       1510 1 2 1 1  91 ALA H   2l30_ambr001  91 GLU H    1 1 
       1511 1 1 1 1  90 GLU QG  2l30_ambr001  90 GLU HG2  1 1 
       1511 1 2 1 1  91 ALA MB  2l30_ambr001  91 GLU HB1  1 1 
       1512 1 1 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1512 1 2 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1513 1 1 1 1  91 ALA H   2l30_ambr001  91 ALA H    1 1 
       1513 1 2 1 1  92 GLY H   2l30_ambr001  92 GLY H    1 1 
       1514 1 1 1 1  91 ALA HA  2l30_ambr001  91 ALA HA   1 1 
       1514 1 2 1 1  93 GLY H   2l30_ambr001  93 GLY H    1 1 
       1515 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1515 1 2 1 1  92 GLY H   2l30_ambr001  92 ALA H    1 1 
       1516 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1516 1 2 1 1  93 GLY H   2l30_ambr001  93 ALA H    1 1 
       1517 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1517 1 2 1 1  93 GLY QA  2l30_ambr001  93 ALA HA2  1 1 
       1518 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1518 1 2 1 1  94 VAL H   2l30_ambr001  94 ALA H    1 1 
       1519 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1519 1 2 1 1  94 VAL HA  2l30_ambr001  94 ALA HA   1 1 
       1520 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1520 1 2 1 1  94 VAL HB  2l30_ambr001  94 ALA HB   1 1 
       1521 1 1 1 1  91 ALA MB  2l30_ambr001  91 ALA HB1  1 1 
       1521 1 2 1 1  94 VAL QG  2l30_ambr001  94 ALA HG11 1 1 
       1522 1 1 1 1  93 GLY H   2l30_ambr001  93 GLY H    1 1 
       1522 1 2 1 1  94 VAL H   2l30_ambr001  94 VAL H    1 1 
       1523 1 1 1 1  93 GLY QA  2l30_ambr001  93 GLY HA2  1 1 
       1523 1 2 1 1  94 VAL QG  2l30_ambr001  94 GLY HG11 1 1 
       1524 1 1 1 1  94 VAL H   2l30_ambr001  94 VAL H    1 1 
       1524 1 2 1 1  94 VAL HB  2l30_ambr001  94 VAL HB   1 1 
       1525 1 1 1 1  94 VAL H   2l30_ambr001  94 VAL H    1 1 
       1525 1 2 1 1  95 THR H   2l30_ambr001  95 THR H    1 1 
       1526 1 1 1 1  94 VAL HA  2l30_ambr001  94 VAL HA   1 1 
       1526 1 2 1 1  95 THR MG  2l30_ambr001  95 THR HG21 1 1 
       1527 1 1 1 1  94 VAL HB  2l30_ambr001  94 VAL HB   1 1 
       1527 1 2 1 1  95 THR H   2l30_ambr001  95 THR H    1 1 
       1528 1 1 1 1  94 VAL QG  2l30_ambr001  94 VAL HG11 1 1 
       1528 1 2 1 1  95 THR H   2l30_ambr001  95 VAL H    1 1 
       1529 1 1 1 1  94 VAL QG  2l30_ambr001  94 VAL HG11 1 1 
       1529 1 2 1 1  95 THR HA  2l30_ambr001  95 VAL HA   1 1 
       1530 1 1 1 1  94 VAL QG  2l30_ambr001  94 VAL HG11 1 1 
       1530 1 2 1 1  95 THR MG  2l30_ambr001  95 VAL HG21 1 1 
       1531 1 1 1 1  94 VAL QG  2l30_ambr001  94 VAL HG11 1 1 
       1531 1 2 1 1  96 GLY QA  2l30_ambr001  96 VAL HA2  1 1 
       1532 1 1 1 1  95 THR HA  2l30_ambr001  95 THR HA   1 1 
       1532 1 2 1 1  95 THR HB  2l30_ambr001  95 THR HB   1 1 
       1533 1 1 1 1  95 THR HA  2l30_ambr001  95 THR HA   1 1 
       1533 1 2 1 1  96 GLY QA  2l30_ambr001  96 GLY HA2  1 1 
       1534 1 1 1 1  95 THR HB  2l30_ambr001  95 THR HB   1 1 
       1534 1 2 1 1  96 GLY QA  2l30_ambr001  96 GLY HA2  1 1 
       1535 1 1 1 1  96 GLY QA  2l30_ambr001  96 GLY HA2  1 1 
       1535 1 2 1 1  97 LYS QE  2l30_ambr001  97 GLY HE2  1 1 
       1536 1 1 1 1  97 LYS HA  2l30_ambr001  97 LYS HA   1 1 
       1536 1 2 1 1  97 LYS QE  2l30_ambr001  97 LYS HE2  1 1 
       1537 1 1 1 1  97 LYS QB  2l30_ambr001  97 LYS HB2  1 1 
       1537 1 2 1 1  98 GLY QA  2l30_ambr001  98 LYS HA2  1 1 
       1538 1 1 1 1  98 GLY QA  2l30_ambr001  98 GLY HA2  1 1 
       1538 1 2 1 1  99 GLN HA  2l30_ambr001  99 GLY HA   1 1 
       1539 1 1 1 1  98 GLY QA  2l30_ambr001  98 GLY HA2  1 1 
       1539 1 2 1 1  99 GLN QB  2l30_ambr001  99 GLY HB2  1 1 
       1540 1 1 1 1  99 GLN HA  2l30_ambr001  99 GLN HA   1 1 
       1540 1 2 1 1 100 ASP QB  2l30_ambr001 100 ASP HB2  1 1 
       1541 1 1 1 1  99 GLN QG  2l30_ambr001  99 GLN HG2  1 1 
       1541 1 2 1 1 100 ASP H   2l30_ambr001 100 GLN H    1 1 
       1542 1 1 1 1 100 ASP H   2l30_ambr001 100 ASP H    1 1 
       1542 1 2 1 1 101 GLY H   2l30_ambr001 101 GLY H    1 1 
       1543 1 1 1 1 100 ASP QB  2l30_ambr001 100 ASP HB2  1 1 
       1543 1 2 1 1 101 GLY H   2l30_ambr001 101 ASP H    1 1 
       1544 1 1 1 1 101 GLY H   2l30_ambr001 101 GLY H    1 1 
       1544 1 2 1 1 102 ILE H   2l30_ambr001 102 ILE H    1 1 
       1545 1 1 1 1 101 GLY H   2l30_ambr001 101 GLY H    1 1 
       1545 1 2 1 1 102 ILE HB  2l30_ambr001 102 ILE HB   1 1 
       1546 1 1 1 1 101 GLY QA  2l30_ambr001 101 GLY HA2  1 1 
       1546 1 2 1 1 102 ILE HA  2l30_ambr001 102 GLY HA   1 1 
       1547 1 1 1 1 101 GLY QA  2l30_ambr001 101 GLY HA2  1 1 
       1547 1 2 1 1 102 ILE MG  2l30_ambr001 102 GLY HG21 1 1 
       1548 1 1 1 1 102 ILE H   2l30_ambr001 102 ILE H    1 1 
       1548 1 2 1 1 102 ILE HB  2l30_ambr001 102 ILE HB   1 1 
       1549 1 1 1 1 102 ILE HA  2l30_ambr001 102 ILE HA   1 1 
       1549 1 2 1 1 103 GLY QA  2l30_ambr001 103 GLY HA2  1 1 
       1550 1 1 1 1 102 ILE MG  2l30_ambr001 102 ILE HG21 1 1 
       1550 1 2 1 1 103 GLY QA  2l30_ambr001 103 ILE HA2  1 1 
       1551 1 1 1 1 105 LYS QB  2l30_ambr001 105 LYS HB2  1 1 
       1551 1 2 1 1 106 ALA H   2l30_ambr001 106 LYS H    1 1 
       1552 1 1 1 1 105 LYS QG  2l30_ambr001 105 LYS HG2  1 1 
       1552 1 2 1 1 106 ALA HA  2l30_ambr001 106 LYS HA   1 1 
       1553 1 1 1 1 106 ALA H   2l30_ambr001 106 ALA H    1 1 
       1553 1 2 1 1 107 GLU H   2l30_ambr001 107 GLU H    1 1 
       1554 1 1 1 1 106 ALA HA  2l30_ambr001 106 ALA HA   1 1 
       1554 1 2 1 1 107 GLU HA  2l30_ambr001 107 GLU HA   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . .   4.928 0.0   5.488 1 1 
          2 1 . . . . .   5.488 0.0   6.048 1 1 
          3 1 . . . . .     5.3 0.0     5.8 1 1 
          4 1 . . . . .   5.824 0.0   6.384 1 1 
          5 1 . . . . .     4.4 0.0     4.9 1 1 
          6 1 . . . . .     4.3 0.0     4.8 1 1 
          7 1 . . . . .     5.6 0.0    6.16 1 1 
          8 1 . . . . .   5.488 0.0   6.048 1 1 
          9 1 . . . . .    5.04 0.0     5.6 1 1 
         10 1 . . . . . 5.77024 0.0 6.39744 1 1 
         11 1 . . . . . 6.14656 0.0 6.77376 1 1 
         12 1 . . . . .     4.1 0.0     4.6 1 1 
         13 1 . . . . .   5.824 0.0   6.384 1 1 
         14 1 . . . . .     3.2 0.0     3.7 1 1 
         15 1 . . . . .   5.936 0.0   6.496 1 1 
         16 1 . . . . .   5.824 0.0   6.384 1 1 
         17 1 . . . . .   4.592 0.0   5.152 1 1 
         18 1 . . . . .   4.592 0.0   5.152 1 1 
         19 1 . . . . .   5.264 0.0   5.824 1 1 
         20 1 . . . . .    3.92 0.0    4.48 1 1 
         21 1 . . . . .     4.7 0.0     5.2 1 1 
         22 1 . . . . .     5.1 0.0     5.6 1 1 
         23 1 . . . . .   4.144 0.0   4.704 1 1 
         24 1 . . . . .   3.696 0.0   4.256 1 1 
         25 1 . . . . .     3.0 0.0     3.5 1 1 
         26 1 . . . . .     4.5 0.0     5.0 1 1 
         27 1 . . . . .    6.75 0.0   7.425 1 1 
         28 1 . . . . .     5.0 0.0     5.5 1 1 
         29 1 . . . . .     4.0 0.0     4.5 1 1 
         30 1 . . . . .    4.48 0.0    5.04 1 1 
         31 1 . . . . .   5.376 0.0   5.936 1 1 
         32 1 . . . . .   4.704 0.0   5.264 1 1 
         33 1 . . . . .   5.264 0.0   5.824 1 1 
         34 1 . . . . . 5.26848 0.0 5.89568 1 1 
         35 1 . . . . .   5.488 0.0   6.048 1 1 
         36 1 . . . . .   5.488 0.0   6.048 1 1 
         37 1 . . . . .   4.928 0.0   5.488 1 1 
         38 1 . . . . . 4.76672 0.0 5.39392 1 1 
         39 1 . . . . .  5.0176 0.0  5.6448 1 1 
         40 1 . . . . .   5.376 0.0   5.936 1 1 
         41 1 . . . . . 5.26848 0.0 5.89568 1 1 
         42 1 . . . . .     4.1 0.0     4.6 1 1 
         43 1 . . . . .     3.4 0.0     3.9 1 1 
         44 1 . . . . .     5.5 0.0     6.0 1 1 
         45 1 . . . . .   5.824 0.0   6.384 1 1 
         46 1 . . . . .     5.2 0.0     5.7 1 1 
         47 1 . . . . .     4.7 0.0     5.2 1 1 
         48 1 . . . . .     4.0 0.0     4.5 1 1 
         49 1 . . . . .     5.4 0.0     6.0 1 1 
         50 1 . . . . .     4.1 0.0     4.6 1 1 
         51 1 . . . . .   4.368 0.0   4.928 1 1 
         52 1 . . . . .    6.24 0.0    6.84 1 1 
         53 1 . . . . .   4.928 0.0   5.488 1 1 
         54 1 . . . . .   4.928 0.0   5.488 1 1 
         55 1 . . . . . 5.77024 0.0 6.39744 1 1 
         56 1 . . . . . 5.51936 0.0 6.14656 1 1 
         57 1 . . . . .   5.152 0.0   5.712 1 1 
         58 1 . . . . .    5.67 0.0   6.345 1 1 
         59 1 . . . . .  6.9552 0.0  7.7112 1 1 
         60 1 . . . . .  7.4088 0.0  8.1648 1 1 
         61 1 . . . . .  6.3504 0.0  7.1064 1 1 
         62 1 . . . . .    8.91 0.0    9.72 1 1 
         63 1 . . . . .   7.938 0.0   8.748 1 1 
         64 1 . . . . .  6.6528 0.0  7.4088 1 1 
         65 1 . . . . .     4.7 0.0     5.2 1 1 
         66 1 . . . . .   5.376 0.0   5.936 1 1 
         67 1 . . . . .     5.2 0.0     5.7 1 1 
         68 1 . . . . .     4.9 0.0     5.4 1 1 
         69 1 . . . . .   5.712 0.0   6.272 1 1 
         70 1 . . . . .     5.3 0.0     5.8 1 1 
         71 1 . . . . .     4.8 0.0     5.3 1 1 
         72 1 . . . . .    5.04 0.0     5.6 1 1 
         73 1 . . . . .     4.3 0.0     4.8 1 1 
         74 1 . . . . .    5.67 0.0   6.345 1 1 
         75 1 . . . . .     4.6 0.0     5.1 1 1 
         76 1 . . . . .   4.256 0.0   4.816 1 1 
         77 1 . . . . .   5.376 0.0   5.936 1 1 
         78 1 . . . . .     3.2 0.0     3.7 1 1 
         79 1 . . . . .     5.0 0.0     5.5 1 1 
         80 1 . . . . .   5.712 0.0   6.272 1 1 
         81 1 . . . . .     4.0 0.0     4.5 1 1 
         82 1 . . . . .    6.36 0.0    6.96 1 1 
         83 1 . . . . .   5.376 0.0   5.936 1 1 
         84 1 . . . . .     6.6 0.0     7.2 1 1 
         85 1 . . . . .     4.2 0.0     4.7 1 1 
         86 1 . . . . .     5.0 0.0     5.5 1 1 
         87 1 . . . . .   6.075 0.0    6.75 1 1 
         88 1 . . . . .   4.368 0.0   4.928 1 1 
         89 1 . . . . .  6.4512 0.0  7.1232 1 1 
         90 1 . . . . .  6.8544 0.0  7.5264 1 1 
         91 1 . . . . . 6.39744 0.0 7.02464 1 1 
         92 1 . . . . .  5.2416 0.0  5.9136 1 1 
         93 1 . . . . .   6.272 0.0  6.8992 1 1 
         94 1 . . . . .    4.48 0.0    5.04 1 1 
         95 1 . . . . .   5.488 0.0   6.048 1 1 
         96 1 . . . . .  5.4432 0.0  6.1992 1 1 
         97 1 . . . . .   5.488 0.0   6.048 1 1 
         98 1 . . . . .    4.48 0.0    5.04 1 1 
         99 1 . . . . .   5.376 0.0   6.048 1 1 
        100 1 . . . . . 5.14304 0.0 5.77024 1 1 
        101 1 . . . . .   5.712 0.0   6.272 1 1 
        102 1 . . . . .   4.816 0.0   5.376 1 1 
        103 1 . . . . .   4.704 0.0   5.376 1 1 
        104 1 . . . . . 6.64832 0.0 7.27552 1 1 
        105 1 . . . . . 6.52288 0.0 7.15008 1 1 
        106 1 . . . . . 5.14304 0.0 5.77024 1 1 
        107 1 . . . . .    5.04 0.0     5.6 1 1 
        108 1 . . . . .     5.6 0.0    6.16 1 1 
        109 1 . . . . . 5.89568 0.0 6.52288 1 1 
        110 1 . . . . .   5.264 0.0   5.824 1 1 
        111 1 . . . . .     5.2 0.0     5.7 1 1 
        112 1 . . . . .    4.68 0.0    5.28 1 1 
        113 1 . . . . .     3.7 0.0     4.2 1 1 
        114 1 . . . . .    5.28 0.0    5.88 1 1 
        115 1 . . . . .     4.6 0.0     5.1 1 1 
        116 1 . . . . .   5.805 0.0    6.48 1 1 
        117 1 . . . . .     3.3 0.0     3.8 1 1 
        118 1 . . . . .     4.9 0.0     5.4 1 1 
        119 1 . . . . .     4.7 0.0     5.2 1 1 
        120 1 . . . . .   6.615 0.0    7.29 1 1 
        121 1 . . . . .    6.36 0.0    6.96 1 1 
        122 1 . . . . .     4.6 0.0     5.1 1 1 
        123 1 . . . . .    5.13 0.0   5.805 1 1 
        124 1 . . . . .     3.9 0.0     4.4 1 1 
        125 1 . . . . .     4.8 0.0     5.3 1 1 
        126 1 . . . . .   4.032 0.0   4.592 1 1 
        127 1 . . . . .   4.368 0.0   4.928 1 1 
        128 1 . . . . .   5.376 0.0   5.936 1 1 
        129 1 . . . . .  4.3008 0.0  4.9728 1 1 
        130 1 . . . . .   5.936 0.0   6.496 1 1 
        131 1 . . . . .   5.264 0.0   5.824 1 1 
        132 1 . . . . . 5.39392 0.0 6.02112 1 1 
        133 1 . . . . .   4.928 0.0   5.488 1 1 
        134 1 . . . . .  7.8624 0.0  8.6184 1 1 
        135 1 . . . . .  5.6448 0.0  6.3168 1 1 
        136 1 . . . . .     5.6 0.0    6.16 1 1 
        137 1 . . . . .   4.592 0.0   5.152 1 1 
        138 1 . . . . .    6.16 0.0    6.72 1 1 
        139 1 . . . . .  8.0136 0.0  8.7696 1 1 
        140 1 . . . . .   5.488 0.0   6.048 1 1 
        141 1 . . . . . 5.14304 0.0 5.77024 1 1 
        142 1 . . . . .    6.16 0.0    6.72 1 1 
        143 1 . . . . .    5.04 0.0     5.6 1 1 
        144 1 . . . . .   5.712 0.0   6.272 1 1 
        145 1 . . . . .  8.0136 0.0  8.7696 1 1 
        146 1 . . . . .     5.6 0.0    6.16 1 1 
        147 1 . . . . . 5.26848 0.0 5.89568 1 1 
        148 1 . . . . . 6.52288 0.0 7.15008 1 1 
        149 1 . . . . .  5.5104 0.0  6.1824 1 1 
        150 1 . . . . .   5.824 0.0   6.384 1 1 
        151 1 . . . . .   5.488 0.0   6.048 1 1 
        152 1 . . . . .   5.936 0.0   6.496 1 1 
        153 1 . . . . .    6.16 0.0    6.72 1 1 
        154 1 . . . . . 5.77024 0.0 6.39744 1 1 
        155 1 . . . . .     4.8 0.0     5.3 1 1 
        156 1 . . . . .    5.88 0.0    6.48 1 1 
        157 1 . . . . .     5.5 0.0     6.0 1 1 
        158 1 . . . . .    4.86 0.0   5.535 1 1 
        159 1 . . . . .     4.9 0.0     5.4 1 1 
        160 1 . . . . .     4.8 0.0     5.3 1 1 
        161 1 . . . . .   5.264 0.0   5.824 1 1 
        162 1 . . . . .     5.3 0.0     5.8 1 1 
        163 1 . . . . .   7.155 0.0    7.83 1 1 
        164 1 . . . . .     3.1 0.0     3.6 1 1 
        165 1 . . . . .     4.5 0.0     5.0 1 1 
        166 1 . . . . .   5.264 0.0   5.824 1 1 
        167 1 . . . . .   6.885 0.0    7.56 1 1 
        168 1 . . . . .     4.6 0.0     5.1 1 1 
        169 1 . . . . .     4.6 0.0     5.1 1 1 
        170 1 . . . . .     3.7 0.0     4.2 1 1 
        171 1 . . . . .    5.04 0.0     5.6 1 1 
        172 1 . . . . .   4.592 0.0   5.152 1 1 
        173 1 . . . . .     4.3 0.0     4.8 1 1 
        174 1 . . . . .     5.4 0.0     5.9 1 1 
        175 1 . . . . .    7.29 0.0   7.965 1 1 
        176 1 . . . . .     4.3 0.0     4.8 1 1 
        177 1 . . . . .     4.5 0.0     5.0 1 1 
        178 1 . . . . .     4.6 0.0     5.1 1 1 
        179 1 . . . . .   4.725 0.0     5.4 1 1 
        180 1 . . . . .    4.32 0.0   4.995 1 1 
        181 1 . . . . .    5.94 0.0   6.615 1 1 
        182 1 . . . . .  7.2576 0.0  8.0136 1 1 
        183 1 . . . . .   7.425 0.0     8.1 1 1 
        184 1 . . . . . 6.01425 0.0  6.9255 1 1 
        185 1 . . . . .    5.94 0.0   6.615 1 1 
        186 1 . . . . .    5.67 0.0   6.345 1 1 
        187 1 . . . . .     5.4 0.0   6.075 1 1 
        188 1 . . . . .  5.1408 0.0  5.8968 1 1 
        189 1 . . . . .   7.425 0.0     8.1 1 1 
        190 1 . . . . .    6.75 0.0   7.425 1 1 
        191 1 . . . . .  6.9552 0.0  7.7112 1 1 
        192 1 . . . . .  7.2576 0.0  8.0136 1 1 
        193 1 . . . . .   6.345 0.0    7.02 1 1 
        194 1 . . . . .   6.804 0.0    7.56 1 1 
        195 1 . . . . .   5.535 0.0    6.21 1 1 
        196 1 . . . . .    4.86 0.0   5.535 1 1 
        197 1 . . . . .  6.5016 0.0  7.2576 1 1 
        198 1 . . . . .    7.56 0.0   8.316 1 1 
        199 1 . . . . .   6.075 0.0    6.75 1 1 
        200 1 . . . . .   6.885 0.0    7.56 1 1 
        201 1 . . . . .   7.425 0.0     8.1 1 1 
        202 1 . . . . .   6.561 0.0 7.47225 1 1 
        203 1 . . . . .    6.21 0.0   6.885 1 1 
        204 1 . . . . . 6.37875 0.0    7.29 1 1 
        205 1 . . . . .     4.6 0.0     5.1 1 1 
        206 1 . . . . .    6.16 0.0    6.72 1 1 
        207 1 . . . . .     4.9 0.0     5.4 1 1 
        208 1 . . . . .   5.535 0.0    6.21 1 1 
        209 1 . . . . .     5.5 0.0     6.0 1 1 
        210 1 . . . . .     4.0 0.0     4.5 1 1 
        211 1 . . . . .   5.712 0.0   6.272 1 1 
        212 1 . . . . .     5.4 0.0     5.9 1 1 
        213 1 . . . . .     3.9 0.0     4.4 1 1 
        214 1 . . . . .   5.264 0.0   5.824 1 1 
        215 1 . . . . .     5.1 0.0     5.6 1 1 
        216 1 . . . . .    5.94 0.0   6.615 1 1 
        217 1 . . . . .     3.1 0.0     3.6 1 1 
        218 1 . . . . .     5.0 0.0     5.5 1 1 
        219 1 . . . . .   4.928 0.0   5.488 1 1 
        220 1 . . . . .    6.21 0.0   6.885 1 1 
        221 1 . . . . .   5.712 0.0   6.272 1 1 
        222 1 . . . . .    4.86 0.0   5.535 1 1 
        223 1 . . . . .   4.368 0.0   4.928 1 1 
        224 1 . . . . .    6.16 0.0    6.72 1 1 
        225 1 . . . . .   5.376 0.0   5.936 1 1 
        226 1 . . . . .   4.592 0.0   5.152 1 1 
        227 1 . . . . .   5.936 0.0   6.496 1 1 
        228 1 . . . . .   5.376 0.0   5.936 1 1 
        229 1 . . . . .   4.592 0.0   5.152 1 1 
        230 1 . . . . .     5.2 0.0     5.7 1 1 
        231 1 . . . . .     5.0 0.0     5.5 1 1 
        232 1 . . . . .   7.425 0.0     8.1 1 1 
        233 1 . . . . .     5.4 0.0     5.9 1 1 
        234 1 . . . . .    6.16 0.0    6.72 1 1 
        235 1 . . . . .   5.535 0.0    6.21 1 1 
        236 1 . . . . .     4.9 0.0     5.4 1 1 
        237 1 . . . . .    3.92 0.0    4.48 1 1 
        238 1 . . . . .   5.152 0.0   5.712 1 1 
        239 1 . . . . .     3.1 0.0     3.6 1 1 
        240 1 . . . . .     4.4 0.0     4.9 1 1 
        241 1 . . . . .    4.92 0.0    5.52 1 1 
        242 1 . . . . .     4.2 0.0     4.7 1 1 
        243 1 . . . . .   5.712 0.0   6.272 1 1 
        244 1 . . . . .   5.805 0.0    6.48 1 1 
        245 1 . . . . .     4.7 0.0     5.2 1 1 
        246 1 . . . . .   5.824 0.0   6.384 1 1 
        247 1 . . . . .   6.885 0.0    7.56 1 1 
        248 1 . . . . .   4.816 0.0   5.376 1 1 
        249 1 . . . . .   4.928 0.0   5.488 1 1 
        250 1 . . . . .   7.392 0.0   8.064 1 1 
        251 1 . . . . .   4.816 0.0   5.376 1 1 
        252 1 . . . . . 5.77024 0.0 6.39744 1 1 
        253 1 . . . . .  6.1992 0.0  6.9552 1 1 
        254 1 . . . . .    5.04 0.0     5.6 1 1 
        255 1 . . . . .  6.5016 0.0  7.2576 1 1 
        256 1 . . . . .    6.16 0.0    6.72 1 1 
        257 1 . . . . . 5.89568 0.0 6.52288 1 1 
        258 1 . . . . .  5.8968 0.0  6.6528 1 1 
        259 1 . . . . .   4.032 0.0   4.592 1 1 
        260 1 . . . . .   6.272 0.0  6.8992 1 1 
        261 1 . . . . .  5.5944 0.0  6.3504 1 1 
        262 1 . . . . .   5.824 0.0   6.384 1 1 
        263 1 . . . . .    4.48 0.0    5.04 1 1 
        264 1 . . . . .     4.5 0.0     5.0 1 1 
        265 1 . . . . .     4.9 0.0     5.4 1 1 
        266 1 . . . . .     4.9 0.0     5.4 1 1 
        267 1 . . . . .     5.2 0.0     5.7 1 1 
        268 1 . . . . .     4.9 0.0     5.4 1 1 
        269 1 . . . . .   4.592 0.0   5.152 1 1 
        270 1 . . . . .     6.6 0.0     7.2 1 1 
        271 1 . . . . .    5.28 0.0    5.88 1 1 
        272 1 . . . . .   5.328 0.0   6.048 1 1 
        273 1 . . . . .    6.36 0.0    6.96 1 1 
        274 1 . . . . .     4.2 0.0     4.8 1 1 
        275 1 . . . . .  5.7792 0.0  6.4512 1 1 
        276 1 . . . . .    4.68 0.0    5.28 1 1 
        277 1 . . . . .    5.28 0.0    5.88 1 1 
        278 1 . . . . .     4.2 0.0     4.8 1 1 
        279 1 . . . . .     6.0 0.0     6.6 1 1 
        280 1 . . . . .  5.5104 0.0  6.1824 1 1 
        281 1 . . . . .    5.64 0.0    6.24 1 1 
        282 1 . . . . .  5.6448 0.0  6.3168 1 1 
        283 1 . . . . .  4.4352 0.0  5.1072 1 1 
        284 1 . . . . .   5.488 0.0   6.048 1 1 
        285 1 . . . . .     4.2 0.0     4.7 1 1 
        286 1 . . . . .   5.936 0.0   6.496 1 1 
        287 1 . . . . .   3.584 0.0   4.144 1 1 
        288 1 . . . . .   4.704 0.0   5.264 1 1 
        289 1 . . . . .   3.808 0.0   4.368 1 1 
        290 1 . . . . .  5.6448 0.0   6.272 1 1 
        291 1 . . . . .    6.16 0.0    6.72 1 1 
        292 1 . . . . .     5.2 0.0     5.7 1 1 
        293 1 . . . . .   6.048 0.0   6.608 1 1 
        294 1 . . . . .     5.4 0.0     5.9 1 1 
        295 1 . . . . .     5.0 0.0     5.5 1 1 
        296 1 . . . . .     4.7 0.0     5.2 1 1 
        297 1 . . . . .   4.816 0.0   5.376 1 1 
        298 1 . . . . .    4.48 0.0    5.04 1 1 
        299 1 . . . . .    5.04 0.0     5.6 1 1 
        300 1 . . . . .    4.48 0.0    5.04 1 1 
        301 1 . . . . . 6.02112 0.0 6.64832 1 1 
        302 1 . . . . . 5.26848 0.0 5.89568 1 1 
        303 1 . . . . .   5.264 0.0   5.824 1 1 
        304 1 . . . . .   4.704 0.0   5.264 1 1 
        305 1 . . . . .   4.592 0.0   5.152 1 1 
        306 1 . . . . .  5.6448 0.0   6.272 1 1 
        307 1 . . . . . 6.52288 0.0 7.15008 1 1 
        308 1 . . . . .     3.9 0.0     4.4 1 1 
        309 1 . . . . .    5.64 0.0    6.24 1 1 
        310 1 . . . . .    3.92 0.0    4.48 1 1 
        311 1 . . . . .    5.04 0.0     5.6 1 1 
        312 1 . . . . .    6.16 0.0    6.72 1 1 
        313 1 . . . . .    6.16 0.0    6.72 1 1 
        314 1 . . . . .     4.6 0.0     5.1 1 1 
        315 1 . . . . .     5.5 0.0     6.0 1 1 
        316 1 . . . . .     3.0 0.0     3.5 1 1 
        317 1 . . . . .    5.64 0.0    6.24 1 1 
        318 1 . . . . .     5.5 0.0     6.0 1 1 
        319 1 . . . . .    4.08 0.0    4.68 1 1 
        320 1 . . . . .    5.76 0.0    6.36 1 1 
        321 1 . . . . .   5.184 0.0   5.904 1 1 
        322 1 . . . . .   6.624 0.0   7.344 1 1 
        323 1 . . . . .     5.4 0.0     6.0 1 1 
        324 1 . . . . .  5.5104 0.0  6.1824 1 1 
        325 1 . . . . .    4.44 0.0    5.04 1 1 
        326 1 . . . . .    5.64 0.0    6.24 1 1 
        327 1 . . . . .     6.6 0.0     7.2 1 1 
        328 1 . . . . .   3.696 0.0   4.256 1 1 
        329 1 . . . . .   5.712 0.0   6.272 1 1 
        330 1 . . . . .     5.1 0.0     5.6 1 1 
        331 1 . . . . .     6.6 0.0     7.2 1 1 
        332 1 . . . . .     4.9 0.0     5.4 1 1 
        333 1 . . . . .     4.9 0.0     5.4 1 1 
        334 1 . . . . .     3.2 0.0     3.7 1 1 
        335 1 . . . . .   5.376 0.0   5.936 1 1 
        336 1 . . . . .     3.4 0.0     3.9 1 1 
        337 1 . . . . .   4.704 0.0   5.264 1 1 
        338 1 . . . . .     3.7 0.0     4.2 1 1 
        339 1 . . . . .    5.76 0.0    6.36 1 1 
        340 1 . . . . .    5.04 0.0     5.6 1 1 
        341 1 . . . . .   3.584 0.0   4.144 1 1 
        342 1 . . . . . 6.02112 0.0 6.64832 1 1 
        343 1 . . . . . 5.77024 0.0 6.39744 1 1 
        344 1 . . . . .    4.48 0.0    5.04 1 1 
        345 1 . . . . . 5.77024 0.0 6.39744 1 1 
        346 1 . . . . .    6.16 0.0    6.72 1 1 
        347 1 . . . . .  6.8544 0.0  7.5264 1 1 
        348 1 . . . . . 5.89568 0.0 6.52288 1 1 
        349 1 . . . . .     5.1 0.0     5.6 1 1 
        350 1 . . . . .     5.0 0.0     5.5 1 1 
        351 1 . . . . .     3.9 0.0     4.4 1 1 
        352 1 . . . . .   5.376 0.0   5.936 1 1 
        353 1 . . . . .     4.2 0.0     4.7 1 1 
        354 1 . . . . .   4.928 0.0   5.488 1 1 
        355 1 . . . . .     4.3 0.0     4.8 1 1 
        356 1 . . . . .     5.4 0.0     6.0 1 1 
        357 1 . . . . .   5.152 0.0   5.712 1 1 
        358 1 . . . . .     3.3 0.0     3.8 1 1 
        359 1 . . . . .   5.488 0.0   6.048 1 1 
        360 1 . . . . .   4.928 0.0   5.488 1 1 
        361 1 . . . . .     4.8 0.0     5.3 1 1 
        362 1 . . . . .     5.2 0.0     5.7 1 1 
        363 1 . . . . .     4.2 0.0     4.8 1 1 
        364 1 . . . . .   5.152 0.0   5.712 1 1 
        365 1 . . . . .    6.48 0.0    7.08 1 1 
        366 1 . . . . .     3.9 0.0     4.4 1 1 
        367 1 . . . . .   5.712 0.0   6.272 1 1 
        368 1 . . . . .     4.9 0.0     5.4 1 1 
        369 1 . . . . .   5.488 0.0   6.048 1 1 
        370 1 . . . . .   5.712 0.0   6.272 1 1 
        371 1 . . . . .   4.592 0.0   5.152 1 1 
        372 1 . . . . .    4.48 0.0    5.04 1 1 
        373 1 . . . . .   4.368 0.0   4.928 1 1 
        374 1 . . . . .    4.48 0.0    5.04 1 1 
        375 1 . . . . . 5.51936 0.0 6.14656 1 1 
        376 1 . . . . .   5.376 0.0   5.936 1 1 
        377 1 . . . . .   5.488 0.0   6.048 1 1 
        378 1 . . . . .  6.8992 0.0  7.5264 1 1 
        379 1 . . . . .  5.5104 0.0  6.1824 1 1 
        380 1 . . . . . 6.02112 0.0 6.64832 1 1 
        381 1 . . . . .  6.9888 0.0  7.6608 1 1 
        382 1 . . . . .   5.152 0.0   5.712 1 1 
        383 1 . . . . .   4.592 0.0   5.152 1 1 
        384 1 . . . . .   4.704 0.0   5.264 1 1 
        385 1 . . . . .   4.816 0.0   5.376 1 1 
        386 1 . . . . .   4.144 0.0   4.704 1 1 
        387 1 . . . . .     3.9 0.0     4.4 1 1 
        388 1 . . . . .     5.4 0.0     5.9 1 1 
        389 1 . . . . .    4.92 0.0    5.52 1 1 
        390 1 . . . . .     5.5 0.0     6.0 1 1 
        391 1 . . . . .     4.2 0.0     4.7 1 1 
        392 1 . . . . .    6.16 0.0    6.72 1 1 
        393 1 . . . . .   3.472 0.0   4.032 1 1 
        394 1 . . . . .    5.04 0.0     5.6 1 1 
        395 1 . . . . .     4.7 0.0     5.2 1 1 
        396 1 . . . . .     5.2 0.0     5.7 1 1 
        397 1 . . . . .     4.5 0.0     5.0 1 1 
        398 1 . . . . .     4.2 0.0     4.7 1 1 
        399 1 . . . . .    5.04 0.0     5.6 1 1 
        400 1 . . . . .   5.824 0.0   6.384 1 1 
        401 1 . . . . .   5.264 0.0   5.824 1 1 
        402 1 . . . . . 5.26848 0.0 5.89568 1 1 
        403 1 . . . . .   6.048 0.0   6.608 1 1 
        404 1 . . . . . 5.51936 0.0 6.14656 1 1 
        405 1 . . . . .     5.6 0.0    6.16 1 1 
        406 1 . . . . .   5.712 0.0   6.272 1 1 
        407 1 . . . . .     5.6 0.0    6.16 1 1 
        408 1 . . . . .   6.272 0.0  6.8992 1 1 
        409 1 . . . . .   5.264 0.0   5.824 1 1 
        410 1 . . . . .   5.488 0.0   6.048 1 1 
        411 1 . . . . .     5.6 0.0    6.16 1 1 
        412 1 . . . . .   5.264 0.0   5.824 1 1 
        413 1 . . . . .    6.16 0.0    6.72 1 1 
        414 1 . . . . .   5.264 0.0   5.824 1 1 
        415 1 . . . . .    6.16 0.0    6.72 1 1 
        416 1 . . . . .  5.6448 0.0   6.272 1 1 
        417 1 . . . . .   5.824 0.0   6.384 1 1 
        418 1 . . . . .   4.592 0.0   5.152 1 1 
        419 1 . . . . .     3.4 0.0     3.9 1 1 
        420 1 . . . . .   6.048 0.0   6.608 1 1 
        421 1 . . . . .     4.8 0.0     5.3 1 1 
        422 1 . . . . .   5.824 0.0   6.384 1 1 
        423 1 . . . . .   4.592 0.0   5.152 1 1 
        424 1 . . . . .   5.488 0.0   6.048 1 1 
        425 1 . . . . .   4.256 0.0   4.816 1 1 
        426 1 . . . . .     5.6 0.0    6.16 1 1 
        427 1 . . . . .     5.6 0.0    6.16 1 1 
        428 1 . . . . .   5.936 0.0   6.496 1 1 
        429 1 . . . . .    7.02 0.0   7.695 1 1 
        430 1 . . . . .   4.256 0.0   4.816 1 1 
        431 1 . . . . . 5.89568 0.0 6.52288 1 1 
        432 1 . . . . . 5.26848 0.0 5.89568 1 1 
        433 1 . . . . . 5.14304 0.0 5.77024 1 1 
        434 1 . . . . .   5.376 0.0   5.936 1 1 
        435 1 . . . . . 5.51936 0.0 6.14656 1 1 
        436 1 . . . . .   6.804 0.0    7.56 1 1 
        437 1 . . . . .    6.16 0.0    6.72 1 1 
        438 1 . . . . .    5.04 0.0     5.6 1 1 
        439 1 . . . . .  6.5016 0.0  7.2576 1 1 
        440 1 . . . . .    6.16 0.0    6.72 1 1 
        441 1 . . . . .   5.824 0.0   6.384 1 1 
        442 1 . . . . .   4.928 0.0   5.488 1 1 
        443 1 . . . . . 4.13952 0.0 4.76672 1 1 
        444 1 . . . . . 5.51936 0.0 6.14656 1 1 
        445 1 . . . . .   5.488 0.0   6.048 1 1 
        446 1 . . . . .   4.256 0.0   4.816 1 1 
        447 1 . . . . .   5.824 0.0   6.384 1 1 
        448 1 . . . . .  5.7456 0.0  6.5016 1 1 
        449 1 . . . . .    4.48 0.0    5.04 1 1 
        450 1 . . . . .   4.816 0.0   5.376 1 1 
        451 1 . . . . . 5.77024 0.0 6.39744 1 1 
        452 1 . . . . . 5.89568 0.0 6.52288 1 1 
        453 1 . . . . . 5.39392 0.0 6.02112 1 1 
        454 1 . . . . .   6.048 0.0   6.608 1 1 
        455 1 . . . . .  6.5016 0.0  7.2576 1 1 
        456 1 . . . . .     4.9 0.0     5.4 1 1 
        457 1 . . . . .     5.2 0.0     5.7 1 1 
        458 1 . . . . .    6.16 0.0    6.72 1 1 
        459 1 . . . . .    5.04 0.0     5.6 1 1 
        460 1 . . . . .   5.936 0.0   6.496 1 1 
        461 1 . . . . .   4.928 0.0   5.488 1 1 
        462 1 . . . . .   6.272 0.0  6.8992 1 1 
        463 1 . . . . .     2.9 0.0     3.4 1 1 
        464 1 . . . . .     3.7 0.0     4.2 1 1 
        465 1 . . . . .   5.712 0.0   6.272 1 1 
        466 1 . . . . .    5.04 0.0     5.6 1 1 
        467 1 . . . . .    3.92 0.0    4.48 1 1 
        468 1 . . . . .     4.5 0.0     5.0 1 1 
        469 1 . . . . .     3.0 0.0     3.5 1 1 
        470 1 . . . . .   3.808 0.0   4.368 1 1 
        471 1 . . . . .   5.488 0.0   6.048 1 1 
        472 1 . . . . . 6.02112 0.0 6.64832 1 1 
        473 1 . . . . .   4.032 0.0   4.592 1 1 
        474 1 . . . . .   4.704 0.0   5.264 1 1 
        475 1 . . . . .   3.136 0.0   3.696 1 1 
        476 1 . . . . .     4.8 0.0     5.3 1 1 
        477 1 . . . . .     4.9 0.0     5.4 1 1 
        478 1 . . . . .     3.1 0.0     3.6 1 1 
        479 1 . . . . .     4.9 0.0     5.4 1 1 
        480 1 . . . . .   5.264 0.0   5.824 1 1 
        481 1 . . . . .   3.696 0.0   4.256 1 1 
        482 1 . . . . .   5.264 0.0   5.824 1 1 
        483 1 . . . . . 6.14656 0.0 6.77376 1 1 
        484 1 . . . . .   5.152 0.0   5.712 1 1 
        485 1 . . . . .  6.5856 0.0  7.2576 1 1 
        486 1 . . . . .  6.3168 0.0  6.9888 1 1 
        487 1 . . . . .   6.048 0.0   6.608 1 1 
        488 1 . . . . . 4.89216 0.0 5.51936 1 1 
        489 1 . . . . .     3.9 0.0     4.4 1 1 
        490 1 . . . . .    5.04 0.0    5.64 1 1 
        491 1 . . . . .   4.592 0.0   5.152 1 1 
        492 1 . . . . .     5.6 0.0    6.16 1 1 
        493 1 . . . . .   4.816 0.0   5.376 1 1 
        494 1 . . . . .     4.7 0.0     5.2 1 1 
        495 1 . . . . .     5.5 0.0     6.0 1 1 
        496 1 . . . . .     5.4 0.0     6.0 1 1 
        497 1 . . . . .  5.5104 0.0  6.1824 1 1 
        498 1 . . . . .  6.9888 0.0  7.6608 1 1 
        499 1 . . . . .    5.88 0.0    6.48 1 1 
        500 1 . . . . .    6.36 0.0    6.96 1 1 
        501 1 . . . . .     6.0 0.0     6.6 1 1 
        502 1 . . . . .  5.2416 0.0  5.9136 1 1 
        503 1 . . . . .    5.88 0.0    6.48 1 1 
        504 1 . . . . .    5.28 0.0    5.88 1 1 
        505 1 . . . . .     5.4 0.0     6.0 1 1 
        506 1 . . . . .    4.92 0.0    5.52 1 1 
        507 1 . . . . .  7.1232 0.0  7.7952 1 1 
        508 1 . . . . .    5.04 0.0    5.64 1 1 
        509 1 . . . . .    6.12 0.0    6.72 1 1 
        510 1 . . . . .    5.76 0.0    6.36 1 1 
        511 1 . . . . .   6.048 0.0   6.608 1 1 
        512 1 . . . . .   5.712 0.0   6.272 1 1 
        513 1 . . . . .     5.6 0.0    6.16 1 1 
        514 1 . . . . .   5.824 0.0   6.384 1 1 
        515 1 . . . . .   5.264 0.0   5.824 1 1 
        516 1 . . . . .   7.392 0.0   8.064 1 1 
        517 1 . . . . .  5.7792 0.0  6.4512 1 1 
        518 1 . . . . .  6.4512 0.0  7.1232 1 1 
        519 1 . . . . .    6.72 0.0   7.392 1 1 
        520 1 . . . . .    6.12 0.0    6.72 1 1 
        521 1 . . . . .     6.6 0.0     7.2 1 1 
        522 1 . . . . .    4.68 0.0    5.28 1 1 
        523 1 . . . . .  4.9728 0.0  5.6448 1 1 
        524 1 . . . . .   5.376 0.0   6.048 1 1 
        525 1 . . . . .  6.9888 0.0  7.6608 1 1 
        526 1 . . . . .     6.6 0.0     7.2 1 1 
        527 1 . . . . .    5.88 0.0    6.48 1 1 
        528 1 . . . . .    6.12 0.0    6.72 1 1 
        529 1 . . . . .    4.44 0.0    5.04 1 1 
        530 1 . . . . .     6.6 0.0     7.2 1 1 
        531 1 . . . . .     3.0 0.0     3.5 1 1 
        532 1 . . . . .     4.8 0.0     5.3 1 1 
        533 1 . . . . .   4.256 0.0   4.816 1 1 
        534 1 . . . . .   4.592 0.0   5.152 1 1 
        535 1 . . . . .    6.16 0.0    6.72 1 1 
        536 1 . . . . . 5.51936 0.0 6.14656 1 1 
        537 1 . . . . .     5.6 0.0    6.16 1 1 
        538 1 . . . . .    5.04 0.0     5.6 1 1 
        539 1 . . . . .     5.0 0.0     5.5 1 1 
        540 1 . . . . .   5.824 0.0   6.384 1 1 
        541 1 . . . . .     3.1 0.0     3.6 1 1 
        542 1 . . . . .     4.6 0.0     5.1 1 1 
        543 1 . . . . .     5.6 0.0    6.16 1 1 
        544 1 . . . . .   5.264 0.0   5.824 1 1 
        545 1 . . . . .   4.704 0.0   5.264 1 1 
        546 1 . . . . .   5.488 0.0   6.048 1 1 
        547 1 . . . . .     3.5 0.0     4.0 1 1 
        548 1 . . . . .   5.152 0.0   5.712 1 1 
        549 1 . . . . .     4.4 0.0     4.9 1 1 
        550 1 . . . . .     4.8 0.0     5.3 1 1 
        551 1 . . . . .     3.0 0.0     3.5 1 1 
        552 1 . . . . .   5.264 0.0   5.824 1 1 
        553 1 . . . . .   4.144 0.0   4.704 1 1 
        554 1 . . . . .     4.4 0.0     4.9 1 1 
        555 1 . . . . .     5.2 0.0     5.7 1 1 
        556 1 . . . . .     3.1 0.0     3.6 1 1 
        557 1 . . . . .    5.04 0.0     5.6 1 1 
        558 1 . . . . .   5.264 0.0   5.824 1 1 
        559 1 . . . . . 5.51936 0.0 6.14656 1 1 
        560 1 . . . . . 5.89568 0.0 6.52288 1 1 
        561 1 . . . . .    4.86 0.0   5.535 1 1 
        562 1 . . . . .   7.155 0.0    7.83 1 1 
        563 1 . . . . .  8.1648 0.0  8.9208 1 1 
        564 1 . . . . .    6.75 0.0   7.425 1 1 
        565 1 . . . . .  5.8968 0.0  6.6528 1 1 
        566 1 . . . . .  6.5016 0.0  7.2576 1 1 
        567 1 . . . . .   6.804 0.0    7.56 1 1 
        568 1 . . . . .    6.21 0.0   6.885 1 1 
        569 1 . . . . . 5.64975 0.0   6.561 1 1 
        570 1 . . . . .   6.885 0.0    7.56 1 1 
        571 1 . . . . .  6.6528 0.0  7.4088 1 1 
        572 1 . . . . .  6.5016 0.0  7.2576 1 1 
        573 1 . . . . .  6.6528 0.0  7.4088 1 1 
        574 1 . . . . .    7.29 0.0 8.20125 1 1 
        575 1 . . . . .     5.0 0.0     5.5 1 1 
        576 1 . . . . .     4.8 0.0     5.3 1 1 
        577 1 . . . . .   5.376 0.0   5.936 1 1 
        578 1 . . . . .    6.16 0.0    6.72 1 1 
        579 1 . . . . .   4.704 0.0   5.264 1 1 
        580 1 . . . . .     4.9 0.0     5.4 1 1 
        581 1 . . . . .   5.152 0.0   5.712 1 1 
        582 1 . . . . .     5.2 0.0     5.7 1 1 
        583 1 . . . . .    6.75 0.0   7.425 1 1 
        584 1 . . . . .     3.4 0.0     3.9 1 1 
        585 1 . . . . .   5.152 0.0   5.712 1 1 
        586 1 . . . . .   5.264 0.0   5.824 1 1 
        587 1 . . . . .     5.2 0.0     5.7 1 1 
        588 1 . . . . .     4.2 0.0     4.7 1 1 
        589 1 . . . . .     4.1 0.0     4.6 1 1 
        590 1 . . . . .     4.8 0.0     5.3 1 1 
        591 1 . . . . .   5.488 0.0   6.048 1 1 
        592 1 . . . . .   4.704 0.0   5.264 1 1 
        593 1 . . . . .   5.712 0.0   6.272 1 1 
        594 1 . . . . .    6.16 0.0    6.72 1 1 
        595 1 . . . . . 6.02112 0.0 6.64832 1 1 
        596 1 . . . . .   5.264 0.0   5.824 1 1 
        597 1 . . . . .   5.936 0.0   6.496 1 1 
        598 1 . . . . .    5.04 0.0     5.6 1 1 
        599 1 . . . . .     5.0 0.0     5.5 1 1 
        600 1 . . . . .     4.9 0.0     5.4 1 1 
        601 1 . . . . .     4.7 0.0     5.2 1 1 
        602 1 . . . . .     5.5 0.0     6.0 1 1 
        603 1 . . . . .     4.2 0.0     4.7 1 1 
        604 1 . . . . .    4.68 0.0    5.28 1 1 
        605 1 . . . . .     3.3 0.0     3.8 1 1 
        606 1 . . . . .    4.44 0.0    5.04 1 1 
        607 1 . . . . .     4.5 0.0     5.0 1 1 
        608 1 . . . . .  3.6288 0.0  4.3008 1 1 
        609 1 . . . . .   4.704 0.0   5.264 1 1 
        610 1 . . . . .   4.928 0.0   5.488 1 1 
        611 1 . . . . . 6.02112 0.0 6.64832 1 1 
        612 1 . . . . .    4.56 0.0    5.16 1 1 
        613 1 . . . . .    6.24 0.0    6.84 1 1 
        614 1 . . . . .  7.2576 0.0  7.9296 1 1 
        615 1 . . . . .    4.44 0.0    5.04 1 1 
        616 1 . . . . .     6.6 0.0     7.2 1 1 
        617 1 . . . . .     6.0 0.0     6.6 1 1 
        618 1 . . . . .     4.2 0.0     4.8 1 1 
        619 1 . . . . .     3.6 0.0     4.2 1 1 
        620 1 . . . . .   4.176 0.0   4.896 1 1 
        621 1 . . . . .   6.048 0.0   6.768 1 1 
        622 1 . . . . .    5.52 0.0    6.12 1 1 
        623 1 . . . . .     6.6 0.0     7.2 1 1 
        624 1 . . . . .   4.536 0.0   5.346 1 1 
        625 1 . . . . .    4.86 0.0    5.67 1 1 
        626 1 . . . . .    5.04 0.0     5.6 1 1 
        627 1 . . . . .   4.928 0.0   5.488 1 1 
        628 1 . . . . . 5.26848 0.0 5.89568 1 1 
        629 1 . . . . . 6.39744 0.0 7.02464 1 1 
        630 1 . . . . .  7.2576 0.0  8.0136 1 1 
        631 1 . . . . .     4.9 0.0     5.4 1 1 
        632 1 . . . . .     3.2 0.0     3.7 1 1 
        633 1 . . . . .     4.3 0.0     4.8 1 1 
        634 1 . . . . .     4.7 0.0     5.2 1 1 
        635 1 . . . . .     5.0 0.0     5.5 1 1 
        636 1 . . . . .     3.9 0.0     4.4 1 1 
        637 1 . . . . .     4.8 0.0     5.3 1 1 
        638 1 . . . . .     4.3 0.0     4.8 1 1 
        639 1 . . . . .    5.04 0.0     5.6 1 1 
        640 1 . . . . .    4.08 0.0    4.68 1 1 
        641 1 . . . . .     6.6 0.0     7.2 1 1 
        642 1 . . . . .     7.2 0.0    7.92 1 1 
        643 1 . . . . .    5.76 0.0    6.48 1 1 
        644 1 . . . . .     4.8 0.0     5.4 1 1 
        645 1 . . . . .  4.5696 0.0  5.2416 1 1 
        646 1 . . . . .   7.392 0.0   8.064 1 1 
        647 1 . . . . .  6.3168 0.0  6.9888 1 1 
        648 1 . . . . .    4.32 0.0    4.92 1 1 
        649 1 . . . . .     5.4 0.0     6.0 1 1 
        650 1 . . . . .    4.56 0.0    5.16 1 1 
        651 1 . . . . .    6.36 0.0    6.96 1 1 
        652 1 . . . . .    6.24 0.0    6.84 1 1 
        653 1 . . . . .    4.68 0.0    5.28 1 1 
        654 1 . . . . .     6.6 0.0     7.2 1 1 
        655 1 . . . . .    4.92 0.0    5.52 1 1 
        656 1 . . . . .    4.68 0.0    5.28 1 1 
        657 1 . . . . .    5.28 0.0    5.88 1 1 
        658 1 . . . . .     3.8 0.0     4.3 1 1 
        659 1 . . . . .    5.28 0.0    5.88 1 1 
        660 1 . . . . .     4.2 0.0     4.8 1 1 
        661 1 . . . . .    5.88 0.0    6.48 1 1 
        662 1 . . . . .     4.5 0.0     5.0 1 1 
        663 1 . . . . .   5.824 0.0   6.384 1 1 
        664 1 . . . . .     3.9 0.0     4.4 1 1 
        665 1 . . . . .   5.152 0.0   5.712 1 1 
        666 1 . . . . .     5.0 0.0     5.5 1 1 
        667 1 . . . . .    6.16 0.0    6.72 1 1 
        668 1 . . . . .   5.376 0.0   5.936 1 1 
        669 1 . . . . .   3.584 0.0   4.144 1 1 
        670 1 . . . . .     3.3 0.0     3.8 1 1 
        671 1 . . . . .     4.9 0.0     5.4 1 1 
        672 1 . . . . .   5.376 0.0   5.936 1 1 
        673 1 . . . . .    3.36 0.0    3.96 1 1 
        674 1 . . . . .     4.4 0.0     4.9 1 1 
        675 1 . . . . .   6.885 0.0    7.56 1 1 
        676 1 . . . . .     4.8 0.0     5.3 1 1 
        677 1 . . . . .   5.712 0.0   6.272 1 1 
        678 1 . . . . .    6.16 0.0    6.72 1 1 
        679 1 . . . . .   4.256 0.0   4.816 1 1 
        680 1 . . . . .    6.24 0.0    6.84 1 1 
        681 1 . . . . .    6.48 0.0    7.08 1 1 
        682 1 . . . . .  6.8544 0.0  7.5264 1 1 
        683 1 . . . . .  4.4352 0.0  5.1072 1 1 
        684 1 . . . . .  5.7792 0.0  6.4512 1 1 
        685 1 . . . . .     5.4 0.0     6.0 1 1 
        686 1 . . . . .    5.28 0.0    5.88 1 1 
        687 1 . . . . .   5.832 0.0   6.642 1 1 
        688 1 . . . . .  6.1824 0.0  6.8544 1 1 
        689 1 . . . . .     5.4 0.0     6.0 1 1 
        690 1 . . . . .    5.16 0.0    5.76 1 1 
        691 1 . . . . .    5.04 0.0     5.6 1 1 
        692 1 . . . . .   5.824 0.0   6.384 1 1 
        693 1 . . . . .     4.2 0.0     4.8 1 1 
        694 1 . . . . .    4.56 0.0    5.16 1 1 
        695 1 . . . . .    6.48 0.0     7.2 1 1 
        696 1 . . . . .    5.52 0.0    6.12 1 1 
        697 1 . . . . .   5.346 0.0   6.156 1 1 
        698 1 . . . . .    5.88 0.0    6.48 1 1 
        699 1 . . . . .    4.92 0.0    5.52 1 1 
        700 1 . . . . .  5.1072 0.0  5.7792 1 1 
        701 1 . . . . .    5.88 0.0    6.48 1 1 
        702 1 . . . . .  4.8384 0.0  5.5104 1 1 
        703 1 . . . . .   7.776 0.0   8.586 1 1 
        704 1 . . . . .    5.28 0.0    5.88 1 1 
        705 1 . . . . .    4.44 0.0    5.04 1 1 
        706 1 . . . . .   4.704 0.0   5.264 1 1 
        707 1 . . . . .     5.1 0.0     5.6 1 1 
        708 1 . . . . .   6.885 0.0    7.56 1 1 
        709 1 . . . . .     4.8 0.0     5.3 1 1 
        710 1 . . . . .    3.84 0.0    4.44 1 1 
        711 1 . . . . .     3.2 0.0     3.7 1 1 
        712 1 . . . . .     5.1 0.0     5.6 1 1 
        713 1 . . . . .     5.4 0.0   6.075 1 1 
        714 1 . . . . .     3.7 0.0     4.2 1 1 
        715 1 . . . . .     5.6 0.0    6.16 1 1 
        716 1 . . . . .     5.0 0.0     5.5 1 1 
        717 1 . . . . .   5.376 0.0   5.936 1 1 
        718 1 . . . . .    4.32 0.0    4.92 1 1 
        719 1 . . . . .  4.3008 0.0  4.9728 1 1 
        720 1 . . . . .  5.6448 0.0  6.3168 1 1 
        721 1 . . . . .    4.32 0.0    4.92 1 1 
        722 1 . . . . .     4.2 0.0     4.8 1 1 
        723 1 . . . . .    5.64 0.0    6.24 1 1 
        724 1 . . . . .    3.84 0.0    4.44 1 1 
        725 1 . . . . .  4.5696 0.0  5.2416 1 1 
        726 1 . . . . .  4.5696 0.0  5.2416 1 1 
        727 1 . . . . .  6.4512 0.0  7.1232 1 1 
        728 1 . . . . .    4.92 0.0    5.52 1 1 
        729 1 . . . . .    6.12 0.0    6.72 1 1 
        730 1 . . . . . 6.52288 0.0 7.15008 1 1 
        731 1 . . . . .     3.9 0.0     4.4 1 1 
        732 1 . . . . .     4.8 0.0     5.3 1 1 
        733 1 . . . . .   5.488 0.0   6.048 1 1 
        734 1 . . . . .     3.7 0.0     4.2 1 1 
        735 1 . . . . .    5.67 0.0   6.345 1 1 
        736 1 . . . . .     3.8 0.0     4.3 1 1 
        737 1 . . . . .     2.8 0.0     3.3 1 1 
        738 1 . . . . .   5.712 0.0   6.272 1 1 
        739 1 . . . . .   5.152 0.0   5.712 1 1 
        740 1 . . . . .    4.48 0.0    5.04 1 1 
        741 1 . . . . .   7.155 0.0    7.83 1 1 
        742 1 . . . . .     4.0 0.0     4.5 1 1 
        743 1 . . . . .     5.6 0.0    6.16 1 1 
        744 1 . . . . .     5.3 0.0     5.8 1 1 
        745 1 . . . . .    4.86 0.0   5.535 1 1 
        746 1 . . . . .   6.885 0.0    7.56 1 1 
        747 1 . . . . .  7.1064 0.0  7.8624 1 1 
        748 1 . . . . .   6.804 0.0    7.56 1 1 
        749 1 . . . . .   6.885 0.0    7.56 1 1 
        750 1 . . . . .    5.13 0.0   5.805 1 1 
        751 1 . . . . .  6.6528 0.0  7.4088 1 1 
        752 1 . . . . .    6.48 0.0   7.155 1 1 
        753 1 . . . . .    5.94 0.0   6.615 1 1 
        754 1 . . . . .  6.1965 0.0 7.10775 1 1 
        755 1 . . . . .    5.13 0.0   5.805 1 1 
        756 1 . . . . .  6.5016 0.0  7.2576 1 1 
        757 1 . . . . .     5.4 0.0   6.075 1 1 
        758 1 . . . . .     5.4 0.0   6.075 1 1 
        759 1 . . . . .   3.472 0.0   4.032 1 1 
        760 1 . . . . .    4.48 0.0    5.04 1 1 
        761 1 . . . . .     4.9 0.0     5.4 1 1 
        762 1 . . . . .   5.824 0.0   6.384 1 1 
        763 1 . . . . .    6.16 0.0    6.72 1 1 
        764 1 . . . . .   5.376 0.0   5.936 1 1 
        765 1 . . . . .     2.8 0.0     3.3 1 1 
        766 1 . . . . .   5.152 0.0   5.712 1 1 
        767 1 . . . . .     3.3 0.0     3.8 1 1 
        768 1 . . . . .   5.264 0.0   5.824 1 1 
        769 1 . . . . .   4.368 0.0   4.928 1 1 
        770 1 . . . . .   5.488 0.0   6.048 1 1 
        771 1 . . . . .    4.48 0.0    5.04 1 1 
        772 1 . . . . .     4.4 0.0     4.9 1 1 
        773 1 . . . . .   6.075 0.0    6.75 1 1 
        774 1 . . . . .   4.032 0.0   4.592 1 1 
        775 1 . . . . .   5.712 0.0   6.272 1 1 
        776 1 . . . . . 5.89568 0.0 6.52288 1 1 
        777 1 . . . . . 5.39392 0.0 6.02112 1 1 
        778 1 . . . . . 5.51936 0.0 6.14656 1 1 
        779 1 . . . . . 5.51936 0.0 6.14656 1 1 
        780 1 . . . . . 5.51936 0.0 6.14656 1 1 
        781 1 . . . . . 6.52288 0.0 7.15008 1 1 
        782 1 . . . . .   3.472 0.0   4.032 1 1 
        783 1 . . . . .   4.816 0.0   5.376 1 1 
        784 1 . . . . .     5.5 0.0     6.0 1 1 
        785 1 . . . . .     4.9 0.0     5.4 1 1 
        786 1 . . . . .     4.2 0.0     4.7 1 1 
        787 1 . . . . .   5.264 0.0   5.824 1 1 
        788 1 . . . . .   5.488 0.0   6.048 1 1 
        789 1 . . . . .   5.936 0.0   6.496 1 1 
        790 1 . . . . .     4.1 0.0     4.6 1 1 
        791 1 . . . . .     5.4 0.0   6.075 1 1 
        792 1 . . . . .     4.3 0.0     4.8 1 1 
        793 1 . . . . .     5.6 0.0    6.16 1 1 
        794 1 . . . . .   2.912 0.0   3.472 1 1 
        795 1 . . . . .     4.8 0.0     5.4 1 1 
        796 1 . . . . .   4.455 0.0    5.13 1 1 
        797 1 . . . . . 5.14304 0.0 5.77024 1 1 
        798 1 . . . . .    5.04 0.0     5.6 1 1 
        799 1 . . . . . 6.02112 0.0 6.64832 1 1 
        800 1 . . . . .   4.144 0.0   4.704 1 1 
        801 1 . . . . .   4.928 0.0   5.488 1 1 
        802 1 . . . . . 6.14656 0.0 6.77376 1 1 
        803 1 . . . . .  5.6448 0.0   6.272 1 1 
        804 1 . . . . .    6.16 0.0    6.72 1 1 
        805 1 . . . . .   4.928 0.0   5.488 1 1 
        806 1 . . . . .   4.592 0.0   5.152 1 1 
        807 1 . . . . .     5.6 0.0    6.16 1 1 
        808 1 . . . . .   6.048 0.0   6.804 1 1 
        809 1 . . . . .     4.7 0.0     5.2 1 1 
        810 1 . . . . .   4.928 0.0   5.488 1 1 
        811 1 . . . . .    4.48 0.0    5.04 1 1 
        812 1 . . . . .  4.4352 0.0  5.1072 1 1 
        813 1 . . . . .  6.3504 0.0  7.1064 1 1 
        814 1 . . . . .   5.264 0.0   5.824 1 1 
        815 1 . . . . .     3.2 0.0     3.7 1 1 
        816 1 . . . . .    4.68 0.0    5.28 1 1 
        817 1 . . . . .    6.16 0.0    6.72 1 1 
        818 1 . . . . .   4.816 0.0   5.376 1 1 
        819 1 . . . . . 5.77024 0.0 6.39744 1 1 
        820 1 . . . . .    5.28 0.0    5.88 1 1 
        821 1 . . . . .   7.614 0.0   8.424 1 1 
        822 1 . . . . .     5.6 0.0    6.16 1 1 
        823 1 . . . . .     4.5 0.0     5.0 1 1 
        824 1 . . . . .   7.425 0.0     8.1 1 1 
        825 1 . . . . .     3.3 0.0     3.8 1 1 
        826 1 . . . . .     4.9 0.0     5.4 1 1 
        827 1 . . . . .   4.368 0.0   4.928 1 1 
        828 1 . . . . .     5.6 0.0    6.16 1 1 
        829 1 . . . . .  7.1064 0.0  7.8624 1 1 
        830 1 . . . . . 5.89568 0.0 6.52288 1 1 
        831 1 . . . . .  6.6528 0.0  7.4088 1 1 
        832 1 . . . . . 5.77024 0.0 6.39744 1 1 
        833 1 . . . . .   6.804 0.0    7.56 1 1 
        834 1 . . . . .     5.2 0.0     5.7 1 1 
        835 1 . . . . .     4.4 0.0     4.9 1 1 
        836 1 . . . . .    6.75 0.0   7.425 1 1 
        837 1 . . . . .     3.1 0.0     3.6 1 1 
        838 1 . . . . .   4.704 0.0   5.264 1 1 
        839 1 . . . . .   5.152 0.0   5.712 1 1 
        840 1 . . . . . 5.77024 0.0 6.39744 1 1 
        841 1 . . . . .     4.3 0.0     4.8 1 1 
        842 1 . . . . .   5.824 0.0   6.384 1 1 
        843 1 . . . . .   3.136 0.0   3.696 1 1 
        844 1 . . . . . 6.14656 0.0 6.77376 1 1 
        845 1 . . . . . 6.02112 0.0 6.64832 1 1 
        846 1 . . . . . 4.89216 0.0 5.51936 1 1 
        847 1 . . . . .  8.0136 0.0  8.7696 1 1 
        848 1 . . . . .   5.712 0.0   6.272 1 1 
        849 1 . . . . .   4.032 0.0   4.592 1 1 
        850 1 . . . . .     5.2 0.0     5.7 1 1 
        851 1 . . . . .   4.368 0.0   4.928 1 1 
        852 1 . . . . .     5.6 0.0    6.16 1 1 
        853 1 . . . . .    5.04 0.0     5.6 1 1 
        854 1 . . . . .    7.56 0.0   8.316 1 1 
        855 1 . . . . .   5.264 0.0   5.824 1 1 
        856 1 . . . . .     4.0 0.0     4.5 1 1 
        857 1 . . . . .    4.05 0.0   4.725 1 1 
        858 1 . . . . .   5.488 0.0   6.048 1 1 
        859 1 . . . . .    3.36 0.0    3.92 1 1 
        860 1 . . . . .    5.04 0.0     5.6 1 1 
        861 1 . . . . .    3.92 0.0    4.48 1 1 
        862 1 . . . . .   6.615 0.0    7.29 1 1 
        863 1 . . . . .  5.5944 0.0  6.3504 1 1 
        864 1 . . . . .  8.1648 0.0  8.9208 1 1 
        865 1 . . . . .   4.995 0.0    5.67 1 1 
        866 1 . . . . .   7.425 0.0     8.1 1 1 
        867 1 . . . . .     3.1 0.0     3.6 1 1 
        868 1 . . . . .   4.704 0.0   5.264 1 1 
        869 1 . . . . .   5.488 0.0   6.048 1 1 
        870 1 . . . . .   5.264 0.0   5.824 1 1 
        871 1 . . . . .   5.376 0.0   5.936 1 1 
        872 1 . . . . .     5.6 0.0    6.16 1 1 
        873 1 . . . . .   5.488 0.0   6.048 1 1 
        874 1 . . . . .    4.48 0.0    5.04 1 1 
        875 1 . . . . .   5.264 0.0   5.824 1 1 
        876 1 . . . . .     4.8 0.0     5.3 1 1 
        877 1 . . . . .     5.2 0.0     5.7 1 1 
        878 1 . . . . .   5.936 0.0   6.496 1 1 
        879 1 . . . . .     3.9 0.0     4.4 1 1 
        880 1 . . . . .     3.1 0.0     3.6 1 1 
        881 1 . . . . .     5.1 0.0     5.6 1 1 
        882 1 . . . . . 5.51936 0.0 6.14656 1 1 
        883 1 . . . . .     5.0 0.0     5.5 1 1 
        884 1 . . . . .     4.5 0.0     5.0 1 1 
        885 1 . . . . .     4.9 0.0     5.4 1 1 
        886 1 . . . . .   5.824 0.0   6.384 1 1 
        887 1 . . . . .     4.0 0.0     4.5 1 1 
        888 1 . . . . .     3.4 0.0     3.9 1 1 
        889 1 . . . . .   6.048 0.0   6.608 1 1 
        890 1 . . . . .   5.712 0.0   6.272 1 1 
        891 1 . . . . .    4.48 0.0    5.04 1 1 
        892 1 . . . . .     4.7 0.0     5.2 1 1 
        893 1 . . . . .     3.3 0.0     3.8 1 1 
        894 1 . . . . .   4.144 0.0   4.704 1 1 
        895 1 . . . . . 4.64128 0.0 5.26848 1 1 
        896 1 . . . . .     5.6 0.0    6.16 1 1 
        897 1 . . . . . 5.51936 0.0 6.14656 1 1 
        898 1 . . . . .  6.6528 0.0  7.4088 1 1 
        899 1 . . . . .   5.712 0.0   6.272 1 1 
        900 1 . . . . .  5.4432 0.0  6.1992 1 1 
        901 1 . . . . .     4.9 0.0     5.4 1 1 
        902 1 . . . . .   4.592 0.0   5.152 1 1 
        903 1 . . . . .     4.3 0.0     4.8 1 1 
        904 1 . . . . .     3.2 0.0     3.7 1 1 
        905 1 . . . . .     4.7 0.0     5.2 1 1 
        906 1 . . . . .   5.264 0.0   5.824 1 1 
        907 1 . . . . .   4.704 0.0   5.264 1 1 
        908 1 . . . . .   4.816 0.0   5.376 1 1 
        909 1 . . . . . 6.14656 0.0 6.77376 1 1 
        910 1 . . . . .   4.032 0.0   4.592 1 1 
        911 1 . . . . . 5.77024 0.0 6.39744 1 1 
        912 1 . . . . .   5.936 0.0   6.496 1 1 
        913 1 . . . . .     3.8 0.0     4.3 1 1 
        914 1 . . . . .     4.8 0.0     5.3 1 1 
        915 1 . . . . .   4.144 0.0   4.704 1 1 
        916 1 . . . . .     5.4 0.0     5.9 1 1 
        917 1 . . . . .   4.032 0.0   4.592 1 1 
        918 1 . . . . . 6.02112 0.0 6.64832 1 1 
        919 1 . . . . .   5.712 0.0   6.272 1 1 
        920 1 . . . . .   4.928 0.0   5.488 1 1 
        921 1 . . . . .   5.712 0.0   6.272 1 1 
        922 1 . . . . . 6.14656 0.0 6.77376 1 1 
        923 1 . . . . .     5.6 0.0    6.16 1 1 
        924 1 . . . . .  6.1992 0.0  6.9552 1 1 
        925 1 . . . . .    6.16 0.0    6.72 1 1 
        926 1 . . . . .   4.592 0.0   5.152 1 1 
        927 1 . . . . .   4.816 0.0   5.376 1 1 
        928 1 . . . . .   6.272 0.0  6.8992 1 1 
        929 1 . . . . . 6.64832 0.0 7.27552 1 1 
        930 1 . . . . . 5.89568 0.0 6.52288 1 1 
        931 1 . . . . . 6.39744 0.0 7.02464 1 1 
        932 1 . . . . .    4.48 0.0    5.04 1 1 
        933 1 . . . . .  5.4432 0.0  6.1992 1 1 
        934 1 . . . . .   5.152 0.0   5.712 1 1 
        935 1 . . . . .  5.5104 0.0  6.1824 1 1 
        936 1 . . . . .     5.1 0.0     5.6 1 1 
        937 1 . . . . .     5.1 0.0     5.6 1 1 
        938 1 . . . . .     5.6 0.0    6.16 1 1 
        939 1 . . . . .     3.9 0.0     4.4 1 1 
        940 1 . . . . .     5.4 0.0   6.075 1 1 
        941 1 . . . . .     4.7 0.0     5.2 1 1 
        942 1 . . . . .    5.28 0.0    5.88 1 1 
        943 1 . . . . .   3.584 0.0   4.144 1 1 
        944 1 . . . . .     3.5 0.0     4.0 1 1 
        945 1 . . . . .     5.0 0.0     5.5 1 1 
        946 1 . . . . .     5.0 0.0     5.5 1 1 
        947 1 . . . . .     4.6 0.0     5.1 1 1 
        948 1 . . . . .   5.376 0.0   5.936 1 1 
        949 1 . . . . .     3.5 0.0     4.0 1 1 
        950 1 . . . . .     4.9 0.0     5.4 1 1 
        951 1 . . . . .     5.1 0.0     5.6 1 1 
        952 1 . . . . .   6.345 0.0    7.02 1 1 
        953 1 . . . . .   4.256 0.0   4.816 1 1 
        954 1 . . . . .     3.4 0.0     3.9 1 1 
        955 1 . . . . .     4.9 0.0     5.4 1 1 
        956 1 . . . . .     4.2 0.0     4.7 1 1 
        957 1 . . . . .   4.928 0.0   5.488 1 1 
        958 1 . . . . .   5.376 0.0   5.936 1 1 
        959 1 . . . . .   5.376 0.0   5.936 1 1 
        960 1 . . . . .    4.48 0.0    5.04 1 1 
        961 1 . . . . .   4.256 0.0   4.816 1 1 
        962 1 . . . . .   6.272 0.0  6.8992 1 1 
        963 1 . . . . . 6.39744 0.0 7.02464 1 1 
        964 1 . . . . .     3.6 0.0     4.1 1 1 
        965 1 . . . . .     4.8 0.0     5.3 1 1 
        966 1 . . . . .     4.8 0.0     5.3 1 1 
        967 1 . . . . .   6.345 0.0    7.02 1 1 
        968 1 . . . . .     4.8 0.0     5.3 1 1 
        969 1 . . . . .     4.7 0.0     5.2 1 1 
        970 1 . . . . .     4.9 0.0     5.4 1 1 
        971 1 . . . . .    4.86 0.0   5.535 1 1 
        972 1 . . . . .   4.368 0.0   4.928 1 1 
        973 1 . . . . .   5.712 0.0   6.272 1 1 
        974 1 . . . . .   5.824 0.0   6.384 1 1 
        975 1 . . . . .  8.0136 0.0  8.7696 1 1 
        976 1 . . . . .   5.488 0.0   6.048 1 1 
        977 1 . . . . .  6.8992 0.0  7.5264 1 1 
        978 1 . . . . .   5.824 0.0   6.384 1 1 
        979 1 . . . . .   7.392 0.0   8.064 1 1 
        980 1 . . . . .   5.824 0.0   6.384 1 1 
        981 1 . . . . .    6.16 0.0    6.72 1 1 
        982 1 . . . . .   5.936 0.0   6.496 1 1 
        983 1 . . . . .  4.9728 0.0  5.6448 1 1 
        984 1 . . . . .    4.32 0.0    4.92 1 1 
        985 1 . . . . .     3.6 0.0     4.1 1 1 
        986 1 . . . . .     4.9 0.0     5.4 1 1 
        987 1 . . . . .     3.6 0.0     4.1 1 1 
        988 1 . . . . .     5.6 0.0    6.16 1 1 
        989 1 . . . . .     3.8 0.0     4.3 1 1 
        990 1 . . . . .     5.4 0.0     5.9 1 1 
        991 1 . . . . .     4.5 0.0     5.0 1 1 
        992 1 . . . . .   7.155 0.0    7.83 1 1 
        993 1 . . . . .     4.8 0.0     5.3 1 1 
        994 1 . . . . .    6.24 0.0    6.84 1 1 
        995 1 . . . . .   4.928 0.0   5.488 1 1 
        996 1 . . . . .   5.376 0.0   6.048 1 1 
        997 1 . . . . .     5.6 0.0    6.16 1 1 
        998 1 . . . . . 5.39392 0.0 6.02112 1 1 
        999 1 . . . . .   5.488 0.0   6.048 1 1 
       1000 1 . . . . .    4.56 0.0    5.16 1 1 
       1001 1 . . . . .    6.21 0.0   6.885 1 1 
       1002 1 . . . . .   7.155 0.0    7.83 1 1 
       1003 1 . . . . .     5.0 0.0     5.5 1 1 
       1004 1 . . . . .    4.56 0.0    5.16 1 1 
       1005 1 . . . . .    5.88 0.0    6.48 1 1 
       1006 1 . . . . .     5.3 0.0     5.8 1 1 
       1007 1 . . . . .    6.24 0.0    6.84 1 1 
       1008 1 . . . . .    5.04 0.0     5.6 1 1 
       1009 1 . . . . .     5.3 0.0     5.8 1 1 
       1010 1 . . . . .     4.5 0.0     5.0 1 1 
       1011 1 . . . . .    4.56 0.0    5.16 1 1 
       1012 1 . . . . .    5.28 0.0    5.88 1 1 
       1013 1 . . . . .     5.0 0.0     5.5 1 1 
       1014 1 . . . . .   6.075 0.0    6.75 1 1 
       1015 1 . . . . .     4.2 0.0     4.7 1 1 
       1016 1 . . . . .    4.44 0.0    5.04 1 1 
       1017 1 . . . . .     6.6 0.0     7.2 1 1 
       1018 1 . . . . .     4.3 0.0     4.8 1 1 
       1019 1 . . . . .    5.13 0.0   5.805 1 1 
       1020 1 . . . . .     5.5 0.0     6.0 1 1 
       1021 1 . . . . .     5.3 0.0     5.8 1 1 
       1022 1 . . . . .     5.4 0.0     6.0 1 1 
       1023 1 . . . . .     5.1 0.0     5.6 1 1 
       1024 1 . . . . .    4.56 0.0    5.16 1 1 
       1025 1 . . . . .     5.5 0.0     6.0 1 1 
       1026 1 . . . . .     4.4 0.0     4.9 1 1 
       1027 1 . . . . .    6.16 0.0    6.72 1 1 
       1028 1 . . . . .     4.0 0.0     4.5 1 1 
       1029 1 . . . . .     5.6 0.0    6.16 1 1 
       1030 1 . . . . .   4.368 0.0   4.928 1 1 
       1031 1 . . . . .     3.3 0.0     3.8 1 1 
       1032 1 . . . . .     5.4 0.0   6.075 1 1 
       1033 1 . . . . .   4.704 0.0   5.264 1 1 
       1034 1 . . . . .    5.04 0.0     5.6 1 1 
       1035 1 . . . . .     4.8 0.0     5.3 1 1 
       1036 1 . . . . .   7.155 0.0    7.83 1 1 
       1037 1 . . . . .     4.7 0.0     5.2 1 1 
       1038 1 . . . . .   5.264 0.0   5.824 1 1 
       1039 1 . . . . .   8.316 0.0   9.072 1 1 
       1040 1 . . . . .    6.16 0.0    6.72 1 1 
       1041 1 . . . . .     3.4 0.0     3.9 1 1 
       1042 1 . . . . .   3.915 0.0    4.59 1 1 
       1043 1 . . . . .     3.5 0.0     4.0 1 1 
       1044 1 . . . . .   5.488 0.0   6.048 1 1 
       1045 1 . . . . .     5.2 0.0     5.7 1 1 
       1046 1 . . . . .     4.0 0.0     4.5 1 1 
       1047 1 . . . . .     5.4 0.0     5.9 1 1 
       1048 1 . . . . .     5.5 0.0     6.0 1 1 
       1049 1 . . . . .   6.615 0.0    7.29 1 1 
       1050 1 . . . . .  7.7112 0.0  8.4672 1 1 
       1051 1 . . . . .   6.615 0.0    7.29 1 1 
       1052 1 . . . . .    5.67 0.0   6.345 1 1 
       1053 1 . . . . .     4.6 0.0     5.1 1 1 
       1054 1 . . . . .     4.5 0.0     5.0 1 1 
       1055 1 . . . . .     4.6 0.0     5.1 1 1 
       1056 1 . . . . .   5.936 0.0   6.496 1 1 
       1057 1 . . . . .   5.488 0.0   6.048 1 1 
       1058 1 . . . . .  6.8544 0.0  7.5264 1 1 
       1059 1 . . . . . 6.39744 0.0 7.02464 1 1 
       1060 1 . . . . .     5.3 0.0     5.8 1 1 
       1061 1 . . . . .     3.1 0.0     3.6 1 1 
       1062 1 . . . . .     4.8 0.0     5.3 1 1 
       1063 1 . . . . .     4.5 0.0     5.0 1 1 
       1064 1 . . . . .   5.712 0.0   6.272 1 1 
       1065 1 . . . . .     6.6 0.0     7.2 1 1 
       1066 1 . . . . .    4.48 0.0    5.04 1 1 
       1067 1 . . . . .   5.376 0.0   5.936 1 1 
       1068 1 . . . . .   6.272 0.0  6.8992 1 1 
       1069 1 . . . . .     3.7 0.0     4.2 1 1 
       1070 1 . . . . .     5.2 0.0     5.7 1 1 
       1071 1 . . . . .     4.8 0.0     5.3 1 1 
       1072 1 . . . . .   5.376 0.0   5.936 1 1 
       1073 1 . . . . .     5.0 0.0     5.5 1 1 
       1074 1 . . . . .    5.52 0.0    6.12 1 1 
       1075 1 . . . . .     3.1 0.0     3.6 1 1 
       1076 1 . . . . .   3.808 0.0   4.368 1 1 
       1077 1 . . . . .     5.1 0.0     5.6 1 1 
       1078 1 . . . . .   5.936 0.0   6.496 1 1 
       1079 1 . . . . .    7.02 0.0   7.695 1 1 
       1080 1 . . . . .     5.4 0.0     6.0 1 1 
       1081 1 . . . . .     4.7 0.0     5.2 1 1 
       1082 1 . . . . .     5.1 0.0     5.6 1 1 
       1083 1 . . . . .   7.155 0.0    7.83 1 1 
       1084 1 . . . . .     5.5 0.0     6.0 1 1 
       1085 1 . . . . .     4.4 0.0     4.9 1 1 
       1086 1 . . . . .    3.96 0.0    4.56 1 1 
       1087 1 . . . . .     6.0 0.0     6.6 1 1 
       1088 1 . . . . .   7.392 0.0   8.064 1 1 
       1089 1 . . . . .  6.9888 0.0  7.6608 1 1 
       1090 1 . . . . .  6.9888 0.0  7.6608 1 1 
       1091 1 . . . . .    5.76 0.0    6.36 1 1 
       1092 1 . . . . .     6.0 0.0     6.6 1 1 
       1093 1 . . . . .    5.76 0.0    6.36 1 1 
       1094 1 . . . . .   5.346 0.0   6.156 1 1 
       1095 1 . . . . .     8.1 0.0    8.91 1 1 
       1096 1 . . . . .    5.04 0.0    5.64 1 1 
       1097 1 . . . . .   6.048 0.0   6.768 1 1 
       1098 1 . . . . .   5.264 0.0   5.824 1 1 
       1099 1 . . . . .  7.8624 0.0  8.6184 1 1 
       1100 1 . . . . .    4.08 0.0    4.68 1 1 
       1101 1 . . . . .    6.24 0.0    6.84 1 1 
       1102 1 . . . . .    4.44 0.0    5.04 1 1 
       1103 1 . . . . .    5.28 0.0    5.88 1 1 
       1104 1 . . . . .    6.72 0.0   7.392 1 1 
       1105 1 . . . . .     6.6 0.0     7.2 1 1 
       1106 1 . . . . .    4.08 0.0    4.68 1 1 
       1107 1 . . . . .  5.2416 0.0  5.9136 1 1 
       1108 1 . . . . .   5.376 0.0   6.048 1 1 
       1109 1 . . . . .  5.9136 0.0  6.5856 1 1 
       1110 1 . . . . .    6.12 0.0    6.72 1 1 
       1111 1 . . . . .     6.6 0.0     7.2 1 1 
       1112 1 . . . . .  4.9728 0.0  5.6448 1 1 
       1113 1 . . . . .   6.048 0.0    6.72 1 1 
       1114 1 . . . . .    4.56 0.0    5.16 1 1 
       1115 1 . . . . .   5.346 0.0   6.156 1 1 
       1116 1 . . . . .   5.328 0.0   6.048 1 1 
       1117 1 . . . . .   4.592 0.0   5.152 1 1 
       1118 1 . . . . .   4.368 0.0   4.928 1 1 
       1119 1 . . . . .     3.3 0.0     3.8 1 1 
       1120 1 . . . . .   4.032 0.0   4.592 1 1 
       1121 1 . . . . .   5.712 0.0   6.272 1 1 
       1122 1 . . . . .    4.48 0.0    5.04 1 1 
       1123 1 . . . . .   5.152 0.0   5.712 1 1 
       1124 1 . . . . .   5.264 0.0   5.824 1 1 
       1125 1 . . . . .   5.488 0.0   6.048 1 1 
       1126 1 . . . . .    5.04 0.0     5.6 1 1 
       1127 1 . . . . .     5.6 0.0    6.16 1 1 
       1128 1 . . . . . 6.52288 0.0 7.15008 1 1 
       1129 1 . . . . .   4.704 0.0   5.264 1 1 
       1130 1 . . . . .    6.16 0.0    6.72 1 1 
       1131 1 . . . . .     5.0 0.0     5.5 1 1 
       1132 1 . . . . .     5.1 0.0     5.6 1 1 
       1133 1 . . . . .   5.376 0.0   5.936 1 1 
       1134 1 . . . . .   7.425 0.0     8.1 1 1 
       1135 1 . . . . .     5.2 0.0     5.7 1 1 
       1136 1 . . . . .   5.824 0.0   6.384 1 1 
       1137 1 . . . . .   5.488 0.0   6.048 1 1 
       1138 1 . . . . .     4.7 0.0     5.2 1 1 
       1139 1 . . . . .     4.5 0.0     5.0 1 1 
       1140 1 . . . . .   3.584 0.0   4.144 1 1 
       1141 1 . . . . .    5.04 0.0     5.6 1 1 
       1142 1 . . . . .     4.5 0.0     5.0 1 1 
       1143 1 . . . . .     4.9 0.0     5.4 1 1 
       1144 1 . . . . .     4.9 0.0     5.4 1 1 
       1145 1 . . . . .    6.21 0.0   6.885 1 1 
       1146 1 . . . . . 5.26848 0.0 5.89568 1 1 
       1147 1 . . . . .    5.04 0.0     5.6 1 1 
       1148 1 . . . . .   4.704 0.0   5.264 1 1 
       1149 1 . . . . .   4.144 0.0   4.704 1 1 
       1150 1 . . . . .  5.1408 0.0  5.8968 1 1 
       1151 1 . . . . .   4.816 0.0   5.376 1 1 
       1152 1 . . . . . 5.89568 0.0 6.52288 1 1 
       1153 1 . . . . .    6.16 0.0    6.72 1 1 
       1154 1 . . . . .   6.345 0.0    7.02 1 1 
       1155 1 . . . . .    6.16 0.0    6.72 1 1 
       1156 1 . . . . .     4.8 0.0     5.3 1 1 
       1157 1 . . . . .    6.75 0.0   7.425 1 1 
       1158 1 . . . . .     4.3 0.0     4.8 1 1 
       1159 1 . . . . .    4.48 0.0    5.04 1 1 
       1160 1 . . . . .     3.6 0.0     4.1 1 1 
       1161 1 . . . . .    4.32 0.0   4.995 1 1 
       1162 1 . . . . .    4.48 0.0    5.04 1 1 
       1163 1 . . . . .   4.704 0.0   5.264 1 1 
       1164 1 . . . . .   6.048 0.0   6.608 1 1 
       1165 1 . . . . .   4.928 0.0   5.488 1 1 
       1166 1 . . . . .   5.292 0.0   6.048 1 1 
       1167 1 . . . . .   6.048 0.0   6.804 1 1 
       1168 1 . . . . .   4.368 0.0   4.928 1 1 
       1169 1 . . . . .  6.8992 0.0  7.5264 1 1 
       1170 1 . . . . .    6.16 0.0    6.72 1 1 
       1171 1 . . . . .   6.048 0.0   6.608 1 1 
       1172 1 . . . . .   8.316 0.0   9.072 1 1 
       1173 1 . . . . .   5.264 0.0   5.824 1 1 
       1174 1 . . . . . 6.52288 0.0 7.15008 1 1 
       1175 1 . . . . . 6.14656 0.0 6.77376 1 1 
       1176 1 . . . . .  5.6448 0.0  6.3168 1 1 
       1177 1 . . . . .    4.48 0.0    5.04 1 1 
       1178 1 . . . . .   5.152 0.0   5.712 1 1 
       1179 1 . . . . .    6.16 0.0    6.72 1 1 
       1180 1 . . . . .  7.7112 0.0  8.4672 1 1 
       1181 1 . . . . .  6.3504 0.0  7.1064 1 1 
       1182 1 . . . . .    3.92 0.0    4.48 1 1 
       1183 1 . . . . . 6.52288 0.0 7.15008 1 1 
       1184 1 . . . . .  5.6448 0.0  6.3168 1 1 
       1185 1 . . . . .     3.2 0.0     3.7 1 1 
       1186 1 . . . . .     5.2 0.0     5.7 1 1 
       1187 1 . . . . .    6.21 0.0   6.885 1 1 
       1188 1 . . . . .     4.3 0.0     4.8 1 1 
       1189 1 . . . . .   6.615 0.0    7.29 1 1 
       1190 1 . . . . .     5.6 0.0    6.16 1 1 
       1191 1 . . . . .   4.928 0.0   5.488 1 1 
       1192 1 . . . . .     4.9 0.0     5.4 1 1 
       1193 1 . . . . .     4.6 0.0     5.1 1 1 
       1194 1 . . . . .   6.885 0.0    7.56 1 1 
       1195 1 . . . . .   5.152 0.0   5.712 1 1 
       1196 1 . . . . .   7.425 0.0     8.1 1 1 
       1197 1 . . . . .   5.824 0.0   6.384 1 1 
       1198 1 . . . . .   5.488 0.0   6.048 1 1 
       1199 1 . . . . .  8.1648 0.0  8.9208 1 1 
       1200 1 . . . . . 6.64832 0.0 7.27552 1 1 
       1201 1 . . . . . 6.02112 0.0 6.64832 1 1 
       1202 1 . . . . .    5.04 0.0     5.6 1 1 
       1203 1 . . . . . 6.02112 0.0 6.64832 1 1 
       1204 1 . . . . .   6.272 0.0  6.8992 1 1 
       1205 1 . . . . .     3.3 0.0     3.8 1 1 
       1206 1 . . . . .     3.0 0.0     3.5 1 1 
       1207 1 . . . . .     4.9 0.0     5.4 1 1 
       1208 1 . . . . .     5.3 0.0     5.8 1 1 
       1209 1 . . . . .   7.425 0.0     8.1 1 1 
       1210 1 . . . . .    6.16 0.0    6.72 1 1 
       1211 1 . . . . .     3.8 0.0     4.3 1 1 
       1212 1 . . . . .    4.86 0.0   5.535 1 1 
       1213 1 . . . . .   5.805 0.0    6.48 1 1 
       1214 1 . . . . .   6.804 0.0    7.56 1 1 
       1215 1 . . . . .  6.1992 0.0  6.9552 1 1 
       1216 1 . . . . .   7.425 0.0     8.1 1 1 
       1217 1 . . . . .    4.48 0.0    5.04 1 1 
       1218 1 . . . . .   6.615 0.0    7.29 1 1 
       1219 1 . . . . .   3.696 0.0   4.256 1 1 
       1220 1 . . . . .   5.824 0.0   6.384 1 1 
       1221 1 . . . . .   4.368 0.0   4.928 1 1 
       1222 1 . . . . .  7.1064 0.0  7.8624 1 1 
       1223 1 . . . . .   6.048 0.0   6.608 1 1 
       1224 1 . . . . .   8.316 0.0   9.072 1 1 
       1225 1 . . . . .     3.5 0.0     4.0 1 1 
       1226 1 . . . . .     4.9 0.0     5.4 1 1 
       1227 1 . . . . .     3.4 0.0     3.9 1 1 
       1228 1 . . . . .   4.704 0.0   5.264 1 1 
       1229 1 . . . . .     4.9 0.0     5.4 1 1 
       1230 1 . . . . .     5.0 0.0     5.5 1 1 
       1231 1 . . . . .   4.928 0.0   5.488 1 1 
       1232 1 . . . . .   5.824 0.0   6.384 1 1 
       1233 1 . . . . .    4.86 0.0   5.535 1 1 
       1234 1 . . . . .    6.75 0.0   7.425 1 1 
       1235 1 . . . . .   6.804 0.0    7.56 1 1 
       1236 1 . . . . .   6.345 0.0    7.02 1 1 
       1237 1 . . . . .   5.535 0.0    6.21 1 1 
       1238 1 . . . . .   6.885 0.0    7.56 1 1 
       1239 1 . . . . .  6.5016 0.0  7.2576 1 1 
       1240 1 . . . . .  6.3504 0.0  7.1064 1 1 
       1241 1 . . . . .   7.425 0.0     8.1 1 1 
       1242 1 . . . . .   3.584 0.0   4.144 1 1 
       1243 1 . . . . .     5.4 0.0     5.9 1 1 
       1244 1 . . . . .     3.3 0.0     3.8 1 1 
       1245 1 . . . . .   5.152 0.0   5.712 1 1 
       1246 1 . . . . .     4.1 0.0     4.6 1 1 
       1247 1 . . . . .   4.928 0.0   5.488 1 1 
       1248 1 . . . . .     3.3 0.0     3.8 1 1 
       1249 1 . . . . .   5.264 0.0   5.824 1 1 
       1250 1 . . . . .     5.6 0.0    6.16 1 1 
       1251 1 . . . . .   4.928 0.0   5.488 1 1 
       1252 1 . . . . . 5.77024 0.0 6.39744 1 1 
       1253 1 . . . . .     3.7 0.0     4.2 1 1 
       1254 1 . . . . .     4.9 0.0     5.4 1 1 
       1255 1 . . . . .   6.615 0.0    7.29 1 1 
       1256 1 . . . . .     5.1 0.0     5.6 1 1 
       1257 1 . . . . .     4.3 0.0     4.8 1 1 
       1258 1 . . . . .   5.265 0.0    5.94 1 1 
       1259 1 . . . . .     4.6 0.0     5.1 1 1 
       1260 1 . . . . .   4.928 0.0   5.488 1 1 
       1261 1 . . . . .     5.6 0.0    6.16 1 1 
       1262 1 . . . . . 5.89568 0.0 6.52288 1 1 
       1263 1 . . . . .  8.1648 0.0  8.9208 1 1 
       1264 1 . . . . .    6.16 0.0    6.72 1 1 
       1265 1 . . . . .    7.56 0.0   8.316 1 1 
       1266 1 . . . . .   5.376 0.0   5.936 1 1 
       1267 1 . . . . .  6.1992 0.0  6.9552 1 1 
       1268 1 . . . . . 6.02112 0.0 6.64832 1 1 
       1269 1 . . . . .     5.6 0.0    6.16 1 1 
       1270 1 . . . . .    5.04 0.0     5.6 1 1 
       1271 1 . . . . . 6.64832 0.0 7.27552 1 1 
       1272 1 . . . . .    6.16 0.0    6.72 1 1 
       1273 1 . . . . .    5.04 0.0     5.6 1 1 
       1274 1 . . . . .    5.04 0.0     5.6 1 1 
       1275 1 . . . . . 5.89568 0.0 6.52288 1 1 
       1276 1 . . . . .  6.8992 0.0  7.5264 1 1 
       1277 1 . . . . . 5.77024 0.0 6.39744 1 1 
       1278 1 . . . . . 6.02112 0.0 6.64832 1 1 
       1279 1 . . . . .     4.5 0.0     5.0 1 1 
       1280 1 . . . . .   5.376 0.0   5.936 1 1 
       1281 1 . . . . .   5.936 0.0   6.496 1 1 
       1282 1 . . . . .   5.376 0.0   5.936 1 1 
       1283 1 . . . . .   4.704 0.0   5.264 1 1 
       1284 1 . . . . .   5.824 0.0   6.384 1 1 
       1285 1 . . . . .     3.5 0.0     4.0 1 1 
       1286 1 . . . . .   5.488 0.0   6.048 1 1 
       1287 1 . . . . .     4.8 0.0     5.3 1 1 
       1288 1 . . . . .     4.7 0.0     5.2 1 1 
       1289 1 . . . . .    5.04 0.0     5.6 1 1 
       1290 1 . . . . .   4.816 0.0   5.376 1 1 
       1291 1 . . . . .   6.272 0.0  6.8992 1 1 
       1292 1 . . . . .   4.032 0.0   4.592 1 1 
       1293 1 . . . . .     3.2 0.0     3.7 1 1 
       1294 1 . . . . .   5.376 0.0   5.936 1 1 
       1295 1 . . . . .    6.75 0.0   7.425 1 1 
       1296 1 . . . . .    3.36 0.0    3.92 1 1 
       1297 1 . . . . .   7.155 0.0    7.83 1 1 
       1298 1 . . . . .   4.816 0.0   5.376 1 1 
       1299 1 . . . . .   5.488 0.0   6.048 1 1 
       1300 1 . . . . .   5.152 0.0   5.712 1 1 
       1301 1 . . . . .   8.316 0.0   9.072 1 1 
       1302 1 . . . . .   3.696 0.0   4.256 1 1 
       1303 1 . . . . .    4.86 0.0   5.535 1 1 
       1304 1 . . . . .     4.3 0.0     4.8 1 1 
       1305 1 . . . . .     3.3 0.0     3.8 1 1 
       1306 1 . . . . .   5.152 0.0   5.712 1 1 
       1307 1 . . . . .   5.824 0.0   6.384 1 1 
       1308 1 . . . . . 5.14304 0.0 5.77024 1 1 
       1309 1 . . . . .   5.376 0.0   5.936 1 1 
       1310 1 . . . . .   6.345 0.0    7.02 1 1 
       1311 1 . . . . .    6.75 0.0   7.425 1 1 
       1312 1 . . . . .  6.5016 0.0  7.2576 1 1 
       1313 1 . . . . .   7.155 0.0    7.83 1 1 
       1314 1 . . . . .   7.155 0.0    7.83 1 1 
       1315 1 . . . . .  6.1965 0.0 7.10775 1 1 
       1316 1 . . . . .   5.712 0.0   6.272 1 1 
       1317 1 . . . . .   5.152 0.0   5.712 1 1 
       1318 1 . . . . .   4.816 0.0   5.376 1 1 
       1319 1 . . . . .     4.9 0.0     5.4 1 1 
       1320 1 . . . . .   5.376 0.0   5.936 1 1 
       1321 1 . . . . .     5.1 0.0     5.6 1 1 
       1322 1 . . . . .     5.3 0.0     5.8 1 1 
       1323 1 . . . . .     5.6 0.0    6.16 1 1 
       1324 1 . . . . .    6.16 0.0    6.72 1 1 
       1325 1 . . . . .   4.928 0.0   5.488 1 1 
       1326 1 . . . . .  5.6448 0.0   6.272 1 1 
       1327 1 . . . . .   4.704 0.0   5.264 1 1 
       1328 1 . . . . .   5.712 0.0   6.272 1 1 
       1329 1 . . . . .  5.6448 0.0   6.272 1 1 
       1330 1 . . . . .    6.16 0.0    6.72 1 1 
       1331 1 . . . . .     4.6 0.0     5.1 1 1 
       1332 1 . . . . .     5.2 0.0     5.7 1 1 
       1333 1 . . . . .     4.2 0.0     4.7 1 1 
       1334 1 . . . . .     4.7 0.0     5.2 1 1 
       1335 1 . . . . .     4.5 0.0     5.0 1 1 
       1336 1 . . . . .     4.1 0.0     4.6 1 1 
       1337 1 . . . . .   4.256 0.0   4.816 1 1 
       1338 1 . . . . .   5.264 0.0   5.824 1 1 
       1339 1 . . . . .   4.704 0.0   5.264 1 1 
       1340 1 . . . . .   5.712 0.0   6.272 1 1 
       1341 1 . . . . .     4.6 0.0     5.1 1 1 
       1342 1 . . . . .     4.2 0.0     4.7 1 1 
       1343 1 . . . . .   5.264 0.0   5.824 1 1 
       1344 1 . . . . .     5.5 0.0     6.0 1 1 
       1345 1 . . . . .    6.16 0.0    6.72 1 1 
       1346 1 . . . . .     5.5 0.0     6.0 1 1 
       1347 1 . . . . .   3.472 0.0   4.032 1 1 
       1348 1 . . . . .     3.3 0.0     3.8 1 1 
       1349 1 . . . . .     4.8 0.0     5.3 1 1 
       1350 1 . . . . .     4.7 0.0     5.2 1 1 
       1351 1 . . . . .     4.2 0.0     4.7 1 1 
       1352 1 . . . . .   4.704 0.0   5.264 1 1 
       1353 1 . . . . .   4.704 0.0   5.264 1 1 
       1354 1 . . . . .     4.4 0.0     4.9 1 1 
       1355 1 . . . . .   4.032 0.0   4.592 1 1 
       1356 1 . . . . .     3.3 0.0     3.8 1 1 
       1357 1 . . . . .   6.048 0.0   6.608 1 1 
       1358 1 . . . . .     4.6 0.0     5.1 1 1 
       1359 1 . . . . .     5.6 0.0    6.16 1 1 
       1360 1 . . . . .     5.5 0.0     6.0 1 1 
       1361 1 . . . . .     3.5 0.0     4.0 1 1 
       1362 1 . . . . .   3.808 0.0   4.368 1 1 
       1363 1 . . . . .   4.592 0.0   5.152 1 1 
       1364 1 . . . . .   4.704 0.0   5.264 1 1 
       1365 1 . . . . .   5.152 0.0   5.712 1 1 
       1366 1 . . . . .     4.7 0.0     5.2 1 1 
       1367 1 . . . . .   6.075 0.0    6.75 1 1 
       1368 1 . . . . .    5.04 0.0     5.6 1 1 
       1369 1 . . . . .    6.16 0.0    6.72 1 1 
       1370 1 . . . . . 6.02112 0.0 6.64832 1 1 
       1371 1 . . . . .   5.936 0.0   6.496 1 1 
       1372 1 . . . . .   6.804 0.0    7.56 1 1 
       1373 1 . . . . .     3.6 0.0     4.1 1 1 
       1374 1 . . . . .     5.6 0.0    6.16 1 1 
       1375 1 . . . . .     4.9 0.0     5.4 1 1 
       1376 1 . . . . .     5.0 0.0     5.5 1 1 
       1377 1 . . . . .     4.8 0.0     5.3 1 1 
       1378 1 . . . . .     4.2 0.0     4.7 1 1 
       1379 1 . . . . .     4.3 0.0     4.8 1 1 
       1380 1 . . . . .   5.535 0.0    6.21 1 1 
       1381 1 . . . . .     4.5 0.0     5.0 1 1 
       1382 1 . . . . .   5.824 0.0   6.384 1 1 
       1383 1 . . . . .   5.264 0.0   5.824 1 1 
       1384 1 . . . . .   4.144 0.0   4.704 1 1 
       1385 1 . . . . .   5.712 0.0   6.272 1 1 
       1386 1 . . . . . 5.89568 0.0 6.52288 1 1 
       1387 1 . . . . .    3.92 0.0    4.48 1 1 
       1388 1 . . . . .     5.5 0.0     6.0 1 1 
       1389 1 . . . . .     4.9 0.0     5.4 1 1 
       1390 1 . . . . .     5.1 0.0     5.6 1 1 
       1391 1 . . . . .     4.3 0.0     4.8 1 1 
       1392 1 . . . . .     4.5 0.0     5.0 1 1 
       1393 1 . . . . .   4.928 0.0   5.488 1 1 
       1394 1 . . . . .    3.36 0.0    3.92 1 1 
       1395 1 . . . . .   4.592 0.0   5.152 1 1 
       1396 1 . . . . .    6.16 0.0    6.72 1 1 
       1397 1 . . . . .     3.4 0.0     3.9 1 1 
       1398 1 . . . . .     5.1 0.0     5.6 1 1 
       1399 1 . . . . .   6.615 0.0    7.29 1 1 
       1400 1 . . . . .     5.2 0.0     5.7 1 1 
       1401 1 . . . . .     5.2 0.0     5.7 1 1 
       1402 1 . . . . .   5.712 0.0   6.272 1 1 
       1403 1 . . . . .     5.5 0.0     6.0 1 1 
       1404 1 . . . . .   4.704 0.0   5.264 1 1 
       1405 1 . . . . .     4.6 0.0     5.1 1 1 
       1406 1 . . . . .   5.488 0.0   6.048 1 1 
       1407 1 . . . . .   4.032 0.0   4.592 1 1 
       1408 1 . . . . .   5.264 0.0   5.824 1 1 
       1409 1 . . . . .  6.1992 0.0  6.9552 1 1 
       1410 1 . . . . .     5.6 0.0    6.16 1 1 
       1411 1 . . . . .   5.152 0.0   5.712 1 1 
       1412 1 . . . . .  4.9896 0.0  5.7456 1 1 
       1413 1 . . . . .   4.928 0.0   5.488 1 1 
       1414 1 . . . . .  7.1064 0.0  7.8624 1 1 
       1415 1 . . . . .  6.9552 0.0  7.7112 1 1 
       1416 1 . . . . .     3.6 0.0     4.1 1 1 
       1417 1 . . . . .    4.05 0.0   4.725 1 1 
       1418 1 . . . . .     3.5 0.0     4.0 1 1 
       1419 1 . . . . .     4.1 0.0     4.6 1 1 
       1420 1 . . . . .     4.9 0.0     5.4 1 1 
       1421 1 . . . . .     5.5 0.0     6.0 1 1 
       1422 1 . . . . .     4.1 0.0     4.6 1 1 
       1423 1 . . . . .     5.3 0.0     5.8 1 1 
       1424 1 . . . . .     4.1 0.0     4.6 1 1 
       1425 1 . . . . .     6.0 0.0     6.6 1 1 
       1426 1 . . . . .     3.9 0.0     4.4 1 1 
       1427 1 . . . . .    5.13 0.0   5.805 1 1 
       1428 1 . . . . .    6.21 0.0   6.885 1 1 
       1429 1 . . . . .  5.7456 0.0  6.5016 1 1 
       1430 1 . . . . .   7.425 0.0     8.1 1 1 
       1431 1 . . . . .    7.02 0.0   7.695 1 1 
       1432 1 . . . . .    6.48 0.0   7.155 1 1 
       1433 1 . . . . .   8.586 0.0   9.396 1 1 
       1434 1 . . . . .   5.805 0.0    6.48 1 1 
       1435 1 . . . . .   6.804 0.0   7.614 1 1 
       1436 1 . . . . .   3.696 0.0   4.256 1 1 
       1437 1 . . . . .   5.152 0.0   5.712 1 1 
       1438 1 . . . . .   5.936 0.0   6.496 1 1 
       1439 1 . . . . .   4.368 0.0   4.928 1 1 
       1440 1 . . . . .     3.4 0.0     3.9 1 1 
       1441 1 . . . . .     4.8 0.0     5.3 1 1 
       1442 1 . . . . .   4.816 0.0   5.376 1 1 
       1443 1 . . . . .     5.0 0.0     5.5 1 1 
       1444 1 . . . . .     4.1 0.0     4.6 1 1 
       1445 1 . . . . .     4.8 0.0     5.4 1 1 
       1446 1 . . . . .     4.8 0.0     5.3 1 1 
       1447 1 . . . . .   4.032 0.0   4.592 1 1 
       1448 1 . . . . .     5.6 0.0    6.16 1 1 
       1449 1 . . . . .     5.6 0.0    6.16 1 1 
       1450 1 . . . . .    3.36 0.0    3.92 1 1 
       1451 1 . . . . .   5.376 0.0   5.936 1 1 
       1452 1 . . . . .     3.4 0.0     3.9 1 1 
       1453 1 . . . . .     4.8 0.0     5.3 1 1 
       1454 1 . . . . .    5.88 0.0    6.48 1 1 
       1455 1 . . . . .     5.2 0.0     5.7 1 1 
       1456 1 . . . . .   4.144 0.0   4.704 1 1 
       1457 1 . . . . .   5.152 0.0   5.712 1 1 
       1458 1 . . . . .     4.8 0.0     5.3 1 1 
       1459 1 . . . . .     4.0 0.0     4.5 1 1 
       1460 1 . . . . .   4.032 0.0   4.592 1 1 
       1461 1 . . . . .    5.16 0.0    5.76 1 1 
       1462 1 . . . . .   4.256 0.0   4.816 1 1 
       1463 1 . . . . .   5.488 0.0   6.048 1 1 
       1464 1 . . . . .   5.376 0.0   5.936 1 1 
       1465 1 . . . . .   5.376 0.0   5.936 1 1 
       1466 1 . . . . .     3.4 0.0     3.9 1 1 
       1467 1 . . . . .    4.44 0.0    5.04 1 1 
       1468 1 . . . . .    5.64 0.0    6.24 1 1 
       1469 1 . . . . .     4.2 0.0     4.7 1 1 
       1470 1 . . . . .    5.04 0.0    5.64 1 1 
       1471 1 . . . . .     4.8 0.0     5.3 1 1 
       1472 1 . . . . .     4.3 0.0     4.8 1 1 
       1473 1 . . . . .    3.96 0.0    4.56 1 1 
       1474 1 . . . . .    5.64 0.0    6.24 1 1 
       1475 1 . . . . .    6.24 0.0    6.84 1 1 
       1476 1 . . . . .     5.4 0.0     6.0 1 1 
       1477 1 . . . . .    5.76 0.0    6.36 1 1 
       1478 1 . . . . .    6.48 0.0     7.2 1 1 
       1479 1 . . . . .   5.616 0.0   6.336 1 1 
       1480 1 . . . . .     5.4 0.0     6.0 1 1 
       1481 1 . . . . .  4.8384 0.0  5.5104 1 1 
       1482 1 . . . . .     6.6 0.0     7.2 1 1 
       1483 1 . . . . .    5.16 0.0    5.76 1 1 
       1484 1 . . . . .    6.48 0.0    7.29 1 1 
       1485 1 . . . . .   7.776 0.0   8.496 1 1 
       1486 1 . . . . .    3.48 0.0    4.08 1 1 
       1487 1 . . . . .     3.4 0.0     3.9 1 1 
       1488 1 . . . . .     5.1 0.0     5.6 1 1 
       1489 1 . . . . .   5.824 0.0   6.384 1 1 
       1490 1 . . . . .   5.376 0.0   5.936 1 1 
       1491 1 . . . . .     4.7 0.0     5.2 1 1 
       1492 1 . . . . .    6.36 0.0    6.96 1 1 
       1493 1 . . . . .     4.5 0.0     5.0 1 1 
       1494 1 . . . . .    3.84 0.0    4.44 1 1 
       1495 1 . . . . .    5.04 0.0    5.64 1 1 
       1496 1 . . . . .  6.5856 0.0  7.2576 1 1 
       1497 1 . . . . .  6.3168 0.0  6.9888 1 1 
       1498 1 . . . . .     6.0 0.0     6.6 1 1 
       1499 1 . . . . .    3.36 0.0    3.92 1 1 
       1500 1 . . . . .   4.144 0.0   4.704 1 1 
       1501 1 . . . . .     3.3 0.0     3.8 1 1 
       1502 1 . . . . .     5.4 0.0     5.9 1 1 
       1503 1 . . . . .    5.28 0.0    5.88 1 1 
       1504 1 . . . . .     4.5 0.0     5.0 1 1 
       1505 1 . . . . .     3.6 0.0     4.1 1 1 
       1506 1 . . . . .     4.8 0.0     5.3 1 1 
       1507 1 . . . . .   4.032 0.0   4.592 1 1 
       1508 1 . . . . .    5.04 0.0     5.6 1 1 
       1509 1 . . . . .  6.5856 0.0  7.2576 1 1 
       1510 1 . . . . .   5.264 0.0   5.824 1 1 
       1511 1 . . . . .  7.1232 0.0  7.7952 1 1 
       1512 1 . . . . .    3.12 0.0    3.72 1 1 
       1513 1 . . . . .     3.4 0.0     3.9 1 1 
       1514 1 . . . . .     5.5 0.0     6.0 1 1 
       1515 1 . . . . .    4.32 0.0    4.92 1 1 
       1516 1 . . . . .    5.76 0.0    6.36 1 1 
       1517 1 . . . . .  6.4512 0.0  7.1232 1 1 
       1518 1 . . . . .     6.6 0.0     7.2 1 1 
       1519 1 . . . . .    6.48 0.0    7.08 1 1 
       1520 1 . . . . .    6.24 0.0    6.84 1 1 
       1521 1 . . . . .     8.1 0.0    8.91 1 1 
       1522 1 . . . . .     4.0 0.0     4.5 1 1 
       1523 1 . . . . .   6.804 0.0    7.56 1 1 
       1524 1 . . . . .     3.6 0.0     4.1 1 1 
       1525 1 . . . . .     4.9 0.0     5.4 1 1 
       1526 1 . . . . .    4.56 0.0    5.16 1 1 
       1527 1 . . . . .     5.2 0.0     5.7 1 1 
       1528 1 . . . . .    7.29 0.0   7.965 1 1 
       1529 1 . . . . .   6.615 0.0    7.29 1 1 
       1530 1 . . . . .   6.318 0.0   7.128 1 1 
       1531 1 . . . . .  6.3504 0.0  7.1064 1 1 
       1532 1 . . . . .     3.0 0.0     3.5 1 1 
       1533 1 . . . . .   4.704 0.0   5.264 1 1 
       1534 1 . . . . .   4.816 0.0   5.376 1 1 
       1535 1 . . . . . 6.52288 0.0 7.15008 1 1 
       1536 1 . . . . .   5.824 0.0   6.384 1 1 
       1537 1 . . . . . 5.26848 0.0 5.89568 1 1 
       1538 1 . . . . .   4.816 0.0   5.376 1 1 
       1539 1 . . . . . 5.26848 0.0 5.89568 1 1 
       1540 1 . . . . .    5.04 0.0     5.6 1 1 
       1541 1 . . . . .     5.6 0.0    6.16 1 1 
       1542 1 . . . . .     4.7 0.0     5.2 1 1 
       1543 1 . . . . .   5.488 0.0   6.048 1 1 
       1544 1 . . . . .     4.9 0.0     5.4 1 1 
       1545 1 . . . . .     5.3 0.0     5.8 1 1 
       1546 1 . . . . .   4.592 0.0   5.152 1 1 
       1547 1 . . . . .  5.1072 0.0  5.7792 1 1 
       1548 1 . . . . .     4.2 0.0     4.7 1 1 
       1549 1 . . . . .    4.48 0.0    5.04 1 1 
       1550 1 . . . . .  5.7792 0.0  6.4512 1 1 
       1551 1 . . . . .   5.824 0.0   6.384 1 1 
       1552 1 . . . . .   5.152 0.0   5.712 1 1 
       1553 1 . . . . .     4.0 0.0     4.5 1 1 
       1554 1 . . . . .     4.6 0.0     5.1 1 1 
    stop_

save_


save_AMBER_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1  8 LEU C 1 1  9 TYR N  1 1  9 TYR CA 1 1  9 TYR C     -168.3 -106.399994 2l30_ambr001  8 LEU C 2l30_ambr001  9 TYR N  2l30_ambr001  9 TYR CA 2l30_ambr001  9 TYR C 1 1 
         2 . 1 1  9 TYR N 1 1  9 TYR CA 1 1  9 TYR C  1 1 10 ARG N      132.6       168.4 2l30_ambr001  9 TYR N 2l30_ambr001  9 TYR CA 2l30_ambr001  9 TYR C  2l30_ambr001 10 ARG N 1 1 
         3 . 1 1  9 TYR C 1 1 10 ARG N  1 1 10 ARG CA 1 1 10 ARG C     -161.5       -82.6 2l30_ambr001  9 TYR C 2l30_ambr001 10 ARG N  2l30_ambr001 10 ARG CA 2l30_ambr001 10 ARG C 1 1 
         4 . 1 1 10 ARG N 1 1 10 ARG CA 1 1 10 ARG C  1 1 11 VAL N      118.1       142.1 2l30_ambr001 10 ARG N 2l30_ambr001 10 ARG CA 2l30_ambr001 10 ARG C  2l30_ambr001 11 VAL N 1 1 
         5 . 1 1 10 ARG C 1 1 11 VAL N  1 1 11 VAL CA 1 1 11 VAL C     -169.6       -95.1 2l30_ambr001 10 ARG C 2l30_ambr001 11 VAL N  2l30_ambr001 11 VAL CA 2l30_ambr001 11 VAL C 1 1 
         6 . 1 1 11 VAL N 1 1 11 VAL CA 1 1 11 VAL C  1 1 12 GLU N      130.6       175.7 2l30_ambr001 11 VAL N 2l30_ambr001 11 VAL CA 2l30_ambr001 11 VAL C  2l30_ambr001 12 GLU N 1 1 
         7 . 1 1 14 ALA C 1 1 15 LYS N  1 1 15 LYS CA 1 1 15 LYS C     -113.3  -58.699997 2l30_ambr001 14 ALA C 2l30_ambr001 15 LYS N  2l30_ambr001 15 LYS CA 2l30_ambr001 15 LYS C 1 1 
         8 . 1 1 15 LYS N 1 1 15 LYS CA 1 1 15 LYS C  1 1 16 SER N      -46.6       -25.9 2l30_ambr001 15 LYS N 2l30_ambr001 15 LYS CA 2l30_ambr001 15 LYS C  2l30_ambr001 16 SER N 1 1 
         9 . 1 1 15 LYS C 1 1 16 SER N  1 1 16 SER CA 1 1 16 SER C     -168.7       -76.6 2l30_ambr001 15 LYS C 2l30_ambr001 16 SER N  2l30_ambr001 16 SER CA 2l30_ambr001 16 SER C 1 1 
        10 . 1 1 16 SER N 1 1 16 SER CA 1 1 16 SER C  1 1 17 GLY N      132.9       165.9 2l30_ambr001 16 SER N 2l30_ambr001 16 SER CA 2l30_ambr001 16 SER C  2l30_ambr001 17 GLY N 1 1 
        11 . 1 1 26 GLU C 1 1 27 SER N  1 1 27 SER CA 1 1 27 SER C -128.89998  -58.300003 2l30_ambr001 26 GLU C 2l30_ambr001 27 SER N  2l30_ambr001 27 SER CA 2l30_ambr001 27 SER C 1 1 
        12 . 1 1 27 SER N 1 1 27 SER CA 1 1 27 SER C  1 1 28 ILE N      101.8       144.2 2l30_ambr001 27 SER N 2l30_ambr001 27 SER CA 2l30_ambr001 27 SER C  2l30_ambr001 28 ILE N 1 1 
        13 . 1 1 27 SER C 1 1 28 ILE N  1 1 28 ILE CA 1 1 28 ILE C     -127.1  -49.099995 2l30_ambr001 27 SER C 2l30_ambr001 28 ILE N  2l30_ambr001 28 ILE CA 2l30_ambr001 28 ILE C 1 1 
        14 . 1 1 28 ILE N 1 1 28 ILE CA 1 1 28 ILE C  1 1 29 PRO N      107.5       138.8 2l30_ambr001 28 ILE N 2l30_ambr001 28 ILE CA 2l30_ambr001 28 ILE C  2l30_ambr001 29 PRO N 1 1 
        15 . 1 1 29 PRO N 1 1 29 PRO CA 1 1 29 PRO C  1 1 30 LYS N      128.4       157.2 2l30_ambr001 29 PRO N 2l30_ambr001 29 PRO CA 2l30_ambr001 29 PRO C  2l30_ambr001 30 LYS N 1 1 
        16 . 1 1 32 SER C 1 1 33 LEU N  1 1 33 LEU CA 1 1 33 LEU C     -114.6       -60.0 2l30_ambr001 32 SER C 2l30_ambr001 33 LEU N  2l30_ambr001 33 LEU CA 2l30_ambr001 33 LEU C 1 1 
        17 . 1 1 33 LEU N 1 1 33 LEU CA 1 1 33 LEU C  1 1 34 ARG N  118.80001       139.8 2l30_ambr001 33 LEU N 2l30_ambr001 33 LEU CA 2l30_ambr001 33 LEU C  2l30_ambr001 34 ARG N 1 1 
        18 . 1 1 33 LEU C 1 1 34 ARG N  1 1 34 ARG CA 1 1 34 ARG C     -147.6       -87.0 2l30_ambr001 33 LEU C 2l30_ambr001 34 ARG N  2l30_ambr001 34 ARG CA 2l30_ambr001 34 ARG C 1 1 
        19 . 1 1 34 ARG N 1 1 34 ARG CA 1 1 34 ARG C  1 1 35 MET N  128.89998       161.2 2l30_ambr001 34 ARG N 2l30_ambr001 34 ARG CA 2l30_ambr001 34 ARG C  2l30_ambr001 35 MET N 1 1 
        20 . 1 1 34 ARG C 1 1 35 MET N  1 1 35 MET CA 1 1 35 MET C     -146.2      -106.2 2l30_ambr001 34 ARG C 2l30_ambr001 35 MET N  2l30_ambr001 35 MET CA 2l30_ambr001 35 MET C 1 1 
        21 . 1 1 35 MET N 1 1 35 MET CA 1 1 35 MET C  1 1 36 ALA N  127.19999       148.3 2l30_ambr001 35 MET N 2l30_ambr001 35 MET CA 2l30_ambr001 35 MET C  2l30_ambr001 36 ALA N 1 1 
        22 . 1 1 35 MET C 1 1 36 ALA N  1 1 36 ALA CA 1 1 36 ALA C     -161.4       -90.7 2l30_ambr001 35 MET C 2l30_ambr001 36 ALA N  2l30_ambr001 36 ALA CA 2l30_ambr001 36 ALA C 1 1 
        23 . 1 1 36 ALA N 1 1 36 ALA CA 1 1 36 ALA C  1 1 37 ILE N      126.4       166.3 2l30_ambr001 36 ALA N 2l30_ambr001 36 ALA CA 2l30_ambr001 36 ALA C  2l30_ambr001 37 ILE N 1 1 
        24 . 1 1 36 ALA C 1 1 37 ILE N  1 1 37 ILE CA 1 1 37 ILE C -132.69998       -90.3 2l30_ambr001 36 ALA C 2l30_ambr001 37 ILE N  2l30_ambr001 37 ILE CA 2l30_ambr001 37 ILE C 1 1 
        25 . 1 1 37 ILE N 1 1 37 ILE CA 1 1 37 ILE C  1 1 38 MET N      128.5   148.49998 2l30_ambr001 37 ILE N 2l30_ambr001 37 ILE CA 2l30_ambr001 37 ILE C  2l30_ambr001 38 MET N 1 1 
        26 . 1 1 37 ILE C 1 1 38 MET N  1 1 38 MET CA 1 1 38 MET C     -133.9       -80.9 2l30_ambr001 37 ILE C 2l30_ambr001 38 MET N  2l30_ambr001 38 MET CA 2l30_ambr001 38 MET C 1 1 
        27 . 1 1 38 MET N 1 1 38 MET CA 1 1 38 MET C  1 1 39 VAL N      103.1       131.2 2l30_ambr001 38 MET N 2l30_ambr001 38 MET CA 2l30_ambr001 38 MET C  2l30_ambr001 39 VAL N 1 1 
        28 . 1 1 38 MET C 1 1 39 VAL N  1 1 39 VAL CA 1 1 39 VAL C     -158.5       -86.1 2l30_ambr001 38 MET C 2l30_ambr001 39 VAL N  2l30_ambr001 39 VAL CA 2l30_ambr001 39 VAL C 1 1 
        29 . 1 1 39 VAL N 1 1 39 VAL CA 1 1 39 VAL C  1 1 40 GLN N      125.9       157.7 2l30_ambr001 39 VAL N 2l30_ambr001 39 VAL CA 2l30_ambr001 39 VAL C  2l30_ambr001 40 GLN N 1 1 
        30 . 1 1 39 VAL C 1 1 40 GLN N  1 1 40 GLN CA 1 1 40 GLN C     -146.6  -44.699997 2l30_ambr001 39 VAL C 2l30_ambr001 40 GLN N  2l30_ambr001 40 GLN CA 2l30_ambr001 40 GLN C 1 1 
        31 . 1 1 40 GLN N 1 1 40 GLN CA 1 1 40 GLN C  1 1 41 SER N  102.59999       144.5 2l30_ambr001 40 GLN N 2l30_ambr001 40 GLN CA 2l30_ambr001 40 GLN C  2l30_ambr001 41 SER N 1 1 
        32 . 1 1 40 GLN C 1 1 41 SER N  1 1 41 SER CA 1 1 41 SER C -117.50001       -42.6 2l30_ambr001 40 GLN C 2l30_ambr001 41 SER N  2l30_ambr001 41 SER CA 2l30_ambr001 41 SER C 1 1 
        33 . 1 1 41 SER N 1 1 41 SER CA 1 1 41 SER C  1 1 42 PRO N      105.1       156.7 2l30_ambr001 41 SER N 2l30_ambr001 41 SER CA 2l30_ambr001 41 SER C  2l30_ambr001 42 PRO N 1 1 
        34 . 1 1 46 GLY C 1 1 47 LYS N  1 1 47 LYS CA 1 1 47 LYS C     -161.9       -88.4 2l30_ambr001 46 GLY C 2l30_ambr001 47 LYS N  2l30_ambr001 47 LYS CA 2l30_ambr001 47 LYS C 1 1 
        35 . 1 1 47 LYS N 1 1 47 LYS CA 1 1 47 LYS C  1 1 48 VAL N      135.2       155.6 2l30_ambr001 47 LYS N 2l30_ambr001 47 LYS CA 2l30_ambr001 47 LYS C  2l30_ambr001 48 VAL N 1 1 
        36 . 1 1 47 LYS C 1 1 48 VAL N  1 1 48 VAL CA 1 1 48 VAL C     -161.6      -105.1 2l30_ambr001 47 LYS C 2l30_ambr001 48 VAL N  2l30_ambr001 48 VAL CA 2l30_ambr001 48 VAL C 1 1 
        37 . 1 1 48 VAL N 1 1 48 VAL CA 1 1 48 VAL C  1 1 49 PRO N 106.399994       161.1 2l30_ambr001 48 VAL N 2l30_ambr001 48 VAL CA 2l30_ambr001 48 VAL C  2l30_ambr001 49 PRO N 1 1 
        38 . 1 1 49 PRO N 1 1 49 PRO CA 1 1 49 PRO C  1 1 50 HIS N 120.700005       146.9 2l30_ambr001 49 PRO N 2l30_ambr001 49 PRO CA 2l30_ambr001 49 PRO C  2l30_ambr001 50 HIE N 1 1 
        39 . 1 1 49 PRO C 1 1 50 HIS N  1 1 50 HIS CA 1 1 50 HIS C     -140.0       -71.3 2l30_ambr001 49 PRO C 2l30_ambr001 50 HIE N  2l30_ambr001 50 HIE CA 2l30_ambr001 50 HIE C 1 1 
        40 . 1 1 50 HIS N 1 1 50 HIS CA 1 1 50 HIS C  1 1 51 TRP N   95.99999       158.1 2l30_ambr001 50 HIE N 2l30_ambr001 50 HIE CA 2l30_ambr001 50 HIE C  2l30_ambr001 51 TRP N 1 1 
        41 . 1 1 50 HIS C 1 1 51 TRP N  1 1 51 TRP CA 1 1 51 TRP C -157.89998       -78.9 2l30_ambr001 50 HIE C 2l30_ambr001 51 TRP N  2l30_ambr001 51 TRP CA 2l30_ambr001 51 TRP C 1 1 
        42 . 1 1 51 TRP N 1 1 51 TRP CA 1 1 51 TRP C  1 1 52 TYR N 127.799995       172.2 2l30_ambr001 51 TRP N 2l30_ambr001 51 TRP CA 2l30_ambr001 51 TRP C  2l30_ambr001 52 TYR N 1 1 
        43 . 1 1 51 TRP C 1 1 52 TYR N  1 1 52 TYR CA 1 1 52 TYR C     -177.2  -63.699997 2l30_ambr001 51 TRP C 2l30_ambr001 52 TYR N  2l30_ambr001 52 TYR CA 2l30_ambr001 52 TYR C 1 1 
        44 . 1 1 52 TYR N 1 1 52 TYR CA 1 1 52 TYR C  1 1 53 HIS N      146.2       166.2 2l30_ambr001 52 TYR N 2l30_ambr001 52 TYR CA 2l30_ambr001 52 TYR C  2l30_ambr001 53 HIE N 1 1 
        45 . 1 1 53 HIS C 1 1 54 PHE N  1 1 54 PHE CA 1 1 54 PHE C      -83.9       -43.9 2l30_ambr001 53 HIE C 2l30_ambr001 54 PHE N  2l30_ambr001 54 PHE CA 2l30_ambr001 54 PHE C 1 1 
        46 . 1 1 54 PHE N 1 1 54 PHE CA 1 1 54 PHE C  1 1 55 SER N      -53.6       -33.6 2l30_ambr001 54 PHE N 2l30_ambr001 54 PHE CA 2l30_ambr001 54 PHE C  2l30_ambr001 55 SER N 1 1 
        47 . 1 1 54 PHE C 1 1 55 SER N  1 1 55 SER CA 1 1 55 SER C      -84.3       -44.3 2l30_ambr001 54 PHE C 2l30_ambr001 55 SER N  2l30_ambr001 55 SER CA 2l30_ambr001 55 SER C 1 1 
        48 . 1 1 55 SER N 1 1 55 SER CA 1 1 55 SER C  1 1 56 CYS N      -48.2       -28.2 2l30_ambr001 55 SER N 2l30_ambr001 55 SER CA 2l30_ambr001 55 SER C  2l30_ambr001 56 CYM N 1 1 
        49 . 1 1 55 SER C 1 1 56 CYS N  1 1 56 CYS CA 1 1 56 CYS C      -81.2       -41.2 2l30_ambr001 55 SER C 2l30_ambr001 56 CYM N  2l30_ambr001 56 CYM CA 2l30_ambr001 56 CYM C 1 1 
        50 . 1 1 56 CYS N 1 1 56 CYS CA 1 1 56 CYS C  1 1 57 PHE N      -55.9       -35.9 2l30_ambr001 56 CYM N 2l30_ambr001 56 CYM CA 2l30_ambr001 56 CYM C  2l30_ambr001 57 PHE N 1 1 
        51 . 1 1 56 CYS C 1 1 57 PHE N  1 1 57 PHE CA 1 1 57 PHE C      -83.8       -43.8 2l30_ambr001 56 CYM C 2l30_ambr001 57 PHE N  2l30_ambr001 57 PHE CA 2l30_ambr001 57 PHE C 1 1 
        52 . 1 1 57 PHE N 1 1 57 PHE CA 1 1 57 PHE C  1 1 58 TRP N      -51.2       -31.2 2l30_ambr001 57 PHE N 2l30_ambr001 57 PHE CA 2l30_ambr001 57 PHE C  2l30_ambr001 58 TRP N 1 1 
        53 . 1 1 57 PHE C 1 1 58 TRP N  1 1 58 TRP CA 1 1 58 TRP C     -107.0       -46.4 2l30_ambr001 57 PHE C 2l30_ambr001 58 TRP N  2l30_ambr001 58 TRP CA 2l30_ambr001 58 TRP C 1 1 
        54 . 1 1 58 TRP N 1 1 58 TRP CA 1 1 58 TRP C  1 1 59 LYS N -29.700003         1.1 2l30_ambr001 58 TRP N 2l30_ambr001 58 TRP CA 2l30_ambr001 58 TRP C  2l30_ambr001 59 LYS N 1 1 
        55 . 1 1 58 TRP C 1 1 59 LYS N  1 1 59 LYS CA 1 1 59 LYS C     -110.8       -32.3 2l30_ambr001 58 TRP C 2l30_ambr001 59 LYS N  2l30_ambr001 59 LYS CA 2l30_ambr001 59 LYS C 1 1 
        56 . 1 1 59 LYS N 1 1 59 LYS CA 1 1 59 LYS C  1 1 60 VAL N      -41.6       -17.9 2l30_ambr001 59 LYS N 2l30_ambr001 59 LYS CA 2l30_ambr001 59 LYS C  2l30_ambr001 60 VAL N 1 1 
        57 . 1 1 59 LYS C 1 1 60 VAL N  1 1 60 VAL CA 1 1 60 VAL C     -123.7       -49.4 2l30_ambr001 59 LYS C 2l30_ambr001 60 VAL N  2l30_ambr001 60 VAL CA 2l30_ambr001 60 VAL C 1 1 
        58 . 1 1 60 VAL N 1 1 60 VAL CA 1 1 60 VAL C  1 1 61 GLY N -46.899998  -3.8000002 2l30_ambr001 60 VAL N 2l30_ambr001 60 VAL CA 2l30_ambr001 60 VAL C  2l30_ambr001 61 GLY N 1 1 
        59 . 1 1 61 GLY C 1 1 62 HIS N  1 1 62 HIS CA 1 1 62 HIS C     -129.8  -60.299995 2l30_ambr001 61 GLY C 2l30_ambr001 62 HIE N  2l30_ambr001 62 HIE CA 2l30_ambr001 62 HIE C 1 1 
        60 . 1 1 62 HIS N 1 1 62 HIS CA 1 1 62 HIS C  1 1 63 SER N      128.5       151.7 2l30_ambr001 62 HIE N 2l30_ambr001 62 HIE CA 2l30_ambr001 62 HIE C  2l30_ambr001 63 SER N 1 1 
        61 . 1 1 62 HIS C 1 1 63 SER N  1 1 63 SER CA 1 1 63 SER C     -143.5       -50.4 2l30_ambr001 62 HIE C 2l30_ambr001 63 SER N  2l30_ambr001 63 SER CA 2l30_ambr001 63 SER C 1 1 
        62 . 1 1 63 SER N 1 1 63 SER CA 1 1 63 SER C  1 1 64 ILE N      117.3       154.0 2l30_ambr001 63 SER N 2l30_ambr001 63 SER CA 2l30_ambr001 63 SER C  2l30_ambr001 64 ILE N 1 1 
        63 . 1 1 63 SER C 1 1 64 ILE N  1 1 64 ILE CA 1 1 64 ILE C     -154.2       -72.1 2l30_ambr001 63 SER C 2l30_ambr001 64 ILE N  2l30_ambr001 64 ILE CA 2l30_ambr001 64 ILE C 1 1 
        64 . 1 1 64 ILE N 1 1 64 ILE CA 1 1 64 ILE C  1 1 65 ARG N      119.3       139.3 2l30_ambr001 64 ILE N 2l30_ambr001 64 ILE CA 2l30_ambr001 64 ILE C  2l30_ambr001 65 ARG N 1 1 
        65 . 1 1 67 PRO N 1 1 67 PRO CA 1 1 67 PRO C  1 1 68 ASP N      -40.7       -16.7 2l30_ambr001 67 PRO N 2l30_ambr001 67 PRO CA 2l30_ambr001 67 PRO C  2l30_ambr001 68 ASP N 1 1 
        66 . 1 1 67 PRO C 1 1 68 ASP N  1 1 68 ASP CA 1 1 68 ASP C      -84.8       -44.8 2l30_ambr001 67 PRO C 2l30_ambr001 68 ASP N  2l30_ambr001 68 ASP CA 2l30_ambr001 68 ASP C 1 1 
        67 . 1 1 68 ASP N 1 1 68 ASP CA 1 1 68 ASP C  1 1 69 VAL N      -32.6       -10.0 2l30_ambr001 68 ASP N 2l30_ambr001 68 ASP CA 2l30_ambr001 68 ASP C  2l30_ambr001 69 VAL N 1 1 
        68 . 1 1 68 ASP C 1 1 69 VAL N  1 1 69 VAL CA 1 1 69 VAL C     -141.7       -37.6 2l30_ambr001 68 ASP C 2l30_ambr001 69 VAL N  2l30_ambr001 69 VAL CA 2l30_ambr001 69 VAL C 1 1 
        69 . 1 1 69 VAL N 1 1 69 VAL CA 1 1 69 VAL C  1 1 70 GLU N      -46.4       -19.5 2l30_ambr001 69 VAL N 2l30_ambr001 69 VAL CA 2l30_ambr001 69 VAL C  2l30_ambr001 70 GLU N 1 1 
        70 . 1 1 70 GLU C 1 1 71 VAL N  1 1 71 VAL CA 1 1 71 VAL C     -129.5       -48.8 2l30_ambr001 70 GLU C 2l30_ambr001 71 VAL N  2l30_ambr001 71 VAL CA 2l30_ambr001 71 VAL C 1 1 
        71 . 1 1 71 VAL N 1 1 71 VAL CA 1 1 71 VAL C  1 1 72 ASP N   73.59999       113.3 2l30_ambr001 71 VAL N 2l30_ambr001 71 VAL CA 2l30_ambr001 71 VAL C  2l30_ambr001 72 ASP N 1 1 
        72 . 1 1 71 VAL C 1 1 72 ASP N  1 1 72 ASP CA 1 1 72 ASP C     -141.7       -15.6 2l30_ambr001 71 VAL C 2l30_ambr001 72 ASP N  2l30_ambr001 72 ASP CA 2l30_ambr001 72 ASP C 1 1 
        73 . 1 1 72 ASP N 1 1 72 ASP CA 1 1 72 ASP C  1 1 73 GLY N 119.899994       143.6 2l30_ambr001 72 ASP N 2l30_ambr001 72 ASP CA 2l30_ambr001 72 ASP C  2l30_ambr001 73 GLY N 1 1 
        74 . 1 1 73 GLY C 1 1 74 PHE N  1 1 74 PHE CA 1 1 74 PHE C      -75.6       -35.6 2l30_ambr001 73 GLY C 2l30_ambr001 74 PHE N  2l30_ambr001 74 PHE CA 2l30_ambr001 74 PHE C 1 1 
        75 . 1 1 74 PHE N 1 1 74 PHE CA 1 1 74 PHE C  1 1 75 SER N      -58.8       -26.7 2l30_ambr001 74 PHE N 2l30_ambr001 74 PHE CA 2l30_ambr001 74 PHE C  2l30_ambr001 75 SER N 1 1 
        76 . 1 1 74 PHE C 1 1 75 SER N  1 1 75 SER CA 1 1 75 SER C      -87.9       -47.9 2l30_ambr001 74 PHE C 2l30_ambr001 75 SER N  2l30_ambr001 75 SER CA 2l30_ambr001 75 SER C 1 1 
        77 . 1 1 75 SER N 1 1 75 SER CA 1 1 75 SER C  1 1 76 GLU N      -30.0        -6.3 2l30_ambr001 75 SER N 2l30_ambr001 75 SER CA 2l30_ambr001 75 SER C  2l30_ambr001 76 GLU N 1 1 
        78 . 1 1 75 SER C 1 1 76 GLU N  1 1 76 GLU CA 1 1 76 GLU C     -135.4  -56.199997 2l30_ambr001 75 SER C 2l30_ambr001 76 GLU N  2l30_ambr001 76 GLU CA 2l30_ambr001 76 GLU C 1 1 
        79 . 1 1 76 GLU N 1 1 76 GLU CA 1 1 76 GLU C  1 1 77 LEU N      -30.3        19.5 2l30_ambr001 76 GLU N 2l30_ambr001 76 GLU CA 2l30_ambr001 76 GLU C  2l30_ambr001 77 LEU N 1 1 
        80 . 1 1 77 LEU C 1 1 78 ARG N  1 1 78 ARG CA 1 1 78 ARG C     -143.0       -21.9 2l30_ambr001 77 LEU C 2l30_ambr001 78 ARG N  2l30_ambr001 78 ARG CA 2l30_ambr001 78 ARG C 1 1 
        81 . 1 1 78 ARG N 1 1 78 ARG CA 1 1 78 ARG C  1 1 79 TRP N      141.6       166.9 2l30_ambr001 78 ARG N 2l30_ambr001 78 ARG CA 2l30_ambr001 78 ARG C  2l30_ambr001 79 TRP N 1 1 
        82 . 1 1 78 ARG C 1 1 79 TRP N  1 1 79 TRP CA 1 1 79 TRP C      -77.6       -37.6 2l30_ambr001 78 ARG C 2l30_ambr001 79 TRP N  2l30_ambr001 79 TRP CA 2l30_ambr001 79 TRP C 1 1 
        83 . 1 1 79 TRP N 1 1 79 TRP CA 1 1 79 TRP C  1 1 80 ASP N      -53.6       -33.6 2l30_ambr001 79 TRP N 2l30_ambr001 79 TRP CA 2l30_ambr001 79 TRP C  2l30_ambr001 80 ASP N 1 1 
        84 . 1 1 79 TRP C 1 1 80 ASP N  1 1 80 ASP CA 1 1 80 ASP C      -81.3       -41.3 2l30_ambr001 79 TRP C 2l30_ambr001 80 ASP N  2l30_ambr001 80 ASP CA 2l30_ambr001 80 ASP C 1 1 
        85 . 1 1 80 ASP N 1 1 80 ASP CA 1 1 80 ASP C  1 1 81 ASP N      -50.8  -30.800001 2l30_ambr001 80 ASP N 2l30_ambr001 80 ASP CA 2l30_ambr001 80 ASP C  2l30_ambr001 81 ASP N 1 1 
        86 . 1 1 80 ASP C 1 1 81 ASP N  1 1 81 ASP CA 1 1 81 ASP C      -85.7       -45.7 2l30_ambr001 80 ASP C 2l30_ambr001 81 ASP N  2l30_ambr001 81 ASP CA 2l30_ambr001 81 ASP C 1 1 
        87 . 1 1 81 ASP N 1 1 81 ASP CA 1 1 81 ASP C  1 1 82 GLN N      -50.6  -30.599998 2l30_ambr001 81 ASP N 2l30_ambr001 81 ASP CA 2l30_ambr001 81 ASP C  2l30_ambr001 82 GLN N 1 1 
        88 . 1 1 81 ASP C 1 1 82 GLN N  1 1 82 GLN CA 1 1 82 GLN C      -82.3       -42.3 2l30_ambr001 81 ASP C 2l30_ambr001 82 GLN N  2l30_ambr001 82 GLN CA 2l30_ambr001 82 GLN C 1 1 
        89 . 1 1 82 GLN N 1 1 82 GLN CA 1 1 82 GLN C  1 1 83 GLN N      -51.8  -31.799997 2l30_ambr001 82 GLN N 2l30_ambr001 82 GLN CA 2l30_ambr001 82 GLN C  2l30_ambr001 83 GLN N 1 1 
        90 . 1 1 82 GLN C 1 1 83 GLN N  1 1 83 GLN CA 1 1 83 GLN C      -84.8       -44.8 2l30_ambr001 82 GLN C 2l30_ambr001 83 GLN N  2l30_ambr001 83 GLN CA 2l30_ambr001 83 GLN C 1 1 
        91 . 1 1 83 GLN N 1 1 83 GLN CA 1 1 83 GLN C  1 1 84 LYS N      -47.5       -27.5 2l30_ambr001 83 GLN N 2l30_ambr001 83 GLN CA 2l30_ambr001 83 GLN C  2l30_ambr001 84 LYS N 1 1 
        92 . 1 1 83 GLN C 1 1 84 LYS N  1 1 84 LYS CA 1 1 84 LYS C      -84.2       -44.2 2l30_ambr001 83 GLN C 2l30_ambr001 84 LYS N  2l30_ambr001 84 LYS CA 2l30_ambr001 84 LYS C 1 1 
        93 . 1 1 84 LYS N 1 1 84 LYS CA 1 1 84 LYS C  1 1 85 VAL N -54.299995       -34.3 2l30_ambr001 84 LYS N 2l30_ambr001 84 LYS CA 2l30_ambr001 84 LYS C  2l30_ambr001 85 VAL N 1 1 
        94 . 1 1 84 LYS C 1 1 85 VAL N  1 1 85 VAL CA 1 1 85 VAL C      -84.3       -44.3 2l30_ambr001 84 LYS C 2l30_ambr001 85 VAL N  2l30_ambr001 85 VAL CA 2l30_ambr001 85 VAL C 1 1 
        95 . 1 1 85 VAL N 1 1 85 VAL CA 1 1 85 VAL C  1 1 86 LYS N      -52.5       -32.5 2l30_ambr001 85 VAL N 2l30_ambr001 85 VAL CA 2l30_ambr001 85 VAL C  2l30_ambr001 86 LYS N 1 1 
        96 . 1 1 85 VAL C 1 1 86 LYS N  1 1 86 LYS CA 1 1 86 LYS C      -81.2       -41.1 2l30_ambr001 85 VAL C 2l30_ambr001 86 LYS N  2l30_ambr001 86 LYS CA 2l30_ambr001 86 LYS C 1 1 
        97 . 1 1 86 LYS N 1 1 86 LYS CA 1 1 86 LYS C  1 1 87 LYS N      -48.9       -28.9 2l30_ambr001 86 LYS N 2l30_ambr001 86 LYS CA 2l30_ambr001 86 LYS C  2l30_ambr001 87 LYS N 1 1 
        98 . 1 1 86 LYS C 1 1 87 LYS N  1 1 87 LYS CA 1 1 87 LYS C      -82.0       -42.0 2l30_ambr001 86 LYS C 2l30_ambr001 87 LYS N  2l30_ambr001 87 LYS CA 2l30_ambr001 87 LYS C 1 1 
        99 . 1 1 87 LYS N 1 1 87 LYS CA 1 1 87 LYS C  1 1 88 THR N      -50.5  -30.499998 2l30_ambr001 87 LYS N 2l30_ambr001 87 LYS CA 2l30_ambr001 87 LYS C  2l30_ambr001 88 THR N 1 1 
       100 . 1 1 87 LYS C 1 1 88 THR N  1 1 88 THR CA 1 1 88 THR C      -84.2       -44.2 2l30_ambr001 87 LYS C 2l30_ambr001 88 THR N  2l30_ambr001 88 THR CA 2l30_ambr001 88 THR C 1 1 
       101 . 1 1 88 THR N 1 1 88 THR CA 1 1 88 THR C  1 1 89 ALA N      -51.8  -31.799997 2l30_ambr001 88 THR N 2l30_ambr001 88 THR CA 2l30_ambr001 88 THR C  2l30_ambr001 89 ALA N 1 1 
       102 . 1 1 88 THR C 1 1 89 ALA N  1 1 89 ALA CA 1 1 89 ALA C      -86.3       -46.3 2l30_ambr001 88 THR C 2l30_ambr001 89 ALA N  2l30_ambr001 89 ALA CA 2l30_ambr001 89 ALA C 1 1 
       103 . 1 1 89 ALA N 1 1 89 ALA CA 1 1 89 ALA C  1 1 90 GLU N      -39.2       -11.7 2l30_ambr001 89 ALA N 2l30_ambr001 89 ALA CA 2l30_ambr001 89 ALA C  2l30_ambr001 90 GLU N 1 1 
       104 . 1 1 89 ALA C 1 1 90 GLU N  1 1 90 GLU CA 1 1 90 GLU C      -86.9  -46.899998 2l30_ambr001 89 ALA C 2l30_ambr001 90 GLU N  2l30_ambr001 90 GLU CA 2l30_ambr001 90 GLU C 1 1 
       105 . 1 1 90 GLU N 1 1 90 GLU CA 1 1 90 GLU C  1 1 91 ALA N      -45.4  -15.299999 2l30_ambr001 90 GLU N 2l30_ambr001 90 GLU CA 2l30_ambr001 90 GLU C  2l30_ambr001 91 ALA N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C    0.549   0.321  20.115 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C    1.011   1.770  19.913 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C   -0.163   2.674  19.465 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C    1.037   6.604  20.402 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C    0.198   4.164  19.382 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H    2.495   2.756  18.845 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H    1.838   1.471  18.049 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H    2.896   1.224  19.269 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H    1.364   2.128  20.881 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H   -0.534   2.347  18.493 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H   -0.981   2.580  20.180 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H    0.058   7.005  20.140 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H    1.456   7.188  21.221 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H    1.699   6.673  19.538 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H    0.917   4.319  18.578 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H   -0.707   4.715  19.123 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N    2.144   1.816  18.950 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O    1.081  -0.599  19.489 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S    0.872   4.871  20.914 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 ALA C    C   -1.722  -1.724  19.885 1.00 . A A .   2 ALA C    1 1 
        1    21 1 1   2 ALA CA   C   -1.032  -1.238  21.179 1.00 . A A .   2 ALA CA   1 1 
        1    22 1 1   2 ALA CB   C   -2.003  -1.188  22.365 1.00 . A A .   2 ALA CB   1 1 
        1    23 1 1   2 ALA H    H   -0.833   0.857  21.507 1.00 . A A .   2 ALA H    1 1 
        1    24 1 1   2 ALA HA   H   -0.239  -1.946  21.429 1.00 . A A .   2 ALA HA   1 1 
        1    25 1 1   2 ALA HB1  H   -2.809  -0.482  22.163 1.00 . A A .   2 ALA HB1  1 1 
        1    26 1 1   2 ALA HB2  H   -2.431  -2.178  22.529 1.00 . A A .   2 ALA HB2  1 1 
        1    27 1 1   2 ALA HB3  H   -1.472  -0.881  23.268 1.00 . A A .   2 ALA HB3  1 1 
        1    28 1 1   2 ALA N    N   -0.431   0.085  20.995 1.00 . A A .   2 ALA N    1 1 
        1    29 1 1   2 ALA O    O   -2.538  -1.012  19.296 1.00 . A A .   2 ALA O    1 1 
        1    30 1 1   3 GLU C    C   -1.816  -2.843  16.930 1.00 . A A .   3 GLU C    1 1 
        1    31 1 1   3 GLU CA   C   -1.928  -3.623  18.259 1.00 . A A .   3 GLU CA   1 1 
        1    32 1 1   3 GLU CB   C   -3.342  -4.182  18.538 1.00 . A A .   3 GLU CB   1 1 
        1    33 1 1   3 GLU CD   C   -2.523  -6.237  19.828 1.00 . A A .   3 GLU CD   1 1 
        1    34 1 1   3 GLU CG   C   -3.470  -5.021  19.821 1.00 . A A .   3 GLU CG   1 1 
        1    35 1 1   3 GLU H    H   -0.731  -3.469  20.012 1.00 . A A .   3 GLU H    1 1 
        1    36 1 1   3 GLU HA   H   -1.265  -4.471  18.085 1.00 . A A .   3 GLU HA   1 1 
        1    37 1 1   3 GLU HB2  H   -4.043  -3.349  18.605 1.00 . A A .   3 GLU HB2  1 1 
        1    38 1 1   3 GLU HB3  H   -3.648  -4.804  17.700 1.00 . A A .   3 GLU HB3  1 1 
        1    39 1 1   3 GLU HG2  H   -3.278  -4.389  20.692 1.00 . A A .   3 GLU HG2  1 1 
        1    40 1 1   3 GLU HG3  H   -4.505  -5.362  19.904 1.00 . A A .   3 GLU HG3  1 1 
        1    41 1 1   3 GLU N    N   -1.389  -2.943  19.451 1.00 . A A .   3 GLU N    1 1 
        1    42 1 1   3 GLU O    O   -2.594  -3.050  15.995 1.00 . A A .   3 GLU O    1 1 
        1    43 1 1   3 GLU OE1  O   -2.907  -7.315  19.312 1.00 . A A .   3 GLU OE1  1 1 
        1    44 1 1   3 GLU OE2  O   -1.390  -6.126  20.357 1.00 . A A .   3 GLU OE2  1 1 
        1    45 1 1   4 SER C    C   -0.299  -2.063  14.319 1.00 . A A .   4 SER C    1 1 
        1    46 1 1   4 SER CA   C   -0.458  -1.221  15.599 1.00 . A A .   4 SER CA   1 1 
        1    47 1 1   4 SER CB   C    0.863  -0.491  15.850 1.00 . A A .   4 SER CB   1 1 
        1    48 1 1   4 SER H    H   -0.218  -1.832  17.628 1.00 . A A .   4 SER H    1 1 
        1    49 1 1   4 SER HA   H   -1.241  -0.486  15.415 1.00 . A A .   4 SER HA   1 1 
        1    50 1 1   4 SER HB2  H    1.546  -1.187  16.343 1.00 . A A .   4 SER HB2  1 1 
        1    51 1 1   4 SER HB3  H    1.297  -0.171  14.902 1.00 . A A .   4 SER HB3  1 1 
        1    52 1 1   4 SER HG   H    0.123   1.292  16.169 1.00 . A A .   4 SER HG   1 1 
        1    53 1 1   4 SER N    N   -0.792  -1.991  16.809 1.00 . A A .   4 SER N    1 1 
        1    54 1 1   4 SER O    O   -0.542  -1.549  13.227 1.00 . A A .   4 SER O    1 1 
        1    55 1 1   4 SER OG   O    0.659   0.649  16.674 1.00 . A A .   4 SER OG   1 1 
        1    56 1 1   5 SER C    C   -0.764  -5.407  13.240 1.00 . A A .   5 SER C    1 1 
        1    57 1 1   5 SER CA   C    0.269  -4.279  13.313 1.00 . A A .   5 SER CA   1 1 
        1    58 1 1   5 SER CB   C    1.711  -4.807  13.290 1.00 . A A .   5 SER CB   1 1 
        1    59 1 1   5 SER H    H    0.278  -3.681  15.367 1.00 . A A .   5 SER H    1 1 
        1    60 1 1   5 SER HA   H    0.111  -3.744  12.381 1.00 . A A .   5 SER HA   1 1 
        1    61 1 1   5 SER HB2  H    1.862  -5.478  14.137 1.00 . A A .   5 SER HB2  1 1 
        1    62 1 1   5 SER HB3  H    1.870  -5.361  12.363 1.00 . A A .   5 SER HB3  1 1 
        1    63 1 1   5 SER HG   H    3.549  -4.128  13.328 1.00 . A A .   5 SER HG   1 1 
        1    64 1 1   5 SER N    N    0.064  -3.346  14.440 1.00 . A A .   5 SER N    1 1 
        1    65 1 1   5 SER O    O   -0.568  -6.394  12.527 1.00 . A A .   5 SER O    1 1 
        1    66 1 1   5 SER OG   O    2.652  -3.745  13.359 1.00 . A A .   5 SER OG   1 1 
        1    67 1 1   6 ASP C    C   -3.972  -5.918  12.628 1.00 . A A .   6 ASP C    1 1 
        1    68 1 1   6 ASP CA   C   -3.040  -6.191  13.835 1.00 . A A .   6 ASP CA   1 1 
        1    69 1 1   6 ASP CB   C   -3.759  -6.261  15.192 1.00 . A A .   6 ASP CB   1 1 
        1    70 1 1   6 ASP CG   C   -4.749  -7.439  15.287 1.00 . A A .   6 ASP CG   1 1 
        1    71 1 1   6 ASP H    H   -2.027  -4.427  14.489 1.00 . A A .   6 ASP H    1 1 
        1    72 1 1   6 ASP HA   H   -2.596  -7.166  13.653 1.00 . A A .   6 ASP HA   1 1 
        1    73 1 1   6 ASP HB2  H   -3.010  -6.381  15.977 1.00 . A A .   6 ASP HB2  1 1 
        1    74 1 1   6 ASP HB3  H   -4.281  -5.317  15.364 1.00 . A A .   6 ASP HB3  1 1 
        1    75 1 1   6 ASP N    N   -1.909  -5.255  13.914 1.00 . A A .   6 ASP N    1 1 
        1    76 1 1   6 ASP O    O   -5.200  -5.982  12.717 1.00 . A A .   6 ASP O    1 1 
        1    77 1 1   6 ASP OD1  O   -4.405  -8.562  14.843 1.00 . A A .   6 ASP OD1  1 1 
        1    78 1 1   6 ASP OD2  O   -5.861  -7.259  15.842 1.00 . A A .   6 ASP OD2  1 1 
        1    79 1 1   7 LYS C    C   -3.441  -6.391   9.190 1.00 . A A .   7 LYS C    1 1 
        1    80 1 1   7 LYS CA   C   -3.970  -5.351  10.173 1.00 . A A .   7 LYS CA   1 1 
        1    81 1 1   7 LYS CB   C   -3.709  -3.895   9.720 1.00 . A A .   7 LYS CB   1 1 
        1    82 1 1   7 LYS CD   C   -3.274  -2.332  11.696 1.00 . A A .   7 LYS CD   1 1 
        1    83 1 1   7 LYS CE   C   -3.885  -1.407  12.758 1.00 . A A .   7 LYS CE   1 1 
        1    84 1 1   7 LYS CG   C   -4.301  -2.836  10.670 1.00 . A A .   7 LYS CG   1 1 
        1    85 1 1   7 LYS H    H   -2.349  -5.570  11.498 1.00 . A A .   7 LYS H    1 1 
        1    86 1 1   7 LYS HA   H   -5.046  -5.501  10.199 1.00 . A A .   7 LYS HA   1 1 
        1    87 1 1   7 LYS HB2  H   -2.638  -3.724   9.592 1.00 . A A .   7 LYS HB2  1 1 
        1    88 1 1   7 LYS HB3  H   -4.178  -3.748   8.749 1.00 . A A .   7 LYS HB3  1 1 
        1    89 1 1   7 LYS HD2  H   -2.837  -3.180  12.214 1.00 . A A .   7 LYS HD2  1 1 
        1    90 1 1   7 LYS HD3  H   -2.463  -1.825  11.172 1.00 . A A .   7 LYS HD3  1 1 
        1    91 1 1   7 LYS HE2  H   -4.742  -1.910  13.215 1.00 . A A .   7 LYS HE2  1 1 
        1    92 1 1   7 LYS HE3  H   -3.137  -1.251  13.542 1.00 . A A .   7 LYS HE3  1 1 
        1    93 1 1   7 LYS HG2  H   -4.639  -1.990  10.072 1.00 . A A .   7 LYS HG2  1 1 
        1    94 1 1   7 LYS HG3  H   -5.167  -3.253  11.186 1.00 . A A .   7 LYS HG3  1 1 
        1    95 1 1   7 LYS HZ1  H   -4.671   0.506  12.928 1.00 . A A .   7 LYS HZ1  1 1 
        1    96 1 1   7 LYS HZ2  H   -3.491   0.399  11.802 1.00 . A A .   7 LYS HZ2  1 1 
        1    97 1 1   7 LYS HZ3  H   -4.997  -0.190  11.487 1.00 . A A .   7 LYS HZ3  1 1 
        1    98 1 1   7 LYS N    N   -3.360  -5.579  11.487 1.00 . A A .   7 LYS N    1 1 
        1    99 1 1   7 LYS NZ   N   -4.293  -0.090  12.205 1.00 . A A .   7 LYS NZ   1 1 
        1   100 1 1   7 LYS O    O   -2.642  -7.259   9.551 1.00 . A A .   7 LYS O    1 1 
        1   101 1 1   8 LEU C    C   -2.537  -6.099   5.873 1.00 . A A .   8 LEU C    1 1 
        1   102 1 1   8 LEU CA   C   -3.323  -7.013   6.800 1.00 . A A .   8 LEU CA   1 1 
        1   103 1 1   8 LEU CB   C   -4.489  -7.615   6.002 1.00 . A A .   8 LEU CB   1 1 
        1   104 1 1   8 LEU CD1  C   -6.652  -8.800   5.861 1.00 . A A .   8 LEU CD1  1 1 
        1   105 1 1   8 LEU CD2  C   -4.820  -9.789   7.253 1.00 . A A .   8 LEU CD2  1 1 
        1   106 1 1   8 LEU CG   C   -5.476  -8.494   6.781 1.00 . A A .   8 LEU CG   1 1 
        1   107 1 1   8 LEU H    H   -4.580  -5.584   7.757 1.00 . A A .   8 LEU H    1 1 
        1   108 1 1   8 LEU HA   H   -2.615  -7.790   7.110 1.00 . A A .   8 LEU HA   1 1 
        1   109 1 1   8 LEU HB2  H   -5.051  -6.787   5.569 1.00 . A A .   8 LEU HB2  1 1 
        1   110 1 1   8 LEU HB3  H   -4.077  -8.200   5.178 1.00 . A A .   8 LEU HB3  1 1 
        1   111 1 1   8 LEU HD11 H   -7.098  -7.856   5.537 1.00 . A A .   8 LEU HD11 1 1 
        1   112 1 1   8 LEU HD12 H   -6.305  -9.349   4.987 1.00 . A A .   8 LEU HD12 1 1 
        1   113 1 1   8 LEU HD13 H   -7.399  -9.385   6.395 1.00 . A A .   8 LEU HD13 1 1 
        1   114 1 1   8 LEU HD21 H   -4.422 -10.336   6.399 1.00 . A A .   8 LEU HD21 1 1 
        1   115 1 1   8 LEU HD22 H   -4.010  -9.555   7.943 1.00 . A A .   8 LEU HD22 1 1 
        1   116 1 1   8 LEU HD23 H   -5.556 -10.404   7.770 1.00 . A A .   8 LEU HD23 1 1 
        1   117 1 1   8 LEU HG   H   -5.860  -7.954   7.646 1.00 . A A .   8 LEU HG   1 1 
        1   118 1 1   8 LEU N    N   -3.872  -6.279   7.941 1.00 . A A .   8 LEU N    1 1 
        1   119 1 1   8 LEU O    O   -1.657  -6.589   5.172 1.00 . A A .   8 LEU O    1 1 
        1   120 1 1   9 TYR C    C   -1.940  -2.579   5.316 1.00 . A A .   9 TYR C    1 1 
        1   121 1 1   9 TYR CA   C   -2.432  -3.918   4.758 1.00 . A A .   9 TYR CA   1 1 
        1   122 1 1   9 TYR CB   C   -3.604  -3.741   3.767 1.00 . A A .   9 TYR CB   1 1 
        1   123 1 1   9 TYR CD1  C   -3.559  -6.112   2.844 1.00 . A A .   9 TYR CD1  1 1 
        1   124 1 1   9 TYR CD2  C   -5.712  -5.080   3.284 1.00 . A A .   9 TYR CD2  1 1 
        1   125 1 1   9 TYR CE1  C   -4.197  -7.308   2.473 1.00 . A A .   9 TYR CE1  1 1 
        1   126 1 1   9 TYR CE2  C   -6.361  -6.274   2.911 1.00 . A A .   9 TYR CE2  1 1 
        1   127 1 1   9 TYR CG   C   -4.305  -5.005   3.285 1.00 . A A .   9 TYR CG   1 1 
        1   128 1 1   9 TYR CZ   C   -5.603  -7.403   2.526 1.00 . A A .   9 TYR CZ   1 1 
        1   129 1 1   9 TYR H    H   -3.466  -4.405   6.546 1.00 . A A .   9 TYR H    1 1 
        1   130 1 1   9 TYR HA   H   -1.601  -4.369   4.216 1.00 . A A .   9 TYR HA   1 1 
        1   131 1 1   9 TYR HB2  H   -4.356  -3.128   4.252 1.00 . A A .   9 TYR HB2  1 1 
        1   132 1 1   9 TYR HB3  H   -3.239  -3.208   2.890 1.00 . A A .   9 TYR HB3  1 1 
        1   133 1 1   9 TYR HD1  H   -2.484  -6.051   2.819 1.00 . A A .   9 TYR HD1  1 1 
        1   134 1 1   9 TYR HD2  H   -6.297  -4.220   3.580 1.00 . A A .   9 TYR HD2  1 1 
        1   135 1 1   9 TYR HE1  H   -3.606  -8.159   2.173 1.00 . A A .   9 TYR HE1  1 1 
        1   136 1 1   9 TYR HE2  H   -7.438  -6.331   2.919 1.00 . A A .   9 TYR HE2  1 1 
        1   137 1 1   9 TYR HH   H   -5.572  -9.251   1.939 1.00 . A A .   9 TYR HH   1 1 
        1   138 1 1   9 TYR N    N   -2.839  -4.800   5.848 1.00 . A A .   9 TYR N    1 1 
        1   139 1 1   9 TYR O    O   -2.358  -2.144   6.390 1.00 . A A .   9 TYR O    1 1 
        1   140 1 1   9 TYR OH   O   -6.217  -8.584   2.232 1.00 . A A .   9 TYR OH   1 1 
        1   141 1 1  10 ARG C    C   -0.376   0.225   3.616 1.00 . A A .  10 ARG C    1 1 
        1   142 1 1  10 ARG CA   C   -0.466  -0.609   4.897 1.00 . A A .  10 ARG CA   1 1 
        1   143 1 1  10 ARG CB   C    0.887  -0.829   5.616 1.00 . A A .  10 ARG CB   1 1 
        1   144 1 1  10 ARG CD   C    1.563   1.595   6.266 1.00 . A A .  10 ARG CD   1 1 
        1   145 1 1  10 ARG CG   C    1.940   0.297   5.531 1.00 . A A .  10 ARG CG   1 1 
        1   146 1 1  10 ARG CZ   C    2.606   1.736   8.561 1.00 . A A .  10 ARG CZ   1 1 
        1   147 1 1  10 ARG H    H   -0.708  -2.372   3.738 1.00 . A A .  10 ARG H    1 1 
        1   148 1 1  10 ARG HA   H   -1.142  -0.107   5.584 1.00 . A A .  10 ARG HA   1 1 
        1   149 1 1  10 ARG HB2  H    0.687  -1.047   6.666 1.00 . A A .  10 ARG HB2  1 1 
        1   150 1 1  10 ARG HB3  H    1.342  -1.728   5.203 1.00 . A A .  10 ARG HB3  1 1 
        1   151 1 1  10 ARG HD2  H    2.232   2.392   5.942 1.00 . A A .  10 ARG HD2  1 1 
        1   152 1 1  10 ARG HD3  H    0.554   1.872   5.974 1.00 . A A .  10 ARG HD3  1 1 
        1   153 1 1  10 ARG HE   H    0.776   1.126   8.205 1.00 . A A .  10 ARG HE   1 1 
        1   154 1 1  10 ARG HG2  H    2.877  -0.079   5.942 1.00 . A A .  10 ARG HG2  1 1 
        1   155 1 1  10 ARG HG3  H    2.134   0.529   4.481 1.00 . A A .  10 ARG HG3  1 1 
        1   156 1 1  10 ARG HH11 H    3.831   2.729   7.295 1.00 . A A .  10 ARG HH11 1 1 
        1   157 1 1  10 ARG HH12 H    4.442   2.459   8.892 1.00 . A A .  10 ARG HH12 1 1 
        1   158 1 1  10 ARG HH21 H    1.516   1.176  10.115 1.00 . A A .  10 ARG HH21 1 1 
        1   159 1 1  10 ARG HH22 H    3.163   1.675  10.496 1.00 . A A .  10 ARG HH22 1 1 
        1   160 1 1  10 ARG N    N   -1.051  -1.917   4.579 1.00 . A A .  10 ARG N    1 1 
        1   161 1 1  10 ARG NE   N    1.611   1.461   7.736 1.00 . A A .  10 ARG NE   1 1 
        1   162 1 1  10 ARG NH1  N    3.737   2.273   8.204 1.00 . A A .  10 ARG NH1  1 1 
        1   163 1 1  10 ARG NH2  N    2.449   1.470   9.821 1.00 . A A .  10 ARG NH2  1 1 
        1   164 1 1  10 ARG O    O   -0.109  -0.330   2.554 1.00 . A A .  10 ARG O    1 1 
        1   165 1 1  11 VAL C    C    0.230   3.805   3.216 1.00 . A A .  11 VAL C    1 1 
        1   166 1 1  11 VAL CA   C   -0.374   2.525   2.635 1.00 . A A .  11 VAL CA   1 1 
        1   167 1 1  11 VAL CB   C   -1.698   2.801   1.898 1.00 . A A .  11 VAL CB   1 1 
        1   168 1 1  11 VAL CG1  C   -2.668   3.708   2.667 1.00 . A A .  11 VAL CG1  1 1 
        1   169 1 1  11 VAL CG2  C   -1.461   3.472   0.540 1.00 . A A .  11 VAL CG2  1 1 
        1   170 1 1  11 VAL H    H   -0.897   1.896   4.607 1.00 . A A .  11 VAL H    1 1 
        1   171 1 1  11 VAL HA   H    0.341   2.120   1.914 1.00 . A A .  11 VAL HA   1 1 
        1   172 1 1  11 VAL HB   H   -2.182   1.830   1.749 1.00 . A A .  11 VAL HB   1 1 
        1   173 1 1  11 VAL HG11 H   -2.301   4.730   2.686 1.00 . A A .  11 VAL HG11 1 1 
        1   174 1 1  11 VAL HG12 H   -3.647   3.696   2.188 1.00 . A A .  11 VAL HG12 1 1 
        1   175 1 1  11 VAL HG13 H   -2.761   3.375   3.696 1.00 . A A .  11 VAL HG13 1 1 
        1   176 1 1  11 VAL HG21 H   -1.061   4.474   0.686 1.00 . A A .  11 VAL HG21 1 1 
        1   177 1 1  11 VAL HG22 H   -0.744   2.911  -0.049 1.00 . A A .  11 VAL HG22 1 1 
        1   178 1 1  11 VAL HG23 H   -2.399   3.532  -0.011 1.00 . A A .  11 VAL HG23 1 1 
        1   179 1 1  11 VAL N    N   -0.592   1.535   3.706 1.00 . A A .  11 VAL N    1 1 
        1   180 1 1  11 VAL O    O   -0.123   4.207   4.324 1.00 . A A .  11 VAL O    1 1 
        1   181 1 1  12 GLU C    C    2.587   6.318   1.763 1.00 . A A .  12 GLU C    1 1 
        1   182 1 1  12 GLU CA   C    1.803   5.687   2.916 1.00 . A A .  12 GLU CA   1 1 
        1   183 1 1  12 GLU CB   C    2.748   5.452   4.115 1.00 . A A .  12 GLU CB   1 1 
        1   184 1 1  12 GLU CD   C    4.822   4.384   5.048 1.00 . A A .  12 GLU CD   1 1 
        1   185 1 1  12 GLU CG   C    3.851   4.418   3.864 1.00 . A A .  12 GLU CG   1 1 
        1   186 1 1  12 GLU H    H    1.412   4.086   1.581 1.00 . A A .  12 GLU H    1 1 
        1   187 1 1  12 GLU HA   H    1.043   6.410   3.214 1.00 . A A .  12 GLU HA   1 1 
        1   188 1 1  12 GLU HB2  H    3.214   6.400   4.385 1.00 . A A .  12 GLU HB2  1 1 
        1   189 1 1  12 GLU HB3  H    2.165   5.125   4.976 1.00 . A A .  12 GLU HB3  1 1 
        1   190 1 1  12 GLU HG2  H    3.395   3.436   3.734 1.00 . A A .  12 GLU HG2  1 1 
        1   191 1 1  12 GLU HG3  H    4.396   4.670   2.952 1.00 . A A .  12 GLU HG3  1 1 
        1   192 1 1  12 GLU N    N    1.156   4.440   2.500 1.00 . A A .  12 GLU N    1 1 
        1   193 1 1  12 GLU O    O    2.904   5.670   0.763 1.00 . A A .  12 GLU O    1 1 
        1   194 1 1  12 GLU OE1  O    4.408   3.978   6.156 1.00 . A A .  12 GLU OE1  1 1 
        1   195 1 1  12 GLU OE2  O    5.996   4.791   4.870 1.00 . A A .  12 GLU OE2  1 1 
        1   196 1 1  13 TYR C    C    5.374   7.839   1.510 1.00 . A A .  13 TYR C    1 1 
        1   197 1 1  13 TYR CA   C    3.950   8.240   1.102 1.00 . A A .  13 TYR CA   1 1 
        1   198 1 1  13 TYR CB   C    3.747   9.753   1.172 1.00 . A A .  13 TYR CB   1 1 
        1   199 1 1  13 TYR CD1  C    1.733   9.870  -0.364 1.00 . A A .  13 TYR CD1  1 1 
        1   200 1 1  13 TYR CD2  C    1.612  10.957   1.815 1.00 . A A .  13 TYR CD2  1 1 
        1   201 1 1  13 TYR CE1  C    0.464  10.384  -0.693 1.00 . A A .  13 TYR CE1  1 1 
        1   202 1 1  13 TYR CE2  C    0.338  11.463   1.495 1.00 . A A .  13 TYR CE2  1 1 
        1   203 1 1  13 TYR CG   C    2.330  10.203   0.867 1.00 . A A .  13 TYR CG   1 1 
        1   204 1 1  13 TYR CZ   C   -0.227  11.200   0.228 1.00 . A A .  13 TYR CZ   1 1 
        1   205 1 1  13 TYR H    H    2.609   8.087   2.743 1.00 . A A .  13 TYR H    1 1 
        1   206 1 1  13 TYR HA   H    3.792   7.927   0.072 1.00 . A A .  13 TYR HA   1 1 
        1   207 1 1  13 TYR HB2  H    4.029  10.099   2.168 1.00 . A A .  13 TYR HB2  1 1 
        1   208 1 1  13 TYR HB3  H    4.420  10.229   0.457 1.00 . A A .  13 TYR HB3  1 1 
        1   209 1 1  13 TYR HD1  H    2.249   9.214  -1.053 1.00 . A A .  13 TYR HD1  1 1 
        1   210 1 1  13 TYR HD2  H    2.042  11.151   2.788 1.00 . A A .  13 TYR HD2  1 1 
        1   211 1 1  13 TYR HE1  H    0.020  10.160  -1.652 1.00 . A A .  13 TYR HE1  1 1 
        1   212 1 1  13 TYR HE2  H   -0.201  12.071   2.207 1.00 . A A .  13 TYR HE2  1 1 
        1   213 1 1  13 TYR HH   H   -1.655  11.588  -1.035 1.00 . A A .  13 TYR HH   1 1 
        1   214 1 1  13 TYR N    N    2.952   7.584   1.937 1.00 . A A .  13 TYR N    1 1 
        1   215 1 1  13 TYR O    O    5.675   7.692   2.698 1.00 . A A .  13 TYR O    1 1 
        1   216 1 1  13 TYR OH   O   -1.436  11.731  -0.091 1.00 . A A .  13 TYR OH   1 1 
        1   217 1 1  14 ALA C    C    8.549   8.502   1.071 1.00 . A A .  14 ALA C    1 1 
        1   218 1 1  14 ALA CA   C    7.656   7.290   0.738 1.00 . A A .  14 ALA CA   1 1 
        1   219 1 1  14 ALA CB   C    8.115   6.550  -0.523 1.00 . A A .  14 ALA CB   1 1 
        1   220 1 1  14 ALA H    H    5.943   7.803  -0.419 1.00 . A A .  14 ALA H    1 1 
        1   221 1 1  14 ALA HA   H    7.705   6.589   1.571 1.00 . A A .  14 ALA HA   1 1 
        1   222 1 1  14 ALA HB1  H    8.031   7.210  -1.386 1.00 . A A .  14 ALA HB1  1 1 
        1   223 1 1  14 ALA HB2  H    9.152   6.227  -0.414 1.00 . A A .  14 ALA HB2  1 1 
        1   224 1 1  14 ALA HB3  H    7.483   5.679  -0.695 1.00 . A A .  14 ALA HB3  1 1 
        1   225 1 1  14 ALA N    N    6.265   7.681   0.535 1.00 . A A .  14 ALA N    1 1 
        1   226 1 1  14 ALA O    O    8.774   9.369   0.223 1.00 . A A .  14 ALA O    1 1 
        1   227 1 1  15 LYS C    C   11.397   9.546   2.155 1.00 . A A .  15 LYS C    1 1 
        1   228 1 1  15 LYS CA   C    9.990   9.628   2.768 1.00 . A A .  15 LYS CA   1 1 
        1   229 1 1  15 LYS CB   C   10.088   9.618   4.310 1.00 . A A .  15 LYS CB   1 1 
        1   230 1 1  15 LYS CD   C    7.550   9.571   4.974 1.00 . A A .  15 LYS CD   1 1 
        1   231 1 1  15 LYS CE   C    7.582   8.154   5.567 1.00 . A A .  15 LYS CE   1 1 
        1   232 1 1  15 LYS CG   C    8.911  10.279   5.055 1.00 . A A .  15 LYS CG   1 1 
        1   233 1 1  15 LYS H    H    8.862   7.802   2.936 1.00 . A A .  15 LYS H    1 1 
        1   234 1 1  15 LYS HA   H    9.585  10.593   2.455 1.00 . A A .  15 LYS HA   1 1 
        1   235 1 1  15 LYS HB2  H   10.240   8.600   4.670 1.00 . A A .  15 LYS HB2  1 1 
        1   236 1 1  15 LYS HB3  H   10.978  10.184   4.592 1.00 . A A .  15 LYS HB3  1 1 
        1   237 1 1  15 LYS HD2  H    6.824  10.168   5.529 1.00 . A A .  15 LYS HD2  1 1 
        1   238 1 1  15 LYS HD3  H    7.223   9.539   3.935 1.00 . A A .  15 LYS HD3  1 1 
        1   239 1 1  15 LYS HE2  H    8.339   7.565   5.046 1.00 . A A .  15 LYS HE2  1 1 
        1   240 1 1  15 LYS HE3  H    7.872   8.211   6.621 1.00 . A A .  15 LYS HE3  1 1 
        1   241 1 1  15 LYS HG2  H    9.185  10.360   6.108 1.00 . A A .  15 LYS HG2  1 1 
        1   242 1 1  15 LYS HG3  H    8.792  11.295   4.674 1.00 . A A .  15 LYS HG3  1 1 
        1   243 1 1  15 LYS HZ1  H    5.918   7.571   4.481 1.00 . A A .  15 LYS HZ1  1 1 
        1   244 1 1  15 LYS HZ2  H    6.317   6.489   5.616 1.00 . A A .  15 LYS HZ2  1 1 
        1   245 1 1  15 LYS HZ3  H    5.575   7.897   6.058 1.00 . A A .  15 LYS HZ3  1 1 
        1   246 1 1  15 LYS N    N    9.096   8.546   2.295 1.00 . A A .  15 LYS N    1 1 
        1   247 1 1  15 LYS NZ   N    6.261   7.492   5.436 1.00 . A A .  15 LYS NZ   1 1 
        1   248 1 1  15 LYS O    O   12.044  10.571   1.948 1.00 . A A .  15 LYS O    1 1 
        1   249 1 1  16 SER C    C   13.170   6.611   0.654 1.00 . A A .  16 SER C    1 1 
        1   250 1 1  16 SER CA   C   13.163   8.029   1.246 1.00 . A A .  16 SER CA   1 1 
        1   251 1 1  16 SER CB   C   14.307   8.198   2.250 1.00 . A A .  16 SER CB   1 1 
        1   252 1 1  16 SER H    H   11.243   7.554   1.996 1.00 . A A .  16 SER H    1 1 
        1   253 1 1  16 SER HA   H   13.329   8.732   0.436 1.00 . A A .  16 SER HA   1 1 
        1   254 1 1  16 SER HB2  H   14.107   9.046   2.906 1.00 . A A .  16 SER HB2  1 1 
        1   255 1 1  16 SER HB3  H   14.415   7.298   2.857 1.00 . A A .  16 SER HB3  1 1 
        1   256 1 1  16 SER HG   H   16.251   8.418   2.136 1.00 . A A .  16 SER HG   1 1 
        1   257 1 1  16 SER N    N   11.868   8.332   1.866 1.00 . A A .  16 SER N    1 1 
        1   258 1 1  16 SER O    O   12.314   5.786   0.984 1.00 . A A .  16 SER O    1 1 
        1   259 1 1  16 SER OG   O   15.494   8.461   1.518 1.00 . A A .  16 SER OG   1 1 
        1   260 1 1  17 GLY C    C   14.724   3.830  -0.220 1.00 . A A .  17 GLY C    1 1 
        1   261 1 1  17 GLY CA   C   14.252   5.072  -0.993 1.00 . A A .  17 GLY CA   1 1 
        1   262 1 1  17 GLY H    H   14.857   7.018  -0.360 1.00 . A A .  17 GLY H    1 1 
        1   263 1 1  17 GLY HA2  H   13.278   4.848  -1.428 1.00 . A A .  17 GLY HA2  1 1 
        1   264 1 1  17 GLY HA3  H   14.953   5.239  -1.807 1.00 . A A .  17 GLY HA3  1 1 
        1   265 1 1  17 GLY N    N   14.143   6.315  -0.211 1.00 . A A .  17 GLY N    1 1 
        1   266 1 1  17 GLY O    O   15.386   2.966  -0.798 1.00 . A A .  17 GLY O    1 1 
        1   267 1 1  18 ARG C    C   14.093   1.383   1.901 1.00 . A A .  18 ARG C    1 1 
        1   268 1 1  18 ARG CA   C   14.910   2.680   1.994 1.00 . A A .  18 ARG CA   1 1 
        1   269 1 1  18 ARG CB   C   14.942   3.205   3.443 1.00 . A A .  18 ARG CB   1 1 
        1   270 1 1  18 ARG CD   C   17.348   4.094   3.375 1.00 . A A .  18 ARG CD   1 1 
        1   271 1 1  18 ARG CG   C   15.875   4.407   3.678 1.00 . A A .  18 ARG CG   1 1 
        1   272 1 1  18 ARG CZ   C   18.777   5.514   4.875 1.00 . A A .  18 ARG CZ   1 1 
        1   273 1 1  18 ARG H    H   13.860   4.486   1.472 1.00 . A A .  18 ARG H    1 1 
        1   274 1 1  18 ARG HA   H   15.923   2.394   1.705 1.00 . A A .  18 ARG HA   1 1 
        1   275 1 1  18 ARG HB2  H   13.930   3.491   3.737 1.00 . A A .  18 ARG HB2  1 1 
        1   276 1 1  18 ARG HB3  H   15.259   2.396   4.105 1.00 . A A .  18 ARG HB3  1 1 
        1   277 1 1  18 ARG HD2  H   17.656   3.206   3.929 1.00 . A A .  18 ARG HD2  1 1 
        1   278 1 1  18 ARG HD3  H   17.453   3.875   2.311 1.00 . A A .  18 ARG HD3  1 1 
        1   279 1 1  18 ARG HE   H   18.447   5.867   2.951 1.00 . A A .  18 ARG HE   1 1 
        1   280 1 1  18 ARG HG2  H   15.556   5.246   3.060 1.00 . A A .  18 ARG HG2  1 1 
        1   281 1 1  18 ARG HG3  H   15.786   4.707   4.723 1.00 . A A .  18 ARG HG3  1 1 
        1   282 1 1  18 ARG HH11 H   17.997   3.964   5.865 1.00 . A A .  18 ARG HH11 1 1 
        1   283 1 1  18 ARG HH12 H   19.018   5.014   6.809 1.00 . A A .  18 ARG HH12 1 1 
        1   284 1 1  18 ARG HH21 H   19.730   7.154   4.217 1.00 . A A .  18 ARG HH21 1 1 
        1   285 1 1  18 ARG HH22 H   19.967   6.769   5.896 1.00 . A A .  18 ARG HH22 1 1 
        1   286 1 1  18 ARG N    N   14.442   3.751   1.088 1.00 . A A .  18 ARG N    1 1 
        1   287 1 1  18 ARG NE   N   18.226   5.236   3.705 1.00 . A A .  18 ARG NE   1 1 
        1   288 1 1  18 ARG NH1  N   18.582   4.778   5.933 1.00 . A A .  18 ARG NH1  1 1 
        1   289 1 1  18 ARG NH2  N   19.546   6.557   5.007 1.00 . A A .  18 ARG NH2  1 1 
        1   290 1 1  18 ARG O    O   14.580   0.333   2.322 1.00 . A A .  18 ARG O    1 1 
        1   291 1 1  19 ALA C    C   12.216  -0.281  -0.328 1.00 . A A .  19 ALA C    1 1 
        1   292 1 1  19 ALA CA   C   12.027   0.278   1.097 1.00 . A A .  19 ALA CA   1 1 
        1   293 1 1  19 ALA CB   C   10.568   0.644   1.392 1.00 . A A .  19 ALA CB   1 1 
        1   294 1 1  19 ALA H    H   12.571   2.335   1.001 1.00 . A A .  19 ALA H    1 1 
        1   295 1 1  19 ALA HA   H   12.302  -0.514   1.797 1.00 . A A .  19 ALA HA   1 1 
        1   296 1 1  19 ALA HB1  H   10.225   1.404   0.691 1.00 . A A .  19 ALA HB1  1 1 
        1   297 1 1  19 ALA HB2  H    9.945  -0.245   1.289 1.00 . A A .  19 ALA HB2  1 1 
        1   298 1 1  19 ALA HB3  H   10.474   1.017   2.413 1.00 . A A .  19 ALA HB3  1 1 
        1   299 1 1  19 ALA N    N   12.879   1.442   1.348 1.00 . A A .  19 ALA N    1 1 
        1   300 1 1  19 ALA O    O   12.452   0.466  -1.284 1.00 . A A .  19 ALA O    1 1 
        1   301 1 1  20 SER C    C   11.025  -3.208  -2.027 1.00 . A A .  20 SER C    1 1 
        1   302 1 1  20 SER CA   C   12.239  -2.334  -1.729 1.00 . A A .  20 SER CA   1 1 
        1   303 1 1  20 SER CB   C   13.516  -3.183  -1.708 1.00 . A A .  20 SER CB   1 1 
        1   304 1 1  20 SER H    H   11.756  -2.135   0.334 1.00 . A A .  20 SER H    1 1 
        1   305 1 1  20 SER HA   H   12.329  -1.622  -2.541 1.00 . A A .  20 SER HA   1 1 
        1   306 1 1  20 SER HB2  H   13.470  -3.878  -0.867 1.00 . A A .  20 SER HB2  1 1 
        1   307 1 1  20 SER HB3  H   13.582  -3.762  -2.632 1.00 . A A .  20 SER HB3  1 1 
        1   308 1 1  20 SER HG   H   14.858  -1.972  -2.458 1.00 . A A .  20 SER HG   1 1 
        1   309 1 1  20 SER N    N   12.056  -1.599  -0.469 1.00 . A A .  20 SER N    1 1 
        1   310 1 1  20 SER O    O   10.406  -3.745  -1.106 1.00 . A A .  20 SER O    1 1 
        1   311 1 1  20 SER OG   O   14.672  -2.370  -1.585 1.00 . A A .  20 SER OG   1 1 
        1   312 1 1  21 CYS C    C    9.561  -5.525  -3.628 1.00 . A A .  21 CYS C    1 1 
        1   313 1 1  21 CYS CA   C    9.461  -3.997  -3.758 1.00 . A A .  21 CYS CA   1 1 
        1   314 1 1  21 CYS CB   C    9.161  -3.523  -5.182 1.00 . A A .  21 CYS CB   1 1 
        1   315 1 1  21 CYS H    H   11.313  -2.984  -4.022 1.00 . A A .  21 CYS H    1 1 
        1   316 1 1  21 CYS HA   H    8.650  -3.652  -3.122 1.00 . A A .  21 CYS HA   1 1 
        1   317 1 1  21 CYS HB2  H    9.197  -2.430  -5.198 1.00 . A A .  21 CYS HB2  1 1 
        1   318 1 1  21 CYS HB3  H    9.931  -3.903  -5.857 1.00 . A A .  21 CYS HB3  1 1 
        1   319 1 1  21 CYS N    N   10.682  -3.341  -3.309 1.00 . A A .  21 CYS N    1 1 
        1   320 1 1  21 CYS O    O   10.311  -6.189  -4.349 1.00 . A A .  21 CYS O    1 1 
        1   321 1 1  21 CYS SG   S    7.506  -4.083  -5.734 1.00 . A A .  21 CYS SG   1 1 
        1   322 1 1  22 LYS C    C    7.922  -8.284  -3.601 1.00 . A A .  22 LYS C    1 1 
        1   323 1 1  22 LYS CA   C    8.663  -7.544  -2.479 1.00 . A A .  22 LYS CA   1 1 
        1   324 1 1  22 LYS CB   C    7.976  -7.789  -1.119 1.00 . A A .  22 LYS CB   1 1 
        1   325 1 1  22 LYS CD   C   10.138  -7.888   0.307 1.00 . A A .  22 LYS CD   1 1 
        1   326 1 1  22 LYS CE   C   10.068  -9.409   0.502 1.00 . A A .  22 LYS CE   1 1 
        1   327 1 1  22 LYS CG   C    8.752  -7.266   0.104 1.00 . A A .  22 LYS CG   1 1 
        1   328 1 1  22 LYS H    H    8.235  -5.468  -2.121 1.00 . A A .  22 LYS H    1 1 
        1   329 1 1  22 LYS HA   H    9.668  -7.970  -2.471 1.00 . A A .  22 LYS HA   1 1 
        1   330 1 1  22 LYS HB2  H    6.998  -7.307  -1.129 1.00 . A A .  22 LYS HB2  1 1 
        1   331 1 1  22 LYS HB3  H    7.801  -8.858  -0.990 1.00 . A A .  22 LYS HB3  1 1 
        1   332 1 1  22 LYS HD2  H   10.762  -7.645  -0.554 1.00 . A A .  22 LYS HD2  1 1 
        1   333 1 1  22 LYS HD3  H   10.574  -7.436   1.200 1.00 . A A .  22 LYS HD3  1 1 
        1   334 1 1  22 LYS HE2  H    9.392  -9.625   1.336 1.00 . A A .  22 LYS HE2  1 1 
        1   335 1 1  22 LYS HE3  H    9.644  -9.864  -0.398 1.00 . A A .  22 LYS HE3  1 1 
        1   336 1 1  22 LYS HG2  H    8.872  -6.187   0.024 1.00 . A A .  22 LYS HG2  1 1 
        1   337 1 1  22 LYS HG3  H    8.161  -7.463   0.996 1.00 . A A .  22 LYS HG3  1 1 
        1   338 1 1  22 LYS HZ1  H   11.355 -10.990   0.901 1.00 . A A .  22 LYS HZ1  1 1 
        1   339 1 1  22 LYS HZ2  H   12.049  -9.815   0.008 1.00 . A A .  22 LYS HZ2  1 1 
        1   340 1 1  22 LYS HZ3  H   11.818  -9.597   1.612 1.00 . A A .  22 LYS HZ3  1 1 
        1   341 1 1  22 LYS N    N    8.773  -6.096  -2.714 1.00 . A A .  22 LYS N    1 1 
        1   342 1 1  22 LYS NZ   N   11.411  -9.988   0.773 1.00 . A A .  22 LYS NZ   1 1 
        1   343 1 1  22 LYS O    O    7.929  -9.517  -3.614 1.00 . A A .  22 LYS O    1 1 
        1   344 1 1  23 LYS C    C    7.209  -8.089  -6.992 1.00 . A A .  23 LYS C    1 1 
        1   345 1 1  23 LYS CA   C    6.488  -8.110  -5.634 1.00 . A A .  23 LYS CA   1 1 
        1   346 1 1  23 LYS CB   C    5.098  -7.444  -5.649 1.00 . A A .  23 LYS CB   1 1 
        1   347 1 1  23 LYS CD   C    3.959  -9.438  -6.858 1.00 . A A .  23 LYS CD   1 1 
        1   348 1 1  23 LYS CE   C    3.082  -9.801  -8.060 1.00 . A A .  23 LYS CE   1 1 
        1   349 1 1  23 LYS CG   C    4.188  -7.915  -6.802 1.00 . A A .  23 LYS CG   1 1 
        1   350 1 1  23 LYS H    H    7.377  -6.547  -4.442 1.00 . A A .  23 LYS H    1 1 
        1   351 1 1  23 LYS HA   H    6.322  -9.166  -5.419 1.00 . A A .  23 LYS HA   1 1 
        1   352 1 1  23 LYS HB2  H    4.598  -7.641  -4.695 1.00 . A A .  23 LYS HB2  1 1 
        1   353 1 1  23 LYS HB3  H    5.228  -6.366  -5.731 1.00 . A A .  23 LYS HB3  1 1 
        1   354 1 1  23 LYS HD2  H    4.908  -9.961  -6.958 1.00 . A A .  23 LYS HD2  1 1 
        1   355 1 1  23 LYS HD3  H    3.478  -9.767  -5.938 1.00 . A A .  23 LYS HD3  1 1 
        1   356 1 1  23 LYS HE2  H    2.131  -9.275  -7.965 1.00 . A A .  23 LYS HE2  1 1 
        1   357 1 1  23 LYS HE3  H    3.572  -9.446  -8.972 1.00 . A A .  23 LYS HE3  1 1 
        1   358 1 1  23 LYS HG2  H    3.222  -7.421  -6.693 1.00 . A A .  23 LYS HG2  1 1 
        1   359 1 1  23 LYS HG3  H    4.618  -7.586  -7.749 1.00 . A A .  23 LYS HG3  1 1 
        1   360 1 1  23 LYS HZ1  H    3.708 -11.773  -8.284 1.00 . A A .  23 LYS HZ1  1 1 
        1   361 1 1  23 LYS HZ2  H    2.396 -11.624  -7.319 1.00 . A A .  23 LYS HZ2  1 1 
        1   362 1 1  23 LYS HZ3  H    2.240 -11.486  -8.935 1.00 . A A .  23 LYS HZ3  1 1 
        1   363 1 1  23 LYS N    N    7.292  -7.552  -4.532 1.00 . A A .  23 LYS N    1 1 
        1   364 1 1  23 LYS NZ   N    2.842 -11.266  -8.152 1.00 . A A .  23 LYS NZ   1 1 
        1   365 1 1  23 LYS O    O    7.284  -9.148  -7.618 1.00 . A A .  23 LYS O    1 1 
        1   366 1 1  24 CYS C    C   10.033  -6.805  -8.580 1.00 . A A .  24 CYS C    1 1 
        1   367 1 1  24 CYS CA   C    8.489  -6.850  -8.716 1.00 . A A .  24 CYS CA   1 1 
        1   368 1 1  24 CYS CB   C    7.852  -5.799  -9.651 1.00 . A A .  24 CYS CB   1 1 
        1   369 1 1  24 CYS H    H    7.676  -6.119  -6.861 1.00 . A A .  24 CYS H    1 1 
        1   370 1 1  24 CYS HA   H    8.317  -7.788  -9.244 1.00 . A A .  24 CYS HA   1 1 
        1   371 1 1  24 CYS HB2  H    8.204  -6.018 -10.662 1.00 . A A .  24 CYS HB2  1 1 
        1   372 1 1  24 CYS HB3  H    6.767  -5.934  -9.656 1.00 . A A .  24 CYS HB3  1 1 
        1   373 1 1  24 CYS N    N    7.757  -6.949  -7.436 1.00 . A A .  24 CYS N    1 1 
        1   374 1 1  24 CYS O    O   10.750  -6.745  -9.584 1.00 . A A .  24 CYS O    1 1 
        1   375 1 1  24 CYS SG   S    8.274  -4.055  -9.272 1.00 . A A .  24 CYS SG   1 1 
        1   376 1 1  25 SER C    C   12.881  -5.888  -7.369 1.00 . A A .  25 SER C    1 1 
        1   377 1 1  25 SER CA   C   11.977  -7.082  -7.002 1.00 . A A .  25 SER CA   1 1 
        1   378 1 1  25 SER CB   C   12.545  -8.424  -7.496 1.00 . A A .  25 SER CB   1 1 
        1   379 1 1  25 SER H    H    9.896  -6.976  -6.581 1.00 . A A .  25 SER H    1 1 
        1   380 1 1  25 SER HA   H   12.012  -7.134  -5.913 1.00 . A A .  25 SER HA   1 1 
        1   381 1 1  25 SER HB2  H   12.565  -8.433  -8.587 1.00 . A A .  25 SER HB2  1 1 
        1   382 1 1  25 SER HB3  H   13.568  -8.536  -7.131 1.00 . A A .  25 SER HB3  1 1 
        1   383 1 1  25 SER HG   H   12.170 -10.344  -7.349 1.00 . A A .  25 SER HG   1 1 
        1   384 1 1  25 SER N    N   10.548  -6.935  -7.350 1.00 . A A .  25 SER N    1 1 
        1   385 1 1  25 SER O    O   14.107  -6.017  -7.403 1.00 . A A .  25 SER O    1 1 
        1   386 1 1  25 SER OG   O   11.767  -9.517  -7.022 1.00 . A A .  25 SER OG   1 1 
        1   387 1 1  26 GLU C    C   12.952  -2.649  -6.393 1.00 . A A .  26 GLU C    1 1 
        1   388 1 1  26 GLU CA   C   12.996  -3.424  -7.732 1.00 . A A .  26 GLU CA   1 1 
        1   389 1 1  26 GLU CB   C   12.402  -2.621  -8.910 1.00 . A A .  26 GLU CB   1 1 
        1   390 1 1  26 GLU CD   C   13.868  -3.782 -10.700 1.00 . A A .  26 GLU CD   1 1 
        1   391 1 1  26 GLU CG   C   12.451  -3.339 -10.271 1.00 . A A .  26 GLU CG   1 1 
        1   392 1 1  26 GLU H    H   11.287  -4.688  -7.560 1.00 . A A .  26 GLU H    1 1 
        1   393 1 1  26 GLU HA   H   14.051  -3.595  -7.949 1.00 . A A .  26 GLU HA   1 1 
        1   394 1 1  26 GLU HB2  H   11.363  -2.383  -8.683 1.00 . A A .  26 GLU HB2  1 1 
        1   395 1 1  26 GLU HB3  H   12.942  -1.678  -9.009 1.00 . A A .  26 GLU HB3  1 1 
        1   396 1 1  26 GLU HG2  H   11.784  -4.202 -10.239 1.00 . A A .  26 GLU HG2  1 1 
        1   397 1 1  26 GLU HG3  H   12.052  -2.657 -11.027 1.00 . A A .  26 GLU HG3  1 1 
        1   398 1 1  26 GLU N    N   12.294  -4.713  -7.610 1.00 . A A .  26 GLU N    1 1 
        1   399 1 1  26 GLU O    O   12.649  -3.227  -5.347 1.00 . A A .  26 GLU O    1 1 
        1   400 1 1  26 GLU OE1  O   14.857  -3.059 -10.426 1.00 . A A .  26 GLU OE1  1 1 
        1   401 1 1  26 GLU OE2  O   14.002  -4.844 -11.357 1.00 . A A .  26 GLU OE2  1 1 
        1   402 1 1  27 SER C    C   12.208   0.704  -5.408 1.00 . A A .  27 SER C    1 1 
        1   403 1 1  27 SER CA   C   13.167  -0.472  -5.213 1.00 . A A .  27 SER CA   1 1 
        1   404 1 1  27 SER CB   C   14.551  -0.027  -4.741 1.00 . A A .  27 SER CB   1 1 
        1   405 1 1  27 SER H    H   13.439  -0.896  -7.281 1.00 . A A .  27 SER H    1 1 
        1   406 1 1  27 SER HA   H   12.745  -1.047  -4.398 1.00 . A A .  27 SER HA   1 1 
        1   407 1 1  27 SER HB2  H   15.077   0.457  -5.562 1.00 . A A .  27 SER HB2  1 1 
        1   408 1 1  27 SER HB3  H   14.428   0.676  -3.917 1.00 . A A .  27 SER HB3  1 1 
        1   409 1 1  27 SER HG   H   16.211  -0.852  -4.103 1.00 . A A .  27 SER HG   1 1 
        1   410 1 1  27 SER N    N   13.240  -1.343  -6.399 1.00 . A A .  27 SER N    1 1 
        1   411 1 1  27 SER O    O   11.853   1.062  -6.534 1.00 . A A .  27 SER O    1 1 
        1   412 1 1  27 SER OG   O   15.295  -1.144  -4.277 1.00 . A A .  27 SER OG   1 1 
        1   413 1 1  28 ILE C    C   11.007   3.617  -4.288 1.00 . A A .  28 ILE C    1 1 
        1   414 1 1  28 ILE CA   C   10.539   2.144  -4.295 1.00 . A A .  28 ILE CA   1 1 
        1   415 1 1  28 ILE CB   C    9.597   1.809  -3.114 1.00 . A A .  28 ILE CB   1 1 
        1   416 1 1  28 ILE CD1  C    8.385  -0.120  -1.894 1.00 . A A .  28 ILE CD1  1 1 
        1   417 1 1  28 ILE CG1  C    9.208   0.308  -3.112 1.00 . A A .  28 ILE CG1  1 1 
        1   418 1 1  28 ILE CG2  C    8.327   2.679  -3.177 1.00 . A A .  28 ILE CG2  1 1 
        1   419 1 1  28 ILE H    H   12.060   0.946  -3.398 1.00 . A A .  28 ILE H    1 1 
        1   420 1 1  28 ILE HA   H    9.976   1.947  -5.204 1.00 . A A .  28 ILE HA   1 1 
        1   421 1 1  28 ILE HB   H   10.123   2.024  -2.182 1.00 . A A .  28 ILE HB   1 1 
        1   422 1 1  28 ILE HD11 H    8.851   0.251  -0.983 1.00 . A A .  28 ILE HD11 1 1 
        1   423 1 1  28 ILE HD12 H    7.367   0.261  -1.966 1.00 . A A .  28 ILE HD12 1 1 
        1   424 1 1  28 ILE HD13 H    8.355  -1.207  -1.853 1.00 . A A .  28 ILE HD13 1 1 
        1   425 1 1  28 ILE HG12 H    8.653   0.068  -4.020 1.00 . A A .  28 ILE HG12 1 1 
        1   426 1 1  28 ILE HG13 H   10.109  -0.305  -3.098 1.00 . A A .  28 ILE HG13 1 1 
        1   427 1 1  28 ILE HG21 H    7.716   2.495  -2.299 1.00 . A A .  28 ILE HG21 1 1 
        1   428 1 1  28 ILE HG22 H    8.573   3.741  -3.183 1.00 . A A .  28 ILE HG22 1 1 
        1   429 1 1  28 ILE HG23 H    7.743   2.444  -4.069 1.00 . A A .  28 ILE HG23 1 1 
        1   430 1 1  28 ILE N    N   11.694   1.239  -4.297 1.00 . A A .  28 ILE N    1 1 
        1   431 1 1  28 ILE O    O   11.788   3.992  -3.408 1.00 . A A .  28 ILE O    1 1 
        1   432 1 1  29 PRO C    C   10.382   6.683  -4.065 1.00 . A A .  29 PRO C    1 1 
        1   433 1 1  29 PRO CA   C   10.899   5.889  -5.266 1.00 . A A .  29 PRO CA   1 1 
        1   434 1 1  29 PRO CB   C   10.326   6.446  -6.569 1.00 . A A .  29 PRO CB   1 1 
        1   435 1 1  29 PRO CD   C    9.658   4.151  -6.335 1.00 . A A .  29 PRO CD   1 1 
        1   436 1 1  29 PRO CG   C    9.190   5.487  -6.900 1.00 . A A .  29 PRO CG   1 1 
        1   437 1 1  29 PRO HA   H   11.980   5.981  -5.295 1.00 . A A .  29 PRO HA   1 1 
        1   438 1 1  29 PRO HB2  H    9.966   7.471  -6.465 1.00 . A A .  29 PRO HB2  1 1 
        1   439 1 1  29 PRO HB3  H   11.084   6.401  -7.345 1.00 . A A .  29 PRO HB3  1 1 
        1   440 1 1  29 PRO HD2  H    8.794   3.575  -6.006 1.00 . A A .  29 PRO HD2  1 1 
        1   441 1 1  29 PRO HD3  H   10.216   3.603  -7.095 1.00 . A A .  29 PRO HD3  1 1 
        1   442 1 1  29 PRO HG2  H    8.281   5.802  -6.387 1.00 . A A .  29 PRO HG2  1 1 
        1   443 1 1  29 PRO HG3  H    9.032   5.429  -7.973 1.00 . A A .  29 PRO HG3  1 1 
        1   444 1 1  29 PRO N    N   10.541   4.470  -5.225 1.00 . A A .  29 PRO N    1 1 
        1   445 1 1  29 PRO O    O    9.331   6.368  -3.502 1.00 . A A .  29 PRO O    1 1 
        1   446 1 1  30 LYS C    C    9.837   9.861  -3.258 1.00 . A A .  30 LYS C    1 1 
        1   447 1 1  30 LYS CA   C   10.690   8.724  -2.681 1.00 . A A .  30 LYS CA   1 1 
        1   448 1 1  30 LYS CB   C   11.911   9.186  -1.872 1.00 . A A .  30 LYS CB   1 1 
        1   449 1 1  30 LYS CD   C   14.223  10.290  -1.899 1.00 . A A .  30 LYS CD   1 1 
        1   450 1 1  30 LYS CE   C   14.066  11.167  -0.647 1.00 . A A .  30 LYS CE   1 1 
        1   451 1 1  30 LYS CG   C   12.892  10.082  -2.642 1.00 . A A .  30 LYS CG   1 1 
        1   452 1 1  30 LYS H    H   11.901   7.982  -4.301 1.00 . A A .  30 LYS H    1 1 
        1   453 1 1  30 LYS HA   H   10.045   8.202  -1.975 1.00 . A A .  30 LYS HA   1 1 
        1   454 1 1  30 LYS HB2  H   11.562   9.719  -0.987 1.00 . A A .  30 LYS HB2  1 1 
        1   455 1 1  30 LYS HB3  H   12.439   8.289  -1.551 1.00 . A A .  30 LYS HB3  1 1 
        1   456 1 1  30 LYS HD2  H   14.632   9.315  -1.627 1.00 . A A .  30 LYS HD2  1 1 
        1   457 1 1  30 LYS HD3  H   14.928  10.771  -2.577 1.00 . A A .  30 LYS HD3  1 1 
        1   458 1 1  30 LYS HE2  H   13.861  12.195  -0.963 1.00 . A A .  30 LYS HE2  1 1 
        1   459 1 1  30 LYS HE3  H   13.203  10.825  -0.072 1.00 . A A .  30 LYS HE3  1 1 
        1   460 1 1  30 LYS HG2  H   13.116   9.610  -3.596 1.00 . A A .  30 LYS HG2  1 1 
        1   461 1 1  30 LYS HG3  H   12.421  11.047  -2.825 1.00 . A A .  30 LYS HG3  1 1 
        1   462 1 1  30 LYS HZ1  H   15.170  11.722   1.020 1.00 . A A .  30 LYS HZ1  1 1 
        1   463 1 1  30 LYS HZ2  H   15.464  10.186   0.554 1.00 . A A .  30 LYS HZ2  1 1 
        1   464 1 1  30 LYS HZ3  H   16.101  11.440  -0.291 1.00 . A A .  30 LYS HZ3  1 1 
        1   465 1 1  30 LYS N    N   11.098   7.755  -3.713 1.00 . A A .  30 LYS N    1 1 
        1   466 1 1  30 LYS NZ   N   15.282  11.126   0.210 1.00 . A A .  30 LYS NZ   1 1 
        1   467 1 1  30 LYS O    O    9.837  10.103  -4.465 1.00 . A A .  30 LYS O    1 1 
        1   468 1 1  31 ASP C    C    6.959  10.808  -3.721 1.00 . A A .  31 ASP C    1 1 
        1   469 1 1  31 ASP CA   C    7.990  11.455  -2.761 1.00 . A A .  31 ASP CA   1 1 
        1   470 1 1  31 ASP CB   C    8.569  12.808  -3.218 1.00 . A A .  31 ASP CB   1 1 
        1   471 1 1  31 ASP CG   C    7.497  13.906  -3.332 1.00 . A A .  31 ASP CG   1 1 
        1   472 1 1  31 ASP H    H    9.141  10.263  -1.413 1.00 . A A .  31 ASP H    1 1 
        1   473 1 1  31 ASP HA   H    7.441  11.651  -1.839 1.00 . A A .  31 ASP HA   1 1 
        1   474 1 1  31 ASP HB2  H    9.317  13.133  -2.491 1.00 . A A .  31 ASP HB2  1 1 
        1   475 1 1  31 ASP HB3  H    9.074  12.680  -4.176 1.00 . A A .  31 ASP HB3  1 1 
        1   476 1 1  31 ASP N    N    9.074  10.528  -2.391 1.00 . A A .  31 ASP N    1 1 
        1   477 1 1  31 ASP O    O    6.502  11.406  -4.697 1.00 . A A .  31 ASP O    1 1 
        1   478 1 1  31 ASP OD1  O    6.767  14.149  -2.343 1.00 . A A .  31 ASP OD1  1 1 
        1   479 1 1  31 ASP OD2  O    7.399  14.545  -4.408 1.00 . A A .  31 ASP OD2  1 1 
        1   480 1 1  32 SER C    C    4.805   7.886  -3.223 1.00 . A A .  32 SER C    1 1 
        1   481 1 1  32 SER CA   C    5.667   8.709  -4.194 1.00 . A A .  32 SER CA   1 1 
        1   482 1 1  32 SER CB   C    6.429   7.795  -5.160 1.00 . A A .  32 SER CB   1 1 
        1   483 1 1  32 SER H    H    7.006   9.133  -2.610 1.00 . A A .  32 SER H    1 1 
        1   484 1 1  32 SER HA   H    5.001   9.345  -4.779 1.00 . A A .  32 SER HA   1 1 
        1   485 1 1  32 SER HB2  H    7.163   8.382  -5.715 1.00 . A A .  32 SER HB2  1 1 
        1   486 1 1  32 SER HB3  H    6.949   7.022  -4.593 1.00 . A A .  32 SER HB3  1 1 
        1   487 1 1  32 SER HG   H    5.779   6.269  -6.203 1.00 . A A .  32 SER HG   1 1 
        1   488 1 1  32 SER N    N    6.621   9.543  -3.449 1.00 . A A .  32 SER N    1 1 
        1   489 1 1  32 SER O    O    5.037   7.915  -2.013 1.00 . A A .  32 SER O    1 1 
        1   490 1 1  32 SER OG   O    5.524   7.203  -6.081 1.00 . A A .  32 SER OG   1 1 
        1   491 1 1  33 LEU C    C    3.274   4.875  -2.941 1.00 . A A .  33 LEU C    1 1 
        1   492 1 1  33 LEU CA   C    2.865   6.358  -2.942 1.00 . A A .  33 LEU CA   1 1 
        1   493 1 1  33 LEU CB   C    1.453   6.589  -3.516 1.00 . A A .  33 LEU CB   1 1 
        1   494 1 1  33 LEU CD1  C    0.100   6.612  -1.358 1.00 . A A .  33 LEU CD1  1 1 
        1   495 1 1  33 LEU CD2  C   -0.997   6.028  -3.482 1.00 . A A .  33 LEU CD2  1 1 
        1   496 1 1  33 LEU CG   C    0.317   5.933  -2.710 1.00 . A A .  33 LEU CG   1 1 
        1   497 1 1  33 LEU H    H    3.777   7.055  -4.733 1.00 . A A .  33 LEU H    1 1 
        1   498 1 1  33 LEU HA   H    2.885   6.716  -1.912 1.00 . A A .  33 LEU HA   1 1 
        1   499 1 1  33 LEU HB2  H    1.262   7.662  -3.574 1.00 . A A .  33 LEU HB2  1 1 
        1   500 1 1  33 LEU HB3  H    1.431   6.191  -4.532 1.00 . A A .  33 LEU HB3  1 1 
        1   501 1 1  33 LEU HD11 H    0.984   6.511  -0.736 1.00 . A A .  33 LEU HD11 1 1 
        1   502 1 1  33 LEU HD12 H   -0.121   7.669  -1.501 1.00 . A A .  33 LEU HD12 1 1 
        1   503 1 1  33 LEU HD13 H   -0.738   6.145  -0.848 1.00 . A A .  33 LEU HD13 1 1 
        1   504 1 1  33 LEU HD21 H   -0.885   5.553  -4.456 1.00 . A A .  33 LEU HD21 1 1 
        1   505 1 1  33 LEU HD22 H   -1.785   5.514  -2.931 1.00 . A A .  33 LEU HD22 1 1 
        1   506 1 1  33 LEU HD23 H   -1.271   7.075  -3.618 1.00 . A A .  33 LEU HD23 1 1 
        1   507 1 1  33 LEU HG   H    0.552   4.883  -2.553 1.00 . A A .  33 LEU HG   1 1 
        1   508 1 1  33 LEU N    N    3.810   7.155  -3.727 1.00 . A A .  33 LEU N    1 1 
        1   509 1 1  33 LEU O    O    3.618   4.317  -3.988 1.00 . A A .  33 LEU O    1 1 
        1   510 1 1  34 ARG C    C    2.578   2.103  -0.654 1.00 . A A .  34 ARG C    1 1 
        1   511 1 1  34 ARG CA   C    3.565   2.814  -1.573 1.00 . A A .  34 ARG CA   1 1 
        1   512 1 1  34 ARG CB   C    5.023   2.695  -1.087 1.00 . A A .  34 ARG CB   1 1 
        1   513 1 1  34 ARG CD   C    6.786   3.051   0.680 1.00 . A A .  34 ARG CD   1 1 
        1   514 1 1  34 ARG CG   C    5.321   3.303   0.295 1.00 . A A .  34 ARG CG   1 1 
        1   515 1 1  34 ARG CZ   C    8.309   4.007   2.430 1.00 . A A .  34 ARG CZ   1 1 
        1   516 1 1  34 ARG H    H    2.872   4.729  -0.957 1.00 . A A .  34 ARG H    1 1 
        1   517 1 1  34 ARG HA   H    3.504   2.300  -2.534 1.00 . A A .  34 ARG HA   1 1 
        1   518 1 1  34 ARG HB2  H    5.297   1.639  -1.068 1.00 . A A .  34 ARG HB2  1 1 
        1   519 1 1  34 ARG HB3  H    5.655   3.191  -1.824 1.00 . A A .  34 ARG HB3  1 1 
        1   520 1 1  34 ARG HD2  H    6.966   1.975   0.713 1.00 . A A .  34 ARG HD2  1 1 
        1   521 1 1  34 ARG HD3  H    7.423   3.481  -0.093 1.00 . A A .  34 ARG HD3  1 1 
        1   522 1 1  34 ARG HE   H    6.376   3.705   2.674 1.00 . A A .  34 ARG HE   1 1 
        1   523 1 1  34 ARG HG2  H    5.146   4.379   0.266 1.00 . A A .  34 ARG HG2  1 1 
        1   524 1 1  34 ARG HG3  H    4.671   2.853   1.046 1.00 . A A .  34 ARG HG3  1 1 
        1   525 1 1  34 ARG HH11 H    9.298   3.657   0.731 1.00 . A A .  34 ARG HH11 1 1 
        1   526 1 1  34 ARG HH12 H   10.261   4.311   2.024 1.00 . A A .  34 ARG HH12 1 1 
        1   527 1 1  34 ARG HH21 H    7.600   4.503   4.230 1.00 . A A .  34 ARG HH21 1 1 
        1   528 1 1  34 ARG HH22 H    9.342   4.638   4.035 1.00 . A A .  34 ARG HH22 1 1 
        1   529 1 1  34 ARG N    N    3.207   4.225  -1.774 1.00 . A A .  34 ARG N    1 1 
        1   530 1 1  34 ARG NE   N    7.120   3.635   1.995 1.00 . A A .  34 ARG NE   1 1 
        1   531 1 1  34 ARG NH1  N    9.375   3.979   1.679 1.00 . A A .  34 ARG NH1  1 1 
        1   532 1 1  34 ARG NH2  N    8.437   4.449   3.643 1.00 . A A .  34 ARG NH2  1 1 
        1   533 1 1  34 ARG O    O    1.894   2.732   0.152 1.00 . A A .  34 ARG O    1 1 
        1   534 1 1  35 MET C    C    2.589  -1.254   0.592 1.00 . A A .  35 MET C    1 1 
        1   535 1 1  35 MET CA   C    1.722  -0.132   0.020 1.00 . A A .  35 MET CA   1 1 
        1   536 1 1  35 MET CB   C    0.529  -0.680  -0.785 1.00 . A A .  35 MET CB   1 1 
        1   537 1 1  35 MET CE   C   -3.045  -0.856  -0.463 1.00 . A A .  35 MET CE   1 1 
        1   538 1 1  35 MET CG   C   -0.566   0.371  -0.991 1.00 . A A .  35 MET CG   1 1 
        1   539 1 1  35 MET H    H    3.188   0.355  -1.414 1.00 . A A .  35 MET H    1 1 
        1   540 1 1  35 MET HA   H    1.337   0.401   0.884 1.00 . A A .  35 MET HA   1 1 
        1   541 1 1  35 MET HB2  H    0.877  -1.042  -1.753 1.00 . A A .  35 MET HB2  1 1 
        1   542 1 1  35 MET HB3  H    0.087  -1.507  -0.234 1.00 . A A .  35 MET HB3  1 1 
        1   543 1 1  35 MET HE1  H   -3.380  -0.042   0.178 1.00 . A A .  35 MET HE1  1 1 
        1   544 1 1  35 MET HE2  H   -3.921  -1.388  -0.852 1.00 . A A .  35 MET HE2  1 1 
        1   545 1 1  35 MET HE3  H   -2.434  -1.539   0.128 1.00 . A A .  35 MET HE3  1 1 
        1   546 1 1  35 MET HG2  H   -0.859   0.745  -0.012 1.00 . A A .  35 MET HG2  1 1 
        1   547 1 1  35 MET HG3  H   -0.142   1.196  -1.564 1.00 . A A .  35 MET HG3  1 1 
        1   548 1 1  35 MET N    N    2.526   0.785  -0.783 1.00 . A A .  35 MET N    1 1 
        1   549 1 1  35 MET O    O    3.719  -1.482   0.160 1.00 . A A .  35 MET O    1 1 
        1   550 1 1  35 MET SD   S   -2.068  -0.191  -1.845 1.00 . A A .  35 MET SD   1 1 
        1   551 1 1  36 ALA C    C    1.676  -4.069   2.776 1.00 . A A .  36 ALA C    1 1 
        1   552 1 1  36 ALA CA   C    2.706  -3.066   2.249 1.00 . A A .  36 ALA CA   1 1 
        1   553 1 1  36 ALA CB   C    3.632  -2.555   3.355 1.00 . A A .  36 ALA CB   1 1 
        1   554 1 1  36 ALA H    H    1.144  -1.660   1.938 1.00 . A A .  36 ALA H    1 1 
        1   555 1 1  36 ALA HA   H    3.310  -3.580   1.508 1.00 . A A .  36 ALA HA   1 1 
        1   556 1 1  36 ALA HB1  H    4.481  -2.058   2.901 1.00 . A A .  36 ALA HB1  1 1 
        1   557 1 1  36 ALA HB2  H    3.116  -1.827   3.974 1.00 . A A .  36 ALA HB2  1 1 
        1   558 1 1  36 ALA HB3  H    3.991  -3.383   3.963 1.00 . A A .  36 ALA HB3  1 1 
        1   559 1 1  36 ALA N    N    2.070  -1.923   1.614 1.00 . A A .  36 ALA N    1 1 
        1   560 1 1  36 ALA O    O    0.498  -3.735   2.942 1.00 . A A .  36 ALA O    1 1 
        1   561 1 1  37 ILE C    C    1.864  -6.767   5.025 1.00 . A A .  37 ILE C    1 1 
        1   562 1 1  37 ILE CA   C    1.318  -6.353   3.665 1.00 . A A .  37 ILE CA   1 1 
        1   563 1 1  37 ILE CB   C    1.180  -7.527   2.669 1.00 . A A .  37 ILE CB   1 1 
        1   564 1 1  37 ILE CD1  C   -0.452  -8.545   1.000 1.00 . A A .  37 ILE CD1  1 1 
        1   565 1 1  37 ILE CG1  C   -0.273  -7.577   2.166 1.00 . A A .  37 ILE CG1  1 1 
        1   566 1 1  37 ILE CG2  C    1.592  -8.895   3.228 1.00 . A A .  37 ILE CG2  1 1 
        1   567 1 1  37 ILE H    H    3.113  -5.492   2.895 1.00 . A A .  37 ILE H    1 1 
        1   568 1 1  37 ILE HA   H    0.324  -5.953   3.853 1.00 . A A .  37 ILE HA   1 1 
        1   569 1 1  37 ILE HB   H    1.834  -7.334   1.817 1.00 . A A .  37 ILE HB   1 1 
        1   570 1 1  37 ILE HD11 H   -1.405  -8.343   0.512 1.00 . A A .  37 ILE HD11 1 1 
        1   571 1 1  37 ILE HD12 H    0.368  -8.404   0.296 1.00 . A A .  37 ILE HD12 1 1 
        1   572 1 1  37 ILE HD13 H   -0.437  -9.569   1.369 1.00 . A A .  37 ILE HD13 1 1 
        1   573 1 1  37 ILE HG12 H   -0.941  -7.869   2.977 1.00 . A A .  37 ILE HG12 1 1 
        1   574 1 1  37 ILE HG13 H   -0.560  -6.582   1.827 1.00 . A A .  37 ILE HG13 1 1 
        1   575 1 1  37 ILE HG21 H    0.900  -9.196   4.024 1.00 . A A .  37 ILE HG21 1 1 
        1   576 1 1  37 ILE HG22 H    1.597  -9.618   2.412 1.00 . A A .  37 ILE HG22 1 1 
        1   577 1 1  37 ILE HG23 H    2.611  -8.846   3.609 1.00 . A A .  37 ILE HG23 1 1 
        1   578 1 1  37 ILE N    N    2.136  -5.287   3.077 1.00 . A A .  37 ILE N    1 1 
        1   579 1 1  37 ILE O    O    3.075  -6.836   5.212 1.00 . A A .  37 ILE O    1 1 
        1   580 1 1  38 MET C    C    1.416  -8.993   7.424 1.00 . A A .  38 MET C    1 1 
        1   581 1 1  38 MET CA   C    1.317  -7.469   7.325 1.00 . A A .  38 MET CA   1 1 
        1   582 1 1  38 MET CB   C    0.271  -6.903   8.305 1.00 . A A .  38 MET CB   1 1 
        1   583 1 1  38 MET CE   C    2.670  -4.751   8.598 1.00 . A A .  38 MET CE   1 1 
        1   584 1 1  38 MET CG   C    0.010  -5.387   8.249 1.00 . A A .  38 MET CG   1 1 
        1   585 1 1  38 MET H    H   -0.005  -7.028   5.715 1.00 . A A .  38 MET H    1 1 
        1   586 1 1  38 MET HA   H    2.296  -7.072   7.571 1.00 . A A .  38 MET HA   1 1 
        1   587 1 1  38 MET HB2  H   -0.667  -7.399   8.076 1.00 . A A .  38 MET HB2  1 1 
        1   588 1 1  38 MET HB3  H    0.550  -7.165   9.324 1.00 . A A .  38 MET HB3  1 1 
        1   589 1 1  38 MET HE1  H    2.992  -5.722   8.974 1.00 . A A .  38 MET HE1  1 1 
        1   590 1 1  38 MET HE2  H    2.582  -4.800   7.510 1.00 . A A .  38 MET HE2  1 1 
        1   591 1 1  38 MET HE3  H    3.401  -3.996   8.884 1.00 . A A .  38 MET HE3  1 1 
        1   592 1 1  38 MET HG2  H    0.076  -5.032   7.220 1.00 . A A .  38 MET HG2  1 1 
        1   593 1 1  38 MET HG3  H   -1.015  -5.219   8.574 1.00 . A A .  38 MET HG3  1 1 
        1   594 1 1  38 MET N    N    0.977  -7.071   5.965 1.00 . A A .  38 MET N    1 1 
        1   595 1 1  38 MET O    O    0.398  -9.688   7.427 1.00 . A A .  38 MET O    1 1 
        1   596 1 1  38 MET SD   S    1.057  -4.346   9.299 1.00 . A A .  38 MET SD   1 1 
        1   597 1 1  39 VAL C    C    3.638 -11.254   9.015 1.00 . A A .  39 VAL C    1 1 
        1   598 1 1  39 VAL CA   C    2.912 -10.957   7.705 1.00 . A A .  39 VAL CA   1 1 
        1   599 1 1  39 VAL CB   C    3.651 -11.524   6.477 1.00 . A A .  39 VAL CB   1 1 
        1   600 1 1  39 VAL CG1  C    5.029 -10.894   6.262 1.00 . A A .  39 VAL CG1  1 1 
        1   601 1 1  39 VAL CG2  C    3.799 -13.048   6.518 1.00 . A A .  39 VAL CG2  1 1 
        1   602 1 1  39 VAL H    H    3.433  -8.872   7.506 1.00 . A A .  39 VAL H    1 1 
        1   603 1 1  39 VAL HA   H    1.960 -11.485   7.753 1.00 . A A .  39 VAL HA   1 1 
        1   604 1 1  39 VAL HB   H    3.046 -11.304   5.601 1.00 . A A .  39 VAL HB   1 1 
        1   605 1 1  39 VAL HG11 H    5.689 -11.104   7.103 1.00 . A A .  39 VAL HG11 1 1 
        1   606 1 1  39 VAL HG12 H    5.462 -11.311   5.355 1.00 . A A .  39 VAL HG12 1 1 
        1   607 1 1  39 VAL HG13 H    4.937  -9.815   6.139 1.00 . A A .  39 VAL HG13 1 1 
        1   608 1 1  39 VAL HG21 H    4.183 -13.401   5.560 1.00 . A A .  39 VAL HG21 1 1 
        1   609 1 1  39 VAL HG22 H    4.497 -13.348   7.299 1.00 . A A .  39 VAL HG22 1 1 
        1   610 1 1  39 VAL HG23 H    2.829 -13.514   6.692 1.00 . A A .  39 VAL HG23 1 1 
        1   611 1 1  39 VAL N    N    2.639  -9.513   7.545 1.00 . A A .  39 VAL N    1 1 
        1   612 1 1  39 VAL O    O    4.474 -10.475   9.464 1.00 . A A .  39 VAL O    1 1 
        1   613 1 1  40 GLN C    C    5.459 -13.316  10.476 1.00 . A A .  40 GLN C    1 1 
        1   614 1 1  40 GLN CA   C    4.021 -12.892  10.828 1.00 . A A .  40 GLN CA   1 1 
        1   615 1 1  40 GLN CB   C    3.204 -14.023  11.484 1.00 . A A .  40 GLN CB   1 1 
        1   616 1 1  40 GLN CD   C    1.964 -16.260  11.181 1.00 . A A .  40 GLN CD   1 1 
        1   617 1 1  40 GLN CG   C    2.681 -15.091  10.499 1.00 . A A .  40 GLN CG   1 1 
        1   618 1 1  40 GLN H    H    2.631 -12.985   9.214 1.00 . A A .  40 GLN H    1 1 
        1   619 1 1  40 GLN HA   H    4.090 -12.085  11.559 1.00 . A A .  40 GLN HA   1 1 
        1   620 1 1  40 GLN HB2  H    3.826 -14.501  12.242 1.00 . A A .  40 GLN HB2  1 1 
        1   621 1 1  40 GLN HB3  H    2.346 -13.575  11.987 1.00 . A A .  40 GLN HB3  1 1 
        1   622 1 1  40 GLN HE21 H    1.610 -17.195   9.420 1.00 . A A .  40 GLN HE21 1 1 
        1   623 1 1  40 GLN HE22 H    1.021 -18.000  10.868 1.00 . A A .  40 GLN HE22 1 1 
        1   624 1 1  40 GLN HG2  H    1.984 -14.625   9.799 1.00 . A A .  40 GLN HG2  1 1 
        1   625 1 1  40 GLN HG3  H    3.512 -15.491   9.919 1.00 . A A .  40 GLN HG3  1 1 
        1   626 1 1  40 GLN N    N    3.321 -12.386   9.642 1.00 . A A .  40 GLN N    1 1 
        1   627 1 1  40 GLN NE2  N    1.494 -17.228  10.422 1.00 . A A .  40 GLN NE2  1 1 
        1   628 1 1  40 GLN O    O    5.678 -14.118   9.565 1.00 . A A .  40 GLN O    1 1 
        1   629 1 1  40 GLN OE1  O    1.806 -16.337  12.394 1.00 . A A .  40 GLN OE1  1 1 
        1   630 1 1  41 SER C    C    8.524 -14.168  11.353 1.00 . A A .  41 SER C    1 1 
        1   631 1 1  41 SER CA   C    7.864 -12.898  10.807 1.00 . A A .  41 SER CA   1 1 
        1   632 1 1  41 SER CB   C    8.647 -11.668  11.250 1.00 . A A .  41 SER CB   1 1 
        1   633 1 1  41 SER H    H    6.218 -12.126  11.929 1.00 . A A .  41 SER H    1 1 
        1   634 1 1  41 SER HA   H    7.931 -12.926   9.727 1.00 . A A .  41 SER HA   1 1 
        1   635 1 1  41 SER HB2  H    8.200 -10.783  10.802 1.00 . A A .  41 SER HB2  1 1 
        1   636 1 1  41 SER HB3  H    8.599 -11.575  12.333 1.00 . A A .  41 SER HB3  1 1 
        1   637 1 1  41 SER HG   H   10.339 -10.890  10.630 1.00 . A A .  41 SER HG   1 1 
        1   638 1 1  41 SER N    N    6.451 -12.759  11.173 1.00 . A A .  41 SER N    1 1 
        1   639 1 1  41 SER O    O    8.372 -14.482  12.538 1.00 . A A .  41 SER O    1 1 
        1   640 1 1  41 SER OG   O    9.998 -11.783  10.830 1.00 . A A .  41 SER OG   1 1 
        1   641 1 1  42 PRO C    C   11.436 -15.350  11.839 1.00 . A A .  42 PRO C    1 1 
        1   642 1 1  42 PRO CA   C   10.250 -15.893  11.014 1.00 . A A .  42 PRO CA   1 1 
        1   643 1 1  42 PRO CB   C   10.746 -16.633   9.763 1.00 . A A .  42 PRO CB   1 1 
        1   644 1 1  42 PRO CD   C    9.269 -14.893   9.080 1.00 . A A .  42 PRO CD   1 1 
        1   645 1 1  42 PRO CG   C    9.710 -16.299   8.691 1.00 . A A .  42 PRO CG   1 1 
        1   646 1 1  42 PRO HA   H    9.658 -16.568  11.626 1.00 . A A .  42 PRO HA   1 1 
        1   647 1 1  42 PRO HB2  H   11.717 -16.243   9.455 1.00 . A A .  42 PRO HB2  1 1 
        1   648 1 1  42 PRO HB3  H   10.812 -17.708   9.934 1.00 . A A .  42 PRO HB3  1 1 
        1   649 1 1  42 PRO HD2  H    9.948 -14.147   8.666 1.00 . A A .  42 PRO HD2  1 1 
        1   650 1 1  42 PRO HD3  H    8.252 -14.719   8.726 1.00 . A A .  42 PRO HD3  1 1 
        1   651 1 1  42 PRO HG2  H   10.137 -16.328   7.688 1.00 . A A .  42 PRO HG2  1 1 
        1   652 1 1  42 PRO HG3  H    8.864 -16.984   8.772 1.00 . A A .  42 PRO HG3  1 1 
        1   653 1 1  42 PRO N    N    9.338 -14.863  10.533 1.00 . A A .  42 PRO N    1 1 
        1   654 1 1  42 PRO O    O   12.091 -16.121  12.544 1.00 . A A .  42 PRO O    1 1 
        1   655 1 1  43 MET C    C   12.595 -12.395  13.458 1.00 . A A .  43 MET C    1 1 
        1   656 1 1  43 MET CA   C   12.922 -13.396  12.332 1.00 . A A .  43 MET CA   1 1 
        1   657 1 1  43 MET CB   C   13.716 -12.689  11.224 1.00 . A A .  43 MET CB   1 1 
        1   658 1 1  43 MET CE   C   12.674 -13.317   8.137 1.00 . A A .  43 MET CE   1 1 
        1   659 1 1  43 MET CG   C   14.373 -13.683  10.254 1.00 . A A .  43 MET CG   1 1 
        1   660 1 1  43 MET H    H   11.139 -13.472  11.152 1.00 . A A .  43 MET H    1 1 
        1   661 1 1  43 MET HA   H   13.574 -14.157  12.751 1.00 . A A .  43 MET HA   1 1 
        1   662 1 1  43 MET HB2  H   13.047 -12.017  10.686 1.00 . A A .  43 MET HB2  1 1 
        1   663 1 1  43 MET HB3  H   14.505 -12.080  11.668 1.00 . A A .  43 MET HB3  1 1 
        1   664 1 1  43 MET HE1  H   12.395 -14.363   8.258 1.00 . A A .  43 MET HE1  1 1 
        1   665 1 1  43 MET HE2  H   12.071 -12.712   8.814 1.00 . A A .  43 MET HE2  1 1 
        1   666 1 1  43 MET HE3  H   12.489 -13.007   7.108 1.00 . A A .  43 MET HE3  1 1 
        1   667 1 1  43 MET HG2  H   15.390 -13.876  10.597 1.00 . A A .  43 MET HG2  1 1 
        1   668 1 1  43 MET HG3  H   13.838 -14.632  10.274 1.00 . A A .  43 MET HG3  1 1 
        1   669 1 1  43 MET N    N   11.735 -14.046  11.740 1.00 . A A .  43 MET N    1 1 
        1   670 1 1  43 MET O    O   13.460 -12.105  14.289 1.00 . A A .  43 MET O    1 1 
        1   671 1 1  43 MET SD   S   14.433 -13.120   8.532 1.00 . A A .  43 MET SD   1 1 
        1   672 1 1  44 PHE C    C    9.676 -11.408  15.270 1.00 . A A .  44 PHE C    1 1 
        1   673 1 1  44 PHE CA   C   10.880 -10.880  14.467 1.00 . A A .  44 PHE CA   1 1 
        1   674 1 1  44 PHE CB   C   10.572  -9.564  13.730 1.00 . A A .  44 PHE CB   1 1 
        1   675 1 1  44 PHE CD1  C   10.845  -7.744  15.474 1.00 . A A .  44 PHE CD1  1 1 
        1   676 1 1  44 PHE CD2  C    8.622  -8.183  14.580 1.00 . A A .  44 PHE CD2  1 1 
        1   677 1 1  44 PHE CE1  C   10.310  -6.748  16.311 1.00 . A A .  44 PHE CE1  1 1 
        1   678 1 1  44 PHE CE2  C    8.088  -7.185  15.415 1.00 . A A .  44 PHE CE2  1 1 
        1   679 1 1  44 PHE CG   C   10.002  -8.464  14.606 1.00 . A A .  44 PHE CG   1 1 
        1   680 1 1  44 PHE CZ   C    8.932  -6.469  16.282 1.00 . A A .  44 PHE CZ   1 1 
        1   681 1 1  44 PHE H    H   10.715 -12.165  12.783 1.00 . A A .  44 PHE H    1 1 
        1   682 1 1  44 PHE HA   H   11.669 -10.668  15.190 1.00 . A A .  44 PHE HA   1 1 
        1   683 1 1  44 PHE HB2  H   11.492  -9.198  13.271 1.00 . A A .  44 PHE HB2  1 1 
        1   684 1 1  44 PHE HB3  H    9.867  -9.762  12.924 1.00 . A A .  44 PHE HB3  1 1 
        1   685 1 1  44 PHE HD1  H   11.906  -7.956  15.500 1.00 . A A .  44 PHE HD1  1 1 
        1   686 1 1  44 PHE HD2  H    7.967  -8.737  13.922 1.00 . A A .  44 PHE HD2  1 1 
        1   687 1 1  44 PHE HE1  H   10.959  -6.195  16.978 1.00 . A A .  44 PHE HE1  1 1 
        1   688 1 1  44 PHE HE2  H    7.028  -6.969  15.391 1.00 . A A .  44 PHE HE2  1 1 
        1   689 1 1  44 PHE HZ   H    8.521  -5.702  16.926 1.00 . A A .  44 PHE HZ   1 1 
        1   690 1 1  44 PHE N    N   11.366 -11.871  13.498 1.00 . A A .  44 PHE N    1 1 
        1   691 1 1  44 PHE O    O    8.921 -12.265  14.810 1.00 . A A .  44 PHE O    1 1 
        1   692 1 1  45 ASP C    C    7.107 -10.671  17.251 1.00 . A A .  45 ASP C    1 1 
        1   693 1 1  45 ASP CA   C    8.483 -11.346  17.456 1.00 . A A .  45 ASP CA   1 1 
        1   694 1 1  45 ASP CB   C    9.061 -11.185  18.874 1.00 . A A .  45 ASP CB   1 1 
        1   695 1 1  45 ASP CG   C    8.182 -11.828  19.965 1.00 . A A .  45 ASP CG   1 1 
        1   696 1 1  45 ASP H    H   10.073 -10.109  16.747 1.00 . A A .  45 ASP H    1 1 
        1   697 1 1  45 ASP HA   H    8.328 -12.414  17.293 1.00 . A A .  45 ASP HA   1 1 
        1   698 1 1  45 ASP HB2  H   10.045 -11.659  18.906 1.00 . A A .  45 ASP HB2  1 1 
        1   699 1 1  45 ASP HB3  H    9.198 -10.122  19.082 1.00 . A A .  45 ASP HB3  1 1 
        1   700 1 1  45 ASP N    N    9.484 -10.885  16.481 1.00 . A A .  45 ASP N    1 1 
        1   701 1 1  45 ASP O    O    6.541 -10.065  18.166 1.00 . A A .  45 ASP O    1 1 
        1   702 1 1  45 ASP OD1  O    7.650 -12.945  19.747 1.00 . A A .  45 ASP OD1  1 1 
        1   703 1 1  45 ASP OD2  O    8.060 -11.244  21.069 1.00 . A A .  45 ASP OD2  1 1 
        1   704 1 1  46 GLY C    C    5.153  -9.999  14.108 1.00 . A A .  46 GLY C    1 1 
        1   705 1 1  46 GLY CA   C    5.343 -10.063  15.625 1.00 . A A .  46 GLY CA   1 1 
        1   706 1 1  46 GLY H    H    7.072 -11.244  15.304 1.00 . A A .  46 GLY H    1 1 
        1   707 1 1  46 GLY HA2  H    4.492 -10.592  16.055 1.00 . A A .  46 GLY HA2  1 1 
        1   708 1 1  46 GLY HA3  H    5.343  -9.045  16.017 1.00 . A A .  46 GLY HA3  1 1 
        1   709 1 1  46 GLY N    N    6.583 -10.725  16.022 1.00 . A A .  46 GLY N    1 1 
        1   710 1 1  46 GLY O    O    5.721 -10.788  13.345 1.00 . A A .  46 GLY O    1 1 
        1   711 1 1  47 LYS C    C    4.806  -7.712  11.659 1.00 . A A .  47 LYS C    1 1 
        1   712 1 1  47 LYS CA   C    3.929  -8.800  12.289 1.00 . A A .  47 LYS CA   1 1 
        1   713 1 1  47 LYS CB   C    2.440  -8.414  12.275 1.00 . A A .  47 LYS CB   1 1 
        1   714 1 1  47 LYS CD   C    0.872 -10.436  11.786 1.00 . A A .  47 LYS CD   1 1 
        1   715 1 1  47 LYS CE   C    0.038  -9.728  10.707 1.00 . A A .  47 LYS CE   1 1 
        1   716 1 1  47 LYS CG   C    1.500  -9.506  12.836 1.00 . A A .  47 LYS CG   1 1 
        1   717 1 1  47 LYS H    H    3.956  -8.407  14.371 1.00 . A A .  47 LYS H    1 1 
        1   718 1 1  47 LYS HA   H    4.060  -9.716  11.716 1.00 . A A .  47 LYS HA   1 1 
        1   719 1 1  47 LYS HB2  H    2.322  -7.531  12.901 1.00 . A A .  47 LYS HB2  1 1 
        1   720 1 1  47 LYS HB3  H    2.146  -8.133  11.264 1.00 . A A .  47 LYS HB3  1 1 
        1   721 1 1  47 LYS HD2  H    1.672 -10.989  11.297 1.00 . A A .  47 LYS HD2  1 1 
        1   722 1 1  47 LYS HD3  H    0.240 -11.162  12.301 1.00 . A A .  47 LYS HD3  1 1 
        1   723 1 1  47 LYS HE2  H    0.703  -9.079  10.134 1.00 . A A .  47 LYS HE2  1 1 
        1   724 1 1  47 LYS HE3  H   -0.348 -10.487  10.020 1.00 . A A .  47 LYS HE3  1 1 
        1   725 1 1  47 LYS HG2  H    2.039 -10.128  13.555 1.00 . A A .  47 LYS HG2  1 1 
        1   726 1 1  47 LYS HG3  H    0.696  -9.015  13.385 1.00 . A A .  47 LYS HG3  1 1 
        1   727 1 1  47 LYS HZ1  H   -1.656  -8.520  10.526 1.00 . A A .  47 LYS HZ1  1 1 
        1   728 1 1  47 LYS HZ2  H   -1.705  -9.513  11.827 1.00 . A A .  47 LYS HZ2  1 1 
        1   729 1 1  47 LYS HZ3  H   -0.763  -8.161  11.840 1.00 . A A .  47 LYS HZ3  1 1 
        1   730 1 1  47 LYS N    N    4.335  -9.036  13.679 1.00 . A A .  47 LYS N    1 1 
        1   731 1 1  47 LYS NZ   N   -1.092  -8.935  11.267 1.00 . A A .  47 LYS NZ   1 1 
        1   732 1 1  47 LYS O    O    5.077  -6.693  12.298 1.00 . A A .  47 LYS O    1 1 
        1   733 1 1  48 VAL C    C    5.609  -6.647   8.293 1.00 . A A .  48 VAL C    1 1 
        1   734 1 1  48 VAL CA   C    6.160  -7.037   9.675 1.00 . A A .  48 VAL CA   1 1 
        1   735 1 1  48 VAL CB   C    7.563  -7.668   9.539 1.00 . A A .  48 VAL CB   1 1 
        1   736 1 1  48 VAL CG1  C    8.212  -7.879  10.915 1.00 . A A .  48 VAL CG1  1 1 
        1   737 1 1  48 VAL CG2  C    7.575  -8.997   8.771 1.00 . A A .  48 VAL CG2  1 1 
        1   738 1 1  48 VAL H    H    4.951  -8.777   9.956 1.00 . A A .  48 VAL H    1 1 
        1   739 1 1  48 VAL HA   H    6.279  -6.126  10.259 1.00 . A A .  48 VAL HA   1 1 
        1   740 1 1  48 VAL HB   H    8.187  -6.972   8.981 1.00 . A A .  48 VAL HB   1 1 
        1   741 1 1  48 VAL HG11 H    7.656  -8.615  11.495 1.00 . A A .  48 VAL HG11 1 1 
        1   742 1 1  48 VAL HG12 H    9.238  -8.229  10.793 1.00 . A A .  48 VAL HG12 1 1 
        1   743 1 1  48 VAL HG13 H    8.232  -6.938  11.465 1.00 . A A .  48 VAL HG13 1 1 
        1   744 1 1  48 VAL HG21 H    8.595  -9.376   8.708 1.00 . A A .  48 VAL HG21 1 1 
        1   745 1 1  48 VAL HG22 H    6.952  -9.734   9.275 1.00 . A A .  48 VAL HG22 1 1 
        1   746 1 1  48 VAL HG23 H    7.202  -8.850   7.758 1.00 . A A .  48 VAL HG23 1 1 
        1   747 1 1  48 VAL N    N    5.233  -7.916  10.413 1.00 . A A .  48 VAL N    1 1 
        1   748 1 1  48 VAL O    O    4.886  -7.447   7.691 1.00 . A A .  48 VAL O    1 1 
        1   749 1 1  49 PRO C    C    6.246  -5.488   5.291 1.00 . A A .  49 PRO C    1 1 
        1   750 1 1  49 PRO CA   C    5.422  -4.967   6.481 1.00 . A A .  49 PRO CA   1 1 
        1   751 1 1  49 PRO CB   C    5.470  -3.436   6.565 1.00 . A A .  49 PRO CB   1 1 
        1   752 1 1  49 PRO CD   C    6.597  -4.354   8.476 1.00 . A A .  49 PRO CD   1 1 
        1   753 1 1  49 PRO CG   C    6.643  -3.172   7.508 1.00 . A A .  49 PRO CG   1 1 
        1   754 1 1  49 PRO HA   H    4.390  -5.283   6.361 1.00 . A A .  49 PRO HA   1 1 
        1   755 1 1  49 PRO HB2  H    5.633  -2.971   5.592 1.00 . A A .  49 PRO HB2  1 1 
        1   756 1 1  49 PRO HB3  H    4.549  -3.060   7.011 1.00 . A A .  49 PRO HB3  1 1 
        1   757 1 1  49 PRO HD2  H    7.608  -4.639   8.766 1.00 . A A .  49 PRO HD2  1 1 
        1   758 1 1  49 PRO HD3  H    6.018  -4.072   9.357 1.00 . A A .  49 PRO HD3  1 1 
        1   759 1 1  49 PRO HG2  H    7.579  -3.196   6.951 1.00 . A A .  49 PRO HG2  1 1 
        1   760 1 1  49 PRO HG3  H    6.535  -2.220   8.029 1.00 . A A .  49 PRO HG3  1 1 
        1   761 1 1  49 PRO N    N    5.918  -5.439   7.775 1.00 . A A .  49 PRO N    1 1 
        1   762 1 1  49 PRO O    O    7.473  -5.363   5.277 1.00 . A A .  49 PRO O    1 1 
        1   763 1 1  50 HIS C    C    5.938  -5.242   1.959 1.00 . A A .  50 HIS C    1 1 
        1   764 1 1  50 HIS CA   C    6.213  -6.348   2.965 1.00 . A A .  50 HIS CA   1 1 
        1   765 1 1  50 HIS CB   C    5.726  -7.727   2.480 1.00 . A A .  50 HIS CB   1 1 
        1   766 1 1  50 HIS CD2  C    7.045  -8.876   4.341 1.00 . A A .  50 HIS CD2  1 1 
        1   767 1 1  50 HIS CE1  C    7.479 -10.805   3.368 1.00 . A A .  50 HIS CE1  1 1 
        1   768 1 1  50 HIS CG   C    6.487  -8.874   3.097 1.00 . A A .  50 HIS CG   1 1 
        1   769 1 1  50 HIS H    H    4.590  -6.225   4.352 1.00 . A A .  50 HIS H    1 1 
        1   770 1 1  50 HIS HA   H    7.292  -6.392   3.069 1.00 . A A .  50 HIS HA   1 1 
        1   771 1 1  50 HIS HB2  H    4.663  -7.842   2.689 1.00 . A A .  50 HIS HB2  1 1 
        1   772 1 1  50 HIS HB3  H    5.856  -7.789   1.399 1.00 . A A .  50 HIS HB3  1 1 
        1   773 1 1  50 HIS HD2  H    6.975  -8.071   5.061 1.00 . A A .  50 HIS HD2  1 1 
        1   774 1 1  50 HIS HE1  H    7.813 -11.825   3.222 1.00 . A A .  50 HIS HE1  1 1 
        1   775 1 1  50 HIS HE2  H    8.179 -10.414   5.309 1.00 . A A .  50 HIS HE2  1 1 
        1   776 1 1  50 HIS N    N    5.585  -6.018   4.253 1.00 . A A .  50 HIS N    1 1 
        1   777 1 1  50 HIS ND1  N    6.767 -10.094   2.476 1.00 . A A .  50 HIS ND1  1 1 
        1   778 1 1  50 HIS NE2  N    7.682 -10.088   4.487 1.00 . A A .  50 HIS NE2  1 1 
        1   779 1 1  50 HIS O    O    4.854  -5.211   1.387 1.00 . A A .  50 HIS O    1 1 
        1   780 1 1  51 TRP C    C    6.691  -3.407  -0.533 1.00 . A A .  51 TRP C    1 1 
        1   781 1 1  51 TRP CA   C    6.709  -3.117   0.967 1.00 . A A .  51 TRP CA   1 1 
        1   782 1 1  51 TRP CB   C    7.843  -2.134   1.275 1.00 . A A .  51 TRP CB   1 1 
        1   783 1 1  51 TRP CD1  C    8.649  -1.979   3.679 1.00 . A A .  51 TRP CD1  1 1 
        1   784 1 1  51 TRP CD2  C    6.912  -0.628   3.232 1.00 . A A .  51 TRP CD2  1 1 
        1   785 1 1  51 TRP CE2  C    7.184  -0.508   4.626 1.00 . A A .  51 TRP CE2  1 1 
        1   786 1 1  51 TRP CE3  C    5.840   0.127   2.707 1.00 . A A .  51 TRP CE3  1 1 
        1   787 1 1  51 TRP CG   C    7.832  -1.605   2.669 1.00 . A A .  51 TRP CG   1 1 
        1   788 1 1  51 TRP CH2  C    5.312   0.988   4.925 1.00 . A A .  51 TRP CH2  1 1 
        1   789 1 1  51 TRP CZ2  C    6.397   0.283   5.471 1.00 . A A .  51 TRP CZ2  1 1 
        1   790 1 1  51 TRP CZ3  C    5.039   0.918   3.548 1.00 . A A .  51 TRP CZ3  1 1 
        1   791 1 1  51 TRP H    H    7.779  -4.419   2.244 1.00 . A A .  51 TRP H    1 1 
        1   792 1 1  51 TRP HA   H    5.762  -2.645   1.243 1.00 . A A .  51 TRP HA   1 1 
        1   793 1 1  51 TRP HB2  H    8.803  -2.610   1.071 1.00 . A A .  51 TRP HB2  1 1 
        1   794 1 1  51 TRP HB3  H    7.746  -1.280   0.606 1.00 . A A .  51 TRP HB3  1 1 
        1   795 1 1  51 TRP HD1  H    9.449  -2.709   3.601 1.00 . A A .  51 TRP HD1  1 1 
        1   796 1 1  51 TRP HE1  H    8.751  -1.445   5.724 1.00 . A A .  51 TRP HE1  1 1 
        1   797 1 1  51 TRP HE3  H    5.603   0.047   1.655 1.00 . A A .  51 TRP HE3  1 1 
        1   798 1 1  51 TRP HH2  H    4.680   1.575   5.572 1.00 . A A .  51 TRP HH2  1 1 
        1   799 1 1  51 TRP HZ2  H    6.610   0.333   6.529 1.00 . A A .  51 TRP HZ2  1 1 
        1   800 1 1  51 TRP HZ3  H    4.193   1.448   3.133 1.00 . A A .  51 TRP HZ3  1 1 
        1   801 1 1  51 TRP N    N    6.895  -4.329   1.764 1.00 . A A .  51 TRP N    1 1 
        1   802 1 1  51 TRP NE1  N    8.282  -1.314   4.834 1.00 . A A .  51 TRP NE1  1 1 
        1   803 1 1  51 TRP O    O    7.385  -4.301  -1.013 1.00 . A A .  51 TRP O    1 1 
        1   804 1 1  52 TYR C    C    5.220  -1.317  -3.259 1.00 . A A .  52 TYR C    1 1 
        1   805 1 1  52 TYR CA   C    5.894  -2.602  -2.737 1.00 . A A .  52 TYR CA   1 1 
        1   806 1 1  52 TYR CB   C    5.256  -3.908  -3.264 1.00 . A A .  52 TYR CB   1 1 
        1   807 1 1  52 TYR CD1  C    2.929  -3.673  -2.340 1.00 . A A .  52 TYR CD1  1 1 
        1   808 1 1  52 TYR CD2  C    4.164  -5.720  -1.846 1.00 . A A .  52 TYR CD2  1 1 
        1   809 1 1  52 TYR CE1  C    1.865  -4.141  -1.563 1.00 . A A .  52 TYR CE1  1 1 
        1   810 1 1  52 TYR CE2  C    3.082  -6.205  -1.080 1.00 . A A .  52 TYR CE2  1 1 
        1   811 1 1  52 TYR CG   C    4.085  -4.456  -2.474 1.00 . A A .  52 TYR CG   1 1 
        1   812 1 1  52 TYR CZ   C    1.928  -5.406  -0.947 1.00 . A A .  52 TYR CZ   1 1 
        1   813 1 1  52 TYR H    H    5.288  -1.980  -0.804 1.00 . A A .  52 TYR H    1 1 
        1   814 1 1  52 TYR HA   H    6.916  -2.570  -3.107 1.00 . A A .  52 TYR HA   1 1 
        1   815 1 1  52 TYR HB2  H    4.945  -3.768  -4.293 1.00 . A A .  52 TYR HB2  1 1 
        1   816 1 1  52 TYR HB3  H    6.033  -4.672  -3.280 1.00 . A A .  52 TYR HB3  1 1 
        1   817 1 1  52 TYR HD1  H    2.865  -2.703  -2.813 1.00 . A A .  52 TYR HD1  1 1 
        1   818 1 1  52 TYR HD2  H    5.065  -6.310  -1.935 1.00 . A A .  52 TYR HD2  1 1 
        1   819 1 1  52 TYR HE1  H    1.003  -3.523  -1.439 1.00 . A A .  52 TYR HE1  1 1 
        1   820 1 1  52 TYR HE2  H    3.124  -7.168  -0.575 1.00 . A A .  52 TYR HE2  1 1 
        1   821 1 1  52 TYR HH   H    0.115  -5.257  -0.252 1.00 . A A .  52 TYR HH   1 1 
        1   822 1 1  52 TYR N    N    5.921  -2.619  -1.276 1.00 . A A .  52 TYR N    1 1 
        1   823 1 1  52 TYR O    O    4.593  -0.559  -2.512 1.00 . A A .  52 TYR O    1 1 
        1   824 1 1  52 TYR OH   O    0.871  -5.858  -0.232 1.00 . A A .  52 TYR OH   1 1 
        1   825 1 1  53 HIS C    C    3.200   0.067  -5.073 1.00 . A A .  53 HIS C    1 1 
        1   826 1 1  53 HIS CA   C    4.736   0.086  -5.252 1.00 . A A .  53 HIS CA   1 1 
        1   827 1 1  53 HIS CB   C    5.104   0.046  -6.749 1.00 . A A .  53 HIS CB   1 1 
        1   828 1 1  53 HIS CD2  C    7.390   1.135  -7.004 1.00 . A A .  53 HIS CD2  1 1 
        1   829 1 1  53 HIS CE1  C    8.621  -0.580  -7.631 1.00 . A A .  53 HIS CE1  1 1 
        1   830 1 1  53 HIS CG   C    6.590   0.028  -7.056 1.00 . A A .  53 HIS CG   1 1 
        1   831 1 1  53 HIS H    H    5.943  -1.683  -5.091 1.00 . A A .  53 HIS H    1 1 
        1   832 1 1  53 HIS HA   H    5.110   1.019  -4.824 1.00 . A A .  53 HIS HA   1 1 
        1   833 1 1  53 HIS HB2  H    4.629  -0.816  -7.208 1.00 . A A .  53 HIS HB2  1 1 
        1   834 1 1  53 HIS HB3  H    4.678   0.927  -7.231 1.00 . A A .  53 HIS HB3  1 1 
        1   835 1 1  53 HIS HD2  H    7.072   2.137  -6.745 1.00 . A A .  53 HIS HD2  1 1 
        1   836 1 1  53 HIS HE1  H    9.482  -1.165  -7.938 1.00 . A A .  53 HIS HE1  1 1 
        1   837 1 1  53 HIS HE2  H    9.489   1.314  -7.441 1.00 . A A .  53 HIS HE2  1 1 
        1   838 1 1  53 HIS N    N    5.381  -1.042  -4.556 1.00 . A A .  53 HIS N    1 1 
        1   839 1 1  53 HIS ND1  N    7.380  -1.061  -7.459 1.00 . A A .  53 HIS ND1  1 1 
        1   840 1 1  53 HIS NE2  N    8.658   0.734  -7.366 1.00 . A A .  53 HIS NE2  1 1 
        1   841 1 1  53 HIS O    O    2.614  -0.997  -4.864 1.00 . A A .  53 HIS O    1 1 
        1   842 1 1  54 PHE C    C    0.319   0.322  -6.018 1.00 . A A .  54 PHE C    1 1 
        1   843 1 1  54 PHE CA   C    1.052   1.281  -5.054 1.00 . A A .  54 PHE CA   1 1 
        1   844 1 1  54 PHE CB   C    0.557   2.724  -5.260 1.00 . A A .  54 PHE CB   1 1 
        1   845 1 1  54 PHE CD1  C   -1.838   2.492  -4.414 1.00 . A A .  54 PHE CD1  1 1 
        1   846 1 1  54 PHE CD2  C   -1.474   3.207  -6.711 1.00 . A A .  54 PHE CD2  1 1 
        1   847 1 1  54 PHE CE1  C   -3.226   2.483  -4.637 1.00 . A A .  54 PHE CE1  1 1 
        1   848 1 1  54 PHE CE2  C   -2.864   3.218  -6.924 1.00 . A A .  54 PHE CE2  1 1 
        1   849 1 1  54 PHE CG   C   -0.951   2.834  -5.456 1.00 . A A .  54 PHE CG   1 1 
        1   850 1 1  54 PHE CZ   C   -3.738   2.838  -5.893 1.00 . A A .  54 PHE CZ   1 1 
        1   851 1 1  54 PHE H    H    3.028   2.080  -5.341 1.00 . A A .  54 PHE H    1 1 
        1   852 1 1  54 PHE HA   H    0.792   0.990  -4.034 1.00 . A A .  54 PHE HA   1 1 
        1   853 1 1  54 PHE HB2  H    0.847   3.322  -4.396 1.00 . A A .  54 PHE HB2  1 1 
        1   854 1 1  54 PHE HB3  H    1.055   3.146  -6.135 1.00 . A A .  54 PHE HB3  1 1 
        1   855 1 1  54 PHE HD1  H   -1.458   2.211  -3.443 1.00 . A A .  54 PHE HD1  1 1 
        1   856 1 1  54 PHE HD2  H   -0.809   3.475  -7.520 1.00 . A A .  54 PHE HD2  1 1 
        1   857 1 1  54 PHE HE1  H   -3.905   2.200  -3.846 1.00 . A A .  54 PHE HE1  1 1 
        1   858 1 1  54 PHE HE2  H   -3.271   3.525  -7.879 1.00 . A A .  54 PHE HE2  1 1 
        1   859 1 1  54 PHE HZ   H   -4.805   2.833  -6.064 1.00 . A A .  54 PHE HZ   1 1 
        1   860 1 1  54 PHE N    N    2.521   1.217  -5.192 1.00 . A A .  54 PHE N    1 1 
        1   861 1 1  54 PHE O    O   -0.626  -0.355  -5.612 1.00 . A A .  54 PHE O    1 1 
        1   862 1 1  55 SER C    C    0.502  -2.163  -8.004 1.00 . A A .  55 SER C    1 1 
        1   863 1 1  55 SER CA   C    0.180  -0.689  -8.276 1.00 . A A .  55 SER CA   1 1 
        1   864 1 1  55 SER CB   C    0.636  -0.286  -9.680 1.00 . A A .  55 SER CB   1 1 
        1   865 1 1  55 SER H    H    1.606   0.706  -7.546 1.00 . A A .  55 SER H    1 1 
        1   866 1 1  55 SER HA   H   -0.901  -0.572  -8.251 1.00 . A A .  55 SER HA   1 1 
        1   867 1 1  55 SER HB2  H    0.217  -0.980 -10.411 1.00 . A A .  55 SER HB2  1 1 
        1   868 1 1  55 SER HB3  H    0.262   0.715  -9.898 1.00 . A A .  55 SER HB3  1 1 
        1   869 1 1  55 SER HG   H    2.290   0.103 -10.634 1.00 . A A .  55 SER HG   1 1 
        1   870 1 1  55 SER N    N    0.772   0.210  -7.274 1.00 . A A .  55 SER N    1 1 
        1   871 1 1  55 SER O    O   -0.289  -3.046  -8.341 1.00 . A A .  55 SER O    1 1 
        1   872 1 1  55 SER OG   O    2.052  -0.286  -9.773 1.00 . A A .  55 SER OG   1 1 
        1   873 1 1  56 CYS C    C    1.248  -4.494  -5.969 1.00 . A A .  56 CYS C    1 1 
        1   874 1 1  56 CYS CA   C    2.106  -3.778  -7.036 1.00 . A A .  56 CYS CA   1 1 
        1   875 1 1  56 CYS CB   C    3.596  -3.719  -6.685 1.00 . A A .  56 CYS CB   1 1 
        1   876 1 1  56 CYS H    H    2.244  -1.672  -7.112 1.00 . A A .  56 CYS H    1 1 
        1   877 1 1  56 CYS HA   H    2.010  -4.358  -7.945 1.00 . A A .  56 CYS HA   1 1 
        1   878 1 1  56 CYS HB2  H    3.749  -2.958  -5.920 1.00 . A A .  56 CYS HB2  1 1 
        1   879 1 1  56 CYS HB3  H    3.892  -4.684  -6.270 1.00 . A A .  56 CYS HB3  1 1 
        1   880 1 1  56 CYS N    N    1.638  -2.438  -7.359 1.00 . A A .  56 CYS N    1 1 
        1   881 1 1  56 CYS O    O    1.125  -5.718  -6.033 1.00 . A A .  56 CYS O    1 1 
        1   882 1 1  56 CYS SG   S    4.618  -3.359  -8.169 1.00 . A A .  56 CYS SG   1 1 
        1   883 1 1  57 PHE C    C   -1.474  -5.167  -4.965 1.00 . A A .  57 PHE C    1 1 
        1   884 1 1  57 PHE CA   C   -0.433  -4.377  -4.160 1.00 . A A .  57 PHE CA   1 1 
        1   885 1 1  57 PHE CB   C   -1.163  -3.285  -3.355 1.00 . A A .  57 PHE CB   1 1 
        1   886 1 1  57 PHE CD1  C   -3.399  -4.331  -2.727 1.00 . A A .  57 PHE CD1  1 1 
        1   887 1 1  57 PHE CD2  C   -1.796  -3.891  -0.961 1.00 . A A .  57 PHE CD2  1 1 
        1   888 1 1  57 PHE CE1  C   -4.272  -4.907  -1.790 1.00 . A A .  57 PHE CE1  1 1 
        1   889 1 1  57 PHE CE2  C   -2.672  -4.450  -0.021 1.00 . A A .  57 PHE CE2  1 1 
        1   890 1 1  57 PHE CG   C   -2.140  -3.841  -2.326 1.00 . A A .  57 PHE CG   1 1 
        1   891 1 1  57 PHE CZ   C   -3.909  -4.965  -0.435 1.00 . A A .  57 PHE CZ   1 1 
        1   892 1 1  57 PHE H    H    0.732  -2.778  -5.024 1.00 . A A .  57 PHE H    1 1 
        1   893 1 1  57 PHE HA   H    0.055  -5.067  -3.470 1.00 . A A .  57 PHE HA   1 1 
        1   894 1 1  57 PHE HB2  H   -0.429  -2.658  -2.856 1.00 . A A .  57 PHE HB2  1 1 
        1   895 1 1  57 PHE HB3  H   -1.712  -2.636  -4.039 1.00 . A A .  57 PHE HB3  1 1 
        1   896 1 1  57 PHE HD1  H   -3.703  -4.275  -3.760 1.00 . A A .  57 PHE HD1  1 1 
        1   897 1 1  57 PHE HD2  H   -0.873  -3.472  -0.611 1.00 . A A .  57 PHE HD2  1 1 
        1   898 1 1  57 PHE HE1  H   -5.236  -5.275  -2.108 1.00 . A A .  57 PHE HE1  1 1 
        1   899 1 1  57 PHE HE2  H   -2.396  -4.468   1.022 1.00 . A A .  57 PHE HE2  1 1 
        1   900 1 1  57 PHE HZ   H   -4.597  -5.367   0.293 1.00 . A A .  57 PHE HZ   1 1 
        1   901 1 1  57 PHE N    N    0.584  -3.777  -5.049 1.00 . A A .  57 PHE N    1 1 
        1   902 1 1  57 PHE O    O   -1.784  -6.325  -4.686 1.00 . A A .  57 PHE O    1 1 
        1   903 1 1  58 TRP C    C   -2.487  -6.185  -7.838 1.00 . A A .  58 TRP C    1 1 
        1   904 1 1  58 TRP CA   C   -3.028  -5.104  -6.878 1.00 . A A .  58 TRP CA   1 1 
        1   905 1 1  58 TRP CB   C   -3.731  -3.939  -7.576 1.00 . A A .  58 TRP CB   1 1 
        1   906 1 1  58 TRP CD1  C   -3.352  -1.635  -6.613 1.00 . A A .  58 TRP CD1  1 1 
        1   907 1 1  58 TRP CD2  C   -5.043  -2.676  -5.577 1.00 . A A .  58 TRP CD2  1 1 
        1   908 1 1  58 TRP CE2  C   -4.829  -1.435  -4.891 1.00 . A A .  58 TRP CE2  1 1 
        1   909 1 1  58 TRP CE3  C   -6.093  -3.493  -5.094 1.00 . A A .  58 TRP CE3  1 1 
        1   910 1 1  58 TRP CG   C   -4.057  -2.785  -6.659 1.00 . A A .  58 TRP CG   1 1 
        1   911 1 1  58 TRP CH2  C   -6.634  -1.872  -3.349 1.00 . A A .  58 TRP CH2  1 1 
        1   912 1 1  58 TRP CZ2  C   -5.610  -1.032  -3.796 1.00 . A A .  58 TRP CZ2  1 1 
        1   913 1 1  58 TRP CZ3  C   -6.878  -3.097  -3.993 1.00 . A A .  58 TRP CZ3  1 1 
        1   914 1 1  58 TRP H    H   -1.716  -3.583  -6.182 1.00 . A A .  58 TRP H    1 1 
        1   915 1 1  58 TRP HA   H   -3.773  -5.580  -6.240 1.00 . A A .  58 TRP HA   1 1 
        1   916 1 1  58 TRP HB2  H   -3.083  -3.581  -8.375 1.00 . A A .  58 TRP HB2  1 1 
        1   917 1 1  58 TRP HB3  H   -4.639  -4.316  -8.035 1.00 . A A .  58 TRP HB3  1 1 
        1   918 1 1  58 TRP HD1  H   -2.517  -1.404  -7.259 1.00 . A A .  58 TRP HD1  1 1 
        1   919 1 1  58 TRP HE1  H   -3.335   0.028  -5.316 1.00 . A A .  58 TRP HE1  1 1 
        1   920 1 1  58 TRP HE3  H   -6.304  -4.436  -5.575 1.00 . A A .  58 TRP HE3  1 1 
        1   921 1 1  58 TRP HH2  H   -7.222  -1.565  -2.500 1.00 . A A .  58 TRP HH2  1 1 
        1   922 1 1  58 TRP HZ2  H   -5.445  -0.092  -3.290 1.00 . A A .  58 TRP HZ2  1 1 
        1   923 1 1  58 TRP HZ3  H   -7.669  -3.743  -3.636 1.00 . A A .  58 TRP HZ3  1 1 
        1   924 1 1  58 TRP N    N   -1.987  -4.544  -6.022 1.00 . A A .  58 TRP N    1 1 
        1   925 1 1  58 TRP NE1  N   -3.784  -0.847  -5.567 1.00 . A A .  58 TRP NE1  1 1 
        1   926 1 1  58 TRP O    O   -3.271  -6.949  -8.402 1.00 . A A .  58 TRP O    1 1 
        1   927 1 1  59 LYS C    C   -0.285  -8.638  -7.654 1.00 . A A .  59 LYS C    1 1 
        1   928 1 1  59 LYS CA   C   -0.457  -7.447  -8.608 1.00 . A A .  59 LYS CA   1 1 
        1   929 1 1  59 LYS CB   C    0.907  -7.014  -9.172 1.00 . A A .  59 LYS CB   1 1 
        1   930 1 1  59 LYS CD   C    2.157  -5.300 -10.558 1.00 . A A .  59 LYS CD   1 1 
        1   931 1 1  59 LYS CE   C    1.934  -3.850 -10.987 1.00 . A A .  59 LYS CE   1 1 
        1   932 1 1  59 LYS CG   C    0.785  -5.901 -10.219 1.00 . A A .  59 LYS CG   1 1 
        1   933 1 1  59 LYS H    H   -0.583  -5.621  -7.491 1.00 . A A .  59 LYS H    1 1 
        1   934 1 1  59 LYS HA   H   -1.054  -7.787  -9.453 1.00 . A A .  59 LYS HA   1 1 
        1   935 1 1  59 LYS HB2  H    1.540  -6.679  -8.353 1.00 . A A .  59 LYS HB2  1 1 
        1   936 1 1  59 LYS HB3  H    1.390  -7.872  -9.644 1.00 . A A .  59 LYS HB3  1 1 
        1   937 1 1  59 LYS HD2  H    2.806  -5.323  -9.682 1.00 . A A .  59 LYS HD2  1 1 
        1   938 1 1  59 LYS HD3  H    2.634  -5.868 -11.358 1.00 . A A .  59 LYS HD3  1 1 
        1   939 1 1  59 LYS HE2  H    1.586  -3.844 -12.021 1.00 . A A .  59 LYS HE2  1 1 
        1   940 1 1  59 LYS HE3  H    1.141  -3.433 -10.360 1.00 . A A .  59 LYS HE3  1 1 
        1   941 1 1  59 LYS HG2  H    0.319  -6.289 -11.125 1.00 . A A .  59 LYS HG2  1 1 
        1   942 1 1  59 LYS HG3  H    0.143  -5.118  -9.822 1.00 . A A .  59 LYS HG3  1 1 
        1   943 1 1  59 LYS HZ1  H    3.905  -3.370 -11.420 1.00 . A A .  59 LYS HZ1  1 1 
        1   944 1 1  59 LYS HZ2  H    2.959  -2.065 -11.103 1.00 . A A .  59 LYS HZ2  1 1 
        1   945 1 1  59 LYS HZ3  H    3.483  -3.031  -9.872 1.00 . A A .  59 LYS HZ3  1 1 
        1   946 1 1  59 LYS N    N   -1.153  -6.314  -7.962 1.00 . A A .  59 LYS N    1 1 
        1   947 1 1  59 LYS NZ   N    3.155  -3.025 -10.840 1.00 . A A .  59 LYS NZ   1 1 
        1   948 1 1  59 LYS O    O   -0.317  -9.781  -8.106 1.00 . A A .  59 LYS O    1 1 
        1   949 1 1  60 VAL C    C   -1.753  -9.930  -5.264 1.00 . A A .  60 VAL C    1 1 
        1   950 1 1  60 VAL CA   C   -0.294  -9.438  -5.297 1.00 . A A .  60 VAL CA   1 1 
        1   951 1 1  60 VAL CB   C    0.167  -8.941  -3.903 1.00 . A A .  60 VAL CB   1 1 
        1   952 1 1  60 VAL CG1  C    0.028 -10.020  -2.821 1.00 . A A .  60 VAL CG1  1 1 
        1   953 1 1  60 VAL CG2  C    1.640  -8.516  -3.895 1.00 . A A .  60 VAL CG2  1 1 
        1   954 1 1  60 VAL H    H   -0.013  -7.432  -6.049 1.00 . A A .  60 VAL H    1 1 
        1   955 1 1  60 VAL HA   H    0.326 -10.292  -5.568 1.00 . A A .  60 VAL HA   1 1 
        1   956 1 1  60 VAL HB   H   -0.435  -8.090  -3.600 1.00 . A A .  60 VAL HB   1 1 
        1   957 1 1  60 VAL HG11 H    0.569 -10.921  -3.113 1.00 . A A .  60 VAL HG11 1 1 
        1   958 1 1  60 VAL HG12 H    0.428  -9.652  -1.876 1.00 . A A .  60 VAL HG12 1 1 
        1   959 1 1  60 VAL HG13 H   -1.021 -10.263  -2.666 1.00 . A A .  60 VAL HG13 1 1 
        1   960 1 1  60 VAL HG21 H    2.279  -9.378  -4.075 1.00 . A A .  60 VAL HG21 1 1 
        1   961 1 1  60 VAL HG22 H    1.826  -7.757  -4.651 1.00 . A A .  60 VAL HG22 1 1 
        1   962 1 1  60 VAL HG23 H    1.890  -8.090  -2.923 1.00 . A A .  60 VAL HG23 1 1 
        1   963 1 1  60 VAL N    N   -0.135  -8.397  -6.342 1.00 . A A .  60 VAL N    1 1 
        1   964 1 1  60 VAL O    O   -2.009 -11.113  -5.038 1.00 . A A .  60 VAL O    1 1 
        1   965 1 1  61 GLY C    C   -5.065  -9.643  -4.861 1.00 . A A .  61 GLY C    1 1 
        1   966 1 1  61 GLY CA   C   -4.069  -9.419  -6.003 1.00 . A A .  61 GLY CA   1 1 
        1   967 1 1  61 GLY H    H   -2.433  -8.078  -5.671 1.00 . A A .  61 GLY H    1 1 
        1   968 1 1  61 GLY HA2  H   -4.466  -8.621  -6.630 1.00 . A A .  61 GLY HA2  1 1 
        1   969 1 1  61 GLY HA3  H   -4.030 -10.328  -6.605 1.00 . A A .  61 GLY HA3  1 1 
        1   970 1 1  61 GLY N    N   -2.707  -9.050  -5.591 1.00 . A A .  61 GLY N    1 1 
        1   971 1 1  61 GLY O    O   -6.121 -10.243  -5.078 1.00 . A A .  61 GLY O    1 1 
        1   972 1 1  62 HIS C    C   -6.833  -8.207  -2.711 1.00 . A A .  62 HIS C    1 1 
        1   973 1 1  62 HIS CA   C   -5.677  -9.201  -2.509 1.00 . A A .  62 HIS CA   1 1 
        1   974 1 1  62 HIS CB   C   -4.925  -8.900  -1.201 1.00 . A A .  62 HIS CB   1 1 
        1   975 1 1  62 HIS CD2  C   -3.398 -10.972  -1.341 1.00 . A A .  62 HIS CD2  1 1 
        1   976 1 1  62 HIS CE1  C   -3.155 -11.387   0.813 1.00 . A A .  62 HIS CE1  1 1 
        1   977 1 1  62 HIS CG   C   -4.119 -10.050  -0.635 1.00 . A A .  62 HIS CG   1 1 
        1   978 1 1  62 HIS H    H   -3.883  -8.671  -3.549 1.00 . A A .  62 HIS H    1 1 
        1   979 1 1  62 HIS HA   H   -6.113 -10.198  -2.425 1.00 . A A .  62 HIS HA   1 1 
        1   980 1 1  62 HIS HB2  H   -4.265  -8.043  -1.347 1.00 . A A .  62 HIS HB2  1 1 
        1   981 1 1  62 HIS HB3  H   -5.659  -8.615  -0.448 1.00 . A A .  62 HIS HB3  1 1 
        1   982 1 1  62 HIS HD2  H   -3.306 -11.034  -2.417 1.00 . A A .  62 HIS HD2  1 1 
        1   983 1 1  62 HIS HE1  H   -2.819 -11.840   1.739 1.00 . A A .  62 HIS HE1  1 1 
        1   984 1 1  62 HIS HE2  H   -2.188 -12.584  -0.614 1.00 . A A .  62 HIS HE2  1 1 
        1   985 1 1  62 HIS N    N   -4.751  -9.175  -3.650 1.00 . A A .  62 HIS N    1 1 
        1   986 1 1  62 HIS ND1  N   -3.974 -10.325   0.729 1.00 . A A .  62 HIS ND1  1 1 
        1   987 1 1  62 HIS NE2  N   -2.800 -11.799  -0.415 1.00 . A A .  62 HIS NE2  1 1 
        1   988 1 1  62 HIS O    O   -6.642  -7.113  -3.247 1.00 . A A .  62 HIS O    1 1 
        1   989 1 1  63 SER C    C   -9.095  -6.854  -0.818 1.00 . A A .  63 SER C    1 1 
        1   990 1 1  63 SER CA   C   -9.169  -7.656  -2.116 1.00 . A A .  63 SER CA   1 1 
        1   991 1 1  63 SER CB   C  -10.503  -8.404  -2.247 1.00 . A A .  63 SER CB   1 1 
        1   992 1 1  63 SER H    H   -8.128  -9.481  -1.821 1.00 . A A .  63 SER H    1 1 
        1   993 1 1  63 SER HA   H   -9.132  -6.915  -2.918 1.00 . A A .  63 SER HA   1 1 
        1   994 1 1  63 SER HB2  H  -11.321  -7.681  -2.263 1.00 . A A .  63 SER HB2  1 1 
        1   995 1 1  63 SER HB3  H  -10.510  -8.950  -3.193 1.00 . A A .  63 SER HB3  1 1 
        1   996 1 1  63 SER HG   H  -11.472  -9.881  -1.409 1.00 . A A .  63 SER HG   1 1 
        1   997 1 1  63 SER N    N   -8.030  -8.573  -2.250 1.00 . A A .  63 SER N    1 1 
        1   998 1 1  63 SER O    O   -8.439  -7.244   0.148 1.00 . A A .  63 SER O    1 1 
        1   999 1 1  63 SER OG   O  -10.709  -9.314  -1.175 1.00 . A A .  63 SER OG   1 1 
        1  1000 1 1  64 ILE C    C  -11.393  -4.419   0.414 1.00 . A A .  64 ILE C    1 1 
        1  1001 1 1  64 ILE CA   C   -9.920  -4.840   0.361 1.00 . A A .  64 ILE CA   1 1 
        1  1002 1 1  64 ILE CB   C   -8.957  -3.637   0.290 1.00 . A A .  64 ILE CB   1 1 
        1  1003 1 1  64 ILE CD1  C   -6.536  -2.818  -0.027 1.00 . A A .  64 ILE CD1  1 1 
        1  1004 1 1  64 ILE CG1  C   -7.506  -4.005  -0.097 1.00 . A A .  64 ILE CG1  1 1 
        1  1005 1 1  64 ILE CG2  C   -8.983  -2.901   1.639 1.00 . A A .  64 ILE CG2  1 1 
        1  1006 1 1  64 ILE H    H  -10.264  -5.434  -1.646 1.00 . A A .  64 ILE H    1 1 
        1  1007 1 1  64 ILE HA   H   -9.697  -5.404   1.268 1.00 . A A .  64 ILE HA   1 1 
        1  1008 1 1  64 ILE HB   H   -9.323  -2.980  -0.494 1.00 . A A .  64 ILE HB   1 1 
        1  1009 1 1  64 ILE HD11 H   -7.039  -1.896  -0.316 1.00 . A A .  64 ILE HD11 1 1 
        1  1010 1 1  64 ILE HD12 H   -6.153  -2.727   0.988 1.00 . A A .  64 ILE HD12 1 1 
        1  1011 1 1  64 ILE HD13 H   -5.703  -2.974  -0.703 1.00 . A A .  64 ILE HD13 1 1 
        1  1012 1 1  64 ILE HG12 H   -7.136  -4.797   0.553 1.00 . A A .  64 ILE HG12 1 1 
        1  1013 1 1  64 ILE HG13 H   -7.499  -4.373  -1.123 1.00 . A A .  64 ILE HG13 1 1 
        1  1014 1 1  64 ILE HG21 H  -10.003  -2.627   1.911 1.00 . A A .  64 ILE HG21 1 1 
        1  1015 1 1  64 ILE HG22 H   -8.566  -3.538   2.419 1.00 . A A .  64 ILE HG22 1 1 
        1  1016 1 1  64 ILE HG23 H   -8.384  -1.993   1.575 1.00 . A A .  64 ILE HG23 1 1 
        1  1017 1 1  64 ILE N    N   -9.761  -5.702  -0.811 1.00 . A A .  64 ILE N    1 1 
        1  1018 1 1  64 ILE O    O  -11.948  -3.960  -0.588 1.00 . A A .  64 ILE O    1 1 
        1  1019 1 1  65 ARG C    C  -13.961  -3.583   2.808 1.00 . A A .  65 ARG C    1 1 
        1  1020 1 1  65 ARG CA   C  -13.509  -4.581   1.735 1.00 . A A .  65 ARG CA   1 1 
        1  1021 1 1  65 ARG CB   C  -14.092  -6.003   1.938 1.00 . A A .  65 ARG CB   1 1 
        1  1022 1 1  65 ARG CD   C  -12.194  -7.740   2.048 1.00 . A A .  65 ARG CD   1 1 
        1  1023 1 1  65 ARG CG   C  -13.271  -6.958   2.827 1.00 . A A .  65 ARG CG   1 1 
        1  1024 1 1  65 ARG CZ   C   -9.911  -8.628   2.602 1.00 . A A .  65 ARG CZ   1 1 
        1  1025 1 1  65 ARG H    H  -11.477  -4.927   2.361 1.00 . A A .  65 ARG H    1 1 
        1  1026 1 1  65 ARG HA   H  -13.955  -4.195   0.816 1.00 . A A .  65 ARG HA   1 1 
        1  1027 1 1  65 ARG HB2  H  -15.089  -5.905   2.370 1.00 . A A .  65 ARG HB2  1 1 
        1  1028 1 1  65 ARG HB3  H  -14.222  -6.470   0.960 1.00 . A A .  65 ARG HB3  1 1 
        1  1029 1 1  65 ARG HD2  H  -12.585  -8.729   1.802 1.00 . A A .  65 ARG HD2  1 1 
        1  1030 1 1  65 ARG HD3  H  -11.963  -7.229   1.112 1.00 . A A .  65 ARG HD3  1 1 
        1  1031 1 1  65 ARG HE   H  -10.842  -7.241   3.632 1.00 . A A .  65 ARG HE   1 1 
        1  1032 1 1  65 ARG HG2  H  -12.811  -6.391   3.634 1.00 . A A .  65 ARG HG2  1 1 
        1  1033 1 1  65 ARG HG3  H  -13.944  -7.679   3.293 1.00 . A A .  65 ARG HG3  1 1 
        1  1034 1 1  65 ARG HH11 H  -10.462  -9.384   0.829 1.00 . A A .  65 ARG HH11 1 1 
        1  1035 1 1  65 ARG HH12 H   -8.942  -9.934   1.454 1.00 . A A .  65 ARG HH12 1 1 
        1  1036 1 1  65 ARG HH21 H   -9.007  -7.864   4.173 1.00 . A A .  65 ARG HH21 1 1 
        1  1037 1 1  65 ARG HH22 H   -8.004  -8.887   3.146 1.00 . A A .  65 ARG HH22 1 1 
        1  1038 1 1  65 ARG N    N  -12.041  -4.635   1.561 1.00 . A A .  65 ARG N    1 1 
        1  1039 1 1  65 ARG NE   N  -10.959  -7.865   2.835 1.00 . A A .  65 ARG NE   1 1 
        1  1040 1 1  65 ARG NH1  N   -9.807  -9.448   1.597 1.00 . A A .  65 ARG NH1  1 1 
        1  1041 1 1  65 ARG NH2  N   -8.914  -8.549   3.422 1.00 . A A .  65 ARG NH2  1 1 
        1  1042 1 1  65 ARG O    O  -15.111  -3.145   2.787 1.00 . A A .  65 ARG O    1 1 
        1  1043 1 1  66 HIS C    C  -11.867  -1.246   4.676 1.00 . A A .  66 HIS C    1 1 
        1  1044 1 1  66 HIS CA   C  -13.200  -2.012   4.587 1.00 . A A .  66 HIS CA   1 1 
        1  1045 1 1  66 HIS CB   C  -13.847  -2.405   5.938 1.00 . A A .  66 HIS CB   1 1 
        1  1046 1 1  66 HIS CD2  C  -12.954  -4.802   6.264 1.00 . A A .  66 HIS CD2  1 1 
        1  1047 1 1  66 HIS CE1  C  -12.829  -4.866   8.453 1.00 . A A .  66 HIS CE1  1 1 
        1  1048 1 1  66 HIS CG   C  -13.298  -3.571   6.741 1.00 . A A .  66 HIS CG   1 1 
        1  1049 1 1  66 HIS H    H  -12.146  -3.629   3.677 1.00 . A A .  66 HIS H    1 1 
        1  1050 1 1  66 HIS HA   H  -13.901  -1.316   4.131 1.00 . A A .  66 HIS HA   1 1 
        1  1051 1 1  66 HIS HB2  H  -13.841  -1.522   6.575 1.00 . A A .  66 HIS HB2  1 1 
        1  1052 1 1  66 HIS HB3  H  -14.892  -2.637   5.734 1.00 . A A .  66 HIS HB3  1 1 
        1  1053 1 1  66 HIS HD2  H  -12.946  -5.103   5.234 1.00 . A A .  66 HIS HD2  1 1 
        1  1054 1 1  66 HIS HE1  H  -12.685  -5.245   9.455 1.00 . A A .  66 HIS HE1  1 1 
        1  1055 1 1  66 HIS HE2  H  -12.342  -6.562   7.318 1.00 . A A .  66 HIS HE2  1 1 
        1  1056 1 1  66 HIS N    N  -13.051  -3.162   3.687 1.00 . A A .  66 HIS N    1 1 
        1  1057 1 1  66 HIS ND1  N  -13.249  -3.628   8.139 1.00 . A A .  66 HIS ND1  1 1 
        1  1058 1 1  66 HIS NE2  N  -12.640  -5.592   7.343 1.00 . A A .  66 HIS NE2  1 1 
        1  1059 1 1  66 HIS O    O  -11.165  -1.314   5.686 1.00 . A A .  66 HIS O    1 1 
        1  1060 1 1  67 PRO C    C   -9.566   0.892   4.454 1.00 . A A .  67 PRO C    1 1 
        1  1061 1 1  67 PRO CA   C  -10.083  -0.087   3.400 1.00 . A A .  67 PRO CA   1 1 
        1  1062 1 1  67 PRO CB   C  -10.037   0.531   1.993 1.00 . A A .  67 PRO CB   1 1 
        1  1063 1 1  67 PRO CD   C  -12.243  -0.267   2.398 1.00 . A A .  67 PRO CD   1 1 
        1  1064 1 1  67 PRO CG   C  -11.497   0.859   1.699 1.00 . A A .  67 PRO CG   1 1 
        1  1065 1 1  67 PRO HA   H   -9.434  -0.958   3.445 1.00 . A A .  67 PRO HA   1 1 
        1  1066 1 1  67 PRO HB2  H   -9.411   1.423   1.950 1.00 . A A .  67 PRO HB2  1 1 
        1  1067 1 1  67 PRO HB3  H   -9.689  -0.200   1.266 1.00 . A A .  67 PRO HB3  1 1 
        1  1068 1 1  67 PRO HD2  H  -13.256   0.057   2.637 1.00 . A A .  67 PRO HD2  1 1 
        1  1069 1 1  67 PRO HD3  H  -12.265  -1.151   1.758 1.00 . A A .  67 PRO HD3  1 1 
        1  1070 1 1  67 PRO HG2  H  -11.757   1.804   2.175 1.00 . A A .  67 PRO HG2  1 1 
        1  1071 1 1  67 PRO HG3  H  -11.705   0.885   0.628 1.00 . A A .  67 PRO HG3  1 1 
        1  1072 1 1  67 PRO N    N  -11.461  -0.547   3.595 1.00 . A A .  67 PRO N    1 1 
        1  1073 1 1  67 PRO O    O   -8.409   0.791   4.846 1.00 . A A .  67 PRO O    1 1 
        1  1074 1 1  68 ASP C    C   -9.824   2.019   7.424 1.00 . A A .  68 ASP C    1 1 
        1  1075 1 1  68 ASP CA   C  -10.008   2.709   6.055 1.00 . A A .  68 ASP CA   1 1 
        1  1076 1 1  68 ASP CB   C  -10.955   3.917   6.089 1.00 . A A .  68 ASP CB   1 1 
        1  1077 1 1  68 ASP CG   C  -12.433   3.523   6.191 1.00 . A A .  68 ASP CG   1 1 
        1  1078 1 1  68 ASP H    H  -11.366   1.791   4.684 1.00 . A A .  68 ASP H    1 1 
        1  1079 1 1  68 ASP HA   H   -9.019   3.090   5.799 1.00 . A A .  68 ASP HA   1 1 
        1  1080 1 1  68 ASP HB2  H  -10.683   4.569   6.922 1.00 . A A .  68 ASP HB2  1 1 
        1  1081 1 1  68 ASP HB3  H  -10.810   4.489   5.171 1.00 . A A .  68 ASP HB3  1 1 
        1  1082 1 1  68 ASP N    N  -10.403   1.783   4.984 1.00 . A A .  68 ASP N    1 1 
        1  1083 1 1  68 ASP O    O   -9.312   2.631   8.365 1.00 . A A .  68 ASP O    1 1 
        1  1084 1 1  68 ASP OD1  O  -12.949   3.357   7.321 1.00 . A A .  68 ASP OD1  1 1 
        1  1085 1 1  68 ASP OD2  O  -13.076   3.390   5.121 1.00 . A A .  68 ASP OD2  1 1 
        1  1086 1 1  69 VAL C    C   -8.732  -1.064   8.402 1.00 . A A .  69 VAL C    1 1 
        1  1087 1 1  69 VAL CA   C   -9.933  -0.146   8.671 1.00 . A A .  69 VAL CA   1 1 
        1  1088 1 1  69 VAL CB   C  -11.173  -1.002   9.010 1.00 . A A .  69 VAL CB   1 1 
        1  1089 1 1  69 VAL CG1  C  -11.010  -1.701  10.365 1.00 . A A .  69 VAL CG1  1 1 
        1  1090 1 1  69 VAL CG2  C  -12.473  -0.186   9.045 1.00 . A A .  69 VAL CG2  1 1 
        1  1091 1 1  69 VAL H    H  -10.618   0.307   6.710 1.00 . A A .  69 VAL H    1 1 
        1  1092 1 1  69 VAL HA   H   -9.705   0.475   9.532 1.00 . A A .  69 VAL HA   1 1 
        1  1093 1 1  69 VAL HB   H  -11.281  -1.770   8.248 1.00 . A A .  69 VAL HB   1 1 
        1  1094 1 1  69 VAL HG11 H  -10.880  -0.963  11.156 1.00 . A A .  69 VAL HG11 1 1 
        1  1095 1 1  69 VAL HG12 H  -11.895  -2.303  10.574 1.00 . A A .  69 VAL HG12 1 1 
        1  1096 1 1  69 VAL HG13 H  -10.148  -2.367  10.342 1.00 . A A .  69 VAL HG13 1 1 
        1  1097 1 1  69 VAL HG21 H  -13.302  -0.828   9.342 1.00 . A A .  69 VAL HG21 1 1 
        1  1098 1 1  69 VAL HG22 H  -12.379   0.641   9.748 1.00 . A A .  69 VAL HG22 1 1 
        1  1099 1 1  69 VAL HG23 H  -12.692   0.202   8.050 1.00 . A A .  69 VAL HG23 1 1 
        1  1100 1 1  69 VAL N    N  -10.199   0.737   7.525 1.00 . A A .  69 VAL N    1 1 
        1  1101 1 1  69 VAL O    O   -7.860  -1.218   9.257 1.00 . A A .  69 VAL O    1 1 
        1  1102 1 1  70 GLU C    C   -6.352  -2.184   6.383 1.00 . A A .  70 GLU C    1 1 
        1  1103 1 1  70 GLU CA   C   -7.698  -2.726   6.869 1.00 . A A .  70 GLU CA   1 1 
        1  1104 1 1  70 GLU CB   C   -8.267  -3.644   5.771 1.00 . A A .  70 GLU CB   1 1 
        1  1105 1 1  70 GLU CD   C  -10.023  -5.271   4.982 1.00 . A A .  70 GLU CD   1 1 
        1  1106 1 1  70 GLU CG   C   -9.553  -4.382   6.146 1.00 . A A .  70 GLU CG   1 1 
        1  1107 1 1  70 GLU H    H   -9.429  -1.491   6.560 1.00 . A A .  70 GLU H    1 1 
        1  1108 1 1  70 GLU HA   H   -7.467  -3.312   7.761 1.00 . A A .  70 GLU HA   1 1 
        1  1109 1 1  70 GLU HB2  H   -8.451  -3.048   4.876 1.00 . A A .  70 GLU HB2  1 1 
        1  1110 1 1  70 GLU HB3  H   -7.514  -4.395   5.532 1.00 . A A .  70 GLU HB3  1 1 
        1  1111 1 1  70 GLU HG2  H   -9.365  -4.993   7.032 1.00 . A A .  70 GLU HG2  1 1 
        1  1112 1 1  70 GLU HG3  H  -10.332  -3.663   6.395 1.00 . A A .  70 GLU HG3  1 1 
        1  1113 1 1  70 GLU N    N   -8.675  -1.677   7.214 1.00 . A A .  70 GLU N    1 1 
        1  1114 1 1  70 GLU O    O   -5.319  -2.807   6.629 1.00 . A A .  70 GLU O    1 1 
        1  1115 1 1  70 GLU OE1  O  -10.641  -4.764   4.014 1.00 . A A .  70 GLU OE1  1 1 
        1  1116 1 1  70 GLU OE2  O   -9.784  -6.500   5.028 1.00 . A A .  70 GLU OE2  1 1 
        1  1117 1 1  71 VAL C    C   -4.756   0.679   6.306 1.00 . A A .  71 VAL C    1 1 
        1  1118 1 1  71 VAL CA   C   -5.177  -0.315   5.236 1.00 . A A .  71 VAL CA   1 1 
        1  1119 1 1  71 VAL CB   C   -5.400   0.337   3.872 1.00 . A A .  71 VAL CB   1 1 
        1  1120 1 1  71 VAL CG1  C   -4.038   0.794   3.374 1.00 . A A .  71 VAL CG1  1 1 
        1  1121 1 1  71 VAL CG2  C   -5.945  -0.668   2.853 1.00 . A A .  71 VAL CG2  1 1 
        1  1122 1 1  71 VAL H    H   -7.257  -0.580   5.554 1.00 . A A .  71 VAL H    1 1 
        1  1123 1 1  71 VAL HA   H   -4.329  -0.982   5.075 1.00 . A A .  71 VAL HA   1 1 
        1  1124 1 1  71 VAL HB   H   -6.066   1.195   3.941 1.00 . A A .  71 VAL HB   1 1 
        1  1125 1 1  71 VAL HG11 H   -4.185   1.334   2.442 1.00 . A A .  71 VAL HG11 1 1 
        1  1126 1 1  71 VAL HG12 H   -3.581   1.446   4.121 1.00 . A A .  71 VAL HG12 1 1 
        1  1127 1 1  71 VAL HG13 H   -3.384  -0.064   3.210 1.00 . A A .  71 VAL HG13 1 1 
        1  1128 1 1  71 VAL HG21 H   -5.302  -1.549   2.829 1.00 . A A .  71 VAL HG21 1 1 
        1  1129 1 1  71 VAL HG22 H   -6.949  -0.973   3.138 1.00 . A A .  71 VAL HG22 1 1 
        1  1130 1 1  71 VAL HG23 H   -5.985  -0.213   1.864 1.00 . A A .  71 VAL HG23 1 1 
        1  1131 1 1  71 VAL N    N   -6.362  -1.036   5.704 1.00 . A A .  71 VAL N    1 1 
        1  1132 1 1  71 VAL O    O   -5.261   1.795   6.426 1.00 . A A .  71 VAL O    1 1 
        1  1133 1 1  72 ASP C    C   -2.290   2.194   7.328 1.00 . A A .  72 ASP C    1 1 
        1  1134 1 1  72 ASP CA   C   -3.063   1.066   8.043 1.00 . A A .  72 ASP CA   1 1 
        1  1135 1 1  72 ASP CB   C   -2.162   0.115   8.830 1.00 . A A .  72 ASP CB   1 1 
        1  1136 1 1  72 ASP CG   C   -1.478   0.828   9.993 1.00 . A A .  72 ASP CG   1 1 
        1  1137 1 1  72 ASP H    H   -3.440  -0.699   6.938 1.00 . A A .  72 ASP H    1 1 
        1  1138 1 1  72 ASP HA   H   -3.781   1.516   8.731 1.00 . A A .  72 ASP HA   1 1 
        1  1139 1 1  72 ASP HB2  H   -2.782  -0.704   9.207 1.00 . A A .  72 ASP HB2  1 1 
        1  1140 1 1  72 ASP HB3  H   -1.414  -0.313   8.161 1.00 . A A .  72 ASP HB3  1 1 
        1  1141 1 1  72 ASP N    N   -3.786   0.244   7.092 1.00 . A A .  72 ASP N    1 1 
        1  1142 1 1  72 ASP O    O   -1.820   2.026   6.207 1.00 . A A .  72 ASP O    1 1 
        1  1143 1 1  72 ASP OD1  O   -2.194   1.222  10.942 1.00 . A A .  72 ASP OD1  1 1 
        1  1144 1 1  72 ASP OD2  O   -0.242   1.007   9.928 1.00 . A A .  72 ASP OD2  1 1 
        1  1145 1 1  73 GLY C    C   -2.307   5.363   6.365 1.00 . A A .  73 GLY C    1 1 
        1  1146 1 1  73 GLY CA   C   -1.496   4.543   7.381 1.00 . A A .  73 GLY CA   1 1 
        1  1147 1 1  73 GLY H    H   -2.672   3.480   8.814 1.00 . A A .  73 GLY H    1 1 
        1  1148 1 1  73 GLY HA2  H   -1.216   5.206   8.200 1.00 . A A .  73 GLY HA2  1 1 
        1  1149 1 1  73 GLY HA3  H   -0.580   4.211   6.892 1.00 . A A .  73 GLY HA3  1 1 
        1  1150 1 1  73 GLY N    N   -2.198   3.374   7.935 1.00 . A A .  73 GLY N    1 1 
        1  1151 1 1  73 GLY O    O   -1.950   6.504   6.079 1.00 . A A .  73 GLY O    1 1 
        1  1152 1 1  74 PHE C    C   -4.873   6.915   5.659 1.00 . A A .  74 PHE C    1 1 
        1  1153 1 1  74 PHE CA   C   -4.437   5.563   5.065 1.00 . A A .  74 PHE CA   1 1 
        1  1154 1 1  74 PHE CB   C   -5.647   4.629   4.923 1.00 . A A .  74 PHE CB   1 1 
        1  1155 1 1  74 PHE CD1  C   -6.856   4.982   2.728 1.00 . A A .  74 PHE CD1  1 1 
        1  1156 1 1  74 PHE CD2  C   -7.867   5.843   4.771 1.00 . A A .  74 PHE CD2  1 1 
        1  1157 1 1  74 PHE CE1  C   -7.952   5.458   1.990 1.00 . A A .  74 PHE CE1  1 1 
        1  1158 1 1  74 PHE CE2  C   -8.958   6.328   4.029 1.00 . A A .  74 PHE CE2  1 1 
        1  1159 1 1  74 PHE CG   C   -6.811   5.174   4.121 1.00 . A A .  74 PHE CG   1 1 
        1  1160 1 1  74 PHE CZ   C   -8.996   6.138   2.639 1.00 . A A .  74 PHE CZ   1 1 
        1  1161 1 1  74 PHE H    H   -3.677   3.903   6.169 1.00 . A A .  74 PHE H    1 1 
        1  1162 1 1  74 PHE HA   H   -4.007   5.764   4.078 1.00 . A A .  74 PHE HA   1 1 
        1  1163 1 1  74 PHE HB2  H   -5.317   3.700   4.459 1.00 . A A .  74 PHE HB2  1 1 
        1  1164 1 1  74 PHE HB3  H   -6.012   4.386   5.924 1.00 . A A .  74 PHE HB3  1 1 
        1  1165 1 1  74 PHE HD1  H   -6.054   4.459   2.225 1.00 . A A .  74 PHE HD1  1 1 
        1  1166 1 1  74 PHE HD2  H   -7.844   5.983   5.844 1.00 . A A .  74 PHE HD2  1 1 
        1  1167 1 1  74 PHE HE1  H   -7.996   5.305   0.922 1.00 . A A .  74 PHE HE1  1 1 
        1  1168 1 1  74 PHE HE2  H   -9.775   6.836   4.523 1.00 . A A .  74 PHE HE2  1 1 
        1  1169 1 1  74 PHE HZ   H   -9.833   6.515   2.069 1.00 . A A .  74 PHE HZ   1 1 
        1  1170 1 1  74 PHE N    N   -3.457   4.854   5.907 1.00 . A A .  74 PHE N    1 1 
        1  1171 1 1  74 PHE O    O   -5.133   7.866   4.924 1.00 . A A .  74 PHE O    1 1 
        1  1172 1 1  75 SER C    C   -4.177   9.410   7.463 1.00 . A A .  75 SER C    1 1 
        1  1173 1 1  75 SER CA   C   -5.186   8.275   7.720 1.00 . A A .  75 SER CA   1 1 
        1  1174 1 1  75 SER CB   C   -5.224   7.977   9.223 1.00 . A A .  75 SER CB   1 1 
        1  1175 1 1  75 SER H    H   -4.714   6.202   7.534 1.00 . A A .  75 SER H    1 1 
        1  1176 1 1  75 SER HA   H   -6.171   8.631   7.419 1.00 . A A .  75 SER HA   1 1 
        1  1177 1 1  75 SER HB2  H   -4.232   7.660   9.549 1.00 . A A .  75 SER HB2  1 1 
        1  1178 1 1  75 SER HB3  H   -5.504   8.883   9.763 1.00 . A A .  75 SER HB3  1 1 
        1  1179 1 1  75 SER HG   H   -6.188   6.811  10.472 1.00 . A A .  75 SER HG   1 1 
        1  1180 1 1  75 SER N    N   -4.889   7.033   6.988 1.00 . A A .  75 SER N    1 1 
        1  1181 1 1  75 SER O    O   -4.498  10.577   7.694 1.00 . A A .  75 SER O    1 1 
        1  1182 1 1  75 SER OG   O   -6.161   6.947   9.505 1.00 . A A .  75 SER OG   1 1 
        1  1183 1 1  76 GLU C    C   -2.011  10.589   5.188 1.00 . A A .  76 GLU C    1 1 
        1  1184 1 1  76 GLU CA   C   -1.921  10.072   6.638 1.00 . A A .  76 GLU CA   1 1 
        1  1185 1 1  76 GLU CB   C   -0.534   9.456   6.892 1.00 . A A .  76 GLU CB   1 1 
        1  1186 1 1  76 GLU CD   C   -0.483  10.025   9.388 1.00 . A A .  76 GLU CD   1 1 
        1  1187 1 1  76 GLU CG   C   -0.338   8.922   8.320 1.00 . A A .  76 GLU CG   1 1 
        1  1188 1 1  76 GLU H    H   -2.764   8.119   6.796 1.00 . A A .  76 GLU H    1 1 
        1  1189 1 1  76 GLU HA   H   -2.017  10.934   7.297 1.00 . A A .  76 GLU HA   1 1 
        1  1190 1 1  76 GLU HB2  H   -0.372   8.639   6.188 1.00 . A A .  76 GLU HB2  1 1 
        1  1191 1 1  76 GLU HB3  H    0.228  10.211   6.695 1.00 . A A .  76 GLU HB3  1 1 
        1  1192 1 1  76 GLU HG2  H   -1.055   8.119   8.505 1.00 . A A .  76 GLU HG2  1 1 
        1  1193 1 1  76 GLU HG3  H    0.660   8.482   8.388 1.00 . A A .  76 GLU HG3  1 1 
        1  1194 1 1  76 GLU N    N   -2.973   9.097   6.968 1.00 . A A .  76 GLU N    1 1 
        1  1195 1 1  76 GLU O    O   -1.452  11.642   4.867 1.00 . A A .  76 GLU O    1 1 
        1  1196 1 1  76 GLU OE1  O    0.379  10.936   9.449 1.00 . A A .  76 GLU OE1  1 1 
        1  1197 1 1  76 GLU OE2  O   -1.452   9.983  10.185 1.00 . A A .  76 GLU OE2  1 1 
        1  1198 1 1  77 LEU C    C   -3.844  11.492   2.809 1.00 . A A .  77 LEU C    1 1 
        1  1199 1 1  77 LEU CA   C   -2.934  10.257   2.909 1.00 . A A .  77 LEU CA   1 1 
        1  1200 1 1  77 LEU CB   C   -3.535   9.088   2.105 1.00 . A A .  77 LEU CB   1 1 
        1  1201 1 1  77 LEU CD1  C   -1.625   7.434   2.648 1.00 . A A .  77 LEU CD1  1 1 
        1  1202 1 1  77 LEU CD2  C   -3.368   6.898   0.949 1.00 . A A .  77 LEU CD2  1 1 
        1  1203 1 1  77 LEU CG   C   -2.553   8.023   1.589 1.00 . A A .  77 LEU CG   1 1 
        1  1204 1 1  77 LEU H    H   -3.204   9.050   4.647 1.00 . A A .  77 LEU H    1 1 
        1  1205 1 1  77 LEU HA   H   -1.974  10.517   2.466 1.00 . A A .  77 LEU HA   1 1 
        1  1206 1 1  77 LEU HB2  H   -4.306   8.606   2.701 1.00 . A A .  77 LEU HB2  1 1 
        1  1207 1 1  77 LEU HB3  H   -4.029   9.503   1.226 1.00 . A A .  77 LEU HB3  1 1 
        1  1208 1 1  77 LEU HD11 H   -2.205   7.032   3.476 1.00 . A A .  77 LEU HD11 1 1 
        1  1209 1 1  77 LEU HD12 H   -1.027   6.643   2.201 1.00 . A A .  77 LEU HD12 1 1 
        1  1210 1 1  77 LEU HD13 H   -0.951   8.204   3.019 1.00 . A A .  77 LEU HD13 1 1 
        1  1211 1 1  77 LEU HD21 H   -3.988   6.408   1.699 1.00 . A A .  77 LEU HD21 1 1 
        1  1212 1 1  77 LEU HD22 H   -4.011   7.303   0.168 1.00 . A A .  77 LEU HD22 1 1 
        1  1213 1 1  77 LEU HD23 H   -2.700   6.168   0.500 1.00 . A A .  77 LEU HD23 1 1 
        1  1214 1 1  77 LEU HG   H   -1.923   8.467   0.826 1.00 . A A .  77 LEU HG   1 1 
        1  1215 1 1  77 LEU N    N   -2.721   9.871   4.308 1.00 . A A .  77 LEU N    1 1 
        1  1216 1 1  77 LEU O    O   -4.763  11.679   3.612 1.00 . A A .  77 LEU O    1 1 
        1  1217 1 1  78 ARG C    C   -5.721  12.905   0.613 1.00 . A A .  78 ARG C    1 1 
        1  1218 1 1  78 ARG CA   C   -4.520  13.410   1.398 1.00 . A A .  78 ARG CA   1 1 
        1  1219 1 1  78 ARG CB   C   -3.744  14.518   0.660 1.00 . A A .  78 ARG CB   1 1 
        1  1220 1 1  78 ARG CD   C   -3.291  15.707   2.865 1.00 . A A .  78 ARG CD   1 1 
        1  1221 1 1  78 ARG CG   C   -2.686  15.192   1.549 1.00 . A A .  78 ARG CG   1 1 
        1  1222 1 1  78 ARG CZ   C   -1.395  16.066   4.470 1.00 . A A .  78 ARG CZ   1 1 
        1  1223 1 1  78 ARG H    H   -2.857  12.085   1.150 1.00 . A A .  78 ARG H    1 1 
        1  1224 1 1  78 ARG HA   H   -4.963  13.827   2.302 1.00 . A A .  78 ARG HA   1 1 
        1  1225 1 1  78 ARG HB2  H   -3.258  14.099  -0.223 1.00 . A A .  78 ARG HB2  1 1 
        1  1226 1 1  78 ARG HB3  H   -4.443  15.286   0.318 1.00 . A A .  78 ARG HB3  1 1 
        1  1227 1 1  78 ARG HD2  H   -4.172  16.310   2.629 1.00 . A A .  78 ARG HD2  1 1 
        1  1228 1 1  78 ARG HD3  H   -3.638  14.865   3.469 1.00 . A A .  78 ARG HD3  1 1 
        1  1229 1 1  78 ARG HE   H   -2.367  17.510   3.514 1.00 . A A .  78 ARG HE   1 1 
        1  1230 1 1  78 ARG HG2  H   -1.887  14.483   1.769 1.00 . A A .  78 ARG HG2  1 1 
        1  1231 1 1  78 ARG HG3  H   -2.256  16.030   1.000 1.00 . A A .  78 ARG HG3  1 1 
        1  1232 1 1  78 ARG HH11 H   -1.814  14.112   4.290 1.00 . A A .  78 ARG HH11 1 1 
        1  1233 1 1  78 ARG HH12 H   -0.509  14.496   5.364 1.00 . A A .  78 ARG HH12 1 1 
        1  1234 1 1  78 ARG HH21 H   -0.697  17.896   4.911 1.00 . A A .  78 ARG HH21 1 1 
        1  1235 1 1  78 ARG HH22 H    0.100  16.574   5.710 1.00 . A A .  78 ARG HH22 1 1 
        1  1236 1 1  78 ARG N    N   -3.619  12.314   1.781 1.00 . A A .  78 ARG N    1 1 
        1  1237 1 1  78 ARG NE   N   -2.321  16.510   3.635 1.00 . A A .  78 ARG NE   1 1 
        1  1238 1 1  78 ARG NH1  N   -1.224  14.799   4.725 1.00 . A A .  78 ARG NH1  1 1 
        1  1239 1 1  78 ARG NH2  N   -0.605  16.907   5.075 1.00 . A A .  78 ARG NH2  1 1 
        1  1240 1 1  78 ARG O    O   -5.736  11.774   0.121 1.00 . A A .  78 ARG O    1 1 
        1  1241 1 1  79 TRP C    C   -8.094  12.676  -1.273 1.00 . A A .  79 TRP C    1 1 
        1  1242 1 1  79 TRP CA   C   -8.087  13.326   0.123 1.00 . A A .  79 TRP CA   1 1 
        1  1243 1 1  79 TRP CB   C   -9.080  14.499   0.261 1.00 . A A .  79 TRP CB   1 1 
        1  1244 1 1  79 TRP CD1  C  -11.233  14.349  -1.087 1.00 . A A .  79 TRP CD1  1 1 
        1  1245 1 1  79 TRP CD2  C   -9.652  15.574  -2.106 1.00 . A A .  79 TRP CD2  1 1 
        1  1246 1 1  79 TRP CE2  C  -10.789  15.571  -2.967 1.00 . A A .  79 TRP CE2  1 1 
        1  1247 1 1  79 TRP CE3  C   -8.512  16.282  -2.545 1.00 . A A .  79 TRP CE3  1 1 
        1  1248 1 1  79 TRP CG   C   -9.964  14.786  -0.916 1.00 . A A .  79 TRP CG   1 1 
        1  1249 1 1  79 TRP CH2  C   -9.647  16.941  -4.607 1.00 . A A .  79 TRP CH2  1 1 
        1  1250 1 1  79 TRP CZ2  C  -10.798  16.243  -4.199 1.00 . A A .  79 TRP CZ2  1 1 
        1  1251 1 1  79 TRP CZ3  C   -8.508  16.958  -3.780 1.00 . A A .  79 TRP CZ3  1 1 
        1  1252 1 1  79 TRP H    H   -6.647  14.664   0.948 1.00 . A A .  79 TRP H    1 1 
        1  1253 1 1  79 TRP HA   H   -8.379  12.566   0.845 1.00 . A A .  79 TRP HA   1 1 
        1  1254 1 1  79 TRP HB2  H   -9.713  14.305   1.128 1.00 . A A .  79 TRP HB2  1 1 
        1  1255 1 1  79 TRP HB3  H   -8.532  15.418   0.479 1.00 . A A .  79 TRP HB3  1 1 
        1  1256 1 1  79 TRP HD1  H  -11.778  13.731  -0.380 1.00 . A A .  79 TRP HD1  1 1 
        1  1257 1 1  79 TRP HE1  H  -12.664  14.617  -2.626 1.00 . A A .  79 TRP HE1  1 1 
        1  1258 1 1  79 TRP HE3  H   -7.628  16.291  -1.925 1.00 . A A .  79 TRP HE3  1 1 
        1  1259 1 1  79 TRP HH2  H   -9.635  17.462  -5.557 1.00 . A A .  79 TRP HH2  1 1 
        1  1260 1 1  79 TRP HZ2  H  -11.679  16.220  -4.826 1.00 . A A .  79 TRP HZ2  1 1 
        1  1261 1 1  79 TRP HZ3  H   -7.616  17.486  -4.095 1.00 . A A .  79 TRP HZ3  1 1 
        1  1262 1 1  79 TRP N    N   -6.749  13.750   0.534 1.00 . A A .  79 TRP N    1 1 
        1  1263 1 1  79 TRP NE1  N  -11.725  14.813  -2.294 1.00 . A A .  79 TRP NE1  1 1 
        1  1264 1 1  79 TRP O    O   -8.717  11.637  -1.462 1.00 . A A .  79 TRP O    1 1 
        1  1265 1 1  80 ASP C    C   -6.631  11.267  -3.674 1.00 . A A .  80 ASP C    1 1 
        1  1266 1 1  80 ASP CA   C   -7.228  12.687  -3.595 1.00 . A A .  80 ASP CA   1 1 
        1  1267 1 1  80 ASP CB   C   -6.403  13.669  -4.439 1.00 . A A .  80 ASP CB   1 1 
        1  1268 1 1  80 ASP CG   C   -6.370  13.275  -5.926 1.00 . A A .  80 ASP CG   1 1 
        1  1269 1 1  80 ASP H    H   -6.815  14.051  -2.003 1.00 . A A .  80 ASP H    1 1 
        1  1270 1 1  80 ASP HA   H   -8.237  12.646  -4.006 1.00 . A A .  80 ASP HA   1 1 
        1  1271 1 1  80 ASP HB2  H   -6.835  14.667  -4.350 1.00 . A A .  80 ASP HB2  1 1 
        1  1272 1 1  80 ASP HB3  H   -5.387  13.711  -4.041 1.00 . A A .  80 ASP HB3  1 1 
        1  1273 1 1  80 ASP N    N   -7.321  13.207  -2.224 1.00 . A A .  80 ASP N    1 1 
        1  1274 1 1  80 ASP O    O   -6.985  10.488  -4.559 1.00 . A A .  80 ASP O    1 1 
        1  1275 1 1  80 ASP OD1  O   -7.422  13.375  -6.604 1.00 . A A .  80 ASP OD1  1 1 
        1  1276 1 1  80 ASP OD2  O   -5.285  12.902  -6.432 1.00 . A A .  80 ASP OD2  1 1 
        1  1277 1 1  81 ASP C    C   -6.010   8.631  -1.853 1.00 . A A .  81 ASP C    1 1 
        1  1278 1 1  81 ASP CA   C   -5.123   9.588  -2.646 1.00 . A A .  81 ASP CA   1 1 
        1  1279 1 1  81 ASP CB   C   -3.720   9.681  -2.033 1.00 . A A .  81 ASP CB   1 1 
        1  1280 1 1  81 ASP CG   C   -2.712  10.304  -3.006 1.00 . A A .  81 ASP CG   1 1 
        1  1281 1 1  81 ASP H    H   -5.673  11.505  -1.931 1.00 . A A .  81 ASP H    1 1 
        1  1282 1 1  81 ASP HA   H   -5.017   9.172  -3.647 1.00 . A A .  81 ASP HA   1 1 
        1  1283 1 1  81 ASP HB2  H   -3.762  10.253  -1.104 1.00 . A A .  81 ASP HB2  1 1 
        1  1284 1 1  81 ASP HB3  H   -3.377   8.674  -1.789 1.00 . A A .  81 ASP HB3  1 1 
        1  1285 1 1  81 ASP N    N   -5.746  10.909  -2.740 1.00 . A A .  81 ASP N    1 1 
        1  1286 1 1  81 ASP O    O   -6.178   7.491  -2.272 1.00 . A A .  81 ASP O    1 1 
        1  1287 1 1  81 ASP OD1  O   -2.463   9.696  -4.075 1.00 . A A .  81 ASP OD1  1 1 
        1  1288 1 1  81 ASP OD2  O   -2.149  11.374  -2.682 1.00 . A A .  81 ASP OD2  1 1 
        1  1289 1 1  82 GLN C    C   -8.822   7.909  -1.006 1.00 . A A .  82 GLN C    1 1 
        1  1290 1 1  82 GLN CA   C   -7.682   8.328  -0.065 1.00 . A A .  82 GLN CA   1 1 
        1  1291 1 1  82 GLN CB   C   -8.233   9.156   1.108 1.00 . A A .  82 GLN CB   1 1 
        1  1292 1 1  82 GLN CD   C   -7.800   9.985   3.487 1.00 . A A .  82 GLN CD   1 1 
        1  1293 1 1  82 GLN CG   C   -7.244   9.230   2.278 1.00 . A A .  82 GLN CG   1 1 
        1  1294 1 1  82 GLN H    H   -6.478  10.048  -0.482 1.00 . A A .  82 GLN H    1 1 
        1  1295 1 1  82 GLN HA   H   -7.226   7.418   0.324 1.00 . A A .  82 GLN HA   1 1 
        1  1296 1 1  82 GLN HB2  H   -8.472  10.163   0.766 1.00 . A A .  82 GLN HB2  1 1 
        1  1297 1 1  82 GLN HB3  H   -9.154   8.697   1.466 1.00 . A A .  82 GLN HB3  1 1 
        1  1298 1 1  82 GLN HE21 H   -6.488   9.103   4.742 1.00 . A A .  82 GLN HE21 1 1 
        1  1299 1 1  82 GLN HE22 H   -7.602  10.273   5.457 1.00 . A A .  82 GLN HE22 1 1 
        1  1300 1 1  82 GLN HG2  H   -6.989   8.214   2.583 1.00 . A A .  82 GLN HG2  1 1 
        1  1301 1 1  82 GLN HG3  H   -6.336   9.730   1.953 1.00 . A A .  82 GLN HG3  1 1 
        1  1302 1 1  82 GLN N    N   -6.658   9.096  -0.780 1.00 . A A .  82 GLN N    1 1 
        1  1303 1 1  82 GLN NE2  N   -7.267   9.751   4.666 1.00 . A A .  82 GLN NE2  1 1 
        1  1304 1 1  82 GLN O    O   -9.173   6.731  -1.072 1.00 . A A .  82 GLN O    1 1 
        1  1305 1 1  82 GLN OE1  O   -8.715  10.796   3.403 1.00 . A A .  82 GLN OE1  1 1 
        1  1306 1 1  83 GLN C    C   -9.925   7.606  -3.888 1.00 . A A .  83 GLN C    1 1 
        1  1307 1 1  83 GLN CA   C  -10.384   8.588  -2.801 1.00 . A A .  83 GLN CA   1 1 
        1  1308 1 1  83 GLN CB   C  -10.816   9.917  -3.446 1.00 . A A .  83 GLN CB   1 1 
        1  1309 1 1  83 GLN CD   C  -13.011  10.340  -2.213 1.00 . A A .  83 GLN CD   1 1 
        1  1310 1 1  83 GLN CG   C  -11.599  10.845  -2.502 1.00 . A A .  83 GLN CG   1 1 
        1  1311 1 1  83 GLN H    H   -9.009   9.802  -1.700 1.00 . A A .  83 GLN H    1 1 
        1  1312 1 1  83 GLN HA   H  -11.246   8.136  -2.308 1.00 . A A .  83 GLN HA   1 1 
        1  1313 1 1  83 GLN HB2  H   -9.927  10.443  -3.799 1.00 . A A .  83 GLN HB2  1 1 
        1  1314 1 1  83 GLN HB3  H  -11.441   9.707  -4.315 1.00 . A A .  83 GLN HB3  1 1 
        1  1315 1 1  83 GLN HE21 H  -12.512   9.607  -0.391 1.00 . A A .  83 GLN HE21 1 1 
        1  1316 1 1  83 GLN HE22 H  -14.183   9.395  -0.892 1.00 . A A .  83 GLN HE22 1 1 
        1  1317 1 1  83 GLN HG2  H  -11.060  10.962  -1.563 1.00 . A A .  83 GLN HG2  1 1 
        1  1318 1 1  83 GLN HG3  H  -11.667  11.829  -2.964 1.00 . A A .  83 GLN HG3  1 1 
        1  1319 1 1  83 GLN N    N   -9.344   8.847  -1.801 1.00 . A A .  83 GLN N    1 1 
        1  1320 1 1  83 GLN NE2  N  -13.245   9.718  -1.075 1.00 . A A .  83 GLN NE2  1 1 
        1  1321 1 1  83 GLN O    O  -10.722   6.783  -4.328 1.00 . A A .  83 GLN O    1 1 
        1  1322 1 1  83 GLN OE1  O  -13.929  10.484  -3.010 1.00 . A A .  83 GLN OE1  1 1 
        1  1323 1 1  84 LYS C    C   -7.773   5.396  -4.802 1.00 . A A .  84 LYS C    1 1 
        1  1324 1 1  84 LYS CA   C   -8.074   6.788  -5.340 1.00 . A A .  84 LYS CA   1 1 
        1  1325 1 1  84 LYS CB   C   -6.856   7.543  -5.902 1.00 . A A .  84 LYS CB   1 1 
        1  1326 1 1  84 LYS CD   C   -4.831   6.013  -6.200 1.00 . A A .  84 LYS CD   1 1 
        1  1327 1 1  84 LYS CE   C   -3.864   6.837  -5.333 1.00 . A A .  84 LYS CE   1 1 
        1  1328 1 1  84 LYS CG   C   -5.966   6.784  -6.891 1.00 . A A .  84 LYS CG   1 1 
        1  1329 1 1  84 LYS H    H   -7.998   8.239  -3.826 1.00 . A A .  84 LYS H    1 1 
        1  1330 1 1  84 LYS HA   H   -8.797   6.662  -6.148 1.00 . A A .  84 LYS HA   1 1 
        1  1331 1 1  84 LYS HB2  H   -7.230   8.426  -6.419 1.00 . A A .  84 LYS HB2  1 1 
        1  1332 1 1  84 LYS HB3  H   -6.241   7.883  -5.074 1.00 . A A .  84 LYS HB3  1 1 
        1  1333 1 1  84 LYS HD2  H   -5.281   5.267  -5.549 1.00 . A A .  84 LYS HD2  1 1 
        1  1334 1 1  84 LYS HD3  H   -4.261   5.506  -6.973 1.00 . A A .  84 LYS HD3  1 1 
        1  1335 1 1  84 LYS HE2  H   -4.412   7.235  -4.475 1.00 . A A .  84 LYS HE2  1 1 
        1  1336 1 1  84 LYS HE3  H   -3.103   6.161  -4.936 1.00 . A A .  84 LYS HE3  1 1 
        1  1337 1 1  84 LYS HG2  H   -6.576   6.093  -7.475 1.00 . A A .  84 LYS HG2  1 1 
        1  1338 1 1  84 LYS HG3  H   -5.526   7.500  -7.586 1.00 . A A .  84 LYS HG3  1 1 
        1  1339 1 1  84 LYS HZ1  H   -2.714   8.560  -5.418 1.00 . A A .  84 LYS HZ1  1 1 
        1  1340 1 1  84 LYS HZ2  H   -2.549   7.608  -6.757 1.00 . A A .  84 LYS HZ2  1 1 
        1  1341 1 1  84 LYS HZ3  H   -3.885   8.534  -6.544 1.00 . A A .  84 LYS HZ3  1 1 
        1  1342 1 1  84 LYS N    N   -8.649   7.632  -4.294 1.00 . A A .  84 LYS N    1 1 
        1  1343 1 1  84 LYS NZ   N   -3.211   7.949  -6.073 1.00 . A A .  84 LYS NZ   1 1 
        1  1344 1 1  84 LYS O    O   -8.044   4.424  -5.495 1.00 . A A .  84 LYS O    1 1 
        1  1345 1 1  85 VAL C    C   -8.413   3.268  -2.653 1.00 . A A .  85 VAL C    1 1 
        1  1346 1 1  85 VAL CA   C   -7.074   3.969  -2.900 1.00 . A A .  85 VAL CA   1 1 
        1  1347 1 1  85 VAL CB   C   -6.276   4.148  -1.588 1.00 . A A .  85 VAL CB   1 1 
        1  1348 1 1  85 VAL CG1  C   -6.223   2.877  -0.728 1.00 . A A .  85 VAL CG1  1 1 
        1  1349 1 1  85 VAL CG2  C   -4.823   4.559  -1.863 1.00 . A A .  85 VAL CG2  1 1 
        1  1350 1 1  85 VAL H    H   -7.085   6.130  -3.053 1.00 . A A .  85 VAL H    1 1 
        1  1351 1 1  85 VAL HA   H   -6.505   3.319  -3.572 1.00 . A A .  85 VAL HA   1 1 
        1  1352 1 1  85 VAL HB   H   -6.747   4.935  -1.000 1.00 . A A .  85 VAL HB   1 1 
        1  1353 1 1  85 VAL HG11 H   -5.835   2.042  -1.313 1.00 . A A .  85 VAL HG11 1 1 
        1  1354 1 1  85 VAL HG12 H   -5.575   3.038   0.134 1.00 . A A .  85 VAL HG12 1 1 
        1  1355 1 1  85 VAL HG13 H   -7.217   2.626  -0.356 1.00 . A A .  85 VAL HG13 1 1 
        1  1356 1 1  85 VAL HG21 H   -4.780   5.396  -2.556 1.00 . A A .  85 VAL HG21 1 1 
        1  1357 1 1  85 VAL HG22 H   -4.350   4.858  -0.929 1.00 . A A .  85 VAL HG22 1 1 
        1  1358 1 1  85 VAL HG23 H   -4.267   3.725  -2.284 1.00 . A A .  85 VAL HG23 1 1 
        1  1359 1 1  85 VAL N    N   -7.294   5.272  -3.563 1.00 . A A .  85 VAL N    1 1 
        1  1360 1 1  85 VAL O    O   -8.559   2.099  -3.015 1.00 . A A .  85 VAL O    1 1 
        1  1361 1 1  86 LYS C    C  -11.448   3.083  -3.273 1.00 . A A .  86 LYS C    1 1 
        1  1362 1 1  86 LYS CA   C  -10.773   3.411  -1.939 1.00 . A A .  86 LYS CA   1 1 
        1  1363 1 1  86 LYS CB   C  -11.642   4.317  -1.046 1.00 . A A .  86 LYS CB   1 1 
        1  1364 1 1  86 LYS CD   C  -12.010   4.987   1.450 1.00 . A A .  86 LYS CD   1 1 
        1  1365 1 1  86 LYS CE   C  -13.354   4.265   1.561 1.00 . A A .  86 LYS CE   1 1 
        1  1366 1 1  86 LYS CG   C  -11.090   4.354   0.391 1.00 . A A .  86 LYS CG   1 1 
        1  1367 1 1  86 LYS H    H   -9.253   4.938  -1.843 1.00 . A A .  86 LYS H    1 1 
        1  1368 1 1  86 LYS HA   H  -10.668   2.450  -1.429 1.00 . A A .  86 LYS HA   1 1 
        1  1369 1 1  86 LYS HB2  H  -11.682   5.328  -1.456 1.00 . A A .  86 LYS HB2  1 1 
        1  1370 1 1  86 LYS HB3  H  -12.653   3.908  -1.035 1.00 . A A .  86 LYS HB3  1 1 
        1  1371 1 1  86 LYS HD2  H  -11.505   4.922   2.415 1.00 . A A .  86 LYS HD2  1 1 
        1  1372 1 1  86 LYS HD3  H  -12.177   6.038   1.209 1.00 . A A .  86 LYS HD3  1 1 
        1  1373 1 1  86 LYS HE2  H  -13.954   4.533   0.689 1.00 . A A .  86 LYS HE2  1 1 
        1  1374 1 1  86 LYS HE3  H  -13.163   3.192   1.534 1.00 . A A .  86 LYS HE3  1 1 
        1  1375 1 1  86 LYS HG2  H  -10.857   3.340   0.705 1.00 . A A .  86 LYS HG2  1 1 
        1  1376 1 1  86 LYS HG3  H  -10.155   4.904   0.385 1.00 . A A .  86 LYS HG3  1 1 
        1  1377 1 1  86 LYS HZ1  H  -13.608   4.229   3.636 1.00 . A A .  86 LYS HZ1  1 1 
        1  1378 1 1  86 LYS HZ2  H  -14.170   5.609   2.932 1.00 . A A .  86 LYS HZ2  1 1 
        1  1379 1 1  86 LYS HZ3  H  -15.010   4.214   2.814 1.00 . A A .  86 LYS HZ3  1 1 
        1  1380 1 1  86 LYS N    N   -9.425   3.978  -2.130 1.00 . A A .  86 LYS N    1 1 
        1  1381 1 1  86 LYS NZ   N  -14.080   4.610   2.813 1.00 . A A .  86 LYS NZ   1 1 
        1  1382 1 1  86 LYS O    O  -11.971   1.979  -3.421 1.00 . A A .  86 LYS O    1 1 
        1  1383 1 1  87 LYS C    C  -11.137   2.466  -6.272 1.00 . A A .  87 LYS C    1 1 
        1  1384 1 1  87 LYS CA   C  -11.841   3.668  -5.645 1.00 . A A .  87 LYS CA   1 1 
        1  1385 1 1  87 LYS CB   C  -11.746   4.915  -6.529 1.00 . A A .  87 LYS CB   1 1 
        1  1386 1 1  87 LYS CD   C  -12.555   6.002  -8.636 1.00 . A A .  87 LYS CD   1 1 
        1  1387 1 1  87 LYS CE   C  -13.127   5.776 -10.041 1.00 . A A .  87 LYS CE   1 1 
        1  1388 1 1  87 LYS CG   C  -12.351   4.668  -7.919 1.00 . A A .  87 LYS CG   1 1 
        1  1389 1 1  87 LYS H    H  -10.899   4.851  -4.104 1.00 . A A .  87 LYS H    1 1 
        1  1390 1 1  87 LYS HA   H  -12.900   3.415  -5.581 1.00 . A A .  87 LYS HA   1 1 
        1  1391 1 1  87 LYS HB2  H  -12.309   5.715  -6.045 1.00 . A A .  87 LYS HB2  1 1 
        1  1392 1 1  87 LYS HB3  H  -10.705   5.224  -6.635 1.00 . A A .  87 LYS HB3  1 1 
        1  1393 1 1  87 LYS HD2  H  -13.251   6.598  -8.045 1.00 . A A .  87 LYS HD2  1 1 
        1  1394 1 1  87 LYS HD3  H  -11.598   6.520  -8.701 1.00 . A A .  87 LYS HD3  1 1 
        1  1395 1 1  87 LYS HE2  H  -12.429   5.154 -10.610 1.00 . A A .  87 LYS HE2  1 1 
        1  1396 1 1  87 LYS HE3  H  -14.070   5.228  -9.953 1.00 . A A .  87 LYS HE3  1 1 
        1  1397 1 1  87 LYS HG2  H  -11.682   4.036  -8.506 1.00 . A A .  87 LYS HG2  1 1 
        1  1398 1 1  87 LYS HG3  H  -13.317   4.171  -7.817 1.00 . A A .  87 LYS HG3  1 1 
        1  1399 1 1  87 LYS HZ1  H  -14.008   7.649 -10.252 1.00 . A A .  87 LYS HZ1  1 1 
        1  1400 1 1  87 LYS HZ2  H  -12.492   7.580 -10.862 1.00 . A A .  87 LYS HZ2  1 1 
        1  1401 1 1  87 LYS HZ3  H  -13.734   6.904 -11.676 1.00 . A A .  87 LYS HZ3  1 1 
        1  1402 1 1  87 LYS N    N  -11.341   3.954  -4.286 1.00 . A A .  87 LYS N    1 1 
        1  1403 1 1  87 LYS NZ   N  -13.354   7.062 -10.752 1.00 . A A .  87 LYS NZ   1 1 
        1  1404 1 1  87 LYS O    O  -11.805   1.624  -6.856 1.00 . A A .  87 LYS O    1 1 
        1  1405 1 1  88 THR C    C   -9.457  -0.135  -5.916 1.00 . A A .  88 THR C    1 1 
        1  1406 1 1  88 THR CA   C   -9.049   1.178  -6.593 1.00 . A A .  88 THR CA   1 1 
        1  1407 1 1  88 THR CB   C   -7.541   1.424  -6.451 1.00 . A A .  88 THR CB   1 1 
        1  1408 1 1  88 THR CG2  C   -6.722   0.286  -7.038 1.00 . A A .  88 THR CG2  1 1 
        1  1409 1 1  88 THR H    H   -9.315   3.081  -5.659 1.00 . A A .  88 THR H    1 1 
        1  1410 1 1  88 THR HA   H   -9.242   1.080  -7.654 1.00 . A A .  88 THR HA   1 1 
        1  1411 1 1  88 THR HB   H   -7.275   1.564  -5.403 1.00 . A A .  88 THR HB   1 1 
        1  1412 1 1  88 THR HG1  H   -7.489   3.338  -6.696 1.00 . A A .  88 THR HG1  1 1 
        1  1413 1 1  88 THR HG21 H   -6.997   0.142  -8.081 1.00 . A A .  88 THR HG21 1 1 
        1  1414 1 1  88 THR HG22 H   -5.668   0.538  -6.964 1.00 . A A .  88 THR HG22 1 1 
        1  1415 1 1  88 THR HG23 H   -6.902  -0.628  -6.478 1.00 . A A .  88 THR HG23 1 1 
        1  1416 1 1  88 THR N    N   -9.823   2.325  -6.095 1.00 . A A .  88 THR N    1 1 
        1  1417 1 1  88 THR O    O   -9.541  -1.165  -6.586 1.00 . A A .  88 THR O    1 1 
        1  1418 1 1  88 THR OG1  O   -7.174   2.562  -7.199 1.00 . A A .  88 THR OG1  1 1 
        1  1419 1 1  89 ALA C    C  -11.706  -1.653  -4.367 1.00 . A A .  89 ALA C    1 1 
        1  1420 1 1  89 ALA CA   C  -10.293  -1.264  -3.893 1.00 . A A .  89 ALA CA   1 1 
        1  1421 1 1  89 ALA CB   C  -10.248  -0.941  -2.398 1.00 . A A .  89 ALA CB   1 1 
        1  1422 1 1  89 ALA H    H   -9.768   0.774  -4.127 1.00 . A A .  89 ALA H    1 1 
        1  1423 1 1  89 ALA HA   H   -9.629  -2.111  -4.074 1.00 . A A .  89 ALA HA   1 1 
        1  1424 1 1  89 ALA HB1  H   -9.220  -0.722  -2.102 1.00 . A A .  89 ALA HB1  1 1 
        1  1425 1 1  89 ALA HB2  H  -10.876  -0.080  -2.174 1.00 . A A .  89 ALA HB2  1 1 
        1  1426 1 1  89 ALA HB3  H  -10.613  -1.799  -1.837 1.00 . A A .  89 ALA HB3  1 1 
        1  1427 1 1  89 ALA N    N   -9.795  -0.105  -4.624 1.00 . A A .  89 ALA N    1 1 
        1  1428 1 1  89 ALA O    O  -11.998  -2.839  -4.531 1.00 . A A .  89 ALA O    1 1 
        1  1429 1 1  90 GLU C    C  -13.789  -1.402  -6.737 1.00 . A A .  90 GLU C    1 1 
        1  1430 1 1  90 GLU CA   C  -13.878  -0.908  -5.280 1.00 . A A .  90 GLU CA   1 1 
        1  1431 1 1  90 GLU CB   C  -14.750   0.358  -5.218 1.00 . A A .  90 GLU CB   1 1 
        1  1432 1 1  90 GLU CD   C  -16.153   1.910  -3.794 1.00 . A A .  90 GLU CD   1 1 
        1  1433 1 1  90 GLU CG   C  -15.180   0.715  -3.792 1.00 . A A .  90 GLU CG   1 1 
        1  1434 1 1  90 GLU H    H  -12.281   0.291  -4.480 1.00 . A A .  90 GLU H    1 1 
        1  1435 1 1  90 GLU HA   H  -14.361  -1.690  -4.703 1.00 . A A .  90 GLU HA   1 1 
        1  1436 1 1  90 GLU HB2  H  -14.213   1.198  -5.659 1.00 . A A .  90 GLU HB2  1 1 
        1  1437 1 1  90 GLU HB3  H  -15.652   0.185  -5.808 1.00 . A A .  90 GLU HB3  1 1 
        1  1438 1 1  90 GLU HG2  H  -15.660  -0.156  -3.341 1.00 . A A .  90 GLU HG2  1 1 
        1  1439 1 1  90 GLU HG3  H  -14.298   0.953  -3.197 1.00 . A A .  90 GLU HG3  1 1 
        1  1440 1 1  90 GLU N    N  -12.559  -0.667  -4.677 1.00 . A A .  90 GLU N    1 1 
        1  1441 1 1  90 GLU O    O  -14.592  -2.230  -7.173 1.00 . A A .  90 GLU O    1 1 
        1  1442 1 1  90 GLU OE1  O  -15.695   3.079  -3.770 1.00 . A A .  90 GLU OE1  1 1 
        1  1443 1 1  90 GLU OE2  O  -17.389   1.689  -3.815 1.00 . A A .  90 GLU OE2  1 1 
        1  1444 1 1  91 ALA C    C  -11.813  -2.638  -9.049 1.00 . A A .  91 ALA C    1 1 
        1  1445 1 1  91 ALA CA   C  -12.501  -1.265  -8.870 1.00 . A A .  91 ALA CA   1 1 
        1  1446 1 1  91 ALA CB   C  -11.649  -0.123  -9.444 1.00 . A A .  91 ALA CB   1 1 
        1  1447 1 1  91 ALA H    H  -12.223  -0.190  -7.066 1.00 . A A .  91 ALA H    1 1 
        1  1448 1 1  91 ALA HA   H  -13.444  -1.301  -9.417 1.00 . A A .  91 ALA HA   1 1 
        1  1449 1 1  91 ALA HB1  H  -10.716  -0.035  -8.885 1.00 . A A .  91 ALA HB1  1 1 
        1  1450 1 1  91 ALA HB2  H  -11.423  -0.314 -10.493 1.00 . A A .  91 ALA HB2  1 1 
        1  1451 1 1  91 ALA HB3  H  -12.192   0.820  -9.363 1.00 . A A .  91 ALA HB3  1 1 
        1  1452 1 1  91 ALA N    N  -12.788  -0.924  -7.478 1.00 . A A .  91 ALA N    1 1 
        1  1453 1 1  91 ALA O    O  -11.657  -3.108 -10.180 1.00 . A A .  91 ALA O    1 1 
        1  1454 1 1  92 GLY C    C   -9.231  -4.505  -8.399 1.00 . A A .  92 GLY C    1 1 
        1  1455 1 1  92 GLY CA   C  -10.705  -4.580  -7.974 1.00 . A A .  92 GLY CA   1 1 
        1  1456 1 1  92 GLY H    H  -11.551  -2.846  -7.058 1.00 . A A .  92 GLY H    1 1 
        1  1457 1 1  92 GLY HA2  H  -10.734  -5.000  -6.968 1.00 . A A .  92 GLY HA2  1 1 
        1  1458 1 1  92 GLY HA3  H  -11.226  -5.265  -8.644 1.00 . A A .  92 GLY HA3  1 1 
        1  1459 1 1  92 GLY N    N  -11.398  -3.288  -7.954 1.00 . A A .  92 GLY N    1 1 
        1  1460 1 1  92 GLY O    O   -8.687  -5.504  -8.878 1.00 . A A .  92 GLY O    1 1 
        1  1461 1 1  93 GLY C    C   -6.790  -2.388  -9.739 1.00 . A A .  93 GLY C    1 1 
        1  1462 1 1  93 GLY CA   C   -7.155  -3.149  -8.462 1.00 . A A .  93 GLY CA   1 1 
        1  1463 1 1  93 GLY H    H   -9.076  -2.566  -7.817 1.00 . A A .  93 GLY H    1 1 
        1  1464 1 1  93 GLY HA2  H   -6.754  -2.601  -7.614 1.00 . A A .  93 GLY HA2  1 1 
        1  1465 1 1  93 GLY HA3  H   -6.661  -4.116  -8.499 1.00 . A A .  93 GLY HA3  1 1 
        1  1466 1 1  93 GLY N    N   -8.581  -3.347  -8.231 1.00 . A A .  93 GLY N    1 1 
        1  1467 1 1  93 GLY O    O   -7.505  -2.422 -10.744 1.00 . A A .  93 GLY O    1 1 
        1  1468 1 1  94 VAL C    C   -3.474  -1.548 -10.890 1.00 . A A .  94 VAL C    1 1 
        1  1469 1 1  94 VAL CA   C   -4.943  -1.108 -10.840 1.00 . A A .  94 VAL CA   1 1 
        1  1470 1 1  94 VAL CB   C   -5.116   0.425 -10.857 1.00 . A A .  94 VAL CB   1 1 
        1  1471 1 1  94 VAL CG1  C   -4.286   1.165  -9.801 1.00 . A A .  94 VAL CG1  1 1 
        1  1472 1 1  94 VAL CG2  C   -4.766   0.988 -12.239 1.00 . A A .  94 VAL CG2  1 1 
        1  1473 1 1  94 VAL H    H   -5.158  -1.715  -8.796 1.00 . A A .  94 VAL H    1 1 
        1  1474 1 1  94 VAL HA   H   -5.420  -1.486 -11.744 1.00 . A A .  94 VAL HA   1 1 
        1  1475 1 1  94 VAL HB   H   -6.168   0.644 -10.672 1.00 . A A .  94 VAL HB   1 1 
        1  1476 1 1  94 VAL HG11 H   -3.227   1.138 -10.057 1.00 . A A .  94 VAL HG11 1 1 
        1  1477 1 1  94 VAL HG12 H   -4.612   2.204  -9.745 1.00 . A A .  94 VAL HG12 1 1 
        1  1478 1 1  94 VAL HG13 H   -4.421   0.699  -8.828 1.00 . A A .  94 VAL HG13 1 1 
        1  1479 1 1  94 VAL HG21 H   -5.376   0.502 -13.000 1.00 . A A .  94 VAL HG21 1 1 
        1  1480 1 1  94 VAL HG22 H   -4.971   2.059 -12.259 1.00 . A A .  94 VAL HG22 1 1 
        1  1481 1 1  94 VAL HG23 H   -3.712   0.824 -12.464 1.00 . A A .  94 VAL HG23 1 1 
        1  1482 1 1  94 VAL N    N   -5.633  -1.723  -9.688 1.00 . A A .  94 VAL N    1 1 
        1  1483 1 1  94 VAL O    O   -2.769  -1.521  -9.882 1.00 . A A .  94 VAL O    1 1 
        1  1484 1 1  95 THR C    C   -0.777  -2.550 -13.117 1.00 . A A .  95 THR C    1 1 
        1  1485 1 1  95 THR CA   C   -1.903  -2.968 -12.176 1.00 . A A .  95 THR CA   1 1 
        1  1486 1 1  95 THR CB   C   -2.447  -4.346 -12.587 1.00 . A A .  95 THR CB   1 1 
        1  1487 1 1  95 THR CG2  C   -3.198  -5.001 -11.427 1.00 . A A .  95 THR CG2  1 1 
        1  1488 1 1  95 THR H    H   -3.656  -1.987 -12.843 1.00 . A A .  95 THR H    1 1 
        1  1489 1 1  95 THR HA   H   -1.412  -3.071 -11.212 1.00 . A A .  95 THR HA   1 1 
        1  1490 1 1  95 THR HB   H   -1.615  -4.981 -12.890 1.00 . A A .  95 THR HB   1 1 
        1  1491 1 1  95 THR HG1  H   -3.599  -5.115 -13.956 1.00 . A A .  95 THR HG1  1 1 
        1  1492 1 1  95 THR HG21 H   -3.522  -6.001 -11.714 1.00 . A A .  95 THR HG21 1 1 
        1  1493 1 1  95 THR HG22 H   -2.536  -5.079 -10.566 1.00 . A A .  95 THR HG22 1 1 
        1  1494 1 1  95 THR HG23 H   -4.069  -4.403 -11.155 1.00 . A A .  95 THR HG23 1 1 
        1  1495 1 1  95 THR N    N   -3.019  -2.005 -12.057 1.00 . A A .  95 THR N    1 1 
        1  1496 1 1  95 THR O    O    0.022  -3.385 -13.549 1.00 . A A .  95 THR O    1 1 
        1  1497 1 1  95 THR OG1  O   -3.349  -4.217 -13.671 1.00 . A A .  95 THR OG1  1 1 
        1  1498 1 1  96 GLY C    C    1.751  -0.730 -13.894 1.00 . A A .  96 GLY C    1 1 
        1  1499 1 1  96 GLY CA   C    0.303  -0.790 -14.411 1.00 . A A .  96 GLY CA   1 1 
        1  1500 1 1  96 GLY H    H   -1.349  -0.610 -13.058 1.00 . A A .  96 GLY H    1 1 
        1  1501 1 1  96 GLY HA2  H    0.274  -1.496 -15.241 1.00 . A A .  96 GLY HA2  1 1 
        1  1502 1 1  96 GLY HA3  H    0.008   0.193 -14.770 1.00 . A A .  96 GLY HA3  1 1 
        1  1503 1 1  96 GLY N    N   -0.683  -1.263 -13.445 1.00 . A A .  96 GLY N    1 1 
        1  1504 1 1  96 GLY O    O    2.043  -1.034 -12.732 1.00 . A A .  96 GLY O    1 1 
        1  1505 1 1  97 LYS C    C    4.575   0.704 -13.443 1.00 . A A .  97 LYS C    1 1 
        1  1506 1 1  97 LYS CA   C    4.133  -0.300 -14.520 1.00 . A A .  97 LYS CA   1 1 
        1  1507 1 1  97 LYS CB   C    4.882  -0.026 -15.838 1.00 . A A .  97 LYS CB   1 1 
        1  1508 1 1  97 LYS CD   C    5.513  -0.880 -18.140 1.00 . A A .  97 LYS CD   1 1 
        1  1509 1 1  97 LYS CE   C    5.318  -2.020 -19.147 1.00 . A A .  97 LYS CE   1 1 
        1  1510 1 1  97 LYS CG   C    4.703  -1.157 -16.866 1.00 . A A .  97 LYS CG   1 1 
        1  1511 1 1  97 LYS H    H    2.354  -0.077 -15.701 1.00 . A A .  97 LYS H    1 1 
        1  1512 1 1  97 LYS HA   H    4.437  -1.282 -14.155 1.00 . A A .  97 LYS HA   1 1 
        1  1513 1 1  97 LYS HB2  H    4.534   0.916 -16.265 1.00 . A A .  97 LYS HB2  1 1 
        1  1514 1 1  97 LYS HB3  H    5.947   0.073 -15.621 1.00 . A A .  97 LYS HB3  1 1 
        1  1515 1 1  97 LYS HD2  H    5.179   0.060 -18.582 1.00 . A A .  97 LYS HD2  1 1 
        1  1516 1 1  97 LYS HD3  H    6.571  -0.797 -17.884 1.00 . A A .  97 LYS HD3  1 1 
        1  1517 1 1  97 LYS HE2  H    5.637  -2.958 -18.682 1.00 . A A .  97 LYS HE2  1 1 
        1  1518 1 1  97 LYS HE3  H    4.252  -2.106 -19.377 1.00 . A A .  97 LYS HE3  1 1 
        1  1519 1 1  97 LYS HG2  H    5.039  -2.097 -16.425 1.00 . A A .  97 LYS HG2  1 1 
        1  1520 1 1  97 LYS HG3  H    3.649  -1.250 -17.131 1.00 . A A .  97 LYS HG3  1 1 
        1  1521 1 1  97 LYS HZ1  H    5.800  -0.930 -20.852 1.00 . A A .  97 LYS HZ1  1 1 
        1  1522 1 1  97 LYS HZ2  H    7.080  -1.719 -20.210 1.00 . A A .  97 LYS HZ2  1 1 
        1  1523 1 1  97 LYS HZ3  H    5.952  -2.541 -21.054 1.00 . A A .  97 LYS HZ3  1 1 
        1  1524 1 1  97 LYS N    N    2.675  -0.321 -14.773 1.00 . A A .  97 LYS N    1 1 
        1  1525 1 1  97 LYS NZ   N    6.088  -1.785 -20.396 1.00 . A A .  97 LYS NZ   1 1 
        1  1526 1 1  97 LYS O    O    5.644   0.534 -12.856 1.00 . A A .  97 LYS O    1 1 
        1  1527 1 1  98 GLY C    C    5.121   3.729 -12.493 1.00 . A A .  98 GLY C    1 1 
        1  1528 1 1  98 GLY CA   C    4.019   2.726 -12.122 1.00 . A A .  98 GLY CA   1 1 
        1  1529 1 1  98 GLY H    H    2.911   1.801 -13.697 1.00 . A A .  98 GLY H    1 1 
        1  1530 1 1  98 GLY HA2  H    3.105   3.286 -11.922 1.00 . A A .  98 GLY HA2  1 1 
        1  1531 1 1  98 GLY HA3  H    4.301   2.216 -11.200 1.00 . A A .  98 GLY HA3  1 1 
        1  1532 1 1  98 GLY N    N    3.758   1.721 -13.157 1.00 . A A .  98 GLY N    1 1 
        1  1533 1 1  98 GLY O    O    5.247   4.140 -13.650 1.00 . A A .  98 GLY O    1 1 
        1  1534 1 1  99 GLN C    C    8.184   4.728 -12.385 1.00 . A A .  99 GLN C    1 1 
        1  1535 1 1  99 GLN CA   C    6.935   5.183 -11.602 1.00 . A A .  99 GLN CA   1 1 
        1  1536 1 1  99 GLN CB   C    7.366   5.612 -10.189 1.00 . A A .  99 GLN CB   1 1 
        1  1537 1 1  99 GLN CD   C    5.915   7.698  -9.688 1.00 . A A .  99 GLN CD   1 1 
        1  1538 1 1  99 GLN CG   C    6.279   6.260  -9.313 1.00 . A A .  99 GLN CG   1 1 
        1  1539 1 1  99 GLN H    H    5.754   3.733 -10.584 1.00 . A A .  99 GLN H    1 1 
        1  1540 1 1  99 GLN HA   H    6.515   6.044 -12.123 1.00 . A A .  99 GLN HA   1 1 
        1  1541 1 1  99 GLN HB2  H    7.725   4.720  -9.675 1.00 . A A .  99 GLN HB2  1 1 
        1  1542 1 1  99 GLN HB3  H    8.203   6.308 -10.261 1.00 . A A .  99 GLN HB3  1 1 
        1  1543 1 1  99 GLN HE21 H    5.190   8.071  -7.837 1.00 . A A .  99 GLN HE21 1 1 
        1  1544 1 1  99 GLN HE22 H    5.078   9.387  -9.011 1.00 . A A .  99 GLN HE22 1 1 
        1  1545 1 1  99 GLN HG2  H    5.374   5.652  -9.314 1.00 . A A .  99 GLN HG2  1 1 
        1  1546 1 1  99 GLN HG3  H    6.658   6.271  -8.293 1.00 . A A .  99 GLN HG3  1 1 
        1  1547 1 1  99 GLN N    N    5.897   4.149 -11.492 1.00 . A A .  99 GLN N    1 1 
        1  1548 1 1  99 GLN NE2  N    5.329   8.442  -8.774 1.00 . A A .  99 GLN NE2  1 1 
        1  1549 1 1  99 GLN O    O    8.515   3.541 -12.436 1.00 . A A .  99 GLN O    1 1 
        1  1550 1 1  99 GLN OE1  O    6.143   8.182 -10.790 1.00 . A A .  99 GLN OE1  1 1 
        1  1551 1 1 100 ASP C    C   11.421   5.629 -12.498 1.00 . A A . 100 ASP C    1 1 
        1  1552 1 1 100 ASP CA   C   10.265   5.499 -13.523 1.00 . A A . 100 ASP CA   1 1 
        1  1553 1 1 100 ASP CB   C   10.419   6.498 -14.680 1.00 . A A . 100 ASP CB   1 1 
        1  1554 1 1 100 ASP CG   C   11.683   6.246 -15.523 1.00 . A A . 100 ASP CG   1 1 
        1  1555 1 1 100 ASP H    H    8.573   6.643 -12.891 1.00 . A A . 100 ASP H    1 1 
        1  1556 1 1 100 ASP HA   H   10.317   4.493 -13.943 1.00 . A A . 100 ASP HA   1 1 
        1  1557 1 1 100 ASP HB2  H    9.547   6.420 -15.333 1.00 . A A . 100 ASP HB2  1 1 
        1  1558 1 1 100 ASP HB3  H   10.437   7.512 -14.272 1.00 . A A . 100 ASP HB3  1 1 
        1  1559 1 1 100 ASP N    N    8.931   5.698 -12.924 1.00 . A A . 100 ASP N    1 1 
        1  1560 1 1 100 ASP O    O   12.545   5.196 -12.759 1.00 . A A . 100 ASP O    1 1 
        1  1561 1 1 100 ASP OD1  O   11.767   5.184 -16.186 1.00 . A A . 100 ASP OD1  1 1 
        1  1562 1 1 100 ASP OD2  O   12.573   7.130 -15.564 1.00 . A A . 100 ASP OD2  1 1 
        1  1563 1 1 101 GLY C    C   12.225   5.050  -9.381 1.00 . A A . 101 GLY C    1 1 
        1  1564 1 1 101 GLY CA   C   12.074   6.342 -10.193 1.00 . A A . 101 GLY CA   1 1 
        1  1565 1 1 101 GLY H    H   10.191   6.467 -11.152 1.00 . A A . 101 GLY H    1 1 
        1  1566 1 1 101 GLY HA2  H   13.058   6.634 -10.564 1.00 . A A . 101 GLY HA2  1 1 
        1  1567 1 1 101 GLY HA3  H   11.726   7.132  -9.528 1.00 . A A . 101 GLY HA3  1 1 
        1  1568 1 1 101 GLY N    N   11.146   6.207 -11.321 1.00 . A A . 101 GLY N    1 1 
        1  1569 1 1 101 GLY O    O   11.499   4.073  -9.586 1.00 . A A . 101 GLY O    1 1 
        1  1570 1 1 102 ILE C    C   14.200   4.037  -6.354 1.00 . A A . 102 ILE C    1 1 
        1  1571 1 1 102 ILE CA   C   13.672   3.828  -7.784 1.00 . A A . 102 ILE CA   1 1 
        1  1572 1 1 102 ILE CB   C   14.703   3.164  -8.729 1.00 . A A . 102 ILE CB   1 1 
        1  1573 1 1 102 ILE CD1  C   15.705   0.903  -9.456 1.00 . A A . 102 ILE CD1  1 1 
        1  1574 1 1 102 ILE CG1  C   14.956   1.685  -8.370 1.00 . A A . 102 ILE CG1  1 1 
        1  1575 1 1 102 ILE CG2  C   16.017   3.970  -8.791 1.00 . A A . 102 ILE CG2  1 1 
        1  1576 1 1 102 ILE H    H   13.697   5.913  -8.306 1.00 . A A . 102 ILE H    1 1 
        1  1577 1 1 102 ILE HA   H   12.827   3.157  -7.658 1.00 . A A . 102 ILE HA   1 1 
        1  1578 1 1 102 ILE HB   H   14.257   3.183  -9.729 1.00 . A A . 102 ILE HB   1 1 
        1  1579 1 1 102 ILE HD11 H   16.717   1.290  -9.576 1.00 . A A . 102 ILE HD11 1 1 
        1  1580 1 1 102 ILE HD12 H   15.767  -0.145  -9.165 1.00 . A A . 102 ILE HD12 1 1 
        1  1581 1 1 102 ILE HD13 H   15.171   0.977 -10.404 1.00 . A A . 102 ILE HD13 1 1 
        1  1582 1 1 102 ILE HG12 H   15.534   1.624  -7.449 1.00 . A A . 102 ILE HG12 1 1 
        1  1583 1 1 102 ILE HG13 H   13.997   1.193  -8.212 1.00 . A A . 102 ILE HG13 1 1 
        1  1584 1 1 102 ILE HG21 H   16.553   3.902  -7.844 1.00 . A A . 102 ILE HG21 1 1 
        1  1585 1 1 102 ILE HG22 H   16.655   3.586  -9.586 1.00 . A A . 102 ILE HG22 1 1 
        1  1586 1 1 102 ILE HG23 H   15.811   5.019  -9.008 1.00 . A A . 102 ILE HG23 1 1 
        1  1587 1 1 102 ILE N    N   13.188   5.044  -8.456 1.00 . A A . 102 ILE N    1 1 
        1  1588 1 1 102 ILE O    O   14.381   3.063  -5.622 1.00 . A A . 102 ILE O    1 1 
        1  1589 1 1 103 GLY C    C   15.742   6.782  -4.371 1.00 . A A . 103 GLY C    1 1 
        1  1590 1 1 103 GLY CA   C   14.729   5.636  -4.538 1.00 . A A . 103 GLY CA   1 1 
        1  1591 1 1 103 GLY H    H   14.190   6.052  -6.556 1.00 . A A . 103 GLY H    1 1 
        1  1592 1 1 103 GLY HA2  H   13.807   5.915  -4.034 1.00 . A A . 103 GLY HA2  1 1 
        1  1593 1 1 103 GLY HA3  H   15.135   4.757  -4.042 1.00 . A A . 103 GLY HA3  1 1 
        1  1594 1 1 103 GLY N    N   14.396   5.284  -5.921 1.00 . A A . 103 GLY N    1 1 
        1  1595 1 1 103 GLY O    O   16.140   7.081  -3.242 1.00 . A A . 103 GLY O    1 1 
        1  1596 1 1 104 SER C    C   16.845   9.810  -5.143 1.00 . A A . 104 SER C    1 1 
        1  1597 1 1 104 SER CA   C   17.292   8.381  -5.486 1.00 . A A . 104 SER CA   1 1 
        1  1598 1 1 104 SER CB   C   17.984   8.361  -6.857 1.00 . A A . 104 SER CB   1 1 
        1  1599 1 1 104 SER H    H   15.751   7.178  -6.348 1.00 . A A . 104 SER H    1 1 
        1  1600 1 1 104 SER HA   H   18.035   8.084  -4.745 1.00 . A A . 104 SER HA   1 1 
        1  1601 1 1 104 SER HB2  H   17.257   8.593  -7.636 1.00 . A A . 104 SER HB2  1 1 
        1  1602 1 1 104 SER HB3  H   18.772   9.117  -6.877 1.00 . A A . 104 SER HB3  1 1 
        1  1603 1 1 104 SER HG   H   18.993   7.107  -7.979 1.00 . A A . 104 SER HG   1 1 
        1  1604 1 1 104 SER N    N   16.195   7.399  -5.464 1.00 . A A . 104 SER N    1 1 
        1  1605 1 1 104 SER O    O   15.685  10.186  -5.327 1.00 . A A . 104 SER O    1 1 
        1  1606 1 1 104 SER OG   O   18.556   7.085  -7.105 1.00 . A A . 104 SER OG   1 1 
        1  1607 1 1 105 LYS C    C   17.257  12.807  -5.785 1.00 . A A . 105 LYS C    1 1 
        1  1608 1 1 105 LYS CA   C   17.564  12.088  -4.460 1.00 . A A . 105 LYS CA   1 1 
        1  1609 1 1 105 LYS CB   C   18.789  12.684  -3.740 1.00 . A A . 105 LYS CB   1 1 
        1  1610 1 1 105 LYS CD   C   19.732  14.711  -2.479 1.00 . A A . 105 LYS CD   1 1 
        1  1611 1 1 105 LYS CE   C   21.042  14.804  -3.276 1.00 . A A . 105 LYS CE   1 1 
        1  1612 1 1 105 LYS CG   C   18.575  14.150  -3.320 1.00 . A A . 105 LYS CG   1 1 
        1  1613 1 1 105 LYS H    H   18.721  10.284  -4.553 1.00 . A A . 105 LYS H    1 1 
        1  1614 1 1 105 LYS HA   H   16.695  12.201  -3.809 1.00 . A A . 105 LYS HA   1 1 
        1  1615 1 1 105 LYS HB2  H   18.988  12.094  -2.844 1.00 . A A . 105 LYS HB2  1 1 
        1  1616 1 1 105 LYS HB3  H   19.657  12.615  -4.398 1.00 . A A . 105 LYS HB3  1 1 
        1  1617 1 1 105 LYS HD2  H   19.452  15.710  -2.138 1.00 . A A . 105 LYS HD2  1 1 
        1  1618 1 1 105 LYS HD3  H   19.879  14.078  -1.601 1.00 . A A . 105 LYS HD3  1 1 
        1  1619 1 1 105 LYS HE2  H   21.334  13.801  -3.600 1.00 . A A . 105 LYS HE2  1 1 
        1  1620 1 1 105 LYS HE3  H   20.865  15.408  -4.171 1.00 . A A . 105 LYS HE3  1 1 
        1  1621 1 1 105 LYS HG2  H   18.453  14.774  -4.207 1.00 . A A . 105 LYS HG2  1 1 
        1  1622 1 1 105 LYS HG3  H   17.661  14.214  -2.728 1.00 . A A . 105 LYS HG3  1 1 
        1  1623 1 1 105 LYS HZ1  H   22.990  15.470  -2.999 1.00 . A A . 105 LYS HZ1  1 1 
        1  1624 1 1 105 LYS HZ2  H   21.893  16.344  -2.168 1.00 . A A . 105 LYS HZ2  1 1 
        1  1625 1 1 105 LYS HZ3  H   22.326  14.859  -1.640 1.00 . A A . 105 LYS HZ3  1 1 
        1  1626 1 1 105 LYS N    N   17.786  10.647  -4.682 1.00 . A A . 105 LYS N    1 1 
        1  1627 1 1 105 LYS NZ   N   22.132  15.409  -2.466 1.00 . A A . 105 LYS NZ   1 1 
        1  1628 1 1 105 LYS O    O   17.913  12.548  -6.796 1.00 . A A . 105 LYS O    1 1 
        1  1629 1 1 106 ALA C    C   15.491  13.707  -8.182 1.00 . A A . 106 ALA C    1 1 
        1  1630 1 1 106 ALA CA   C   15.832  14.523  -6.910 1.00 . A A . 106 ALA CA   1 1 
        1  1631 1 1 106 ALA CB   C   16.822  15.680  -7.127 1.00 . A A . 106 ALA CB   1 1 
        1  1632 1 1 106 ALA H    H   15.807  13.870  -4.884 1.00 . A A . 106 ALA H    1 1 
        1  1633 1 1 106 ALA HA   H   14.885  14.975  -6.618 1.00 . A A . 106 ALA HA   1 1 
        1  1634 1 1 106 ALA HB1  H   17.784  15.293  -7.464 1.00 . A A . 106 ALA HB1  1 1 
        1  1635 1 1 106 ALA HB2  H   16.430  16.365  -7.880 1.00 . A A . 106 ALA HB2  1 1 
        1  1636 1 1 106 ALA HB3  H   16.961  16.230  -6.195 1.00 . A A . 106 ALA HB3  1 1 
        1  1637 1 1 106 ALA N    N   16.277  13.716  -5.764 1.00 . A A . 106 ALA N    1 1 
        1  1638 1 1 106 ALA O    O   15.769  14.129  -9.307 1.00 . A A . 106 ALA O    1 1 
        1  1639 1 1 107 GLU C    C   13.276  11.925  -9.901 1.00 . A A . 107 GLU C    1 1 
        1  1640 1 1 107 GLU CA   C   14.562  11.595  -9.109 1.00 . A A . 107 GLU CA   1 1 
        1  1641 1 1 107 GLU CB   C   14.561  10.151  -8.579 1.00 . A A . 107 GLU CB   1 1 
        1  1642 1 1 107 GLU CD   C   13.530   8.429  -6.998 1.00 . A A . 107 GLU CD   1 1 
        1  1643 1 1 107 GLU CG   C   13.386   9.821  -7.640 1.00 . A A . 107 GLU CG   1 1 
        1  1644 1 1 107 GLU H    H   14.701  12.217  -7.066 1.00 . A A . 107 GLU H    1 1 
        1  1645 1 1 107 GLU HA   H   15.377  11.660  -9.830 1.00 . A A . 107 GLU HA   1 1 
        1  1646 1 1 107 GLU HB2  H   14.535   9.469  -9.429 1.00 . A A . 107 GLU HB2  1 1 
        1  1647 1 1 107 GLU HB3  H   15.498   9.984  -8.049 1.00 . A A . 107 GLU HB3  1 1 
        1  1648 1 1 107 GLU HG2  H   13.328  10.579  -6.856 1.00 . A A . 107 GLU HG2  1 1 
        1  1649 1 1 107 GLU HG3  H   12.454   9.855  -8.208 1.00 . A A . 107 GLU HG3  1 1 
        1  1650 1 1 107 GLU N    N   14.881  12.527  -8.011 1.00 . A A . 107 GLU N    1 1 
        1  1651 1 1 107 GLU O    O   12.951  11.229 -10.869 1.00 . A A . 107 GLU O    1 1 
        1  1652 1 1 107 GLU OE1  O   14.161   7.529  -7.605 1.00 . A A . 107 GLU OE1  1 1 
        1  1653 1 1 107 GLU OE2  O   12.983   8.207  -5.894 1.00 . A A . 107 GLU OE2  1 1 
        1  1654 1 1 108 LYS C    C   11.532  14.751 -10.937 1.00 . A A . 108 LYS C    1 1 
        1  1655 1 1 108 LYS CA   C   11.303  13.467 -10.125 1.00 . A A . 108 LYS CA   1 1 
        1  1656 1 1 108 LYS CB   C   10.217  13.662  -9.052 1.00 . A A . 108 LYS CB   1 1 
        1  1657 1 1 108 LYS CD   C    8.745  12.558  -7.276 1.00 . A A . 108 LYS CD   1 1 
        1  1658 1 1 108 LYS CE   C    7.421  13.123  -7.809 1.00 . A A . 108 LYS CE   1 1 
        1  1659 1 1 108 LYS CG   C    9.782  12.342  -8.388 1.00 . A A . 108 LYS CG   1 1 
        1  1660 1 1 108 LYS H    H   12.915  13.512  -8.727 1.00 . A A . 108 LYS H    1 1 
        1  1661 1 1 108 LYS HA   H   10.939  12.722 -10.832 1.00 . A A . 108 LYS HA   1 1 
        1  1662 1 1 108 LYS HB2  H   10.585  14.348  -8.286 1.00 . A A . 108 LYS HB2  1 1 
        1  1663 1 1 108 LYS HB3  H    9.352  14.121  -9.532 1.00 . A A . 108 LYS HB3  1 1 
        1  1664 1 1 108 LYS HD2  H    8.554  11.599  -6.790 1.00 . A A . 108 LYS HD2  1 1 
        1  1665 1 1 108 LYS HD3  H    9.161  13.242  -6.535 1.00 . A A . 108 LYS HD3  1 1 
        1  1666 1 1 108 LYS HE2  H    7.615  14.072  -8.316 1.00 . A A . 108 LYS HE2  1 1 
        1  1667 1 1 108 LYS HE3  H    7.007  12.424  -8.542 1.00 . A A . 108 LYS HE3  1 1 
        1  1668 1 1 108 LYS HG2  H    9.366  11.674  -9.145 1.00 . A A . 108 LYS HG2  1 1 
        1  1669 1 1 108 LYS HG3  H   10.652  11.856  -7.944 1.00 . A A . 108 LYS HG3  1 1 
        1  1670 1 1 108 LYS HZ1  H    5.571  13.707  -7.046 1.00 . A A . 108 LYS HZ1  1 1 
        1  1671 1 1 108 LYS HZ2  H    6.275  12.480  -6.199 1.00 . A A . 108 LYS HZ2  1 1 
        1  1672 1 1 108 LYS HZ3  H    6.823  13.986  -6.012 1.00 . A A . 108 LYS HZ3  1 1 
        1  1673 1 1 108 LYS N    N   12.549  12.979  -9.503 1.00 . A A . 108 LYS N    1 1 
        1  1674 1 1 108 LYS NZ   N    6.450  13.341  -6.710 1.00 . A A . 108 LYS NZ   1 1 
        1  1675 1 1 108 LYS O    O   12.067  15.736 -10.376 1.00 . A A . 108 LYS O    1 1 
        1  1676 1 1 108 LYS OXT  O   11.168  14.767 -12.135 1.00 . A A . 108 LYS OXT  1 1 
        1  1677 2 2   1 ZN  ZN   ZN   6.894  -2.994  -7.710 1.00 . B A . 109 ZN  ZN   1 1 
        2  1678 1 1   1 MET C    C    1.390 -16.753  15.235 1.00 . A A .   1 MET C    1 1 
        2  1679 1 1   1 MET CA   C    0.897 -18.038  15.906 1.00 . A A .   1 MET CA   1 1 
        2  1680 1 1   1 MET CB   C    1.881 -19.195  15.624 1.00 . A A .   1 MET CB   1 1 
        2  1681 1 1   1 MET CE   C    1.218 -21.947  18.747 1.00 . A A .   1 MET CE   1 1 
        2  1682 1 1   1 MET CG   C    1.585 -20.468  16.429 1.00 . A A .   1 MET CG   1 1 
        2  1683 1 1   1 MET H1   H   -1.111 -17.586  15.685 1.00 . A A .   1 MET H1   1 1 
        2  1684 1 1   1 MET H2   H   -0.838 -19.175  15.956 1.00 . A A .   1 MET H2   1 1 
        2  1685 1 1   1 MET H3   H   -0.524 -18.522  14.483 1.00 . A A .   1 MET H3   1 1 
        2  1686 1 1   1 MET HA   H    0.891 -17.855  16.982 1.00 . A A .   1 MET HA   1 1 
        2  1687 1 1   1 MET HB2  H    1.868 -19.438  14.559 1.00 . A A .   1 MET HB2  1 1 
        2  1688 1 1   1 MET HB3  H    2.892 -18.871  15.878 1.00 . A A .   1 MET HB3  1 1 
        2  1689 1 1   1 MET HE1  H    0.274 -22.290  18.322 1.00 . A A .   1 MET HE1  1 1 
        2  1690 1 1   1 MET HE2  H    2.025 -22.595  18.404 1.00 . A A .   1 MET HE2  1 1 
        2  1691 1 1   1 MET HE3  H    1.159 -21.995  19.834 1.00 . A A .   1 MET HE3  1 1 
        2  1692 1 1   1 MET HG2  H    0.630 -20.886  16.106 1.00 . A A .   1 MET HG2  1 1 
        2  1693 1 1   1 MET HG3  H    2.358 -21.201  16.198 1.00 . A A .   1 MET HG3  1 1 
        2  1694 1 1   1 MET N    N   -0.493 -18.357  15.478 1.00 . A A .   1 MET N    1 1 
        2  1695 1 1   1 MET O    O    0.923 -16.408  14.150 1.00 . A A .   1 MET O    1 1 
        2  1696 1 1   1 MET SD   S    1.541 -20.237  18.230 1.00 . A A .   1 MET SD   1 1 
        2  1697 1 1   2 ALA C    C    1.981 -13.722  14.911 1.00 . A A .   2 ALA C    1 1 
        2  1698 1 1   2 ALA CA   C    2.974 -14.817  15.369 1.00 . A A .   2 ALA CA   1 1 
        2  1699 1 1   2 ALA CB   C    4.051 -15.181  14.335 1.00 . A A .   2 ALA CB   1 1 
        2  1700 1 1   2 ALA H    H    2.684 -16.405  16.751 1.00 . A A .   2 ALA H    1 1 
        2  1701 1 1   2 ALA HA   H    3.503 -14.377  16.216 1.00 . A A .   2 ALA HA   1 1 
        2  1702 1 1   2 ALA HB1  H    3.593 -15.621  13.449 1.00 . A A .   2 ALA HB1  1 1 
        2  1703 1 1   2 ALA HB2  H    4.601 -14.285  14.045 1.00 . A A .   2 ALA HB2  1 1 
        2  1704 1 1   2 ALA HB3  H    4.754 -15.895  14.767 1.00 . A A .   2 ALA HB3  1 1 
        2  1705 1 1   2 ALA N    N    2.340 -16.049  15.870 1.00 . A A .   2 ALA N    1 1 
        2  1706 1 1   2 ALA O    O    2.143 -13.114  13.854 1.00 . A A .   2 ALA O    1 1 
        2  1707 1 1   3 GLU C    C    0.114 -11.257  16.517 1.00 . A A .   3 GLU C    1 1 
        2  1708 1 1   3 GLU CA   C   -0.053 -12.404  15.498 1.00 . A A .   3 GLU CA   1 1 
        2  1709 1 1   3 GLU CB   C   -1.465 -13.027  15.514 1.00 . A A .   3 GLU CB   1 1 
        2  1710 1 1   3 GLU CD   C   -2.502 -11.298  13.941 1.00 . A A .   3 GLU CD   1 1 
        2  1711 1 1   3 GLU CG   C   -2.625 -12.047  15.276 1.00 . A A .   3 GLU CG   1 1 
        2  1712 1 1   3 GLU H    H    0.886 -13.977  16.583 1.00 . A A .   3 GLU H    1 1 
        2  1713 1 1   3 GLU HA   H    0.100 -11.975  14.507 1.00 . A A .   3 GLU HA   1 1 
        2  1714 1 1   3 GLU HB2  H   -1.508 -13.799  14.743 1.00 . A A .   3 GLU HB2  1 1 
        2  1715 1 1   3 GLU HB3  H   -1.622 -13.511  16.479 1.00 . A A .   3 GLU HB3  1 1 
        2  1716 1 1   3 GLU HG2  H   -3.562 -12.609  15.297 1.00 . A A .   3 GLU HG2  1 1 
        2  1717 1 1   3 GLU HG3  H   -2.663 -11.328  16.098 1.00 . A A .   3 GLU HG3  1 1 
        2  1718 1 1   3 GLU N    N    0.945 -13.464  15.716 1.00 . A A .   3 GLU N    1 1 
        2  1719 1 1   3 GLU O    O    0.437 -11.484  17.687 1.00 . A A .   3 GLU O    1 1 
        2  1720 1 1   3 GLU OE1  O   -1.816 -10.250  13.909 1.00 . A A .   3 GLU OE1  1 1 
        2  1721 1 1   3 GLU OE2  O   -3.066 -11.743  12.913 1.00 . A A .   3 GLU OE2  1 1 
        2  1722 1 1   4 SER C    C   -0.793  -7.596  16.350 1.00 . A A .   4 SER C    1 1 
        2  1723 1 1   4 SER CA   C    0.079  -8.773  16.821 1.00 . A A .   4 SER CA   1 1 
        2  1724 1 1   4 SER CB   C    1.551  -8.340  16.728 1.00 . A A .   4 SER CB   1 1 
        2  1725 1 1   4 SER H    H   -0.419  -9.940  15.101 1.00 . A A .   4 SER H    1 1 
        2  1726 1 1   4 SER HA   H   -0.160  -8.954  17.870 1.00 . A A .   4 SER HA   1 1 
        2  1727 1 1   4 SER HB2  H    1.702  -7.421  17.296 1.00 . A A .   4 SER HB2  1 1 
        2  1728 1 1   4 SER HB3  H    2.174  -9.118  17.171 1.00 . A A .   4 SER HB3  1 1 
        2  1729 1 1   4 SER HG   H    1.502  -7.337  15.037 1.00 . A A .   4 SER HG   1 1 
        2  1730 1 1   4 SER N    N   -0.101 -10.022  16.061 1.00 . A A .   4 SER N    1 1 
        2  1731 1 1   4 SER O    O   -0.841  -6.570  17.034 1.00 . A A .   4 SER O    1 1 
        2  1732 1 1   4 SER OG   O    1.951  -8.137  15.378 1.00 . A A .   4 SER OG   1 1 
        2  1733 1 1   5 SER C    C   -3.264  -6.722  13.763 1.00 . A A .   5 SER C    1 1 
        2  1734 1 1   5 SER CA   C   -1.877  -6.538  14.388 1.00 . A A .   5 SER CA   1 1 
        2  1735 1 1   5 SER CB   C   -0.843  -6.275  13.282 1.00 . A A .   5 SER CB   1 1 
        2  1736 1 1   5 SER H    H   -1.483  -8.606  14.727 1.00 . A A .   5 SER H    1 1 
        2  1737 1 1   5 SER HA   H   -1.914  -5.651  15.021 1.00 . A A .   5 SER HA   1 1 
        2  1738 1 1   5 SER HB2  H   -0.771  -7.149  12.632 1.00 . A A .   5 SER HB2  1 1 
        2  1739 1 1   5 SER HB3  H   -1.163  -5.423  12.684 1.00 . A A .   5 SER HB3  1 1 
        2  1740 1 1   5 SER HG   H    1.040  -5.742  13.125 1.00 . A A .   5 SER HG   1 1 
        2  1741 1 1   5 SER N    N   -1.451  -7.700  15.186 1.00 . A A .   5 SER N    1 1 
        2  1742 1 1   5 SER O    O   -3.486  -7.635  12.968 1.00 . A A .   5 SER O    1 1 
        2  1743 1 1   5 SER OG   O    0.433  -6.002  13.843 1.00 . A A .   5 SER OG   1 1 
        2  1744 1 1   6 ASP C    C   -5.852  -5.373  12.177 1.00 . A A .   6 ASP C    1 1 
        2  1745 1 1   6 ASP CA   C   -5.601  -5.859  13.627 1.00 . A A .   6 ASP CA   1 1 
        2  1746 1 1   6 ASP CB   C   -6.466  -5.099  14.649 1.00 . A A .   6 ASP CB   1 1 
        2  1747 1 1   6 ASP CG   C   -6.390  -5.719  16.054 1.00 . A A .   6 ASP CG   1 1 
        2  1748 1 1   6 ASP H    H   -3.942  -5.086  14.722 1.00 . A A .   6 ASP H    1 1 
        2  1749 1 1   6 ASP HA   H   -5.916  -6.904  13.652 1.00 . A A .   6 ASP HA   1 1 
        2  1750 1 1   6 ASP HB2  H   -6.146  -4.055  14.681 1.00 . A A .   6 ASP HB2  1 1 
        2  1751 1 1   6 ASP HB3  H   -7.508  -5.114  14.325 1.00 . A A .   6 ASP HB3  1 1 
        2  1752 1 1   6 ASP N    N   -4.189  -5.805  14.055 1.00 . A A .   6 ASP N    1 1 
        2  1753 1 1   6 ASP O    O   -6.992  -5.100  11.788 1.00 . A A .   6 ASP O    1 1 
        2  1754 1 1   6 ASP OD1  O   -7.061  -6.752  16.298 1.00 . A A .   6 ASP OD1  1 1 
        2  1755 1 1   6 ASP OD2  O   -5.668  -5.171  16.921 1.00 . A A .   6 ASP OD2  1 1 
        2  1756 1 1   7 LYS C    C   -3.815  -5.717   9.190 1.00 . A A .   7 LYS C    1 1 
        2  1757 1 1   7 LYS CA   C   -4.773  -4.815   9.972 1.00 . A A .   7 LYS CA   1 1 
        2  1758 1 1   7 LYS CB   C   -4.480  -3.298   9.834 1.00 . A A .   7 LYS CB   1 1 
        2  1759 1 1   7 LYS CD   C   -2.325  -3.003  11.195 1.00 . A A .   7 LYS CD   1 1 
        2  1760 1 1   7 LYS CE   C   -1.744  -2.629  12.570 1.00 . A A .   7 LYS CE   1 1 
        2  1761 1 1   7 LYS CG   C   -3.796  -2.595  11.021 1.00 . A A .   7 LYS CG   1 1 
        2  1762 1 1   7 LYS H    H   -3.898  -5.579  11.702 1.00 . A A .   7 LYS H    1 1 
        2  1763 1 1   7 LYS HA   H   -5.760  -4.979   9.554 1.00 . A A .   7 LYS HA   1 1 
        2  1764 1 1   7 LYS HB2  H   -3.891  -3.116   8.934 1.00 . A A .   7 LYS HB2  1 1 
        2  1765 1 1   7 LYS HB3  H   -5.439  -2.799   9.693 1.00 . A A .   7 LYS HB3  1 1 
        2  1766 1 1   7 LYS HD2  H   -2.243  -4.082  11.075 1.00 . A A .   7 LYS HD2  1 1 
        2  1767 1 1   7 LYS HD3  H   -1.731  -2.540  10.407 1.00 . A A .   7 LYS HD3  1 1 
        2  1768 1 1   7 LYS HE2  H   -2.220  -3.252  13.333 1.00 . A A .   7 LYS HE2  1 1 
        2  1769 1 1   7 LYS HE3  H   -0.676  -2.871  12.567 1.00 . A A .   7 LYS HE3  1 1 
        2  1770 1 1   7 LYS HG2  H   -3.844  -1.520  10.850 1.00 . A A .   7 LYS HG2  1 1 
        2  1771 1 1   7 LYS HG3  H   -4.355  -2.803  11.933 1.00 . A A .   7 LYS HG3  1 1 
        2  1772 1 1   7 LYS HZ1  H   -1.457  -0.964  13.785 1.00 . A A .   7 LYS HZ1  1 1 
        2  1773 1 1   7 LYS HZ2  H   -1.553  -0.571  12.202 1.00 . A A .   7 LYS HZ2  1 1 
        2  1774 1 1   7 LYS HZ3  H   -2.903  -0.958  13.032 1.00 . A A .   7 LYS HZ3  1 1 
        2  1775 1 1   7 LYS N    N   -4.790  -5.250  11.369 1.00 . A A .   7 LYS N    1 1 
        2  1776 1 1   7 LYS NZ   N   -1.929  -1.195  12.920 1.00 . A A .   7 LYS NZ   1 1 
        2  1777 1 1   7 LYS O    O   -2.903  -6.318   9.764 1.00 . A A .   7 LYS O    1 1 
        2  1778 1 1   8 LEU C    C   -2.470  -5.894   5.978 1.00 . A A .   8 LEU C    1 1 
        2  1779 1 1   8 LEU CA   C   -3.298  -6.704   6.970 1.00 . A A .   8 LEU CA   1 1 
        2  1780 1 1   8 LEU CB   C   -4.272  -7.623   6.206 1.00 . A A .   8 LEU CB   1 1 
        2  1781 1 1   8 LEU CD1  C   -6.605  -7.719   7.221 1.00 . A A .   8 LEU CD1  1 1 
        2  1782 1 1   8 LEU CD2  C   -5.489  -9.809   6.525 1.00 . A A .   8 LEU CD2  1 1 
        2  1783 1 1   8 LEU CG   C   -5.243  -8.413   7.101 1.00 . A A .   8 LEU CG   1 1 
        2  1784 1 1   8 LEU H    H   -4.798  -5.289   7.494 1.00 . A A .   8 LEU H    1 1 
        2  1785 1 1   8 LEU HA   H   -2.591  -7.328   7.520 1.00 . A A .   8 LEU HA   1 1 
        2  1786 1 1   8 LEU HB2  H   -4.841  -7.033   5.490 1.00 . A A .   8 LEU HB2  1 1 
        2  1787 1 1   8 LEU HB3  H   -3.665  -8.324   5.631 1.00 . A A .   8 LEU HB3  1 1 
        2  1788 1 1   8 LEU HD11 H   -7.049  -7.595   6.234 1.00 . A A .   8 LEU HD11 1 1 
        2  1789 1 1   8 LEU HD12 H   -7.271  -8.319   7.842 1.00 . A A .   8 LEU HD12 1 1 
        2  1790 1 1   8 LEU HD13 H   -6.502  -6.740   7.682 1.00 . A A .   8 LEU HD13 1 1 
        2  1791 1 1   8 LEU HD21 H   -4.548 -10.359   6.489 1.00 . A A .   8 LEU HD21 1 1 
        2  1792 1 1   8 LEU HD22 H   -6.187 -10.355   7.159 1.00 . A A .   8 LEU HD22 1 1 
        2  1793 1 1   8 LEU HD23 H   -5.897  -9.729   5.518 1.00 . A A .   8 LEU HD23 1 1 
        2  1794 1 1   8 LEU HG   H   -4.804  -8.510   8.093 1.00 . A A .   8 LEU HG   1 1 
        2  1795 1 1   8 LEU N    N   -4.046  -5.834   7.888 1.00 . A A .   8 LEU N    1 1 
        2  1796 1 1   8 LEU O    O   -1.618  -6.453   5.292 1.00 . A A .   8 LEU O    1 1 
        2  1797 1 1   9 TYR C    C   -1.765  -2.385   5.419 1.00 . A A .   9 TYR C    1 1 
        2  1798 1 1   9 TYR CA   C   -2.267  -3.712   4.838 1.00 . A A .   9 TYR CA   1 1 
        2  1799 1 1   9 TYR CB   C   -3.413  -3.499   3.829 1.00 . A A .   9 TYR CB   1 1 
        2  1800 1 1   9 TYR CD1  C   -3.428  -5.837   2.842 1.00 . A A .   9 TYR CD1  1 1 
        2  1801 1 1   9 TYR CD2  C   -5.545  -4.857   3.520 1.00 . A A .   9 TYR CD2  1 1 
        2  1802 1 1   9 TYR CE1  C   -4.090  -7.012   2.440 1.00 . A A .   9 TYR CE1  1 1 
        2  1803 1 1   9 TYR CE2  C   -6.220  -6.027   3.113 1.00 . A A .   9 TYR CE2  1 1 
        2  1804 1 1   9 TYR CG   C   -4.147  -4.757   3.382 1.00 . A A .   9 TYR CG   1 1 
        2  1805 1 1   9 TYR CZ   C   -5.492  -7.105   2.562 1.00 . A A .   9 TYR CZ   1 1 
        2  1806 1 1   9 TYR H    H   -3.363  -4.187   6.579 1.00 . A A .   9 TYR H    1 1 
        2  1807 1 1   9 TYR HA   H   -1.439  -4.186   4.315 1.00 . A A .   9 TYR HA   1 1 
        2  1808 1 1   9 TYR HB2  H   -4.141  -2.832   4.283 1.00 . A A .   9 TYR HB2  1 1 
        2  1809 1 1   9 TYR HB3  H   -3.016  -2.999   2.945 1.00 . A A .   9 TYR HB3  1 1 
        2  1810 1 1   9 TYR HD1  H   -2.360  -5.758   2.742 1.00 . A A .   9 TYR HD1  1 1 
        2  1811 1 1   9 TYR HD2  H   -6.102  -4.026   3.926 1.00 . A A .   9 TYR HD2  1 1 
        2  1812 1 1   9 TYR HE1  H   -3.535  -7.839   2.020 1.00 . A A .   9 TYR HE1  1 1 
        2  1813 1 1   9 TYR HE2  H   -7.294  -6.098   3.209 1.00 . A A .   9 TYR HE2  1 1 
        2  1814 1 1   9 TYR HH   H   -7.091  -8.097   2.079 1.00 . A A .   9 TYR HH   1 1 
        2  1815 1 1   9 TYR N    N   -2.722  -4.589   5.906 1.00 . A A .   9 TYR N    1 1 
        2  1816 1 1   9 TYR O    O   -2.133  -1.991   6.527 1.00 . A A .   9 TYR O    1 1 
        2  1817 1 1   9 TYR OH   O   -6.130  -8.227   2.133 1.00 . A A .   9 TYR OH   1 1 
        2  1818 1 1  10 ARG C    C   -0.226   0.472   3.754 1.00 . A A .  10 ARG C    1 1 
        2  1819 1 1  10 ARG CA   C   -0.279  -0.411   5.004 1.00 . A A .  10 ARG CA   1 1 
        2  1820 1 1  10 ARG CB   C    1.118  -0.716   5.591 1.00 . A A .  10 ARG CB   1 1 
        2  1821 1 1  10 ARG CD   C    1.745   1.430   6.830 1.00 . A A .  10 ARG CD   1 1 
        2  1822 1 1  10 ARG CG   C    2.129   0.443   5.718 1.00 . A A .  10 ARG CG   1 1 
        2  1823 1 1  10 ARG CZ   C    2.278   3.754   7.534 1.00 . A A .  10 ARG CZ   1 1 
        2  1824 1 1  10 ARG H    H   -0.639  -2.120   3.786 1.00 . A A .  10 ARG H    1 1 
        2  1825 1 1  10 ARG HA   H   -0.890   0.079   5.759 1.00 . A A .  10 ARG HA   1 1 
        2  1826 1 1  10 ARG HB2  H    0.990  -1.177   6.573 1.00 . A A .  10 ARG HB2  1 1 
        2  1827 1 1  10 ARG HB3  H    1.570  -1.468   4.954 1.00 . A A .  10 ARG HB3  1 1 
        2  1828 1 1  10 ARG HD2  H    0.712   1.722   6.678 1.00 . A A .  10 ARG HD2  1 1 
        2  1829 1 1  10 ARG HD3  H    1.829   0.919   7.789 1.00 . A A .  10 ARG HD3  1 1 
        2  1830 1 1  10 ARG HE   H    3.367   2.721   6.242 1.00 . A A .  10 ARG HE   1 1 
        2  1831 1 1  10 ARG HG2  H    3.104   0.015   5.952 1.00 . A A .  10 ARG HG2  1 1 
        2  1832 1 1  10 ARG HG3  H    2.222   0.959   4.762 1.00 . A A .  10 ARG HG3  1 1 
        2  1833 1 1  10 ARG HH11 H    0.791   3.025   8.691 1.00 . A A .  10 ARG HH11 1 1 
        2  1834 1 1  10 ARG HH12 H    1.106   4.774   8.758 1.00 . A A .  10 ARG HH12 1 1 
        2  1835 1 1  10 ARG HH21 H    3.768   4.822   6.749 1.00 . A A .  10 ARG HH21 1 1 
        2  1836 1 1  10 ARG HH22 H    2.626   5.693   7.805 1.00 . A A .  10 ARG HH22 1 1 
        2  1837 1 1  10 ARG N    N   -0.921  -1.689   4.661 1.00 . A A .  10 ARG N    1 1 
        2  1838 1 1  10 ARG NE   N    2.569   2.655   6.856 1.00 . A A .  10 ARG NE   1 1 
        2  1839 1 1  10 ARG NH1  N    1.312   3.849   8.393 1.00 . A A .  10 ARG NH1  1 1 
        2  1840 1 1  10 ARG NH2  N    2.968   4.837   7.380 1.00 . A A .  10 ARG NH2  1 1 
        2  1841 1 1  10 ARG O    O   -0.098  -0.066   2.659 1.00 . A A .  10 ARG O    1 1 
        2  1842 1 1  11 VAL C    C    0.563   4.057   3.341 1.00 . A A .  11 VAL C    1 1 
        2  1843 1 1  11 VAL CA   C   -0.113   2.785   2.818 1.00 . A A .  11 VAL CA   1 1 
        2  1844 1 1  11 VAL CB   C   -1.459   3.098   2.138 1.00 . A A .  11 VAL CB   1 1 
        2  1845 1 1  11 VAL CG1  C   -2.365   4.020   2.966 1.00 . A A .  11 VAL CG1  1 1 
        2  1846 1 1  11 VAL CG2  C   -1.260   3.742   0.761 1.00 . A A .  11 VAL CG2  1 1 
        2  1847 1 1  11 VAL H    H   -0.547   2.150   4.814 1.00 . A A .  11 VAL H    1 1 
        2  1848 1 1  11 VAL HA   H    0.553   2.359   2.066 1.00 . A A .  11 VAL HA   1 1 
        2  1849 1 1  11 VAL HB   H   -1.980   2.143   2.009 1.00 . A A .  11 VAL HB   1 1 
        2  1850 1 1  11 VAL HG11 H   -1.957   5.031   3.006 1.00 . A A .  11 VAL HG11 1 1 
        2  1851 1 1  11 VAL HG12 H   -3.359   4.055   2.523 1.00 . A A .  11 VAL HG12 1 1 
        2  1852 1 1  11 VAL HG13 H   -2.441   3.651   3.986 1.00 . A A .  11 VAL HG13 1 1 
        2  1853 1 1  11 VAL HG21 H   -0.567   3.161   0.160 1.00 . A A .  11 VAL HG21 1 1 
        2  1854 1 1  11 VAL HG22 H   -2.216   3.793   0.238 1.00 . A A .  11 VAL HG22 1 1 
        2  1855 1 1  11 VAL HG23 H   -0.852   4.746   0.868 1.00 . A A .  11 VAL HG23 1 1 
        2  1856 1 1  11 VAL N    N   -0.309   1.794   3.894 1.00 . A A .  11 VAL N    1 1 
        2  1857 1 1  11 VAL O    O    0.349   4.448   4.489 1.00 . A A .  11 VAL O    1 1 
        2  1858 1 1  12 GLU C    C    2.672   6.601   1.578 1.00 . A A .  12 GLU C    1 1 
        2  1859 1 1  12 GLU CA   C    2.057   5.968   2.825 1.00 . A A .  12 GLU CA   1 1 
        2  1860 1 1  12 GLU CB   C    3.175   5.754   3.868 1.00 . A A .  12 GLU CB   1 1 
        2  1861 1 1  12 GLU CD   C    5.370   4.623   4.487 1.00 . A A .  12 GLU CD   1 1 
        2  1862 1 1  12 GLU CG   C    4.286   4.793   3.412 1.00 . A A .  12 GLU CG   1 1 
        2  1863 1 1  12 GLU H    H    1.545   4.341   1.578 1.00 . A A .  12 GLU H    1 1 
        2  1864 1 1  12 GLU HA   H    1.332   6.683   3.220 1.00 . A A .  12 GLU HA   1 1 
        2  1865 1 1  12 GLU HB2  H    3.626   6.718   4.107 1.00 . A A .  12 GLU HB2  1 1 
        2  1866 1 1  12 GLU HB3  H    2.730   5.372   4.783 1.00 . A A .  12 GLU HB3  1 1 
        2  1867 1 1  12 GLU HG2  H    3.852   3.818   3.184 1.00 . A A .  12 GLU HG2  1 1 
        2  1868 1 1  12 GLU HG3  H    4.747   5.181   2.503 1.00 . A A .  12 GLU HG3  1 1 
        2  1869 1 1  12 GLU N    N    1.383   4.706   2.513 1.00 . A A .  12 GLU N    1 1 
        2  1870 1 1  12 GLU O    O    2.976   5.934   0.585 1.00 . A A .  12 GLU O    1 1 
        2  1871 1 1  12 GLU OE1  O    5.022   4.323   5.653 1.00 . A A .  12 GLU OE1  1 1 
        2  1872 1 1  12 GLU OE2  O    6.570   4.765   4.151 1.00 . A A .  12 GLU OE2  1 1 
        2  1873 1 1  13 TYR C    C    5.359   8.203   1.265 1.00 . A A .  13 TYR C    1 1 
        2  1874 1 1  13 TYR CA   C    3.929   8.556   0.836 1.00 . A A .  13 TYR CA   1 1 
        2  1875 1 1  13 TYR CB   C    3.706  10.064   0.882 1.00 . A A .  13 TYR CB   1 1 
        2  1876 1 1  13 TYR CD1  C    1.682  10.086  -0.633 1.00 . A A .  13 TYR CD1  1 1 
        2  1877 1 1  13 TYR CD2  C    1.558  11.234   1.516 1.00 . A A .  13 TYR CD2  1 1 
        2  1878 1 1  13 TYR CE1  C    0.398  10.555  -0.962 1.00 . A A .  13 TYR CE1  1 1 
        2  1879 1 1  13 TYR CE2  C    0.271  11.700   1.195 1.00 . A A .  13 TYR CE2  1 1 
        2  1880 1 1  13 TYR CG   C    2.283  10.477   0.578 1.00 . A A .  13 TYR CG   1 1 
        2  1881 1 1  13 TYR CZ   C   -0.302  11.378  -0.053 1.00 . A A .  13 TYR CZ   1 1 
        2  1882 1 1  13 TYR H    H    2.577   8.405   2.477 1.00 . A A .  13 TYR H    1 1 
        2  1883 1 1  13 TYR HA   H    3.786   8.220  -0.189 1.00 . A A .  13 TYR HA   1 1 
        2  1884 1 1  13 TYR HB2  H    3.987  10.432   1.870 1.00 . A A .  13 TYR HB2  1 1 
        2  1885 1 1  13 TYR HB3  H    4.367  10.537   0.154 1.00 . A A .  13 TYR HB3  1 1 
        2  1886 1 1  13 TYR HD1  H    2.200   9.406  -1.297 1.00 . A A .  13 TYR HD1  1 1 
        2  1887 1 1  13 TYR HD2  H    1.988  11.447   2.485 1.00 . A A .  13 TYR HD2  1 1 
        2  1888 1 1  13 TYR HE1  H   -0.058  10.277  -1.900 1.00 . A A .  13 TYR HE1  1 1 
        2  1889 1 1  13 TYR HE2  H   -0.281  12.305   1.900 1.00 . A A .  13 TYR HE2  1 1 
        2  1890 1 1  13 TYR HH   H   -1.774  11.638  -1.290 1.00 . A A .  13 TYR HH   1 1 
        2  1891 1 1  13 TYR N    N    2.940   7.897   1.681 1.00 . A A .  13 TYR N    1 1 
        2  1892 1 1  13 TYR O    O    5.683   8.179   2.456 1.00 . A A .  13 TYR O    1 1 
        2  1893 1 1  13 TYR OH   O   -1.540  11.836  -0.357 1.00 . A A .  13 TYR OH   1 1 
        2  1894 1 1  14 ALA C    C    8.470   8.893   0.810 1.00 . A A .  14 ALA C    1 1 
        2  1895 1 1  14 ALA CA   C    7.632   7.633   0.513 1.00 . A A .  14 ALA CA   1 1 
        2  1896 1 1  14 ALA CB   C    8.123   6.865  -0.719 1.00 . A A .  14 ALA CB   1 1 
        2  1897 1 1  14 ALA H    H    5.895   7.983  -0.668 1.00 . A A .  14 ALA H    1 1 
        2  1898 1 1  14 ALA HA   H    7.702   6.965   1.373 1.00 . A A .  14 ALA HA   1 1 
        2  1899 1 1  14 ALA HB1  H    8.038   7.493  -1.606 1.00 . A A .  14 ALA HB1  1 1 
        2  1900 1 1  14 ALA HB2  H    9.164   6.572  -0.586 1.00 . A A .  14 ALA HB2  1 1 
        2  1901 1 1  14 ALA HB3  H    7.515   5.974  -0.870 1.00 . A A .  14 ALA HB3  1 1 
        2  1902 1 1  14 ALA N    N    6.231   7.962   0.290 1.00 . A A .  14 ALA N    1 1 
        2  1903 1 1  14 ALA O    O    8.757   9.683  -0.092 1.00 . A A .  14 ALA O    1 1 
        2  1904 1 1  15 LYS C    C   11.252   9.975   2.147 1.00 . A A .  15 LYS C    1 1 
        2  1905 1 1  15 LYS CA   C    9.768  10.193   2.495 1.00 . A A .  15 LYS CA   1 1 
        2  1906 1 1  15 LYS CB   C    9.545  10.414   4.006 1.00 . A A .  15 LYS CB   1 1 
        2  1907 1 1  15 LYS CD   C    9.887  12.967   4.010 1.00 . A A .  15 LYS CD   1 1 
        2  1908 1 1  15 LYS CE   C   10.600  14.151   4.681 1.00 . A A .  15 LYS CE   1 1 
        2  1909 1 1  15 LYS CG   C   10.281  11.614   4.631 1.00 . A A .  15 LYS CG   1 1 
        2  1910 1 1  15 LYS H    H    8.559   8.433   2.772 1.00 . A A .  15 LYS H    1 1 
        2  1911 1 1  15 LYS HA   H    9.453  11.091   1.962 1.00 . A A .  15 LYS HA   1 1 
        2  1912 1 1  15 LYS HB2  H    8.476  10.546   4.184 1.00 . A A .  15 LYS HB2  1 1 
        2  1913 1 1  15 LYS HB3  H    9.856   9.514   4.542 1.00 . A A .  15 LYS HB3  1 1 
        2  1914 1 1  15 LYS HD2  H   10.168  12.970   2.958 1.00 . A A .  15 LYS HD2  1 1 
        2  1915 1 1  15 LYS HD3  H    8.807  13.103   4.075 1.00 . A A .  15 LYS HD3  1 1 
        2  1916 1 1  15 LYS HE2  H   11.677  13.958   4.686 1.00 . A A .  15 LYS HE2  1 1 
        2  1917 1 1  15 LYS HE3  H   10.428  15.042   4.070 1.00 . A A .  15 LYS HE3  1 1 
        2  1918 1 1  15 LYS HG2  H   10.041  11.628   5.694 1.00 . A A .  15 LYS HG2  1 1 
        2  1919 1 1  15 LYS HG3  H   11.358  11.472   4.536 1.00 . A A .  15 LYS HG3  1 1 
        2  1920 1 1  15 LYS HZ1  H    9.121  14.589   6.079 1.00 . A A .  15 LYS HZ1  1 1 
        2  1921 1 1  15 LYS HZ2  H   10.296  13.616   6.673 1.00 . A A .  15 LYS HZ2  1 1 
        2  1922 1 1  15 LYS HZ3  H   10.578  15.207   6.469 1.00 . A A .  15 LYS HZ3  1 1 
        2  1923 1 1  15 LYS N    N    8.899   9.074   2.065 1.00 . A A .  15 LYS N    1 1 
        2  1924 1 1  15 LYS NZ   N   10.115  14.403   6.066 1.00 . A A .  15 LYS NZ   1 1 
        2  1925 1 1  15 LYS O    O   11.994  10.937   1.956 1.00 . A A .  15 LYS O    1 1 
        2  1926 1 1  16 SER C    C   12.915   6.868   1.024 1.00 . A A .  16 SER C    1 1 
        2  1927 1 1  16 SER CA   C   13.015   8.261   1.661 1.00 . A A .  16 SER CA   1 1 
        2  1928 1 1  16 SER CB   C   13.933   8.237   2.887 1.00 . A A .  16 SER CB   1 1 
        2  1929 1 1  16 SER H    H   10.968   8.000   2.122 1.00 . A A .  16 SER H    1 1 
        2  1930 1 1  16 SER HA   H   13.443   8.957   0.940 1.00 . A A .  16 SER HA   1 1 
        2  1931 1 1  16 SER HB2  H   13.810   9.161   3.454 1.00 . A A .  16 SER HB2  1 1 
        2  1932 1 1  16 SER HB3  H   13.673   7.396   3.530 1.00 . A A .  16 SER HB3  1 1 
        2  1933 1 1  16 SER HG   H   15.550   8.989   2.076 1.00 . A A .  16 SER HG   1 1 
        2  1934 1 1  16 SER N    N   11.669   8.714   2.030 1.00 . A A .  16 SER N    1 1 
        2  1935 1 1  16 SER O    O   12.132   6.024   1.478 1.00 . A A .  16 SER O    1 1 
        2  1936 1 1  16 SER OG   O   15.285   8.133   2.469 1.00 . A A .  16 SER OG   1 1 
        2  1937 1 1  17 GLY C    C   14.294   4.191  -0.364 1.00 . A A .  17 GLY C    1 1 
        2  1938 1 1  17 GLY CA   C   13.537   5.416  -0.885 1.00 . A A .  17 GLY CA   1 1 
        2  1939 1 1  17 GLY H    H   14.298   7.332  -0.383 1.00 . A A .  17 GLY H    1 1 
        2  1940 1 1  17 GLY HA2  H   12.482   5.158  -0.943 1.00 . A A .  17 GLY HA2  1 1 
        2  1941 1 1  17 GLY HA3  H   13.884   5.639  -1.892 1.00 . A A .  17 GLY HA3  1 1 
        2  1942 1 1  17 GLY N    N   13.665   6.613  -0.048 1.00 . A A .  17 GLY N    1 1 
        2  1943 1 1  17 GLY O    O   15.085   3.594  -1.098 1.00 . A A .  17 GLY O    1 1 
        2  1944 1 1  18 ARG C    C   14.157   1.376   1.431 1.00 . A A .  18 ARG C    1 1 
        2  1945 1 1  18 ARG CA   C   14.794   2.758   1.628 1.00 . A A .  18 ARG CA   1 1 
        2  1946 1 1  18 ARG CB   C   14.867   3.078   3.136 1.00 . A A .  18 ARG CB   1 1 
        2  1947 1 1  18 ARG CD   C   16.809   4.755   2.954 1.00 . A A .  18 ARG CD   1 1 
        2  1948 1 1  18 ARG CG   C   15.404   4.472   3.499 1.00 . A A .  18 ARG CG   1 1 
        2  1949 1 1  18 ARG CZ   C   18.226   6.550   4.012 1.00 . A A .  18 ARG CZ   1 1 
        2  1950 1 1  18 ARG H    H   13.445   4.425   1.441 1.00 . A A .  18 ARG H    1 1 
        2  1951 1 1  18 ARG HA   H   15.812   2.675   1.240 1.00 . A A .  18 ARG HA   1 1 
        2  1952 1 1  18 ARG HB2  H   13.866   2.987   3.562 1.00 . A A .  18 ARG HB2  1 1 
        2  1953 1 1  18 ARG HB3  H   15.499   2.331   3.621 1.00 . A A .  18 ARG HB3  1 1 
        2  1954 1 1  18 ARG HD2  H   17.505   4.025   3.366 1.00 . A A .  18 ARG HD2  1 1 
        2  1955 1 1  18 ARG HD3  H   16.803   4.649   1.868 1.00 . A A .  18 ARG HD3  1 1 
        2  1956 1 1  18 ARG HE   H   16.587   6.864   2.947 1.00 . A A .  18 ARG HE   1 1 
        2  1957 1 1  18 ARG HG2  H   14.717   5.230   3.125 1.00 . A A .  18 ARG HG2  1 1 
        2  1958 1 1  18 ARG HG3  H   15.430   4.558   4.587 1.00 . A A .  18 ARG HG3  1 1 
        2  1959 1 1  18 ARG HH11 H   19.012   4.748   4.367 1.00 . A A .  18 ARG HH11 1 1 
        2  1960 1 1  18 ARG HH12 H   19.866   6.088   5.083 1.00 . A A .  18 ARG HH12 1 1 
        2  1961 1 1  18 ARG HH21 H   17.705   8.476   3.867 1.00 . A A .  18 ARG HH21 1 1 
        2  1962 1 1  18 ARG HH22 H   19.145   8.156   4.795 1.00 . A A .  18 ARG HH22 1 1 
        2  1963 1 1  18 ARG N    N   14.096   3.850   0.917 1.00 . A A .  18 ARG N    1 1 
        2  1964 1 1  18 ARG NE   N   17.207   6.135   3.284 1.00 . A A .  18 ARG NE   1 1 
        2  1965 1 1  18 ARG NH1  N   19.103   5.737   4.529 1.00 . A A .  18 ARG NH1  1 1 
        2  1966 1 1  18 ARG NH2  N   18.376   7.822   4.240 1.00 . A A .  18 ARG NH2  1 1 
        2  1967 1 1  18 ARG O    O   14.826   0.361   1.626 1.00 . A A .  18 ARG O    1 1 
        2  1968 1 1  19 ALA C    C   12.288  -0.607  -0.387 1.00 . A A .  19 ALA C    1 1 
        2  1969 1 1  19 ALA CA   C   12.081   0.108   0.964 1.00 . A A .  19 ALA CA   1 1 
        2  1970 1 1  19 ALA CB   C   10.610   0.455   1.231 1.00 . A A .  19 ALA CB   1 1 
        2  1971 1 1  19 ALA H    H   12.405   2.205   0.904 1.00 . A A .  19 ALA H    1 1 
        2  1972 1 1  19 ALA HA   H   12.400  -0.579   1.750 1.00 . A A .  19 ALA HA   1 1 
        2  1973 1 1  19 ALA HB1  H   10.509   0.912   2.217 1.00 . A A .  19 ALA HB1  1 1 
        2  1974 1 1  19 ALA HB2  H   10.243   1.148   0.474 1.00 . A A .  19 ALA HB2  1 1 
        2  1975 1 1  19 ALA HB3  H   10.011  -0.454   1.207 1.00 . A A .  19 ALA HB3  1 1 
        2  1976 1 1  19 ALA N    N   12.870   1.332   1.080 1.00 . A A .  19 ALA N    1 1 
        2  1977 1 1  19 ALA O    O   12.536   0.029  -1.416 1.00 . A A .  19 ALA O    1 1 
        2  1978 1 1  20 SER C    C   11.051  -3.544  -1.915 1.00 . A A .  20 SER C    1 1 
        2  1979 1 1  20 SER CA   C   12.337  -2.801  -1.560 1.00 . A A .  20 SER CA   1 1 
        2  1980 1 1  20 SER CB   C   13.468  -3.807  -1.326 1.00 . A A .  20 SER CB   1 1 
        2  1981 1 1  20 SER H    H   11.868  -2.377   0.481 1.00 . A A .  20 SER H    1 1 
        2  1982 1 1  20 SER HA   H   12.624  -2.197  -2.416 1.00 . A A .  20 SER HA   1 1 
        2  1983 1 1  20 SER HB2  H   13.183  -4.488  -0.521 1.00 . A A .  20 SER HB2  1 1 
        2  1984 1 1  20 SER HB3  H   13.615  -4.387  -2.239 1.00 . A A .  20 SER HB3  1 1 
        2  1985 1 1  20 SER HG   H   15.376  -3.820  -0.868 1.00 . A A .  20 SER HG   1 1 
        2  1986 1 1  20 SER N    N   12.132  -1.934  -0.387 1.00 . A A .  20 SER N    1 1 
        2  1987 1 1  20 SER O    O   10.417  -4.128  -1.031 1.00 . A A .  20 SER O    1 1 
        2  1988 1 1  20 SER OG   O   14.677  -3.147  -0.981 1.00 . A A .  20 SER OG   1 1 
        2  1989 1 1  21 CYS C    C    9.386  -5.611  -3.672 1.00 . A A .  21 CYS C    1 1 
        2  1990 1 1  21 CYS CA   C    9.420  -4.072  -3.692 1.00 . A A .  21 CYS CA   1 1 
        2  1991 1 1  21 CYS CB   C    9.185  -3.484  -5.080 1.00 . A A .  21 CYS CB   1 1 
        2  1992 1 1  21 CYS H    H   11.331  -3.162  -3.890 1.00 . A A .  21 CYS H    1 1 
        2  1993 1 1  21 CYS HA   H    8.628  -3.708  -3.041 1.00 . A A .  21 CYS HA   1 1 
        2  1994 1 1  21 CYS HB2  H    9.368  -2.407  -5.040 1.00 . A A .  21 CYS HB2  1 1 
        2  1995 1 1  21 CYS HB3  H    9.899  -3.925  -5.780 1.00 . A A .  21 CYS HB3  1 1 
        2  1996 1 1  21 CYS N    N   10.684  -3.537  -3.197 1.00 . A A .  21 CYS N    1 1 
        2  1997 1 1  21 CYS O    O   10.399  -6.285  -3.890 1.00 . A A .  21 CYS O    1 1 
        2  1998 1 1  21 CYS SG   S    7.475  -3.773  -5.660 1.00 . A A .  21 CYS SG   1 1 
        2  1999 1 1  22 LYS C    C    7.230  -8.341  -4.229 1.00 . A A .  22 LYS C    1 1 
        2  2000 1 1  22 LYS CA   C    7.969  -7.593  -3.110 1.00 . A A .  22 LYS CA   1 1 
        2  2001 1 1  22 LYS CB   C    7.263  -7.700  -1.746 1.00 . A A .  22 LYS CB   1 1 
        2  2002 1 1  22 LYS CD   C    9.147  -8.102  -0.109 1.00 . A A .  22 LYS CD   1 1 
        2  2003 1 1  22 LYS CE   C    9.932  -7.498   1.055 1.00 . A A .  22 LYS CE   1 1 
        2  2004 1 1  22 LYS CG   C    8.081  -7.121  -0.595 1.00 . A A .  22 LYS CG   1 1 
        2  2005 1 1  22 LYS H    H    7.452  -5.510  -3.200 1.00 . A A .  22 LYS H    1 1 
        2  2006 1 1  22 LYS HA   H    8.932  -8.098  -3.028 1.00 . A A .  22 LYS HA   1 1 
        2  2007 1 1  22 LYS HB2  H    6.347  -7.125  -1.777 1.00 . A A .  22 LYS HB2  1 1 
        2  2008 1 1  22 LYS HB3  H    7.018  -8.737  -1.513 1.00 . A A .  22 LYS HB3  1 1 
        2  2009 1 1  22 LYS HD2  H    8.652  -9.008   0.244 1.00 . A A .  22 LYS HD2  1 1 
        2  2010 1 1  22 LYS HD3  H    9.821  -8.355  -0.931 1.00 . A A .  22 LYS HD3  1 1 
        2  2011 1 1  22 LYS HE2  H    9.210  -7.090   1.766 1.00 . A A .  22 LYS HE2  1 1 
        2  2012 1 1  22 LYS HE3  H   10.478  -8.304   1.553 1.00 . A A .  22 LYS HE3  1 1 
        2  2013 1 1  22 LYS HG2  H    8.549  -6.195  -0.915 1.00 . A A .  22 LYS HG2  1 1 
        2  2014 1 1  22 LYS HG3  H    7.394  -6.875   0.212 1.00 . A A .  22 LYS HG3  1 1 
        2  2015 1 1  22 LYS HZ1  H   10.414  -5.691   0.109 1.00 . A A .  22 LYS HZ1  1 1 
        2  2016 1 1  22 LYS HZ2  H   11.375  -6.043   1.393 1.00 . A A .  22 LYS HZ2  1 1 
        2  2017 1 1  22 LYS HZ3  H   11.577  -6.835  -0.019 1.00 . A A .  22 LYS HZ3  1 1 
        2  2018 1 1  22 LYS N    N    8.201  -6.163  -3.400 1.00 . A A .  22 LYS N    1 1 
        2  2019 1 1  22 LYS NZ   N   10.884  -6.446   0.606 1.00 . A A .  22 LYS NZ   1 1 
        2  2020 1 1  22 LYS O    O    6.951  -9.535  -4.094 1.00 . A A .  22 LYS O    1 1 
        2  2021 1 1  23 LYS C    C    7.153  -8.031  -7.806 1.00 . A A .  23 LYS C    1 1 
        2  2022 1 1  23 LYS CA   C    6.287  -8.188  -6.551 1.00 . A A .  23 LYS CA   1 1 
        2  2023 1 1  23 LYS CB   C    4.894  -7.549  -6.696 1.00 . A A .  23 LYS CB   1 1 
        2  2024 1 1  23 LYS CD   C    3.872  -9.421  -8.149 1.00 . A A .  23 LYS CD   1 1 
        2  2025 1 1  23 LYS CE   C    2.911  -9.660  -9.319 1.00 . A A .  23 LYS CE   1 1 
        2  2026 1 1  23 LYS CG   C    4.099  -7.913  -7.958 1.00 . A A .  23 LYS CG   1 1 
        2  2027 1 1  23 LYS H    H    7.204  -6.675  -5.315 1.00 . A A .  23 LYS H    1 1 
        2  2028 1 1  23 LYS HA   H    6.143  -9.263  -6.424 1.00 . A A .  23 LYS HA   1 1 
        2  2029 1 1  23 LYS HB2  H    4.295  -7.834  -5.830 1.00 . A A .  23 LYS HB2  1 1 
        2  2030 1 1  23 LYS HB3  H    5.011  -6.468  -6.682 1.00 . A A .  23 LYS HB3  1 1 
        2  2031 1 1  23 LYS HD2  H    4.822  -9.916  -8.356 1.00 . A A .  23 LYS HD2  1 1 
        2  2032 1 1  23 LYS HD3  H    3.450  -9.847  -7.239 1.00 . A A .  23 LYS HD3  1 1 
        2  2033 1 1  23 LYS HE2  H    1.980  -9.122  -9.119 1.00 . A A .  23 LYS HE2  1 1 
        2  2034 1 1  23 LYS HE3  H    3.351  -9.238 -10.228 1.00 . A A .  23 LYS HE3  1 1 
        2  2035 1 1  23 LYS HG2  H    3.132  -7.412  -7.887 1.00 . A A .  23 LYS HG2  1 1 
        2  2036 1 1  23 LYS HG3  H    4.621  -7.518  -8.829 1.00 . A A .  23 LYS HG3  1 1 
        2  2037 1 1  23 LYS HZ1  H    3.472 -11.619  -9.740 1.00 . A A .  23 LYS HZ1  1 1 
        2  2038 1 1  23 LYS HZ2  H    2.219 -11.524  -8.695 1.00 . A A .  23 LYS HZ2  1 1 
        2  2039 1 1  23 LYS HZ3  H    1.980 -11.246 -10.283 1.00 . A A .  23 LYS HZ3  1 1 
        2  2040 1 1  23 LYS N    N    6.939  -7.650  -5.339 1.00 . A A .  23 LYS N    1 1 
        2  2041 1 1  23 LYS NZ   N    2.629 -11.106  -9.519 1.00 . A A .  23 LYS NZ   1 1 
        2  2042 1 1  23 LYS O    O    7.374  -9.025  -8.499 1.00 . A A .  23 LYS O    1 1 
        2  2043 1 1  24 CYS C    C   10.062  -6.688  -8.903 1.00 . A A .  24 CYS C    1 1 
        2  2044 1 1  24 CYS CA   C    8.551  -6.573  -9.232 1.00 . A A .  24 CYS CA   1 1 
        2  2045 1 1  24 CYS CB   C    8.153  -5.263  -9.931 1.00 . A A .  24 CYS CB   1 1 
        2  2046 1 1  24 CYS H    H    7.426  -6.049  -7.477 1.00 . A A .  24 CYS H    1 1 
        2  2047 1 1  24 CYS HA   H    8.358  -7.355  -9.968 1.00 . A A .  24 CYS HA   1 1 
        2  2048 1 1  24 CYS HB2  H    8.607  -5.271 -10.925 1.00 . A A .  24 CYS HB2  1 1 
        2  2049 1 1  24 CYS HB3  H    7.070  -5.227 -10.063 1.00 . A A .  24 CYS HB3  1 1 
        2  2050 1 1  24 CYS N    N    7.663  -6.824  -8.083 1.00 . A A .  24 CYS N    1 1 
        2  2051 1 1  24 CYS O    O   10.897  -6.711  -9.813 1.00 . A A .  24 CYS O    1 1 
        2  2052 1 1  24 CYS SG   S    8.750  -3.781  -9.039 1.00 . A A .  24 CYS SG   1 1 
        2  2053 1 1  25 SER C    C   12.752  -5.856  -7.400 1.00 . A A .  25 SER C    1 1 
        2  2054 1 1  25 SER CA   C   11.775  -7.010  -7.093 1.00 . A A .  25 SER CA   1 1 
        2  2055 1 1  25 SER CB   C   12.346  -8.390  -7.462 1.00 . A A .  25 SER CB   1 1 
        2  2056 1 1  25 SER H    H    9.659  -6.831  -6.943 1.00 . A A .  25 SER H    1 1 
        2  2057 1 1  25 SER HA   H   11.685  -7.008  -6.008 1.00 . A A .  25 SER HA   1 1 
        2  2058 1 1  25 SER HB2  H   12.491  -8.448  -8.542 1.00 . A A .  25 SER HB2  1 1 
        2  2059 1 1  25 SER HB3  H   13.313  -8.520  -6.974 1.00 . A A .  25 SER HB3  1 1 
        2  2060 1 1  25 SER HG   H   11.873 -10.287  -7.290 1.00 . A A .  25 SER HG   1 1 
        2  2061 1 1  25 SER N    N   10.407  -6.831  -7.616 1.00 . A A .  25 SER N    1 1 
        2  2062 1 1  25 SER O    O   13.971  -6.046  -7.399 1.00 . A A .  25 SER O    1 1 
        2  2063 1 1  25 SER OG   O   11.473  -9.431  -7.037 1.00 . A A .  25 SER OG   1 1 
        2  2064 1 1  26 GLU C    C   12.929  -2.666  -6.319 1.00 . A A .  26 GLU C    1 1 
        2  2065 1 1  26 GLU CA   C   12.998  -3.394  -7.682 1.00 . A A .  26 GLU CA   1 1 
        2  2066 1 1  26 GLU CB   C   12.501  -2.526  -8.858 1.00 . A A .  26 GLU CB   1 1 
        2  2067 1 1  26 GLU CD   C   14.101  -3.578 -10.589 1.00 . A A .  26 GLU CD   1 1 
        2  2068 1 1  26 GLU CG   C   12.647  -3.185 -10.241 1.00 . A A .  26 GLU CG   1 1 
        2  2069 1 1  26 GLU H    H   11.224  -4.567  -7.605 1.00 . A A .  26 GLU H    1 1 
        2  2070 1 1  26 GLU HA   H   14.052  -3.609  -7.856 1.00 . A A .  26 GLU HA   1 1 
        2  2071 1 1  26 GLU HB2  H   11.452  -2.277  -8.695 1.00 . A A .  26 GLU HB2  1 1 
        2  2072 1 1  26 GLU HB3  H   13.062  -1.593  -8.873 1.00 . A A .  26 GLU HB3  1 1 
        2  2073 1 1  26 GLU HG2  H   12.001  -4.063 -10.289 1.00 . A A .  26 GLU HG2  1 1 
        2  2074 1 1  26 GLU HG3  H   12.285  -2.479 -10.992 1.00 . A A .  26 GLU HG3  1 1 
        2  2075 1 1  26 GLU N    N   12.230  -4.648  -7.631 1.00 . A A .  26 GLU N    1 1 
        2  2076 1 1  26 GLU O    O   12.587  -3.276  -5.302 1.00 . A A .  26 GLU O    1 1 
        2  2077 1 1  26 GLU OE1  O   15.048  -2.826 -10.254 1.00 . A A .  26 GLU OE1  1 1 
        2  2078 1 1  26 GLU OE2  O   14.309  -4.634 -11.237 1.00 . A A .  26 GLU OE2  1 1 
        2  2079 1 1  27 SER C    C   12.386   0.670  -5.127 1.00 . A A .  27 SER C    1 1 
        2  2080 1 1  27 SER CA   C   13.268  -0.575  -5.028 1.00 . A A .  27 SER CA   1 1 
        2  2081 1 1  27 SER CB   C   14.693  -0.235  -4.590 1.00 . A A .  27 SER CB   1 1 
        2  2082 1 1  27 SER H    H   13.479  -0.894  -7.131 1.00 . A A .  27 SER H    1 1 
        2  2083 1 1  27 SER HA   H   12.844  -1.173  -4.226 1.00 . A A .  27 SER HA   1 1 
        2  2084 1 1  27 SER HB2  H   15.154   0.414  -5.333 1.00 . A A .  27 SER HB2  1 1 
        2  2085 1 1  27 SER HB3  H   14.639   0.278  -3.630 1.00 . A A .  27 SER HB3  1 1 
        2  2086 1 1  27 SER HG   H   16.371  -1.151  -4.145 1.00 . A A .  27 SER HG   1 1 
        2  2087 1 1  27 SER N    N   13.251  -1.369  -6.268 1.00 . A A .  27 SER N    1 1 
        2  2088 1 1  27 SER O    O   12.233   1.270  -6.191 1.00 . A A .  27 SER O    1 1 
        2  2089 1 1  27 SER OG   O   15.479  -1.408  -4.447 1.00 . A A .  27 SER OG   1 1 
        2  2090 1 1  28 ILE C    C   11.175   3.405  -3.705 1.00 . A A .  28 ILE C    1 1 
        2  2091 1 1  28 ILE CA   C   10.634   1.987  -3.980 1.00 . A A .  28 ILE CA   1 1 
        2  2092 1 1  28 ILE CB   C    9.600   1.526  -2.928 1.00 . A A .  28 ILE CB   1 1 
        2  2093 1 1  28 ILE CD1  C    8.379  -0.521  -1.941 1.00 . A A .  28 ILE CD1  1 1 
        2  2094 1 1  28 ILE CG1  C    9.183   0.043  -3.117 1.00 . A A .  28 ILE CG1  1 1 
        2  2095 1 1  28 ILE CG2  C    8.363   2.436  -3.007 1.00 . A A .  28 ILE CG2  1 1 
        2  2096 1 1  28 ILE H    H   11.996   0.576  -3.146 1.00 . A A .  28 ILE H    1 1 
        2  2097 1 1  28 ILE HA   H   10.135   1.963  -4.945 1.00 . A A .  28 ILE HA   1 1 
        2  2098 1 1  28 ILE HB   H   10.046   1.629  -1.939 1.00 . A A .  28 ILE HB   1 1 
        2  2099 1 1  28 ILE HD11 H    8.221  -1.587  -2.097 1.00 . A A .  28 ILE HD11 1 1 
        2  2100 1 1  28 ILE HD12 H    8.937  -0.386  -1.016 1.00 . A A .  28 ILE HD12 1 1 
        2  2101 1 1  28 ILE HD13 H    7.411  -0.030  -1.857 1.00 . A A .  28 ILE HD13 1 1 
        2  2102 1 1  28 ILE HG12 H    8.602  -0.064  -4.034 1.00 . A A .  28 ILE HG12 1 1 
        2  2103 1 1  28 ILE HG13 H   10.064  -0.592  -3.202 1.00 . A A .  28 ILE HG13 1 1 
        2  2104 1 1  28 ILE HG21 H    8.628   3.479  -2.832 1.00 . A A .  28 ILE HG21 1 1 
        2  2105 1 1  28 ILE HG22 H    7.887   2.353  -3.985 1.00 . A A .  28 ILE HG22 1 1 
        2  2106 1 1  28 ILE HG23 H    7.649   2.138  -2.247 1.00 . A A .  28 ILE HG23 1 1 
        2  2107 1 1  28 ILE N    N   11.754   1.041  -4.016 1.00 . A A .  28 ILE N    1 1 
        2  2108 1 1  28 ILE O    O   11.708   3.631  -2.618 1.00 . A A .  28 ILE O    1 1 
        2  2109 1 1  29 PRO C    C   10.948   6.623  -3.612 1.00 . A A .  29 PRO C    1 1 
        2  2110 1 1  29 PRO CA   C   11.721   5.679  -4.543 1.00 . A A .  29 PRO CA   1 1 
        2  2111 1 1  29 PRO CB   C   11.758   6.221  -5.976 1.00 . A A .  29 PRO CB   1 1 
        2  2112 1 1  29 PRO CD   C   10.420   4.249  -5.946 1.00 . A A .  29 PRO CD   1 1 
        2  2113 1 1  29 PRO CG   C   10.474   5.645  -6.568 1.00 . A A .  29 PRO CG   1 1 
        2  2114 1 1  29 PRO HA   H   12.741   5.587  -4.172 1.00 . A A .  29 PRO HA   1 1 
        2  2115 1 1  29 PRO HB2  H   11.770   7.311  -6.012 1.00 . A A .  29 PRO HB2  1 1 
        2  2116 1 1  29 PRO HB3  H   12.621   5.812  -6.503 1.00 . A A .  29 PRO HB3  1 1 
        2  2117 1 1  29 PRO HD2  H    9.381   3.937  -5.822 1.00 . A A .  29 PRO HD2  1 1 
        2  2118 1 1  29 PRO HD3  H   10.957   3.544  -6.581 1.00 . A A .  29 PRO HD3  1 1 
        2  2119 1 1  29 PRO HG2  H    9.618   6.231  -6.233 1.00 . A A .  29 PRO HG2  1 1 
        2  2120 1 1  29 PRO HG3  H   10.503   5.615  -7.655 1.00 . A A .  29 PRO HG3  1 1 
        2  2121 1 1  29 PRO N    N   11.097   4.356  -4.658 1.00 . A A .  29 PRO N    1 1 
        2  2122 1 1  29 PRO O    O    9.742   6.465  -3.415 1.00 . A A .  29 PRO O    1 1 
        2  2123 1 1  30 LYS C    C   10.083   9.603  -3.378 1.00 . A A .  30 LYS C    1 1 
        2  2124 1 1  30 LYS CA   C   10.944   8.778  -2.409 1.00 . A A .  30 LYS CA   1 1 
        2  2125 1 1  30 LYS CB   C   11.944   9.637  -1.620 1.00 . A A .  30 LYS CB   1 1 
        2  2126 1 1  30 LYS CD   C   13.988  11.175  -1.671 1.00 . A A .  30 LYS CD   1 1 
        2  2127 1 1  30 LYS CE   C   13.426  12.294  -0.779 1.00 . A A .  30 LYS CE   1 1 
        2  2128 1 1  30 LYS CG   C   12.931  10.418  -2.494 1.00 . A A .  30 LYS CG   1 1 
        2  2129 1 1  30 LYS H    H   12.610   7.731  -3.272 1.00 . A A .  30 LYS H    1 1 
        2  2130 1 1  30 LYS HA   H   10.255   8.354  -1.681 1.00 . A A .  30 LYS HA   1 1 
        2  2131 1 1  30 LYS HB2  H   11.388  10.335  -0.994 1.00 . A A .  30 LYS HB2  1 1 
        2  2132 1 1  30 LYS HB3  H   12.509   8.974  -0.974 1.00 . A A .  30 LYS HB3  1 1 
        2  2133 1 1  30 LYS HD2  H   14.510  10.458  -1.036 1.00 . A A .  30 LYS HD2  1 1 
        2  2134 1 1  30 LYS HD3  H   14.726  11.600  -2.353 1.00 . A A .  30 LYS HD3  1 1 
        2  2135 1 1  30 LYS HE2  H   12.631  11.889  -0.148 1.00 . A A .  30 LYS HE2  1 1 
        2  2136 1 1  30 LYS HE3  H   14.228  12.632  -0.115 1.00 . A A .  30 LYS HE3  1 1 
        2  2137 1 1  30 LYS HG2  H   13.448   9.711  -3.140 1.00 . A A .  30 LYS HG2  1 1 
        2  2138 1 1  30 LYS HG3  H   12.384  11.121  -3.118 1.00 . A A .  30 LYS HG3  1 1 
        2  2139 1 1  30 LYS HZ1  H   12.116  13.199  -2.144 1.00 . A A .  30 LYS HZ1  1 1 
        2  2140 1 1  30 LYS HZ2  H   12.613  14.196  -0.957 1.00 . A A .  30 LYS HZ2  1 1 
        2  2141 1 1  30 LYS HZ3  H   13.632  13.824  -2.175 1.00 . A A .  30 LYS HZ3  1 1 
        2  2142 1 1  30 LYS N    N   11.621   7.651  -3.078 1.00 . A A .  30 LYS N    1 1 
        2  2143 1 1  30 LYS NZ   N   12.921  13.449  -1.565 1.00 . A A .  30 LYS NZ   1 1 
        2  2144 1 1  30 LYS O    O   10.259   9.537  -4.596 1.00 . A A .  30 LYS O    1 1 
        2  2145 1 1  31 ASP C    C    7.244  10.232  -4.463 1.00 . A A .  31 ASP C    1 1 
        2  2146 1 1  31 ASP CA   C    8.120  11.131  -3.558 1.00 . A A .  31 ASP CA   1 1 
        2  2147 1 1  31 ASP CB   C    8.722  12.366  -4.258 1.00 . A A .  31 ASP CB   1 1 
        2  2148 1 1  31 ASP CG   C    9.389  13.323  -3.261 1.00 . A A .  31 ASP CG   1 1 
        2  2149 1 1  31 ASP H    H    9.084  10.360  -1.812 1.00 . A A .  31 ASP H    1 1 
        2  2150 1 1  31 ASP HA   H    7.432  11.519  -2.804 1.00 . A A .  31 ASP HA   1 1 
        2  2151 1 1  31 ASP HB2  H    9.446  12.050  -5.011 1.00 . A A .  31 ASP HB2  1 1 
        2  2152 1 1  31 ASP HB3  H    7.925  12.904  -4.775 1.00 . A A .  31 ASP HB3  1 1 
        2  2153 1 1  31 ASP N    N    9.149  10.377  -2.824 1.00 . A A .  31 ASP N    1 1 
        2  2154 1 1  31 ASP O    O    6.871  10.598  -5.581 1.00 . A A .  31 ASP O    1 1 
        2  2155 1 1  31 ASP OD1  O    8.674  14.145  -2.639 1.00 . A A .  31 ASP OD1  1 1 
        2  2156 1 1  31 ASP OD2  O   10.631  13.262  -3.095 1.00 . A A .  31 ASP OD2  1 1 
        2  2157 1 1  32 SER C    C    4.927   7.631  -3.524 1.00 . A A .  32 SER C    1 1 
        2  2158 1 1  32 SER CA   C    5.978   8.069  -4.550 1.00 . A A .  32 SER CA   1 1 
        2  2159 1 1  32 SER CB   C    6.741   6.858  -5.109 1.00 . A A .  32 SER CB   1 1 
        2  2160 1 1  32 SER H    H    7.218   8.822  -3.021 1.00 . A A .  32 SER H    1 1 
        2  2161 1 1  32 SER HA   H    5.449   8.535  -5.381 1.00 . A A .  32 SER HA   1 1 
        2  2162 1 1  32 SER HB2  H    6.075   6.292  -5.760 1.00 . A A .  32 SER HB2  1 1 
        2  2163 1 1  32 SER HB3  H    7.586   7.202  -5.707 1.00 . A A .  32 SER HB3  1 1 
        2  2164 1 1  32 SER HG   H    8.112   6.235  -3.847 1.00 . A A .  32 SER HG   1 1 
        2  2165 1 1  32 SER N    N    6.908   9.039  -3.957 1.00 . A A .  32 SER N    1 1 
        2  2166 1 1  32 SER O    O    5.045   7.933  -2.331 1.00 . A A .  32 SER O    1 1 
        2  2167 1 1  32 SER OG   O    7.191   5.992  -4.082 1.00 . A A .  32 SER OG   1 1 
        2  2168 1 1  33 LEU C    C    3.269   4.767  -3.015 1.00 . A A .  33 LEU C    1 1 
        2  2169 1 1  33 LEU CA   C    2.905   6.257  -3.129 1.00 . A A .  33 LEU CA   1 1 
        2  2170 1 1  33 LEU CB   C    1.510   6.503  -3.738 1.00 . A A .  33 LEU CB   1 1 
        2  2171 1 1  33 LEU CD1  C    0.149   6.665  -1.584 1.00 . A A .  33 LEU CD1  1 1 
        2  2172 1 1  33 LEU CD2  C   -0.970   6.117  -3.703 1.00 . A A .  33 LEU CD2  1 1 
        2  2173 1 1  33 LEU CG   C    0.331   5.948  -2.919 1.00 . A A .  33 LEU CG   1 1 
        2  2174 1 1  33 LEU H    H    3.891   6.669  -4.958 1.00 . A A .  33 LEU H    1 1 
        2  2175 1 1  33 LEU HA   H    2.943   6.702  -2.134 1.00 . A A .  33 LEU HA   1 1 
        2  2176 1 1  33 LEU HB2  H    1.367   7.577  -3.865 1.00 . A A .  33 LEU HB2  1 1 
        2  2177 1 1  33 LEU HB3  H    1.487   6.043  -4.727 1.00 . A A .  33 LEU HB3  1 1 
        2  2178 1 1  33 LEU HD11 H    0.010   7.733  -1.748 1.00 . A A .  33 LEU HD11 1 1 
        2  2179 1 1  33 LEU HD12 H   -0.728   6.266  -1.076 1.00 . A A .  33 LEU HD12 1 1 
        2  2180 1 1  33 LEU HD13 H    1.016   6.508  -0.950 1.00 . A A .  33 LEU HD13 1 1 
        2  2181 1 1  33 LEU HD21 H   -1.178   7.177  -3.854 1.00 . A A .  33 LEU HD21 1 1 
        2  2182 1 1  33 LEU HD22 H   -0.883   5.627  -4.671 1.00 . A A .  33 LEU HD22 1 1 
        2  2183 1 1  33 LEU HD23 H   -1.792   5.661  -3.151 1.00 . A A .  33 LEU HD23 1 1 
        2  2184 1 1  33 LEU HG   H    0.492   4.890  -2.727 1.00 . A A .  33 LEU HG   1 1 
        2  2185 1 1  33 LEU N    N    3.896   6.918  -3.975 1.00 . A A .  33 LEU N    1 1 
        2  2186 1 1  33 LEU O    O    3.515   4.100  -4.026 1.00 . A A .  33 LEU O    1 1 
        2  2187 1 1  34 ARG C    C    2.748   2.202  -0.490 1.00 . A A .  34 ARG C    1 1 
        2  2188 1 1  34 ARG CA   C    3.688   2.851  -1.493 1.00 . A A .  34 ARG CA   1 1 
        2  2189 1 1  34 ARG CB   C    5.175   2.774  -1.101 1.00 . A A .  34 ARG CB   1 1 
        2  2190 1 1  34 ARG CD   C    7.113   3.284   0.409 1.00 . A A .  34 ARG CD   1 1 
        2  2191 1 1  34 ARG CG   C    5.598   3.462   0.208 1.00 . A A .  34 ARG CG   1 1 
        2  2192 1 1  34 ARG CZ   C    8.823   4.421   1.862 1.00 . A A .  34 ARG CZ   1 1 
        2  2193 1 1  34 ARG H    H    3.034   4.818  -0.998 1.00 . A A .  34 ARG H    1 1 
        2  2194 1 1  34 ARG HA   H    3.588   2.260  -2.403 1.00 . A A .  34 ARG HA   1 1 
        2  2195 1 1  34 ARG HB2  H    5.459   1.722  -1.040 1.00 . A A .  34 ARG HB2  1 1 
        2  2196 1 1  34 ARG HB3  H    5.740   3.225  -1.917 1.00 . A A .  34 ARG HB3  1 1 
        2  2197 1 1  34 ARG HD2  H    7.339   2.218   0.481 1.00 . A A .  34 ARG HD2  1 1 
        2  2198 1 1  34 ARG HD3  H    7.623   3.688  -0.466 1.00 . A A .  34 ARG HD3  1 1 
        2  2199 1 1  34 ARG HE   H    6.965   4.084   2.400 1.00 . A A .  34 ARG HE   1 1 
        2  2200 1 1  34 ARG HG2  H    5.364   4.526   0.154 1.00 . A A .  34 ARG HG2  1 1 
        2  2201 1 1  34 ARG HG3  H    5.065   3.016   1.048 1.00 . A A .  34 ARG HG3  1 1 
        2  2202 1 1  34 ARG HH11 H    9.651   3.941   0.105 1.00 . A A .  34 ARG HH11 1 1 
        2  2203 1 1  34 ARG HH12 H   10.675   4.834   1.210 1.00 . A A .  34 ARG HH12 1 1 
        2  2204 1 1  34 ARG HH21 H    8.276   5.012   3.668 1.00 . A A .  34 ARG HH21 1 1 
        2  2205 1 1  34 ARG HH22 H    9.980   5.278   3.268 1.00 . A A .  34 ARG HH22 1 1 
        2  2206 1 1  34 ARG N    N    3.299   4.236  -1.788 1.00 . A A .  34 ARG N    1 1 
        2  2207 1 1  34 ARG NE   N    7.609   3.961   1.622 1.00 . A A .  34 ARG NE   1 1 
        2  2208 1 1  34 ARG NH1  N    9.803   4.361   1.005 1.00 . A A .  34 ARG NH1  1 1 
        2  2209 1 1  34 ARG NH2  N    9.055   4.989   3.003 1.00 . A A .  34 ARG NH2  1 1 
        2  2210 1 1  34 ARG O    O    2.145   2.876   0.342 1.00 . A A .  34 ARG O    1 1 
        2  2211 1 1  35 MET C    C    2.642  -1.085   0.857 1.00 . A A .  35 MET C    1 1 
        2  2212 1 1  35 MET CA   C    1.799   0.030   0.250 1.00 . A A .  35 MET CA   1 1 
        2  2213 1 1  35 MET CB   C    0.582  -0.522  -0.520 1.00 . A A .  35 MET CB   1 1 
        2  2214 1 1  35 MET CE   C   -2.810  -0.870  -0.184 1.00 . A A .  35 MET CE   1 1 
        2  2215 1 1  35 MET CG   C   -0.473   0.563  -0.753 1.00 . A A .  35 MET CG   1 1 
        2  2216 1 1  35 MET H    H    3.223   0.418  -1.266 1.00 . A A .  35 MET H    1 1 
        2  2217 1 1  35 MET HA   H    1.454   0.618   1.094 1.00 . A A .  35 MET HA   1 1 
        2  2218 1 1  35 MET HB2  H    0.906  -0.932  -1.476 1.00 . A A .  35 MET HB2  1 1 
        2  2219 1 1  35 MET HB3  H    0.124  -1.321   0.064 1.00 . A A .  35 MET HB3  1 1 
        2  2220 1 1  35 MET HE1  H   -3.835  -1.141  -0.453 1.00 . A A .  35 MET HE1  1 1 
        2  2221 1 1  35 MET HE2  H   -2.238  -1.778   0.007 1.00 . A A .  35 MET HE2  1 1 
        2  2222 1 1  35 MET HE3  H   -2.834  -0.255   0.717 1.00 . A A .  35 MET HE3  1 1 
        2  2223 1 1  35 MET HG2  H   -0.727   0.991   0.216 1.00 . A A .  35 MET HG2  1 1 
        2  2224 1 1  35 MET HG3  H   -0.028   1.347  -1.367 1.00 . A A .  35 MET HG3  1 1 
        2  2225 1 1  35 MET N    N    2.621   0.886  -0.602 1.00 . A A .  35 MET N    1 1 
        2  2226 1 1  35 MET O    O    3.722  -1.391   0.364 1.00 . A A .  35 MET O    1 1 
        2  2227 1 1  35 MET SD   S   -2.027   0.049  -1.543 1.00 . A A .  35 MET SD   1 1 
        2  2228 1 1  36 ALA C    C    1.786  -3.847   3.061 1.00 . A A .  36 ALA C    1 1 
        2  2229 1 1  36 ALA CA   C    2.820  -2.812   2.598 1.00 . A A .  36 ALA CA   1 1 
        2  2230 1 1  36 ALA CB   C    3.735  -2.320   3.731 1.00 . A A .  36 ALA CB   1 1 
        2  2231 1 1  36 ALA H    H    1.263  -1.383   2.293 1.00 . A A .  36 ALA H    1 1 
        2  2232 1 1  36 ALA HA   H    3.444  -3.304   1.860 1.00 . A A .  36 ALA HA   1 1 
        2  2233 1 1  36 ALA HB1  H    3.650  -1.238   3.834 1.00 . A A .  36 ALA HB1  1 1 
        2  2234 1 1  36 ALA HB2  H    3.472  -2.789   4.679 1.00 . A A .  36 ALA HB2  1 1 
        2  2235 1 1  36 ALA HB3  H    4.770  -2.566   3.504 1.00 . A A .  36 ALA HB3  1 1 
        2  2236 1 1  36 ALA N    N    2.175  -1.673   1.951 1.00 . A A .  36 ALA N    1 1 
        2  2237 1 1  36 ALA O    O    0.590  -3.552   3.119 1.00 . A A .  36 ALA O    1 1 
        2  2238 1 1  37 ILE C    C    1.933  -6.603   5.279 1.00 . A A .  37 ILE C    1 1 
        2  2239 1 1  37 ILE CA   C    1.413  -6.136   3.930 1.00 . A A .  37 ILE CA   1 1 
        2  2240 1 1  37 ILE CB   C    1.320  -7.265   2.879 1.00 . A A .  37 ILE CB   1 1 
        2  2241 1 1  37 ILE CD1  C   -0.030  -7.794   0.750 1.00 . A A .  37 ILE CD1  1 1 
        2  2242 1 1  37 ILE CG1  C    0.051  -7.006   2.055 1.00 . A A .  37 ILE CG1  1 1 
        2  2243 1 1  37 ILE CG2  C    1.310  -8.683   3.466 1.00 . A A .  37 ILE CG2  1 1 
        2  2244 1 1  37 ILE H    H    3.237  -5.248   3.281 1.00 . A A .  37 ILE H    1 1 
        2  2245 1 1  37 ILE HA   H    0.409  -5.754   4.110 1.00 . A A .  37 ILE HA   1 1 
        2  2246 1 1  37 ILE HB   H    2.191  -7.204   2.227 1.00 . A A .  37 ILE HB   1 1 
        2  2247 1 1  37 ILE HD11 H    0.854  -7.600   0.148 1.00 . A A .  37 ILE HD11 1 1 
        2  2248 1 1  37 ILE HD12 H   -0.107  -8.859   0.957 1.00 . A A .  37 ILE HD12 1 1 
        2  2249 1 1  37 ILE HD13 H   -0.913  -7.470   0.199 1.00 . A A .  37 ILE HD13 1 1 
        2  2250 1 1  37 ILE HG12 H   -0.818  -7.244   2.669 1.00 . A A .  37 ILE HG12 1 1 
        2  2251 1 1  37 ILE HG13 H    0.015  -5.949   1.802 1.00 . A A .  37 ILE HG13 1 1 
        2  2252 1 1  37 ILE HG21 H    0.462  -8.808   4.142 1.00 . A A .  37 ILE HG21 1 1 
        2  2253 1 1  37 ILE HG22 H    1.255  -9.408   2.654 1.00 . A A .  37 ILE HG22 1 1 
        2  2254 1 1  37 ILE HG23 H    2.243  -8.862   4.002 1.00 . A A .  37 ILE HG23 1 1 
        2  2255 1 1  37 ILE N    N    2.247  -5.050   3.407 1.00 . A A .  37 ILE N    1 1 
        2  2256 1 1  37 ILE O    O    3.136  -6.779   5.446 1.00 . A A .  37 ILE O    1 1 
        2  2257 1 1  38 MET C    C    1.322  -8.912   7.460 1.00 . A A .  38 MET C    1 1 
        2  2258 1 1  38 MET CA   C    1.350  -7.383   7.539 1.00 . A A .  38 MET CA   1 1 
        2  2259 1 1  38 MET CB   C    0.363  -6.826   8.593 1.00 . A A .  38 MET CB   1 1 
        2  2260 1 1  38 MET CE   C    2.927  -4.934   9.034 1.00 . A A .  38 MET CE   1 1 
        2  2261 1 1  38 MET CG   C    0.206  -5.295   8.646 1.00 . A A .  38 MET CG   1 1 
        2  2262 1 1  38 MET H    H    0.047  -6.703   5.993 1.00 . A A .  38 MET H    1 1 
        2  2263 1 1  38 MET HA   H    2.362  -7.098   7.808 1.00 . A A .  38 MET HA   1 1 
        2  2264 1 1  38 MET HB2  H   -0.620  -7.241   8.386 1.00 . A A .  38 MET HB2  1 1 
        2  2265 1 1  38 MET HB3  H    0.662  -7.173   9.581 1.00 . A A .  38 MET HB3  1 1 
        2  2266 1 1  38 MET HE1  H    3.123  -5.956   9.360 1.00 . A A .  38 MET HE1  1 1 
        2  2267 1 1  38 MET HE2  H    2.871  -4.910   7.943 1.00 . A A .  38 MET HE2  1 1 
        2  2268 1 1  38 MET HE3  H    3.729  -4.285   9.383 1.00 . A A .  38 MET HE3  1 1 
        2  2269 1 1  38 MET HG2  H    0.265  -4.877   7.640 1.00 . A A .  38 MET HG2  1 1 
        2  2270 1 1  38 MET HG3  H   -0.797  -5.080   9.011 1.00 . A A .  38 MET HG3  1 1 
        2  2271 1 1  38 MET N    N    1.027  -6.834   6.227 1.00 . A A .  38 MET N    1 1 
        2  2272 1 1  38 MET O    O    0.253  -9.521   7.529 1.00 . A A .  38 MET O    1 1 
        2  2273 1 1  38 MET SD   S    1.350  -4.391   9.724 1.00 . A A .  38 MET SD   1 1 
        2  2274 1 1  39 VAL C    C    3.173 -11.530   8.664 1.00 . A A .  39 VAL C    1 1 
        2  2275 1 1  39 VAL CA   C    2.636 -11.010   7.334 1.00 . A A .  39 VAL CA   1 1 
        2  2276 1 1  39 VAL CB   C    3.444 -11.519   6.124 1.00 . A A .  39 VAL CB   1 1 
        2  2277 1 1  39 VAL CG1  C    4.890 -11.026   6.100 1.00 . A A .  39 VAL CG1  1 1 
        2  2278 1 1  39 VAL CG2  C    3.444 -13.050   6.033 1.00 . A A .  39 VAL CG2  1 1 
        2  2279 1 1  39 VAL H    H    3.341  -8.969   7.282 1.00 . A A .  39 VAL H    1 1 
        2  2280 1 1  39 VAL HA   H    1.642 -11.439   7.211 1.00 . A A .  39 VAL HA   1 1 
        2  2281 1 1  39 VAL HB   H    2.955 -11.155   5.225 1.00 . A A .  39 VAL HB   1 1 
        2  2282 1 1  39 VAL HG11 H    5.368 -11.395   5.194 1.00 . A A .  39 VAL HG11 1 1 
        2  2283 1 1  39 VAL HG12 H    4.911  -9.938   6.086 1.00 . A A .  39 VAL HG12 1 1 
        2  2284 1 1  39 VAL HG13 H    5.441 -11.391   6.965 1.00 . A A .  39 VAL HG13 1 1 
        2  2285 1 1  39 VAL HG21 H    3.910 -13.358   5.096 1.00 . A A .  39 VAL HG21 1 1 
        2  2286 1 1  39 VAL HG22 H    4.004 -13.488   6.859 1.00 . A A .  39 VAL HG22 1 1 
        2  2287 1 1  39 VAL HG23 H    2.420 -13.424   6.046 1.00 . A A .  39 VAL HG23 1 1 
        2  2288 1 1  39 VAL N    N    2.498  -9.539   7.348 1.00 . A A .  39 VAL N    1 1 
        2  2289 1 1  39 VAL O    O    4.113 -10.977   9.230 1.00 . A A .  39 VAL O    1 1 
        2  2290 1 1  40 GLN C    C    4.320 -13.921  10.287 1.00 . A A .  40 GLN C    1 1 
        2  2291 1 1  40 GLN CA   C    2.930 -13.275  10.415 1.00 . A A .  40 GLN CA   1 1 
        2  2292 1 1  40 GLN CB   C    1.829 -14.279  10.817 1.00 . A A .  40 GLN CB   1 1 
        2  2293 1 1  40 GLN CD   C    0.337 -16.221  10.137 1.00 . A A .  40 GLN CD   1 1 
        2  2294 1 1  40 GLN CG   C    1.220 -15.074   9.647 1.00 . A A .  40 GLN CG   1 1 
        2  2295 1 1  40 GLN H    H    1.817 -13.006   8.618 1.00 . A A .  40 GLN H    1 1 
        2  2296 1 1  40 GLN HA   H    2.992 -12.531  11.210 1.00 . A A .  40 GLN HA   1 1 
        2  2297 1 1  40 GLN HB2  H    2.241 -14.970  11.552 1.00 . A A .  40 GLN HB2  1 1 
        2  2298 1 1  40 GLN HB3  H    1.021 -13.725  11.298 1.00 . A A .  40 GLN HB3  1 1 
        2  2299 1 1  40 GLN HE21 H    1.900 -17.491  10.341 1.00 . A A .  40 GLN HE21 1 1 
        2  2300 1 1  40 GLN HE22 H    0.313 -18.127  10.753 1.00 . A A .  40 GLN HE22 1 1 
        2  2301 1 1  40 GLN HG2  H    0.614 -14.403   9.033 1.00 . A A .  40 GLN HG2  1 1 
        2  2302 1 1  40 GLN HG3  H    2.013 -15.481   9.021 1.00 . A A .  40 GLN HG3  1 1 
        2  2303 1 1  40 GLN N    N    2.560 -12.600   9.167 1.00 . A A .  40 GLN N    1 1 
        2  2304 1 1  40 GLN NE2  N    0.902 -17.372  10.436 1.00 . A A .  40 GLN NE2  1 1 
        2  2305 1 1  40 GLN O    O    4.541 -14.786   9.435 1.00 . A A .  40 GLN O    1 1 
        2  2306 1 1  40 GLN OE1  O   -0.876 -16.104  10.258 1.00 . A A .  40 GLN OE1  1 1 
        2  2307 1 1  41 SER C    C    7.149 -15.121  11.357 1.00 . A A .  41 SER C    1 1 
        2  2308 1 1  41 SER CA   C    6.698 -13.738  10.888 1.00 . A A .  41 SER CA   1 1 
        2  2309 1 1  41 SER CB   C    7.547 -12.685  11.591 1.00 . A A .  41 SER CB   1 1 
        2  2310 1 1  41 SER H    H    5.039 -12.776  11.797 1.00 . A A .  41 SER H    1 1 
        2  2311 1 1  41 SER HA   H    6.889 -13.664   9.824 1.00 . A A .  41 SER HA   1 1 
        2  2312 1 1  41 SER HB2  H    7.194 -11.685  11.350 1.00 . A A .  41 SER HB2  1 1 
        2  2313 1 1  41 SER HB3  H    7.496 -12.843  12.666 1.00 . A A .  41 SER HB3  1 1 
        2  2314 1 1  41 SER HG   H    9.045 -12.245  10.417 1.00 . A A .  41 SER HG   1 1 
        2  2315 1 1  41 SER N    N    5.277 -13.466  11.098 1.00 . A A .  41 SER N    1 1 
        2  2316 1 1  41 SER O    O    6.732 -15.580  12.425 1.00 . A A .  41 SER O    1 1 
        2  2317 1 1  41 SER OG   O    8.896 -12.815  11.196 1.00 . A A .  41 SER OG   1 1 
        2  2318 1 1  42 PRO C    C    9.964 -16.540  12.085 1.00 . A A .  42 PRO C    1 1 
        2  2319 1 1  42 PRO CA   C    8.818 -16.907  11.115 1.00 . A A .  42 PRO CA   1 1 
        2  2320 1 1  42 PRO CB   C    9.312 -17.619   9.852 1.00 . A A .  42 PRO CB   1 1 
        2  2321 1 1  42 PRO CD   C    8.450 -15.464   9.246 1.00 . A A .  42 PRO CD   1 1 
        2  2322 1 1  42 PRO CG   C    9.542 -16.468   8.874 1.00 . A A .  42 PRO CG   1 1 
        2  2323 1 1  42 PRO HA   H    8.114 -17.545  11.641 1.00 . A A .  42 PRO HA   1 1 
        2  2324 1 1  42 PRO HB2  H   10.223 -18.193  10.024 1.00 . A A .  42 PRO HB2  1 1 
        2  2325 1 1  42 PRO HB3  H    8.523 -18.267   9.469 1.00 . A A .  42 PRO HB3  1 1 
        2  2326 1 1  42 PRO HD2  H    8.818 -14.444   9.142 1.00 . A A .  42 PRO HD2  1 1 
        2  2327 1 1  42 PRO HD3  H    7.572 -15.606   8.615 1.00 . A A .  42 PRO HD3  1 1 
        2  2328 1 1  42 PRO HG2  H   10.522 -16.029   9.054 1.00 . A A .  42 PRO HG2  1 1 
        2  2329 1 1  42 PRO HG3  H    9.454 -16.794   7.836 1.00 . A A .  42 PRO HG3  1 1 
        2  2330 1 1  42 PRO N    N    8.084 -15.755  10.625 1.00 . A A .  42 PRO N    1 1 
        2  2331 1 1  42 PRO O    O   10.531 -17.444  12.702 1.00 . A A .  42 PRO O    1 1 
        2  2332 1 1  43 MET C    C   10.996 -13.806  14.233 1.00 . A A .  43 MET C    1 1 
        2  2333 1 1  43 MET CA   C   11.408 -14.778  13.113 1.00 . A A .  43 MET CA   1 1 
        2  2334 1 1  43 MET CB   C   12.543 -14.196  12.266 1.00 . A A .  43 MET CB   1 1 
        2  2335 1 1  43 MET CE   C   12.100 -13.557   9.102 1.00 . A A .  43 MET CE   1 1 
        2  2336 1 1  43 MET CG   C   12.305 -12.780  11.726 1.00 . A A .  43 MET CG   1 1 
        2  2337 1 1  43 MET H    H    9.815 -14.554  11.688 1.00 . A A .  43 MET H    1 1 
        2  2338 1 1  43 MET HA   H   11.844 -15.647  13.593 1.00 . A A .  43 MET HA   1 1 
        2  2339 1 1  43 MET HB2  H   13.449 -14.172  12.869 1.00 . A A .  43 MET HB2  1 1 
        2  2340 1 1  43 MET HB3  H   12.712 -14.883  11.445 1.00 . A A .  43 MET HB3  1 1 
        2  2341 1 1  43 MET HE1  H   12.387 -13.453   8.056 1.00 . A A .  43 MET HE1  1 1 
        2  2342 1 1  43 MET HE2  H   12.263 -14.587   9.422 1.00 . A A .  43 MET HE2  1 1 
        2  2343 1 1  43 MET HE3  H   11.043 -13.319   9.219 1.00 . A A .  43 MET HE3  1 1 
        2  2344 1 1  43 MET HG2  H   11.241 -12.610  11.610 1.00 . A A .  43 MET HG2  1 1 
        2  2345 1 1  43 MET HG3  H   12.671 -12.062  12.461 1.00 . A A .  43 MET HG3  1 1 
        2  2346 1 1  43 MET N    N   10.311 -15.248  12.240 1.00 . A A .  43 MET N    1 1 
        2  2347 1 1  43 MET O    O   11.709 -13.690  15.232 1.00 . A A .  43 MET O    1 1 
        2  2348 1 1  43 MET SD   S   13.091 -12.437  10.129 1.00 . A A .  43 MET SD   1 1 
        2  2349 1 1  44 PHE C    C    8.039 -12.593  15.698 1.00 . A A .  44 PHE C    1 1 
        2  2350 1 1  44 PHE CA   C    9.339 -12.117  15.022 1.00 . A A .  44 PHE CA   1 1 
        2  2351 1 1  44 PHE CB   C    9.189 -10.769  14.292 1.00 . A A .  44 PHE CB   1 1 
        2  2352 1 1  44 PHE CD1  C    9.330  -9.115  16.211 1.00 . A A .  44 PHE CD1  1 1 
        2  2353 1 1  44 PHE CD2  C    7.309  -9.164  14.855 1.00 . A A .  44 PHE CD2  1 1 
        2  2354 1 1  44 PHE CE1  C    8.762  -8.111  17.018 1.00 . A A .  44 PHE CE1  1 1 
        2  2355 1 1  44 PHE CE2  C    6.742  -8.158  15.658 1.00 . A A .  44 PHE CE2  1 1 
        2  2356 1 1  44 PHE CG   C    8.601  -9.649  15.131 1.00 . A A .  44 PHE CG   1 1 
        2  2357 1 1  44 PHE CZ   C    7.467  -7.635  16.742 1.00 . A A .  44 PHE CZ   1 1 
        2  2358 1 1  44 PHE H    H    9.338 -13.263  13.229 1.00 . A A .  44 PHE H    1 1 
        2  2359 1 1  44 PHE HA   H   10.065 -11.967  15.821 1.00 . A A .  44 PHE HA   1 1 
        2  2360 1 1  44 PHE HB2  H   10.172 -10.453  13.939 1.00 . A A .  44 PHE HB2  1 1 
        2  2361 1 1  44 PHE HB3  H    8.562 -10.907  13.414 1.00 . A A .  44 PHE HB3  1 1 
        2  2362 1 1  44 PHE HD1  H   10.326  -9.478  16.428 1.00 . A A .  44 PHE HD1  1 1 
        2  2363 1 1  44 PHE HD2  H    6.746  -9.564  14.026 1.00 . A A .  44 PHE HD2  1 1 
        2  2364 1 1  44 PHE HE1  H    9.321  -7.705  17.850 1.00 . A A .  44 PHE HE1  1 1 
        2  2365 1 1  44 PHE HE2  H    5.748  -7.787  15.442 1.00 . A A .  44 PHE HE2  1 1 
        2  2366 1 1  44 PHE HZ   H    7.032  -6.861  17.362 1.00 . A A .  44 PHE HZ   1 1 
        2  2367 1 1  44 PHE N    N    9.865 -13.113  14.079 1.00 . A A .  44 PHE N    1 1 
        2  2368 1 1  44 PHE O    O    7.310 -13.439  15.180 1.00 . A A .  44 PHE O    1 1 
        2  2369 1 1  45 ASP C    C    5.282 -11.712  17.331 1.00 . A A .  45 ASP C    1 1 
        2  2370 1 1  45 ASP CA   C    6.605 -12.403  17.739 1.00 . A A .  45 ASP CA   1 1 
        2  2371 1 1  45 ASP CB   C    6.991 -12.155  19.209 1.00 . A A .  45 ASP CB   1 1 
        2  2372 1 1  45 ASP CG   C    8.188 -13.015  19.648 1.00 . A A .  45 ASP CG   1 1 
        2  2373 1 1  45 ASP H    H    8.328 -11.271  17.172 1.00 . A A .  45 ASP H    1 1 
        2  2374 1 1  45 ASP HA   H    6.432 -13.475  17.629 1.00 . A A .  45 ASP HA   1 1 
        2  2375 1 1  45 ASP HB2  H    7.219 -11.096  19.346 1.00 . A A .  45 ASP HB2  1 1 
        2  2376 1 1  45 ASP HB3  H    6.142 -12.400  19.849 1.00 . A A .  45 ASP HB3  1 1 
        2  2377 1 1  45 ASP N    N    7.733 -12.029  16.867 1.00 . A A .  45 ASP N    1 1 
        2  2378 1 1  45 ASP O    O    4.501 -11.256  18.172 1.00 . A A .  45 ASP O    1 1 
        2  2379 1 1  45 ASP OD1  O    8.005 -14.236  19.874 1.00 . A A .  45 ASP OD1  1 1 
        2  2380 1 1  45 ASP OD2  O    9.311 -12.472  19.787 1.00 . A A .  45 ASP OD2  1 1 
        2  2381 1 1  46 GLY C    C    4.133 -10.638  13.921 1.00 . A A .  46 GLY C    1 1 
        2  2382 1 1  46 GLY CA   C    3.975 -10.792  15.431 1.00 . A A .  46 GLY CA   1 1 
        2  2383 1 1  46 GLY H    H    5.705 -12.022  15.386 1.00 . A A .  46 GLY H    1 1 
        2  2384 1 1  46 GLY HA2  H    3.003 -11.243  15.624 1.00 . A A .  46 GLY HA2  1 1 
        2  2385 1 1  46 GLY HA3  H    3.986  -9.798  15.877 1.00 . A A .  46 GLY HA3  1 1 
        2  2386 1 1  46 GLY N    N    5.047 -11.591  16.024 1.00 . A A .  46 GLY N    1 1 
        2  2387 1 1  46 GLY O    O    4.840 -11.415  13.267 1.00 . A A .  46 GLY O    1 1 
        2  2388 1 1  47 LYS C    C    4.369  -8.263  11.490 1.00 . A A .  47 LYS C    1 1 
        2  2389 1 1  47 LYS CA   C    3.408  -9.367  11.924 1.00 . A A .  47 LYS CA   1 1 
        2  2390 1 1  47 LYS CB   C    1.959  -9.120  11.469 1.00 . A A .  47 LYS CB   1 1 
        2  2391 1 1  47 LYS CD   C    0.026 -10.748  10.925 1.00 . A A .  47 LYS CD   1 1 
        2  2392 1 1  47 LYS CE   C   -0.997  -9.738  10.392 1.00 . A A .  47 LYS CE   1 1 
        2  2393 1 1  47 LYS CG   C    0.994 -10.207  11.983 1.00 . A A .  47 LYS CG   1 1 
        2  2394 1 1  47 LYS H    H    2.982  -8.980  13.985 1.00 . A A .  47 LYS H    1 1 
        2  2395 1 1  47 LYS HA   H    3.741 -10.275  11.429 1.00 . A A .  47 LYS HA   1 1 
        2  2396 1 1  47 LYS HB2  H    1.621  -8.146  11.830 1.00 . A A .  47 LYS HB2  1 1 
        2  2397 1 1  47 LYS HB3  H    1.949  -9.102  10.379 1.00 . A A .  47 LYS HB3  1 1 
        2  2398 1 1  47 LYS HD2  H    0.621 -11.096  10.086 1.00 . A A .  47 LYS HD2  1 1 
        2  2399 1 1  47 LYS HD3  H   -0.490 -11.612  11.345 1.00 . A A .  47 LYS HD3  1 1 
        2  2400 1 1  47 LYS HE2  H   -0.504  -8.774  10.250 1.00 . A A .  47 LYS HE2  1 1 
        2  2401 1 1  47 LYS HE3  H   -1.334 -10.093   9.413 1.00 . A A .  47 LYS HE3  1 1 
        2  2402 1 1  47 LYS HG2  H    1.566 -11.066  12.330 1.00 . A A .  47 LYS HG2  1 1 
        2  2403 1 1  47 LYS HG3  H    0.445  -9.815  12.836 1.00 . A A .  47 LYS HG3  1 1 
        2  2404 1 1  47 LYS HZ1  H   -2.682 -10.470  11.382 1.00 . A A .  47 LYS HZ1  1 1 
        2  2405 1 1  47 LYS HZ2  H   -1.885  -9.431  12.260 1.00 . A A .  47 LYS HZ2  1 1 
        2  2406 1 1  47 LYS HZ3  H   -2.797  -8.857  11.020 1.00 . A A .  47 LYS HZ3  1 1 
        2  2407 1 1  47 LYS N    N    3.478  -9.615  13.367 1.00 . A A .  47 LYS N    1 1 
        2  2408 1 1  47 LYS NZ   N   -2.165  -9.599  11.293 1.00 . A A .  47 LYS NZ   1 1 
        2  2409 1 1  47 LYS O    O    4.553  -7.272  12.199 1.00 . A A .  47 LYS O    1 1 
        2  2410 1 1  48 VAL C    C    5.697  -7.055   8.382 1.00 . A A .  48 VAL C    1 1 
        2  2411 1 1  48 VAL CA   C    6.055  -7.593   9.779 1.00 . A A .  48 VAL CA   1 1 
        2  2412 1 1  48 VAL CB   C    7.406  -8.341   9.776 1.00 . A A .  48 VAL CB   1 1 
        2  2413 1 1  48 VAL CG1  C    7.850  -8.678  11.208 1.00 . A A .  48 VAL CG1  1 1 
        2  2414 1 1  48 VAL CG2  C    7.383  -9.644   8.962 1.00 . A A .  48 VAL CG2  1 1 
        2  2415 1 1  48 VAL H    H    4.746  -9.283   9.799 1.00 . A A .  48 VAL H    1 1 
        2  2416 1 1  48 VAL HA   H    6.165  -6.742  10.448 1.00 . A A .  48 VAL HA   1 1 
        2  2417 1 1  48 VAL HB   H    8.158  -7.686   9.340 1.00 . A A .  48 VAL HB   1 1 
        2  2418 1 1  48 VAL HG11 H    7.153  -9.376  11.673 1.00 . A A .  48 VAL HG11 1 1 
        2  2419 1 1  48 VAL HG12 H    8.842  -9.132  11.194 1.00 . A A .  48 VAL HG12 1 1 
        2  2420 1 1  48 VAL HG13 H    7.892  -7.769  11.809 1.00 . A A .  48 VAL HG13 1 1 
        2  2421 1 1  48 VAL HG21 H    6.677 -10.354   9.393 1.00 . A A .  48 VAL HG21 1 1 
        2  2422 1 1  48 VAL HG22 H    7.095  -9.439   7.932 1.00 . A A .  48 VAL HG22 1 1 
        2  2423 1 1  48 VAL HG23 H    8.377 -10.091   8.960 1.00 . A A .  48 VAL HG23 1 1 
        2  2424 1 1  48 VAL N    N    4.978  -8.443  10.319 1.00 . A A .  48 VAL N    1 1 
        2  2425 1 1  48 VAL O    O    4.987  -7.746   7.646 1.00 . A A .  48 VAL O    1 1 
        2  2426 1 1  49 PRO C    C    6.450  -5.628   5.514 1.00 . A A .  49 PRO C    1 1 
        2  2427 1 1  49 PRO CA   C    5.684  -5.176   6.770 1.00 . A A .  49 PRO CA   1 1 
        2  2428 1 1  49 PRO CB   C    5.853  -3.675   7.024 1.00 . A A .  49 PRO CB   1 1 
        2  2429 1 1  49 PRO CD   C    6.879  -4.887   8.822 1.00 . A A .  49 PRO CD   1 1 
        2  2430 1 1  49 PRO CG   C    7.042  -3.618   7.984 1.00 . A A .  49 PRO CG   1 1 
        2  2431 1 1  49 PRO HA   H    4.627  -5.382   6.625 1.00 . A A .  49 PRO HA   1 1 
        2  2432 1 1  49 PRO HB2  H    6.043  -3.116   6.107 1.00 . A A .  49 PRO HB2  1 1 
        2  2433 1 1  49 PRO HB3  H    4.964  -3.284   7.523 1.00 . A A .  49 PRO HB3  1 1 
        2  2434 1 1  49 PRO HD2  H    7.857  -5.284   9.096 1.00 . A A .  49 PRO HD2  1 1 
        2  2435 1 1  49 PRO HD3  H    6.306  -4.649   9.720 1.00 . A A .  49 PRO HD3  1 1 
        2  2436 1 1  49 PRO HG2  H    7.975  -3.666   7.420 1.00 . A A .  49 PRO HG2  1 1 
        2  2437 1 1  49 PRO HG3  H    7.018  -2.721   8.602 1.00 . A A .  49 PRO HG3  1 1 
        2  2438 1 1  49 PRO N    N    6.131  -5.833   8.001 1.00 . A A .  49 PRO N    1 1 
        2  2439 1 1  49 PRO O    O    7.679  -5.555   5.455 1.00 . A A .  49 PRO O    1 1 
        2  2440 1 1  50 HIS C    C    5.842  -5.217   2.171 1.00 . A A .  50 HIS C    1 1 
        2  2441 1 1  50 HIS CA   C    6.237  -6.333   3.130 1.00 . A A .  50 HIS CA   1 1 
        2  2442 1 1  50 HIS CB   C    5.714  -7.703   2.653 1.00 . A A .  50 HIS CB   1 1 
        2  2443 1 1  50 HIS CD2  C    7.042  -8.966   4.429 1.00 . A A .  50 HIS CD2  1 1 
        2  2444 1 1  50 HIS CE1  C    7.496 -10.816   3.323 1.00 . A A .  50 HIS CE1  1 1 
        2  2445 1 1  50 HIS CG   C    6.502  -8.874   3.182 1.00 . A A .  50 HIS CG   1 1 
        2  2446 1 1  50 HIS H    H    4.725  -6.193   4.635 1.00 . A A .  50 HIS H    1 1 
        2  2447 1 1  50 HIS HA   H    7.323  -6.363   3.139 1.00 . A A .  50 HIS HA   1 1 
        2  2448 1 1  50 HIS HB2  H    4.668  -7.819   2.938 1.00 . A A .  50 HIS HB2  1 1 
        2  2449 1 1  50 HIS HB3  H    5.760  -7.743   1.564 1.00 . A A .  50 HIS HB3  1 1 
        2  2450 1 1  50 HIS HD2  H    6.945  -8.225   5.209 1.00 . A A .  50 HIS HD2  1 1 
        2  2451 1 1  50 HIS HE1  H    7.834 -11.822   3.106 1.00 . A A .  50 HIS HE1  1 1 
        2  2452 1 1  50 HIS HE2  H    8.166 -10.570   5.298 1.00 . A A .  50 HIS HE2  1 1 
        2  2453 1 1  50 HIS N    N    5.718  -6.041   4.475 1.00 . A A .  50 HIS N    1 1 
        2  2454 1 1  50 HIS ND1  N    6.791 -10.045   2.478 1.00 . A A .  50 HIS ND1  1 1 
        2  2455 1 1  50 HIS NE2  N    7.681 -10.184   4.495 1.00 . A A .  50 HIS NE2  1 1 
        2  2456 1 1  50 HIS O    O    4.689  -5.174   1.759 1.00 . A A .  50 HIS O    1 1 
        2  2457 1 1  51 TRP C    C    6.421  -3.426  -0.466 1.00 . A A .  51 TRP C    1 1 
        2  2458 1 1  51 TRP CA   C    6.490  -3.115   1.035 1.00 . A A .  51 TRP CA   1 1 
        2  2459 1 1  51 TRP CB   C    7.557  -2.045   1.289 1.00 . A A .  51 TRP CB   1 1 
        2  2460 1 1  51 TRP CD1  C    8.586  -2.094   3.600 1.00 . A A .  51 TRP CD1  1 1 
        2  2461 1 1  51 TRP CD2  C    6.900  -0.612   3.439 1.00 . A A .  51 TRP CD2  1 1 
        2  2462 1 1  51 TRP CE2  C    7.354  -0.593   4.793 1.00 . A A .  51 TRP CE2  1 1 
        2  2463 1 1  51 TRP CE3  C    5.830   0.254   3.105 1.00 . A A .  51 TRP CE3  1 1 
        2  2464 1 1  51 TRP CG   C    7.692  -1.605   2.712 1.00 . A A .  51 TRP CG   1 1 
        2  2465 1 1  51 TRP CH2  C    5.697   1.050   5.416 1.00 . A A .  51 TRP CH2  1 1 
        2  2466 1 1  51 TRP CZ2  C    6.770   0.218   5.773 1.00 . A A .  51 TRP CZ2  1 1 
        2  2467 1 1  51 TRP CZ3  C    5.224   1.061   4.091 1.00 . A A .  51 TRP CZ3  1 1 
        2  2468 1 1  51 TRP H    H    7.702  -4.408   2.207 1.00 . A A .  51 TRP H    1 1 
        2  2469 1 1  51 TRP HA   H    5.535  -2.692   1.350 1.00 . A A .  51 TRP HA   1 1 
        2  2470 1 1  51 TRP HB2  H    8.522  -2.417   0.939 1.00 . A A .  51 TRP HB2  1 1 
        2  2471 1 1  51 TRP HB3  H    7.307  -1.165   0.694 1.00 . A A .  51 TRP HB3  1 1 
        2  2472 1 1  51 TRP HD1  H    9.330  -2.855   3.385 1.00 . A A .  51 TRP HD1  1 1 
        2  2473 1 1  51 TRP HE1  H    8.951  -1.716   5.648 1.00 . A A .  51 TRP HE1  1 1 
        2  2474 1 1  51 TRP HE3  H    5.457   0.270   2.087 1.00 . A A .  51 TRP HE3  1 1 
        2  2475 1 1  51 TRP HH2  H    5.237   1.678   6.166 1.00 . A A .  51 TRP HH2  1 1 
        2  2476 1 1  51 TRP HZ2  H    7.137   0.198   6.788 1.00 . A A .  51 TRP HZ2  1 1 
        2  2477 1 1  51 TRP HZ3  H    4.373   1.683   3.845 1.00 . A A .  51 TRP HZ3  1 1 
        2  2478 1 1  51 TRP N    N    6.766  -4.306   1.847 1.00 . A A .  51 TRP N    1 1 
        2  2479 1 1  51 TRP NE1  N    8.394  -1.496   4.828 1.00 . A A .  51 TRP NE1  1 1 
        2  2480 1 1  51 TRP O    O    7.175  -4.245  -0.980 1.00 . A A .  51 TRP O    1 1 
        2  2481 1 1  52 TYR C    C    5.205  -1.277  -3.156 1.00 . A A .  52 TYR C    1 1 
        2  2482 1 1  52 TYR CA   C    5.526  -2.700  -2.653 1.00 . A A .  52 TYR CA   1 1 
        2  2483 1 1  52 TYR CB   C    4.494  -3.704  -3.214 1.00 . A A .  52 TYR CB   1 1 
        2  2484 1 1  52 TYR CD1  C    3.639  -5.154  -1.271 1.00 . A A .  52 TYR CD1  1 1 
        2  2485 1 1  52 TYR CD2  C    4.395  -6.219  -3.322 1.00 . A A .  52 TYR CD2  1 1 
        2  2486 1 1  52 TYR CE1  C    3.312  -6.419  -0.736 1.00 . A A .  52 TYR CE1  1 1 
        2  2487 1 1  52 TYR CE2  C    4.051  -7.480  -2.803 1.00 . A A .  52 TYR CE2  1 1 
        2  2488 1 1  52 TYR CG   C    4.217  -5.051  -2.555 1.00 . A A .  52 TYR CG   1 1 
        2  2489 1 1  52 TYR CZ   C    3.523  -7.587  -1.501 1.00 . A A .  52 TYR CZ   1 1 
        2  2490 1 1  52 TYR H    H    4.975  -2.047  -0.718 1.00 . A A .  52 TYR H    1 1 
        2  2491 1 1  52 TYR HA   H    6.506  -2.977  -3.041 1.00 . A A .  52 TYR HA   1 1 
        2  2492 1 1  52 TYR HB2  H    3.534  -3.202  -3.301 1.00 . A A .  52 TYR HB2  1 1 
        2  2493 1 1  52 TYR HB3  H    4.861  -3.934  -4.213 1.00 . A A .  52 TYR HB3  1 1 
        2  2494 1 1  52 TYR HD1  H    3.448  -4.263  -0.689 1.00 . A A .  52 TYR HD1  1 1 
        2  2495 1 1  52 TYR HD2  H    4.796  -6.141  -4.319 1.00 . A A .  52 TYR HD2  1 1 
        2  2496 1 1  52 TYR HE1  H    2.903  -6.503   0.262 1.00 . A A .  52 TYR HE1  1 1 
        2  2497 1 1  52 TYR HE2  H    4.207  -8.377  -3.385 1.00 . A A .  52 TYR HE2  1 1 
        2  2498 1 1  52 TYR HH   H    2.886  -8.775  -0.089 1.00 . A A .  52 TYR HH   1 1 
        2  2499 1 1  52 TYR N    N    5.575  -2.710  -1.196 1.00 . A A .  52 TYR N    1 1 
        2  2500 1 1  52 TYR O    O    4.655  -0.452  -2.418 1.00 . A A .  52 TYR O    1 1 
        2  2501 1 1  52 TYR OH   O    3.224  -8.816  -0.997 1.00 . A A .  52 TYR OH   1 1 
        2  2502 1 1  53 HIS C    C    3.357   0.131  -5.023 1.00 . A A .  53 HIS C    1 1 
        2  2503 1 1  53 HIS CA   C    4.899   0.174  -5.124 1.00 . A A .  53 HIS CA   1 1 
        2  2504 1 1  53 HIS CB   C    5.317   0.207  -6.609 1.00 . A A .  53 HIS CB   1 1 
        2  2505 1 1  53 HIS CD2  C    7.564   1.405  -6.792 1.00 . A A .  53 HIS CD2  1 1 
        2  2506 1 1  53 HIS CE1  C    8.846  -0.227  -7.536 1.00 . A A .  53 HIS CE1  1 1 
        2  2507 1 1  53 HIS CG   C    6.804   0.274  -6.897 1.00 . A A .  53 HIS CG   1 1 
        2  2508 1 1  53 HIS H    H    5.969  -1.697  -4.970 1.00 . A A .  53 HIS H    1 1 
        2  2509 1 1  53 HIS HA   H    5.246   1.089  -4.639 1.00 . A A .  53 HIS HA   1 1 
        2  2510 1 1  53 HIS HB2  H    4.894  -0.656  -7.114 1.00 . A A .  53 HIS HB2  1 1 
        2  2511 1 1  53 HIS HB3  H    4.860   1.086  -7.067 1.00 . A A .  53 HIS HB3  1 1 
        2  2512 1 1  53 HIS HD2  H    7.214   2.381  -6.478 1.00 . A A .  53 HIS HD2  1 1 
        2  2513 1 1  53 HIS HE1  H    9.722  -0.764  -7.886 1.00 . A A .  53 HIS HE1  1 1 
        2  2514 1 1  53 HIS HE2  H    9.649   1.681  -7.230 1.00 . A A .  53 HIS HE2  1 1 
        2  2515 1 1  53 HIS N    N    5.489  -0.990  -4.431 1.00 . A A .  53 HIS N    1 1 
        2  2516 1 1  53 HIS ND1  N    7.624  -0.757  -7.375 1.00 . A A .  53 HIS ND1  1 1 
        2  2517 1 1  53 HIS NE2  N    8.840   1.070  -7.191 1.00 . A A .  53 HIS NE2  1 1 
        2  2518 1 1  53 HIS O    O    2.781  -0.957  -4.944 1.00 . A A .  53 HIS O    1 1 
        2  2519 1 1  54 PHE C    C    0.495   0.375  -5.950 1.00 . A A .  54 PHE C    1 1 
        2  2520 1 1  54 PHE CA   C    1.195   1.330  -4.963 1.00 . A A .  54 PHE CA   1 1 
        2  2521 1 1  54 PHE CB   C    0.696   2.769  -5.177 1.00 . A A .  54 PHE CB   1 1 
        2  2522 1 1  54 PHE CD1  C   -1.739   2.703  -4.406 1.00 . A A .  54 PHE CD1  1 1 
        2  2523 1 1  54 PHE CD2  C   -1.255   3.175  -6.745 1.00 . A A .  54 PHE CD2  1 1 
        2  2524 1 1  54 PHE CE1  C   -3.118   2.765  -4.684 1.00 . A A .  54 PHE CE1  1 1 
        2  2525 1 1  54 PHE CE2  C   -2.635   3.236  -7.017 1.00 . A A .  54 PHE CE2  1 1 
        2  2526 1 1  54 PHE CG   C   -0.799   2.893  -5.443 1.00 . A A .  54 PHE CG   1 1 
        2  2527 1 1  54 PHE CZ   C   -3.564   3.001  -5.992 1.00 . A A .  54 PHE CZ   1 1 
        2  2528 1 1  54 PHE H    H    3.170   2.162  -5.086 1.00 . A A .  54 PHE H    1 1 
        2  2529 1 1  54 PHE HA   H    0.908   1.028  -3.954 1.00 . A A .  54 PHE HA   1 1 
        2  2530 1 1  54 PHE HB2  H    0.944   3.349  -4.292 1.00 . A A .  54 PHE HB2  1 1 
        2  2531 1 1  54 PHE HB3  H    1.236   3.208  -6.018 1.00 . A A .  54 PHE HB3  1 1 
        2  2532 1 1  54 PHE HD1  H   -1.411   2.503  -3.397 1.00 . A A .  54 PHE HD1  1 1 
        2  2533 1 1  54 PHE HD2  H   -0.548   3.337  -7.546 1.00 . A A .  54 PHE HD2  1 1 
        2  2534 1 1  54 PHE HE1  H   -3.844   2.625  -3.897 1.00 . A A .  54 PHE HE1  1 1 
        2  2535 1 1  54 PHE HE2  H   -2.986   3.471  -8.012 1.00 . A A .  54 PHE HE2  1 1 
        2  2536 1 1  54 PHE HZ   H   -4.623   3.020  -6.209 1.00 . A A .  54 PHE HZ   1 1 
        2  2537 1 1  54 PHE N    N    2.667   1.282  -5.063 1.00 . A A .  54 PHE N    1 1 
        2  2538 1 1  54 PHE O    O   -0.389  -0.378  -5.553 1.00 . A A .  54 PHE O    1 1 
        2  2539 1 1  55 SER C    C    0.762  -1.961  -8.147 1.00 . A A .  55 SER C    1 1 
        2  2540 1 1  55 SER CA   C    0.334  -0.499  -8.264 1.00 . A A .  55 SER CA   1 1 
        2  2541 1 1  55 SER CB   C    0.686   0.068  -9.643 1.00 . A A .  55 SER CB   1 1 
        2  2542 1 1  55 SER H    H    1.712   0.909  -7.488 1.00 . A A .  55 SER H    1 1 
        2  2543 1 1  55 SER HA   H   -0.753  -0.482  -8.175 1.00 . A A .  55 SER HA   1 1 
        2  2544 1 1  55 SER HB2  H    0.472  -0.667 -10.421 1.00 . A A .  55 SER HB2  1 1 
        2  2545 1 1  55 SER HB3  H    0.055   0.940  -9.815 1.00 . A A .  55 SER HB3  1 1 
        2  2546 1 1  55 SER HG   H    2.608  -0.300  -9.871 1.00 . A A .  55 SER HG   1 1 
        2  2547 1 1  55 SER N    N    0.915   0.352  -7.220 1.00 . A A .  55 SER N    1 1 
        2  2548 1 1  55 SER O    O   -0.006  -2.849  -8.520 1.00 . A A .  55 SER O    1 1 
        2  2549 1 1  55 SER OG   O    2.044   0.481  -9.713 1.00 . A A .  55 SER OG   1 1 
        2  2550 1 1  56 CYS C    C    1.576  -4.361  -6.339 1.00 . A A .  56 CYS C    1 1 
        2  2551 1 1  56 CYS CA   C    2.437  -3.585  -7.357 1.00 . A A .  56 CYS CA   1 1 
        2  2552 1 1  56 CYS CB   C    3.905  -3.522  -6.936 1.00 . A A .  56 CYS CB   1 1 
        2  2553 1 1  56 CYS H    H    2.528  -1.467  -7.284 1.00 . A A .  56 CYS H    1 1 
        2  2554 1 1  56 CYS HA   H    2.384  -4.097  -8.308 1.00 . A A .  56 CYS HA   1 1 
        2  2555 1 1  56 CYS HB2  H    4.026  -2.775  -6.151 1.00 . A A .  56 CYS HB2  1 1 
        2  2556 1 1  56 CYS HB3  H    4.194  -4.485  -6.515 1.00 . A A .  56 CYS HB3  1 1 
        2  2557 1 1  56 CYS N    N    1.945  -2.232  -7.585 1.00 . A A .  56 CYS N    1 1 
        2  2558 1 1  56 CYS O    O    1.313  -5.543  -6.549 1.00 . A A .  56 CYS O    1 1 
        2  2559 1 1  56 CYS SG   S    4.980  -3.140  -8.369 1.00 . A A .  56 CYS SG   1 1 
        2  2560 1 1  57 PHE C    C   -1.145  -4.838  -5.115 1.00 . A A .  57 PHE C    1 1 
        2  2561 1 1  57 PHE CA   C    0.072  -4.259  -4.368 1.00 . A A .  57 PHE CA   1 1 
        2  2562 1 1  57 PHE CB   C   -0.355  -3.173  -3.371 1.00 . A A .  57 PHE CB   1 1 
        2  2563 1 1  57 PHE CD1  C   -2.681  -3.853  -2.641 1.00 . A A .  57 PHE CD1  1 1 
        2  2564 1 1  57 PHE CD2  C   -0.874  -3.962  -1.015 1.00 . A A .  57 PHE CD2  1 1 
        2  2565 1 1  57 PHE CE1  C   -3.577  -4.360  -1.689 1.00 . A A .  57 PHE CE1  1 1 
        2  2566 1 1  57 PHE CE2  C   -1.784  -4.424  -0.048 1.00 . A A .  57 PHE CE2  1 1 
        2  2567 1 1  57 PHE CG   C   -1.323  -3.668  -2.315 1.00 . A A .  57 PHE CG   1 1 
        2  2568 1 1  57 PHE CZ   C   -3.131  -4.639  -0.389 1.00 . A A .  57 PHE CZ   1 1 
        2  2569 1 1  57 PHE H    H    1.339  -2.731  -5.191 1.00 . A A .  57 PHE H    1 1 
        2  2570 1 1  57 PHE HA   H    0.524  -5.059  -3.783 1.00 . A A .  57 PHE HA   1 1 
        2  2571 1 1  57 PHE HB2  H    0.538  -2.783  -2.881 1.00 . A A .  57 PHE HB2  1 1 
        2  2572 1 1  57 PHE HB3  H   -0.825  -2.348  -3.908 1.00 . A A .  57 PHE HB3  1 1 
        2  2573 1 1  57 PHE HD1  H   -3.040  -3.621  -3.631 1.00 . A A .  57 PHE HD1  1 1 
        2  2574 1 1  57 PHE HD2  H    0.166  -3.822  -0.753 1.00 . A A .  57 PHE HD2  1 1 
        2  2575 1 1  57 PHE HE1  H   -4.613  -4.518  -1.956 1.00 . A A .  57 PHE HE1  1 1 
        2  2576 1 1  57 PHE HE2  H   -1.452  -4.602   0.962 1.00 . A A .  57 PHE HE2  1 1 
        2  2577 1 1  57 PHE HZ   H   -3.831  -5.004   0.348 1.00 . A A .  57 PHE HZ   1 1 
        2  2578 1 1  57 PHE N    N    1.058  -3.694  -5.304 1.00 . A A .  57 PHE N    1 1 
        2  2579 1 1  57 PHE O    O   -1.506  -6.006  -4.950 1.00 . A A .  57 PHE O    1 1 
        2  2580 1 1  58 TRP C    C   -2.604  -5.410  -7.940 1.00 . A A .  58 TRP C    1 1 
        2  2581 1 1  58 TRP CA   C   -2.926  -4.436  -6.793 1.00 . A A .  58 TRP CA   1 1 
        2  2582 1 1  58 TRP CB   C   -3.621  -3.168  -7.297 1.00 . A A .  58 TRP CB   1 1 
        2  2583 1 1  58 TRP CD1  C   -3.283  -0.970  -6.096 1.00 . A A .  58 TRP CD1  1 1 
        2  2584 1 1  58 TRP CD2  C   -4.844  -2.241  -5.108 1.00 . A A .  58 TRP CD2  1 1 
        2  2585 1 1  58 TRP CE2  C   -4.714  -1.050  -4.326 1.00 . A A .  58 TRP CE2  1 1 
        2  2586 1 1  58 TRP CE3  C   -5.809  -3.183  -4.684 1.00 . A A .  58 TRP CE3  1 1 
        2  2587 1 1  58 TRP CG   C   -3.905  -2.161  -6.226 1.00 . A A .  58 TRP CG   1 1 
        2  2588 1 1  58 TRP CH2  C   -6.456  -1.758  -2.811 1.00 . A A .  58 TRP CH2  1 1 
        2  2589 1 1  58 TRP CZ2  C   -5.503  -0.803  -3.195 1.00 . A A .  58 TRP CZ2  1 1 
        2  2590 1 1  58 TRP CZ3  C   -6.603  -2.946  -3.547 1.00 . A A .  58 TRP CZ3  1 1 
        2  2591 1 1  58 TRP H    H   -1.422  -3.091  -6.086 1.00 . A A .  58 TRP H    1 1 
        2  2592 1 1  58 TRP HA   H   -3.623  -4.950  -6.129 1.00 . A A .  58 TRP HA   1 1 
        2  2593 1 1  58 TRP HB2  H   -2.995  -2.703  -8.061 1.00 . A A .  58 TRP HB2  1 1 
        2  2594 1 1  58 TRP HB3  H   -4.566  -3.444  -7.760 1.00 . A A .  58 TRP HB3  1 1 
        2  2595 1 1  58 TRP HD1  H   -2.523  -0.590  -6.766 1.00 . A A .  58 TRP HD1  1 1 
        2  2596 1 1  58 TRP HE1  H   -3.360   0.564  -4.657 1.00 . A A .  58 TRP HE1  1 1 
        2  2597 1 1  58 TRP HE3  H   -5.951  -4.093  -5.247 1.00 . A A .  58 TRP HE3  1 1 
        2  2598 1 1  58 TRP HH2  H   -7.075  -1.577  -1.947 1.00 . A A .  58 TRP HH2  1 1 
        2  2599 1 1  58 TRP HZ2  H   -5.383   0.109  -2.629 1.00 . A A .  58 TRP HZ2  1 1 
        2  2600 1 1  58 TRP HZ3  H   -7.332  -3.684  -3.239 1.00 . A A .  58 TRP HZ3  1 1 
        2  2601 1 1  58 TRP N    N   -1.747  -4.046  -6.008 1.00 . A A .  58 TRP N    1 1 
        2  2602 1 1  58 TRP NE1  N   -3.730  -0.328  -4.962 1.00 . A A .  58 TRP NE1  1 1 
        2  2603 1 1  58 TRP O    O   -3.510  -6.026  -8.502 1.00 . A A .  58 TRP O    1 1 
        2  2604 1 1  59 LYS C    C   -0.428  -7.907  -8.534 1.00 . A A .  59 LYS C    1 1 
        2  2605 1 1  59 LYS CA   C   -0.762  -6.562  -9.201 1.00 . A A .  59 LYS CA   1 1 
        2  2606 1 1  59 LYS CB   C    0.421  -5.860  -9.880 1.00 . A A .  59 LYS CB   1 1 
        2  2607 1 1  59 LYS CD   C    1.890  -5.699 -11.963 1.00 . A A .  59 LYS CD   1 1 
        2  2608 1 1  59 LYS CE   C    2.672  -4.538 -11.314 1.00 . A A .  59 LYS CE   1 1 
        2  2609 1 1  59 LYS CG   C    1.124  -6.631 -10.998 1.00 . A A .  59 LYS CG   1 1 
        2  2610 1 1  59 LYS H    H   -0.643  -4.989  -7.787 1.00 . A A .  59 LYS H    1 1 
        2  2611 1 1  59 LYS HA   H   -1.512  -6.775  -9.966 1.00 . A A .  59 LYS HA   1 1 
        2  2612 1 1  59 LYS HB2  H    0.046  -4.923 -10.297 1.00 . A A .  59 LYS HB2  1 1 
        2  2613 1 1  59 LYS HB3  H    1.167  -5.636  -9.123 1.00 . A A .  59 LYS HB3  1 1 
        2  2614 1 1  59 LYS HD2  H    2.565  -6.298 -12.577 1.00 . A A .  59 LYS HD2  1 1 
        2  2615 1 1  59 LYS HD3  H    1.156  -5.253 -12.637 1.00 . A A .  59 LYS HD3  1 1 
        2  2616 1 1  59 LYS HE2  H    3.020  -3.869 -12.107 1.00 . A A .  59 LYS HE2  1 1 
        2  2617 1 1  59 LYS HE3  H    1.989  -3.959 -10.685 1.00 . A A .  59 LYS HE3  1 1 
        2  2618 1 1  59 LYS HG2  H    1.815  -7.337 -10.544 1.00 . A A .  59 LYS HG2  1 1 
        2  2619 1 1  59 LYS HG3  H    0.381  -7.189 -11.569 1.00 . A A .  59 LYS HG3  1 1 
        2  2620 1 1  59 LYS HZ1  H    4.561  -5.377 -11.103 1.00 . A A .  59 LYS HZ1  1 1 
        2  2621 1 1  59 LYS HZ2  H    4.237  -4.216  -9.983 1.00 . A A .  59 LYS HZ2  1 1 
        2  2622 1 1  59 LYS HZ3  H    3.569  -5.686  -9.830 1.00 . A A .  59 LYS HZ3  1 1 
        2  2623 1 1  59 LYS N    N   -1.314  -5.588  -8.252 1.00 . A A .  59 LYS N    1 1 
        2  2624 1 1  59 LYS NZ   N    3.836  -4.994 -10.512 1.00 . A A .  59 LYS NZ   1 1 
        2  2625 1 1  59 LYS O    O   -0.389  -8.926  -9.222 1.00 . A A .  59 LYS O    1 1 
        2  2626 1 1  60 VAL C    C   -2.007  -9.479  -6.312 1.00 . A A .  60 VAL C    1 1 
        2  2627 1 1  60 VAL CA   C   -0.503  -9.178  -6.406 1.00 . A A .  60 VAL CA   1 1 
        2  2628 1 1  60 VAL CB   C    0.093  -9.078  -4.986 1.00 . A A .  60 VAL CB   1 1 
        2  2629 1 1  60 VAL CG1  C   -0.006 -10.415  -4.237 1.00 . A A .  60 VAL CG1  1 1 
        2  2630 1 1  60 VAL CG2  C    1.574  -8.703  -4.984 1.00 . A A .  60 VAL CG2  1 1 
        2  2631 1 1  60 VAL H    H   -0.192  -7.064  -6.709 1.00 . A A .  60 VAL H    1 1 
        2  2632 1 1  60 VAL HA   H   -0.025 -10.018  -6.910 1.00 . A A .  60 VAL HA   1 1 
        2  2633 1 1  60 VAL HB   H   -0.448  -8.323  -4.418 1.00 . A A .  60 VAL HB   1 1 
        2  2634 1 1  60 VAL HG11 H    0.477 -11.205  -4.811 1.00 . A A .  60 VAL HG11 1 1 
        2  2635 1 1  60 VAL HG12 H    0.484 -10.333  -3.267 1.00 . A A .  60 VAL HG12 1 1 
        2  2636 1 1  60 VAL HG13 H   -1.050 -10.681  -4.071 1.00 . A A .  60 VAL HG13 1 1 
        2  2637 1 1  60 VAL HG21 H    1.904  -8.590  -3.954 1.00 . A A .  60 VAL HG21 1 1 
        2  2638 1 1  60 VAL HG22 H    2.159  -9.486  -5.462 1.00 . A A .  60 VAL HG22 1 1 
        2  2639 1 1  60 VAL HG23 H    1.733  -7.758  -5.498 1.00 . A A .  60 VAL HG23 1 1 
        2  2640 1 1  60 VAL N    N   -0.283  -7.948  -7.202 1.00 . A A .  60 VAL N    1 1 
        2  2641 1 1  60 VAL O    O   -2.422 -10.633  -6.425 1.00 . A A .  60 VAL O    1 1 
        2  2642 1 1  61 GLY C    C   -4.989  -8.867  -4.921 1.00 . A A .  61 GLY C    1 1 
        2  2643 1 1  61 GLY CA   C   -4.294  -8.513  -6.241 1.00 . A A .  61 GLY CA   1 1 
        2  2644 1 1  61 GLY H    H   -2.406  -7.521  -6.044 1.00 . A A .  61 GLY H    1 1 
        2  2645 1 1  61 GLY HA2  H   -4.675  -7.544  -6.561 1.00 . A A .  61 GLY HA2  1 1 
        2  2646 1 1  61 GLY HA3  H   -4.583  -9.248  -6.994 1.00 . A A .  61 GLY HA3  1 1 
        2  2647 1 1  61 GLY N    N   -2.830  -8.432  -6.169 1.00 . A A .  61 GLY N    1 1 
        2  2648 1 1  61 GLY O    O   -6.031  -9.528  -4.939 1.00 . A A .  61 GLY O    1 1 
        2  2649 1 1  62 HIS C    C   -6.371  -7.733  -2.387 1.00 . A A .  62 HIS C    1 1 
        2  2650 1 1  62 HIS CA   C   -5.097  -8.587  -2.468 1.00 . A A .  62 HIS CA   1 1 
        2  2651 1 1  62 HIS CB   C   -4.133  -8.229  -1.327 1.00 . A A .  62 HIS CB   1 1 
        2  2652 1 1  62 HIS CD2  C   -1.881  -9.418  -1.543 1.00 . A A .  62 HIS CD2  1 1 
        2  2653 1 1  62 HIS CE1  C   -2.219 -11.112  -0.169 1.00 . A A .  62 HIS CE1  1 1 
        2  2654 1 1  62 HIS CG   C   -3.139  -9.321  -1.026 1.00 . A A .  62 HIS CG   1 1 
        2  2655 1 1  62 HIS H    H   -3.583  -7.908  -3.829 1.00 . A A .  62 HIS H    1 1 
        2  2656 1 1  62 HIS HA   H   -5.393  -9.629  -2.335 1.00 . A A .  62 HIS HA   1 1 
        2  2657 1 1  62 HIS HB2  H   -3.603  -7.307  -1.567 1.00 . A A .  62 HIS HB2  1 1 
        2  2658 1 1  62 HIS HB3  H   -4.713  -8.050  -0.421 1.00 . A A .  62 HIS HB3  1 1 
        2  2659 1 1  62 HIS HD2  H   -1.416  -8.720  -2.227 1.00 . A A .  62 HIS HD2  1 1 
        2  2660 1 1  62 HIS HE1  H   -2.044 -12.009   0.415 1.00 . A A .  62 HIS HE1  1 1 
        2  2661 1 1  62 HIS HE2  H   -0.381 -10.901  -1.158 1.00 . A A .  62 HIS HE2  1 1 
        2  2662 1 1  62 HIS N    N   -4.433  -8.450  -3.776 1.00 . A A .  62 HIS N    1 1 
        2  2663 1 1  62 HIS ND1  N   -3.357 -10.397  -0.162 1.00 . A A .  62 HIS ND1  1 1 
        2  2664 1 1  62 HIS NE2  N   -1.319 -10.551  -0.993 1.00 . A A .  62 HIS NE2  1 1 
        2  2665 1 1  62 HIS O    O   -6.379  -6.568  -2.795 1.00 . A A .  62 HIS O    1 1 
        2  2666 1 1  63 SER C    C   -8.925  -6.989  -0.343 1.00 . A A .  63 SER C    1 1 
        2  2667 1 1  63 SER CA   C   -8.757  -7.655  -1.705 1.00 . A A .  63 SER CA   1 1 
        2  2668 1 1  63 SER CB   C   -9.899  -8.649  -1.946 1.00 . A A .  63 SER CB   1 1 
        2  2669 1 1  63 SER H    H   -7.367  -9.262  -1.523 1.00 . A A .  63 SER H    1 1 
        2  2670 1 1  63 SER HA   H   -8.843  -6.862  -2.451 1.00 . A A .  63 SER HA   1 1 
        2  2671 1 1  63 SER HB2  H   -9.834  -9.460  -1.217 1.00 . A A .  63 SER HB2  1 1 
        2  2672 1 1  63 SER HB3  H  -10.854  -8.137  -1.815 1.00 . A A .  63 SER HB3  1 1 
        2  2673 1 1  63 SER HG   H  -10.569  -9.812  -3.378 1.00 . A A .  63 SER HG   1 1 
        2  2674 1 1  63 SER N    N   -7.445  -8.308  -1.843 1.00 . A A .  63 SER N    1 1 
        2  2675 1 1  63 SER O    O   -8.558  -7.540   0.696 1.00 . A A .  63 SER O    1 1 
        2  2676 1 1  63 SER OG   O   -9.831  -9.182  -3.261 1.00 . A A .  63 SER OG   1 1 
        2  2677 1 1  64 ILE C    C  -11.192  -4.503   0.836 1.00 . A A .  64 ILE C    1 1 
        2  2678 1 1  64 ILE CA   C   -9.719  -4.935   0.810 1.00 . A A .  64 ILE CA   1 1 
        2  2679 1 1  64 ILE CB   C   -8.743  -3.735   0.767 1.00 . A A .  64 ILE CB   1 1 
        2  2680 1 1  64 ILE CD1  C   -6.284  -2.969   0.446 1.00 . A A .  64 ILE CD1  1 1 
        2  2681 1 1  64 ILE CG1  C   -7.319  -4.088   0.266 1.00 . A A .  64 ILE CG1  1 1 
        2  2682 1 1  64 ILE CG2  C   -8.696  -3.092   2.160 1.00 . A A .  64 ILE CG2  1 1 
        2  2683 1 1  64 ILE H    H   -9.837  -5.437  -1.248 1.00 . A A .  64 ILE H    1 1 
        2  2684 1 1  64 ILE HA   H   -9.521  -5.503   1.720 1.00 . A A .  64 ILE HA   1 1 
        2  2685 1 1  64 ILE HB   H   -9.139  -3.015   0.057 1.00 . A A .  64 ILE HB   1 1 
        2  2686 1 1  64 ILE HD11 H   -6.723  -2.000   0.206 1.00 . A A .  64 ILE HD11 1 1 
        2  2687 1 1  64 ILE HD12 H   -5.926  -2.959   1.473 1.00 . A A .  64 ILE HD12 1 1 
        2  2688 1 1  64 ILE HD13 H   -5.439  -3.139  -0.211 1.00 . A A .  64 ILE HD13 1 1 
        2  2689 1 1  64 ILE HG12 H   -6.957  -4.980   0.773 1.00 . A A .  64 ILE HG12 1 1 
        2  2690 1 1  64 ILE HG13 H   -7.375  -4.312  -0.799 1.00 . A A .  64 ILE HG13 1 1 
        2  2691 1 1  64 ILE HG21 H   -8.284  -3.798   2.878 1.00 . A A .  64 ILE HG21 1 1 
        2  2692 1 1  64 ILE HG22 H   -8.060  -2.208   2.140 1.00 . A A .  64 ILE HG22 1 1 
        2  2693 1 1  64 ILE HG23 H   -9.697  -2.798   2.481 1.00 . A A .  64 ILE HG23 1 1 
        2  2694 1 1  64 ILE N    N   -9.522  -5.798  -0.358 1.00 . A A .  64 ILE N    1 1 
        2  2695 1 1  64 ILE O    O  -11.732  -4.071  -0.187 1.00 . A A .  64 ILE O    1 1 
        2  2696 1 1  65 ARG C    C  -13.760  -3.492   3.149 1.00 . A A .  65 ARG C    1 1 
        2  2697 1 1  65 ARG CA   C  -13.325  -4.566   2.147 1.00 . A A .  65 ARG CA   1 1 
        2  2698 1 1  65 ARG CB   C  -13.944  -5.952   2.455 1.00 . A A .  65 ARG CB   1 1 
        2  2699 1 1  65 ARG CD   C  -12.107  -7.722   2.704 1.00 . A A .  65 ARG CD   1 1 
        2  2700 1 1  65 ARG CG   C  -13.152  -6.852   3.425 1.00 . A A .  65 ARG CG   1 1 
        2  2701 1 1  65 ARG CZ   C   -9.947  -8.786   3.418 1.00 . A A .  65 ARG CZ   1 1 
        2  2702 1 1  65 ARG H    H  -11.304  -4.929   2.802 1.00 . A A .  65 ARG H    1 1 
        2  2703 1 1  65 ARG HA   H  -13.761  -4.237   1.202 1.00 . A A .  65 ARG HA   1 1 
        2  2704 1 1  65 ARG HB2  H  -14.942  -5.798   2.871 1.00 . A A .  65 ARG HB2  1 1 
        2  2705 1 1  65 ARG HB3  H  -14.081  -6.492   1.515 1.00 . A A .  65 ARG HB3  1 1 
        2  2706 1 1  65 ARG HD2  H  -12.544  -8.705   2.523 1.00 . A A .  65 ARG HD2  1 1 
        2  2707 1 1  65 ARG HD3  H  -11.858  -7.284   1.736 1.00 . A A .  65 ARG HD3  1 1 
        2  2708 1 1  65 ARG HE   H  -10.646  -7.099   4.150 1.00 . A A .  65 ARG HE   1 1 
        2  2709 1 1  65 ARG HG2  H  -12.670  -6.238   4.181 1.00 . A A .  65 ARG HG2  1 1 
        2  2710 1 1  65 ARG HG3  H  -13.844  -7.513   3.948 1.00 . A A .  65 ARG HG3  1 1 
        2  2711 1 1  65 ARG HH11 H  -10.833  -9.894   2.013 1.00 . A A .  65 ARG HH11 1 1 
        2  2712 1 1  65 ARG HH12 H   -9.301 -10.496   2.584 1.00 . A A .  65 ARG HH12 1 1 
        2  2713 1 1  65 ARG HH21 H   -8.888  -7.883   4.817 1.00 . A A .  65 ARG HH21 1 1 
        2  2714 1 1  65 ARG HH22 H   -8.180  -9.378   4.182 1.00 . A A .  65 ARG HH22 1 1 
        2  2715 1 1  65 ARG N    N  -11.856  -4.664   1.985 1.00 . A A .  65 ARG N    1 1 
        2  2716 1 1  65 ARG NE   N  -10.867  -7.845   3.491 1.00 . A A .  65 ARG NE   1 1 
        2  2717 1 1  65 ARG NH1  N  -10.037  -9.812   2.619 1.00 . A A .  65 ARG NH1  1 1 
        2  2718 1 1  65 ARG NH2  N   -8.909  -8.689   4.189 1.00 . A A .  65 ARG NH2  1 1 
        2  2719 1 1  65 ARG O    O  -14.887  -3.001   3.067 1.00 . A A .  65 ARG O    1 1 
        2  2720 1 1  66 HIS C    C  -11.632  -1.143   4.939 1.00 . A A .  66 HIS C    1 1 
        2  2721 1 1  66 HIS CA   C  -12.984  -1.872   4.874 1.00 . A A .  66 HIS CA   1 1 
        2  2722 1 1  66 HIS CB   C  -13.663  -2.170   6.233 1.00 . A A .  66 HIS CB   1 1 
        2  2723 1 1  66 HIS CD2  C  -12.743  -4.528   6.734 1.00 . A A .  66 HIS CD2  1 1 
        2  2724 1 1  66 HIS CE1  C  -12.729  -4.468   8.927 1.00 . A A .  66 HIS CE1  1 1 
        2  2725 1 1  66 HIS CG   C  -13.136  -3.281   7.124 1.00 . A A .  66 HIS CG   1 1 
        2  2726 1 1  66 HIS H    H  -11.975  -3.573   4.073 1.00 . A A .  66 HIS H    1 1 
        2  2727 1 1  66 HIS HA   H  -13.648  -1.173   4.371 1.00 . A A .  66 HIS HA   1 1 
        2  2728 1 1  66 HIS HB2  H  -13.662  -1.246   6.812 1.00 . A A .  66 HIS HB2  1 1 
        2  2729 1 1  66 HIS HB3  H  -14.707  -2.408   6.027 1.00 . A A .  66 HIS HB3  1 1 
        2  2730 1 1  66 HIS HD2  H  -12.676  -4.888   5.726 1.00 . A A .  66 HIS HD2  1 1 
        2  2731 1 1  66 HIS HE1  H  -12.635  -4.789   9.955 1.00 . A A .  66 HIS HE1  1 1 
        2  2732 1 1  66 HIS HE2  H  -12.157  -6.215   7.917 1.00 . A A .  66 HIS HE2  1 1 
        2  2733 1 1  66 HIS N    N  -12.861  -3.072   4.037 1.00 . A A .  66 HIS N    1 1 
        2  2734 1 1  66 HIS ND1  N  -13.156  -3.259   8.524 1.00 . A A .  66 HIS ND1  1 1 
        2  2735 1 1  66 HIS NE2  N  -12.470  -5.251   7.871 1.00 . A A .  66 HIS NE2  1 1 
        2  2736 1 1  66 HIS O    O  -10.965  -1.147   5.973 1.00 . A A .  66 HIS O    1 1 
        2  2737 1 1  67 PRO C    C   -9.368   1.022   4.639 1.00 . A A .  67 PRO C    1 1 
        2  2738 1 1  67 PRO CA   C   -9.795  -0.077   3.663 1.00 . A A .  67 PRO CA   1 1 
        2  2739 1 1  67 PRO CB   C   -9.674   0.397   2.206 1.00 . A A .  67 PRO CB   1 1 
        2  2740 1 1  67 PRO CD   C  -11.896  -0.369   2.567 1.00 . A A .  67 PRO CD   1 1 
        2  2741 1 1  67 PRO CG   C  -11.116   0.698   1.814 1.00 . A A .  67 PRO CG   1 1 
        2  2742 1 1  67 PRO HA   H   -9.138  -0.923   3.840 1.00 . A A .  67 PRO HA   1 1 
        2  2743 1 1  67 PRO HB2  H   -9.039   1.279   2.105 1.00 . A A .  67 PRO HB2  1 1 
        2  2744 1 1  67 PRO HB3  H   -9.296  -0.405   1.574 1.00 . A A .  67 PRO HB3  1 1 
        2  2745 1 1  67 PRO HD2  H  -12.920  -0.030   2.725 1.00 . A A .  67 PRO HD2  1 1 
        2  2746 1 1  67 PRO HD3  H  -11.886  -1.302   2.001 1.00 . A A .  67 PRO HD3  1 1 
        2  2747 1 1  67 PRO HG2  H  -11.397   1.676   2.203 1.00 . A A .  67 PRO HG2  1 1 
        2  2748 1 1  67 PRO HG3  H  -11.273   0.639   0.737 1.00 . A A .  67 PRO HG3  1 1 
        2  2749 1 1  67 PRO N    N  -11.175  -0.543   3.820 1.00 . A A .  67 PRO N    1 1 
        2  2750 1 1  67 PRO O    O   -8.211   1.047   5.042 1.00 . A A .  67 PRO O    1 1 
        2  2751 1 1  68 ASP C    C   -9.749   2.271   7.533 1.00 . A A .  68 ASP C    1 1 
        2  2752 1 1  68 ASP CA   C   -9.978   2.881   6.133 1.00 . A A .  68 ASP CA   1 1 
        2  2753 1 1  68 ASP CB   C  -11.038   3.991   6.109 1.00 . A A .  68 ASP CB   1 1 
        2  2754 1 1  68 ASP CG   C  -12.471   3.456   6.226 1.00 . A A .  68 ASP CG   1 1 
        2  2755 1 1  68 ASP H    H  -11.237   1.791   4.798 1.00 . A A .  68 ASP H    1 1 
        2  2756 1 1  68 ASP HA   H   -9.025   3.337   5.866 1.00 . A A .  68 ASP HA   1 1 
        2  2757 1 1  68 ASP HB2  H  -10.837   4.705   6.911 1.00 . A A .  68 ASP HB2  1 1 
        2  2758 1 1  68 ASP HB3  H  -10.948   4.530   5.166 1.00 . A A .  68 ASP HB3  1 1 
        2  2759 1 1  68 ASP N    N  -10.278   1.878   5.103 1.00 . A A .  68 ASP N    1 1 
        2  2760 1 1  68 ASP O    O   -9.284   2.960   8.444 1.00 . A A .  68 ASP O    1 1 
        2  2761 1 1  68 ASP OD1  O  -13.059   3.134   5.164 1.00 . A A .  68 ASP OD1  1 1 
        2  2762 1 1  68 ASP OD2  O  -13.007   3.371   7.355 1.00 . A A .  68 ASP OD2  1 1 
        2  2763 1 1  69 VAL C    C   -8.489  -0.764   8.587 1.00 . A A .  69 VAL C    1 1 
        2  2764 1 1  69 VAL CA   C   -9.695   0.150   8.861 1.00 . A A .  69 VAL CA   1 1 
        2  2765 1 1  69 VAL CB   C  -10.907  -0.702   9.295 1.00 . A A .  69 VAL CB   1 1 
        2  2766 1 1  69 VAL CG1  C  -10.657  -1.390  10.643 1.00 . A A .  69 VAL CG1  1 1 
        2  2767 1 1  69 VAL CG2  C  -12.193   0.127   9.414 1.00 . A A .  69 VAL CG2  1 1 
        2  2768 1 1  69 VAL H    H  -10.438   0.487   6.899 1.00 . A A .  69 VAL H    1 1 
        2  2769 1 1  69 VAL HA   H   -9.437   0.814   9.681 1.00 . A A .  69 VAL HA   1 1 
        2  2770 1 1  69 VAL HB   H  -11.075  -1.475   8.548 1.00 . A A .  69 VAL HB   1 1 
        2  2771 1 1  69 VAL HG11 H  -10.455  -0.644  11.412 1.00 . A A .  69 VAL HG11 1 1 
        2  2772 1 1  69 VAL HG12 H  -11.533  -1.972  10.925 1.00 . A A .  69 VAL HG12 1 1 
        2  2773 1 1  69 VAL HG13 H   -9.811  -2.070  10.565 1.00 . A A .  69 VAL HG13 1 1 
        2  2774 1 1  69 VAL HG21 H  -13.005  -0.501   9.781 1.00 . A A .  69 VAL HG21 1 1 
        2  2775 1 1  69 VAL HG22 H  -12.040   0.962  10.096 1.00 . A A .  69 VAL HG22 1 1 
        2  2776 1 1  69 VAL HG23 H  -12.481   0.505   8.433 1.00 . A A .  69 VAL HG23 1 1 
        2  2777 1 1  69 VAL N    N  -10.029   0.971   7.689 1.00 . A A .  69 VAL N    1 1 
        2  2778 1 1  69 VAL O    O   -7.594  -0.880   9.425 1.00 . A A .  69 VAL O    1 1 
        2  2779 1 1  70 GLU C    C   -6.149  -1.959   6.516 1.00 . A A .  70 GLU C    1 1 
        2  2780 1 1  70 GLU CA   C   -7.473  -2.471   7.089 1.00 . A A .  70 GLU CA   1 1 
        2  2781 1 1  70 GLU CB   C   -8.074  -3.453   6.068 1.00 . A A .  70 GLU CB   1 1 
        2  2782 1 1  70 GLU CD   C   -9.815  -5.141   5.415 1.00 . A A .  70 GLU CD   1 1 
        2  2783 1 1  70 GLU CG   C   -9.333  -4.190   6.523 1.00 . A A .  70 GLU CG   1 1 
        2  2784 1 1  70 GLU H    H   -9.217  -1.250   6.774 1.00 . A A .  70 GLU H    1 1 
        2  2785 1 1  70 GLU HA   H   -7.198  -3.007   8.001 1.00 . A A .  70 GLU HA   1 1 
        2  2786 1 1  70 GLU HB2  H   -8.301  -2.904   5.153 1.00 . A A .  70 GLU HB2  1 1 
        2  2787 1 1  70 GLU HB3  H   -7.323  -4.207   5.837 1.00 . A A .  70 GLU HB3  1 1 
        2  2788 1 1  70 GLU HG2  H   -9.107  -4.753   7.431 1.00 . A A .  70 GLU HG2  1 1 
        2  2789 1 1  70 GLU HG3  H  -10.118  -3.471   6.760 1.00 . A A .  70 GLU HG3  1 1 
        2  2790 1 1  70 GLU N    N   -8.447  -1.410   7.417 1.00 . A A .  70 GLU N    1 1 
        2  2791 1 1  70 GLU O    O   -5.127  -2.631   6.665 1.00 . A A .  70 GLU O    1 1 
        2  2792 1 1  70 GLU OE1  O  -10.490  -4.698   4.455 1.00 . A A .  70 GLU OE1  1 1 
        2  2793 1 1  70 GLU OE2  O   -9.524  -6.356   5.493 1.00 . A A .  70 GLU OE2  1 1 
        2  2794 1 1  71 VAL C    C   -4.513   0.882   6.433 1.00 . A A .  71 VAL C    1 1 
        2  2795 1 1  71 VAL CA   C   -4.980  -0.092   5.362 1.00 . A A .  71 VAL CA   1 1 
        2  2796 1 1  71 VAL CB   C   -5.232   0.578   4.006 1.00 . A A .  71 VAL CB   1 1 
        2  2797 1 1  71 VAL CG1  C   -3.890   1.043   3.458 1.00 . A A .  71 VAL CG1  1 1 
        2  2798 1 1  71 VAL CG2  C   -5.814  -0.410   2.989 1.00 . A A .  71 VAL CG2  1 1 
        2  2799 1 1  71 VAL H    H   -7.047  -0.300   5.792 1.00 . A A .  71 VAL H    1 1 
        2  2800 1 1  71 VAL HA   H   -4.160  -0.783   5.175 1.00 . A A .  71 VAL HA   1 1 
        2  2801 1 1  71 VAL HB   H   -5.893   1.436   4.104 1.00 . A A .  71 VAL HB   1 1 
        2  2802 1 1  71 VAL HG11 H   -3.235   0.188   3.282 1.00 . A A .  71 VAL HG11 1 1 
        2  2803 1 1  71 VAL HG12 H   -4.061   1.576   2.525 1.00 . A A .  71 VAL HG12 1 1 
        2  2804 1 1  71 VAL HG13 H   -3.418   1.707   4.181 1.00 . A A .  71 VAL HG13 1 1 
        2  2805 1 1  71 VAL HG21 H   -6.802  -0.724   3.312 1.00 . A A .  71 VAL HG21 1 1 
        2  2806 1 1  71 VAL HG22 H   -5.900   0.065   2.013 1.00 . A A .  71 VAL HG22 1 1 
        2  2807 1 1  71 VAL HG23 H   -5.168  -1.285   2.917 1.00 . A A .  71 VAL HG23 1 1 
        2  2808 1 1  71 VAL N    N   -6.163  -0.793   5.867 1.00 . A A .  71 VAL N    1 1 
        2  2809 1 1  71 VAL O    O   -4.987   2.012   6.561 1.00 . A A .  71 VAL O    1 1 
        2  2810 1 1  72 ASP C    C   -2.138   2.420   7.422 1.00 . A A .  72 ASP C    1 1 
        2  2811 1 1  72 ASP CA   C   -2.804   1.240   8.161 1.00 . A A .  72 ASP CA   1 1 
        2  2812 1 1  72 ASP CB   C   -1.805   0.306   8.849 1.00 . A A .  72 ASP CB   1 1 
        2  2813 1 1  72 ASP CG   C   -0.991   1.011   9.935 1.00 . A A .  72 ASP CG   1 1 
        2  2814 1 1  72 ASP H    H   -3.226  -0.529   7.067 1.00 . A A .  72 ASP H    1 1 
        2  2815 1 1  72 ASP HA   H   -3.490   1.633   8.913 1.00 . A A .  72 ASP HA   1 1 
        2  2816 1 1  72 ASP HB2  H   -2.372  -0.527   9.277 1.00 . A A .  72 ASP HB2  1 1 
        2  2817 1 1  72 ASP HB3  H   -1.122  -0.107   8.106 1.00 . A A .  72 ASP HB3  1 1 
        2  2818 1 1  72 ASP N    N   -3.553   0.420   7.221 1.00 . A A .  72 ASP N    1 1 
        2  2819 1 1  72 ASP O    O   -1.610   2.259   6.325 1.00 . A A .  72 ASP O    1 1 
        2  2820 1 1  72 ASP OD1  O   -0.062   1.772   9.584 1.00 . A A .  72 ASP OD1  1 1 
        2  2821 1 1  72 ASP OD2  O   -1.280   0.791  11.132 1.00 . A A .  72 ASP OD2  1 1 
        2  2822 1 1  73 GLY C    C   -2.523   5.498   6.298 1.00 . A A .  73 GLY C    1 1 
        2  2823 1 1  73 GLY CA   C   -1.642   4.836   7.361 1.00 . A A .  73 GLY CA   1 1 
        2  2824 1 1  73 GLY H    H   -2.683   3.717   8.860 1.00 . A A .  73 GLY H    1 1 
        2  2825 1 1  73 GLY HA2  H   -1.451   5.571   8.142 1.00 . A A .  73 GLY HA2  1 1 
        2  2826 1 1  73 GLY HA3  H   -0.692   4.592   6.888 1.00 . A A .  73 GLY HA3  1 1 
        2  2827 1 1  73 GLY N    N   -2.201   3.626   7.981 1.00 . A A .  73 GLY N    1 1 
        2  2828 1 1  73 GLY O    O   -2.134   6.524   5.746 1.00 . A A .  73 GLY O    1 1 
        2  2829 1 1  74 PHE C    C   -5.020   7.107   5.618 1.00 . A A .  74 PHE C    1 1 
        2  2830 1 1  74 PHE CA   C   -4.727   5.657   5.178 1.00 . A A .  74 PHE CA   1 1 
        2  2831 1 1  74 PHE CB   C   -5.997   4.798   5.176 1.00 . A A .  74 PHE CB   1 1 
        2  2832 1 1  74 PHE CD1  C   -7.121   5.004   2.921 1.00 . A A .  74 PHE CD1  1 1 
        2  2833 1 1  74 PHE CD2  C   -8.186   6.036   4.855 1.00 . A A .  74 PHE CD2  1 1 
        2  2834 1 1  74 PHE CE1  C   -8.190   5.426   2.112 1.00 . A A .  74 PHE CE1  1 1 
        2  2835 1 1  74 PHE CE2  C   -9.255   6.456   4.043 1.00 . A A .  74 PHE CE2  1 1 
        2  2836 1 1  74 PHE CG   C   -7.122   5.303   4.296 1.00 . A A .  74 PHE CG   1 1 
        2  2837 1 1  74 PHE CZ   C   -9.259   6.141   2.676 1.00 . A A .  74 PHE CZ   1 1 
        2  2838 1 1  74 PHE H    H   -4.002   4.123   6.486 1.00 . A A .  74 PHE H    1 1 
        2  2839 1 1  74 PHE HA   H   -4.334   5.700   4.161 1.00 . A A .  74 PHE HA   1 1 
        2  2840 1 1  74 PHE HB2  H   -5.733   3.800   4.829 1.00 . A A .  74 PHE HB2  1 1 
        2  2841 1 1  74 PHE HB3  H   -6.365   4.703   6.199 1.00 . A A .  74 PHE HB3  1 1 
        2  2842 1 1  74 PHE HD1  H   -6.306   4.441   2.488 1.00 . A A .  74 PHE HD1  1 1 
        2  2843 1 1  74 PHE HD2  H   -8.192   6.267   5.912 1.00 . A A .  74 PHE HD2  1 1 
        2  2844 1 1  74 PHE HE1  H   -8.192   5.199   1.056 1.00 . A A .  74 PHE HE1  1 1 
        2  2845 1 1  74 PHE HE2  H  -10.081   7.007   4.470 1.00 . A A .  74 PHE HE2  1 1 
        2  2846 1 1  74 PHE HZ   H  -10.090   6.452   2.055 1.00 . A A .  74 PHE HZ   1 1 
        2  2847 1 1  74 PHE N    N   -3.740   4.997   6.048 1.00 . A A .  74 PHE N    1 1 
        2  2848 1 1  74 PHE O    O   -5.218   7.992   4.784 1.00 . A A .  74 PHE O    1 1 
        2  2849 1 1  75 SER C    C   -3.931   9.670   7.264 1.00 . A A .  75 SER C    1 1 
        2  2850 1 1  75 SER CA   C   -5.110   8.713   7.528 1.00 . A A .  75 SER CA   1 1 
        2  2851 1 1  75 SER CB   C   -5.312   8.573   9.043 1.00 . A A .  75 SER CB   1 1 
        2  2852 1 1  75 SER H    H   -4.837   6.597   7.554 1.00 . A A .  75 SER H    1 1 
        2  2853 1 1  75 SER HA   H   -6.005   9.178   7.116 1.00 . A A .  75 SER HA   1 1 
        2  2854 1 1  75 SER HB2  H   -4.400   8.175   9.491 1.00 . A A .  75 SER HB2  1 1 
        2  2855 1 1  75 SER HB3  H   -5.514   9.556   9.472 1.00 . A A .  75 SER HB3  1 1 
        2  2856 1 1  75 SER HG   H   -6.514   7.661  10.298 1.00 . A A .  75 SER HG   1 1 
        2  2857 1 1  75 SER N    N   -4.959   7.377   6.925 1.00 . A A .  75 SER N    1 1 
        2  2858 1 1  75 SER O    O   -4.058  10.872   7.497 1.00 . A A .  75 SER O    1 1 
        2  2859 1 1  75 SER OG   O   -6.398   7.702   9.328 1.00 . A A .  75 SER OG   1 1 
        2  2860 1 1  76 GLU C    C   -1.724  10.547   4.960 1.00 . A A .  76 GLU C    1 1 
        2  2861 1 1  76 GLU CA   C   -1.616   9.982   6.395 1.00 . A A .  76 GLU CA   1 1 
        2  2862 1 1  76 GLU CB   C   -0.319   9.158   6.548 1.00 . A A .  76 GLU CB   1 1 
        2  2863 1 1  76 GLU CD   C    1.169   7.719   8.062 1.00 . A A .  76 GLU CD   1 1 
        2  2864 1 1  76 GLU CG   C   -0.089   8.608   7.968 1.00 . A A .  76 GLU CG   1 1 
        2  2865 1 1  76 GLU H    H   -2.738   8.176   6.585 1.00 . A A .  76 GLU H    1 1 
        2  2866 1 1  76 GLU HA   H   -1.543  10.839   7.068 1.00 . A A .  76 GLU HA   1 1 
        2  2867 1 1  76 GLU HB2  H   -0.331   8.331   5.840 1.00 . A A .  76 GLU HB2  1 1 
        2  2868 1 1  76 GLU HB3  H    0.523   9.800   6.289 1.00 . A A .  76 GLU HB3  1 1 
        2  2869 1 1  76 GLU HG2  H    0.007   9.449   8.660 1.00 . A A .  76 GLU HG2  1 1 
        2  2870 1 1  76 GLU HG3  H   -0.960   8.025   8.275 1.00 . A A .  76 GLU HG3  1 1 
        2  2871 1 1  76 GLU N    N   -2.790   9.172   6.772 1.00 . A A .  76 GLU N    1 1 
        2  2872 1 1  76 GLU O    O   -0.957  11.438   4.583 1.00 . A A .  76 GLU O    1 1 
        2  2873 1 1  76 GLU OE1  O    2.256   8.110   7.574 1.00 . A A .  76 GLU OE1  1 1 
        2  2874 1 1  76 GLU OE2  O    1.096   6.612   8.649 1.00 . A A .  76 GLU OE2  1 1 
        2  2875 1 1  77 LEU C    C   -3.864  11.641   2.631 1.00 . A A .  77 LEU C    1 1 
        2  2876 1 1  77 LEU CA   C   -2.909  10.439   2.767 1.00 . A A .  77 LEU CA   1 1 
        2  2877 1 1  77 LEU CB   C   -3.472   9.238   1.991 1.00 . A A .  77 LEU CB   1 1 
        2  2878 1 1  77 LEU CD1  C   -3.360   6.934   1.120 1.00 . A A .  77 LEU CD1  1 1 
        2  2879 1 1  77 LEU CD2  C   -1.258   8.255   1.171 1.00 . A A .  77 LEU CD2  1 1 
        2  2880 1 1  77 LEU CG   C   -2.574   7.993   1.895 1.00 . A A .  77 LEU CG   1 1 
        2  2881 1 1  77 LEU H    H   -3.289   9.346   4.552 1.00 . A A .  77 LEU H    1 1 
        2  2882 1 1  77 LEU HA   H   -1.962  10.721   2.312 1.00 . A A .  77 LEU HA   1 1 
        2  2883 1 1  77 LEU HB2  H   -4.405   8.941   2.466 1.00 . A A .  77 LEU HB2  1 1 
        2  2884 1 1  77 LEU HB3  H   -3.709   9.566   0.979 1.00 . A A .  77 LEU HB3  1 1 
        2  2885 1 1  77 LEU HD11 H   -4.258   6.661   1.675 1.00 . A A .  77 LEU HD11 1 1 
        2  2886 1 1  77 LEU HD12 H   -3.646   7.316   0.140 1.00 . A A .  77 LEU HD12 1 1 
        2  2887 1 1  77 LEU HD13 H   -2.751   6.049   0.980 1.00 . A A .  77 LEU HD13 1 1 
        2  2888 1 1  77 LEU HD21 H   -0.685   7.332   1.111 1.00 . A A .  77 LEU HD21 1 1 
        2  2889 1 1  77 LEU HD22 H   -1.454   8.631   0.168 1.00 . A A .  77 LEU HD22 1 1 
        2  2890 1 1  77 LEU HD23 H   -0.665   8.982   1.725 1.00 . A A .  77 LEU HD23 1 1 
        2  2891 1 1  77 LEU HG   H   -2.335   7.616   2.891 1.00 . A A .  77 LEU HG   1 1 
        2  2892 1 1  77 LEU N    N   -2.673  10.045   4.160 1.00 . A A .  77 LEU N    1 1 
        2  2893 1 1  77 LEU O    O   -4.722  11.881   3.487 1.00 . A A .  77 LEU O    1 1 
        2  2894 1 1  78 ARG C    C   -6.074  12.681   0.614 1.00 . A A .  78 ARG C    1 1 
        2  2895 1 1  78 ARG CA   C   -4.761  13.341   1.038 1.00 . A A .  78 ARG CA   1 1 
        2  2896 1 1  78 ARG CB   C   -4.184  14.153  -0.142 1.00 . A A .  78 ARG CB   1 1 
        2  2897 1 1  78 ARG CD   C   -4.693  16.564   0.532 1.00 . A A .  78 ARG CD   1 1 
        2  2898 1 1  78 ARG CG   C   -3.602  15.510   0.284 1.00 . A A .  78 ARG CG   1 1 
        2  2899 1 1  78 ARG CZ   C   -6.103  17.938  -1.043 1.00 . A A .  78 ARG CZ   1 1 
        2  2900 1 1  78 ARG H    H   -3.026  12.101   0.856 1.00 . A A .  78 ARG H    1 1 
        2  2901 1 1  78 ARG HA   H   -4.995  14.011   1.867 1.00 . A A .  78 ARG HA   1 1 
        2  2902 1 1  78 ARG HB2  H   -3.407  13.580  -0.644 1.00 . A A .  78 ARG HB2  1 1 
        2  2903 1 1  78 ARG HB3  H   -4.959  14.319  -0.890 1.00 . A A .  78 ARG HB3  1 1 
        2  2904 1 1  78 ARG HD2  H   -5.388  16.200   1.291 1.00 . A A .  78 ARG HD2  1 1 
        2  2905 1 1  78 ARG HD3  H   -4.211  17.472   0.903 1.00 . A A .  78 ARG HD3  1 1 
        2  2906 1 1  78 ARG HE   H   -5.413  16.150  -1.444 1.00 . A A .  78 ARG HE   1 1 
        2  2907 1 1  78 ARG HG2  H   -3.002  15.383   1.188 1.00 . A A .  78 ARG HG2  1 1 
        2  2908 1 1  78 ARG HG3  H   -2.945  15.874  -0.507 1.00 . A A .  78 ARG HG3  1 1 
        2  2909 1 1  78 ARG HH11 H   -5.834  18.939   0.664 1.00 . A A .  78 ARG HH11 1 1 
        2  2910 1 1  78 ARG HH12 H   -6.771  19.768  -0.550 1.00 . A A .  78 ARG HH12 1 1 
        2  2911 1 1  78 ARG HH21 H   -6.539  17.135  -2.797 1.00 . A A .  78 ARG HH21 1 1 
        2  2912 1 1  78 ARG HH22 H   -7.179  18.763  -2.535 1.00 . A A .  78 ARG HH22 1 1 
        2  2913 1 1  78 ARG N    N   -3.769  12.353   1.501 1.00 . A A .  78 ARG N    1 1 
        2  2914 1 1  78 ARG NE   N   -5.430  16.858  -0.711 1.00 . A A .  78 ARG NE   1 1 
        2  2915 1 1  78 ARG NH1  N   -6.248  18.963  -0.251 1.00 . A A .  78 ARG NH1  1 1 
        2  2916 1 1  78 ARG NH2  N   -6.651  17.968  -2.220 1.00 . A A .  78 ARG NH2  1 1 
        2  2917 1 1  78 ARG O    O   -6.089  11.540   0.156 1.00 . A A .  78 ARG O    1 1 
        2  2918 1 1  79 TRP C    C   -8.579  12.509  -1.200 1.00 . A A .  79 TRP C    1 1 
        2  2919 1 1  79 TRP CA   C   -8.515  13.046   0.250 1.00 . A A .  79 TRP CA   1 1 
        2  2920 1 1  79 TRP CB   C   -9.457  14.239   0.514 1.00 . A A .  79 TRP CB   1 1 
        2  2921 1 1  79 TRP CD1  C  -11.863  14.066  -0.311 1.00 . A A .  79 TRP CD1  1 1 
        2  2922 1 1  79 TRP CD2  C  -10.523  15.190  -1.716 1.00 . A A .  79 TRP CD2  1 1 
        2  2923 1 1  79 TRP CE2  C  -11.819  15.176  -2.309 1.00 . A A .  79 TRP CE2  1 1 
        2  2924 1 1  79 TRP CE3  C   -9.491  15.829  -2.430 1.00 . A A .  79 TRP CE3  1 1 
        2  2925 1 1  79 TRP CG   C  -10.580  14.469  -0.450 1.00 . A A .  79 TRP CG   1 1 
        2  2926 1 1  79 TRP CH2  C  -11.012  16.362  -4.263 1.00 . A A .  79 TRP CH2  1 1 
        2  2927 1 1  79 TRP CZ2  C  -12.068  15.745  -3.568 1.00 . A A .  79 TRP CZ2  1 1 
        2  2928 1 1  79 TRP CZ3  C   -9.726  16.404  -3.691 1.00 . A A .  79 TRP CZ3  1 1 
        2  2929 1 1  79 TRP H    H   -7.055  14.373   1.056 1.00 . A A .  79 TRP H    1 1 
        2  2930 1 1  79 TRP HA   H   -8.840  12.232   0.895 1.00 . A A .  79 TRP HA   1 1 
        2  2931 1 1  79 TRP HB2  H   -9.870  14.134   1.518 1.00 . A A .  79 TRP HB2  1 1 
        2  2932 1 1  79 TRP HB3  H   -8.872  15.162   0.515 1.00 . A A .  79 TRP HB3  1 1 
        2  2933 1 1  79 TRP HD1  H  -12.251  13.505   0.534 1.00 . A A .  79 TRP HD1  1 1 
        2  2934 1 1  79 TRP HE1  H  -13.594  14.303  -1.509 1.00 . A A .  79 TRP HE1  1 1 
        2  2935 1 1  79 TRP HE3  H   -8.499  15.857  -2.005 1.00 . A A .  79 TRP HE3  1 1 
        2  2936 1 1  79 TRP HH2  H  -11.185  16.800  -5.239 1.00 . A A .  79 TRP HH2  1 1 
        2  2937 1 1  79 TRP HZ2  H  -13.058  15.700  -4.000 1.00 . A A .  79 TRP HZ2  1 1 
        2  2938 1 1  79 TRP HZ3  H   -8.902  16.861  -4.223 1.00 . A A .  79 TRP HZ3  1 1 
        2  2939 1 1  79 TRP N    N   -7.163  13.447   0.671 1.00 . A A .  79 TRP N    1 1 
        2  2940 1 1  79 TRP NE1  N  -12.601  14.490  -1.402 1.00 . A A .  79 TRP NE1  1 1 
        2  2941 1 1  79 TRP O    O   -9.346  11.588  -1.489 1.00 . A A .  79 TRP O    1 1 
        2  2942 1 1  80 ASP C    C   -6.871  11.254  -3.713 1.00 . A A .  80 ASP C    1 1 
        2  2943 1 1  80 ASP CA   C   -7.640  12.576  -3.509 1.00 . A A .  80 ASP CA   1 1 
        2  2944 1 1  80 ASP CB   C   -7.093  13.699  -4.400 1.00 . A A .  80 ASP CB   1 1 
        2  2945 1 1  80 ASP CG   C   -5.863  14.425  -3.841 1.00 . A A .  80 ASP CG   1 1 
        2  2946 1 1  80 ASP H    H   -7.178  13.816  -1.835 1.00 . A A .  80 ASP H    1 1 
        2  2947 1 1  80 ASP HA   H   -8.646  12.377  -3.871 1.00 . A A .  80 ASP HA   1 1 
        2  2948 1 1  80 ASP HB2  H   -6.854  13.273  -5.374 1.00 . A A .  80 ASP HB2  1 1 
        2  2949 1 1  80 ASP HB3  H   -7.887  14.429  -4.548 1.00 . A A .  80 ASP HB3  1 1 
        2  2950 1 1  80 ASP N    N   -7.747  13.026  -2.109 1.00 . A A .  80 ASP N    1 1 
        2  2951 1 1  80 ASP O    O   -7.126  10.539  -4.682 1.00 . A A .  80 ASP O    1 1 
        2  2952 1 1  80 ASP OD1  O   -6.047  15.323  -2.984 1.00 . A A .  80 ASP OD1  1 1 
        2  2953 1 1  80 ASP OD2  O   -4.727  14.124  -4.274 1.00 . A A .  80 ASP OD2  1 1 
        2  2954 1 1  81 ASP C    C   -6.165   8.573  -1.984 1.00 . A A .  81 ASP C    1 1 
        2  2955 1 1  81 ASP CA   C   -5.314   9.582  -2.761 1.00 . A A .  81 ASP CA   1 1 
        2  2956 1 1  81 ASP CB   C   -3.900   9.690  -2.176 1.00 . A A .  81 ASP CB   1 1 
        2  2957 1 1  81 ASP CG   C   -2.906  10.289  -3.180 1.00 . A A .  81 ASP CG   1 1 
        2  2958 1 1  81 ASP H    H   -5.892  11.463  -1.981 1.00 . A A .  81 ASP H    1 1 
        2  2959 1 1  81 ASP HA   H   -5.220   9.193  -3.776 1.00 . A A .  81 ASP HA   1 1 
        2  2960 1 1  81 ASP HB2  H   -3.929  10.288  -1.262 1.00 . A A .  81 ASP HB2  1 1 
        2  2961 1 1  81 ASP HB3  H   -3.550   8.691  -1.912 1.00 . A A .  81 ASP HB3  1 1 
        2  2962 1 1  81 ASP N    N   -5.966  10.894  -2.803 1.00 . A A .  81 ASP N    1 1 
        2  2963 1 1  81 ASP O    O   -6.318   7.446  -2.440 1.00 . A A .  81 ASP O    1 1 
        2  2964 1 1  81 ASP OD1  O   -2.717   9.690  -4.266 1.00 . A A .  81 ASP OD1  1 1 
        2  2965 1 1  81 ASP OD2  O   -2.285  11.329  -2.864 1.00 . A A .  81 ASP OD2  1 1 
        2  2966 1 1  82 GLN C    C   -8.892   7.652  -1.020 1.00 . A A .  82 GLN C    1 1 
        2  2967 1 1  82 GLN CA   C   -7.761   8.171  -0.126 1.00 . A A .  82 GLN CA   1 1 
        2  2968 1 1  82 GLN CB   C   -8.348   9.011   1.020 1.00 . A A .  82 GLN CB   1 1 
        2  2969 1 1  82 GLN CD   C   -7.932   9.977   3.352 1.00 . A A .  82 GLN CD   1 1 
        2  2970 1 1  82 GLN CG   C   -7.378   9.139   2.200 1.00 . A A .  82 GLN CG   1 1 
        2  2971 1 1  82 GLN H    H   -6.605   9.910  -0.530 1.00 . A A .  82 GLN H    1 1 
        2  2972 1 1  82 GLN HA   H   -7.247   7.304   0.290 1.00 . A A .  82 GLN HA   1 1 
        2  2973 1 1  82 GLN HB2  H   -8.605  10.001   0.644 1.00 . A A .  82 GLN HB2  1 1 
        2  2974 1 1  82 GLN HB3  H   -9.265   8.545   1.378 1.00 . A A .  82 GLN HB3  1 1 
        2  2975 1 1  82 GLN HE21 H   -6.554   9.255   4.632 1.00 . A A .  82 GLN HE21 1 1 
        2  2976 1 1  82 GLN HE22 H   -7.691  10.446   5.282 1.00 . A A .  82 GLN HE22 1 1 
        2  2977 1 1  82 GLN HG2  H   -7.143   8.140   2.570 1.00 . A A .  82 GLN HG2  1 1 
        2  2978 1 1  82 GLN HG3  H   -6.455   9.601   1.860 1.00 . A A .  82 GLN HG3  1 1 
        2  2979 1 1  82 GLN N    N   -6.800   8.980  -0.879 1.00 . A A .  82 GLN N    1 1 
        2  2980 1 1  82 GLN NE2  N   -7.349   9.879   4.525 1.00 . A A .  82 GLN NE2  1 1 
        2  2981 1 1  82 GLN O    O   -9.107   6.444  -1.094 1.00 . A A .  82 GLN O    1 1 
        2  2982 1 1  82 GLN OE1  O   -8.883  10.740   3.227 1.00 . A A .  82 GLN OE1  1 1 
        2  2983 1 1  83 GLN C    C  -10.170   7.206  -3.819 1.00 . A A .  83 GLN C    1 1 
        2  2984 1 1  83 GLN CA   C  -10.652   8.106  -2.669 1.00 . A A .  83 GLN CA   1 1 
        2  2985 1 1  83 GLN CB   C  -11.436   9.325  -3.178 1.00 . A A .  83 GLN CB   1 1 
        2  2986 1 1  83 GLN CD   C  -11.362  11.476  -4.513 1.00 . A A .  83 GLN CD   1 1 
        2  2987 1 1  83 GLN CG   C  -10.686  10.137  -4.245 1.00 . A A .  83 GLN CG   1 1 
        2  2988 1 1  83 GLN H    H   -9.368   9.519  -1.676 1.00 . A A .  83 GLN H    1 1 
        2  2989 1 1  83 GLN HA   H  -11.348   7.509  -2.076 1.00 . A A .  83 GLN HA   1 1 
        2  2990 1 1  83 GLN HB2  H  -12.380   8.984  -3.607 1.00 . A A .  83 GLN HB2  1 1 
        2  2991 1 1  83 GLN HB3  H  -11.671   9.966  -2.326 1.00 . A A .  83 GLN HB3  1 1 
        2  2992 1 1  83 GLN HE21 H  -10.706  12.229  -2.761 1.00 . A A .  83 GLN HE21 1 1 
        2  2993 1 1  83 GLN HE22 H  -11.652  13.318  -3.776 1.00 . A A .  83 GLN HE22 1 1 
        2  2994 1 1  83 GLN HG2  H   -9.670  10.322  -3.905 1.00 . A A .  83 GLN HG2  1 1 
        2  2995 1 1  83 GLN HG3  H  -10.639   9.570  -5.176 1.00 . A A .  83 GLN HG3  1 1 
        2  2996 1 1  83 GLN N    N   -9.565   8.528  -1.776 1.00 . A A .  83 GLN N    1 1 
        2  2997 1 1  83 GLN NE2  N  -11.234  12.417  -3.608 1.00 . A A .  83 GLN NE2  1 1 
        2  2998 1 1  83 GLN O    O  -10.932   6.368  -4.289 1.00 . A A .  83 GLN O    1 1 
        2  2999 1 1  83 GLN OE1  O  -12.012  11.696  -5.527 1.00 . A A .  83 GLN OE1  1 1 
        2  3000 1 1  84 LYS C    C   -7.867   5.156  -4.728 1.00 . A A .  84 LYS C    1 1 
        2  3001 1 1  84 LYS CA   C   -8.271   6.518  -5.285 1.00 . A A .  84 LYS CA   1 1 
        2  3002 1 1  84 LYS CB   C   -7.115   7.357  -5.860 1.00 . A A .  84 LYS CB   1 1 
        2  3003 1 1  84 LYS CD   C   -5.016   5.942  -6.226 1.00 . A A .  84 LYS CD   1 1 
        2  3004 1 1  84 LYS CE   C   -4.047   6.821  -5.420 1.00 . A A .  84 LYS CE   1 1 
        2  3005 1 1  84 LYS CG   C   -6.209   6.659  -6.881 1.00 . A A .  84 LYS CG   1 1 
        2  3006 1 1  84 LYS H    H   -8.289   7.955  -3.757 1.00 . A A .  84 LYS H    1 1 
        2  3007 1 1  84 LYS HA   H   -8.985   6.331  -6.089 1.00 . A A .  84 LYS HA   1 1 
        2  3008 1 1  84 LYS HB2  H   -7.553   8.223  -6.354 1.00 . A A .  84 LYS HB2  1 1 
        2  3009 1 1  84 LYS HB3  H   -6.501   7.725  -5.043 1.00 . A A .  84 LYS HB3  1 1 
        2  3010 1 1  84 LYS HD2  H   -5.410   5.200  -5.537 1.00 . A A .  84 LYS HD2  1 1 
        2  3011 1 1  84 LYS HD3  H   -4.460   5.433  -7.011 1.00 . A A .  84 LYS HD3  1 1 
        2  3012 1 1  84 LYS HE2  H   -4.582   7.242  -4.565 1.00 . A A .  84 LYS HE2  1 1 
        2  3013 1 1  84 LYS HE3  H   -3.258   6.181  -5.018 1.00 . A A .  84 LYS HE3  1 1 
        2  3014 1 1  84 LYS HG2  H   -6.795   5.940  -7.455 1.00 . A A .  84 LYS HG2  1 1 
        2  3015 1 1  84 LYS HG3  H   -5.827   7.403  -7.579 1.00 . A A .  84 LYS HG3  1 1 
        2  3016 1 1  84 LYS HZ1  H   -4.144   8.464  -6.699 1.00 . A A .  84 LYS HZ1  1 1 
        2  3017 1 1  84 LYS HZ2  H   -2.944   8.559  -5.606 1.00 . A A .  84 LYS HZ2  1 1 
        2  3018 1 1  84 LYS HZ3  H   -2.791   7.560  -6.912 1.00 . A A .  84 LYS HZ3  1 1 
        2  3019 1 1  84 LYS N    N   -8.905   7.326  -4.245 1.00 . A A .  84 LYS N    1 1 
        2  3020 1 1  84 LYS NZ   N   -3.443   7.913  -6.226 1.00 . A A .  84 LYS NZ   1 1 
        2  3021 1 1  84 LYS O    O   -8.084   4.152  -5.397 1.00 . A A .  84 LYS O    1 1 
        2  3022 1 1  85 VAL C    C   -8.432   3.065  -2.554 1.00 . A A .  85 VAL C    1 1 
        2  3023 1 1  85 VAL CA   C   -7.112   3.810  -2.788 1.00 . A A .  85 VAL CA   1 1 
        2  3024 1 1  85 VAL CB   C   -6.353   4.038  -1.457 1.00 . A A .  85 VAL CB   1 1 
        2  3025 1 1  85 VAL CG1  C   -6.240   2.776  -0.585 1.00 . A A .  85 VAL CG1  1 1 
        2  3026 1 1  85 VAL CG2  C   -4.918   4.530  -1.690 1.00 . A A .  85 VAL CG2  1 1 
        2  3027 1 1  85 VAL H    H   -7.198   5.972  -3.005 1.00 . A A .  85 VAL H    1 1 
        2  3028 1 1  85 VAL HA   H   -6.501   3.171  -3.433 1.00 . A A .  85 VAL HA   1 1 
        2  3029 1 1  85 VAL HB   H   -6.883   4.799  -0.884 1.00 . A A .  85 VAL HB   1 1 
        2  3030 1 1  85 VAL HG11 H   -5.752   1.971  -1.137 1.00 . A A .  85 VAL HG11 1 1 
        2  3031 1 1  85 VAL HG12 H   -5.648   2.992   0.305 1.00 . A A .  85 VAL HG12 1 1 
        2  3032 1 1  85 VAL HG13 H   -7.225   2.445  -0.259 1.00 . A A .  85 VAL HG13 1 1 
        2  3033 1 1  85 VAL HG21 H   -4.897   5.345  -2.410 1.00 . A A .  85 VAL HG21 1 1 
        2  3034 1 1  85 VAL HG22 H   -4.502   4.889  -0.749 1.00 . A A .  85 VAL HG22 1 1 
        2  3035 1 1  85 VAL HG23 H   -4.293   3.718  -2.055 1.00 . A A .  85 VAL HG23 1 1 
        2  3036 1 1  85 VAL N    N   -7.371   5.088  -3.490 1.00 . A A .  85 VAL N    1 1 
        2  3037 1 1  85 VAL O    O   -8.519   1.876  -2.861 1.00 . A A .  85 VAL O    1 1 
        2  3038 1 1  86 LYS C    C  -11.485   2.751  -3.253 1.00 . A A .  86 LYS C    1 1 
        2  3039 1 1  86 LYS CA   C  -10.829   3.151  -1.925 1.00 . A A .  86 LYS CA   1 1 
        2  3040 1 1  86 LYS CB   C  -11.739   4.055  -1.070 1.00 . A A .  86 LYS CB   1 1 
        2  3041 1 1  86 LYS CD   C  -12.172   4.738   1.414 1.00 . A A .  86 LYS CD   1 1 
        2  3042 1 1  86 LYS CE   C  -13.404   3.845   1.572 1.00 . A A .  86 LYS CE   1 1 
        2  3043 1 1  86 LYS CG   C  -11.190   4.191   0.363 1.00 . A A .  86 LYS CG   1 1 
        2  3044 1 1  86 LYS H    H   -9.359   4.729  -1.847 1.00 . A A .  86 LYS H    1 1 
        2  3045 1 1  86 LYS HA   H  -10.700   2.212  -1.382 1.00 . A A .  86 LYS HA   1 1 
        2  3046 1 1  86 LYS HB2  H  -11.830   5.042  -1.527 1.00 . A A .  86 LYS HB2  1 1 
        2  3047 1 1  86 LYS HB3  H  -12.728   3.598  -1.038 1.00 . A A .  86 LYS HB3  1 1 
        2  3048 1 1  86 LYS HD2  H  -11.655   4.777   2.373 1.00 . A A .  86 LYS HD2  1 1 
        2  3049 1 1  86 LYS HD3  H  -12.481   5.749   1.137 1.00 . A A .  86 LYS HD3  1 1 
        2  3050 1 1  86 LYS HE2  H  -14.035   3.982   0.692 1.00 . A A .  86 LYS HE2  1 1 
        2  3051 1 1  86 LYS HE3  H  -13.065   2.810   1.599 1.00 . A A .  86 LYS HE3  1 1 
        2  3052 1 1  86 LYS HG2  H  -10.837   3.219   0.699 1.00 . A A .  86 LYS HG2  1 1 
        2  3053 1 1  86 LYS HG3  H  -10.326   4.845   0.341 1.00 . A A .  86 LYS HG3  1 1 
        2  3054 1 1  86 LYS HZ1  H  -13.660   3.867   3.647 1.00 . A A .  86 LYS HZ1  1 1 
        2  3055 1 1  86 LYS HZ2  H  -14.387   5.134   2.884 1.00 . A A .  86 LYS HZ2  1 1 
        2  3056 1 1  86 LYS HZ3  H  -15.045   3.642   2.829 1.00 . A A .  86 LYS HZ3  1 1 
        2  3057 1 1  86 LYS N    N   -9.494   3.755  -2.109 1.00 . A A .  86 LYS N    1 1 
        2  3058 1 1  86 LYS NZ   N  -14.172   4.151   2.808 1.00 . A A .  86 LYS NZ   1 1 
        2  3059 1 1  86 LYS O    O  -12.031   1.653  -3.340 1.00 . A A .  86 LYS O    1 1 
        2  3060 1 1  87 LYS C    C  -11.005   1.932  -6.145 1.00 . A A .  87 LYS C    1 1 
        2  3061 1 1  87 LYS CA   C  -11.750   3.178  -5.690 1.00 . A A .  87 LYS CA   1 1 
        2  3062 1 1  87 LYS CB   C  -11.553   4.372  -6.648 1.00 . A A .  87 LYS CB   1 1 
        2  3063 1 1  87 LYS CD   C  -11.115   3.449  -9.049 1.00 . A A .  87 LYS CD   1 1 
        2  3064 1 1  87 LYS CE   C  -11.703   3.479 -10.466 1.00 . A A .  87 LYS CE   1 1 
        2  3065 1 1  87 LYS CG   C  -12.074   4.176  -8.086 1.00 . A A .  87 LYS CG   1 1 
        2  3066 1 1  87 LYS H    H  -10.908   4.462  -4.170 1.00 . A A .  87 LYS H    1 1 
        2  3067 1 1  87 LYS HA   H  -12.808   2.911  -5.690 1.00 . A A .  87 LYS HA   1 1 
        2  3068 1 1  87 LYS HB2  H  -12.110   5.212  -6.236 1.00 . A A .  87 LYS HB2  1 1 
        2  3069 1 1  87 LYS HB3  H  -10.501   4.655  -6.683 1.00 . A A .  87 LYS HB3  1 1 
        2  3070 1 1  87 LYS HD2  H  -10.142   3.946  -9.047 1.00 . A A .  87 LYS HD2  1 1 
        2  3071 1 1  87 LYS HD3  H  -10.985   2.413  -8.742 1.00 . A A .  87 LYS HD3  1 1 
        2  3072 1 1  87 LYS HE2  H  -12.734   3.117 -10.421 1.00 . A A .  87 LYS HE2  1 1 
        2  3073 1 1  87 LYS HE3  H  -11.731   4.516 -10.813 1.00 . A A .  87 LYS HE3  1 1 
        2  3074 1 1  87 LYS HG2  H  -13.028   3.647  -8.054 1.00 . A A .  87 LYS HG2  1 1 
        2  3075 1 1  87 LYS HG3  H  -12.260   5.169  -8.498 1.00 . A A .  87 LYS HG3  1 1 
        2  3076 1 1  87 LYS HZ1  H  -10.901   1.676 -11.128 1.00 . A A .  87 LYS HZ1  1 1 
        2  3077 1 1  87 LYS HZ2  H  -11.335   2.674 -12.342 1.00 . A A .  87 LYS HZ2  1 1 
        2  3078 1 1  87 LYS HZ3  H   -9.964   2.957 -11.522 1.00 . A A .  87 LYS HZ3  1 1 
        2  3079 1 1  87 LYS N    N  -11.343   3.554  -4.318 1.00 . A A .  87 LYS N    1 1 
        2  3080 1 1  87 LYS NZ   N  -10.924   2.643 -11.418 1.00 . A A .  87 LYS NZ   1 1 
        2  3081 1 1  87 LYS O    O  -11.628   1.007  -6.651 1.00 . A A .  87 LYS O    1 1 
        2  3082 1 1  88 THR C    C   -9.180  -0.557  -5.523 1.00 . A A .  88 THR C    1 1 
        2  3083 1 1  88 THR CA   C   -8.868   0.721  -6.319 1.00 . A A .  88 THR CA   1 1 
        2  3084 1 1  88 THR CB   C   -7.378   1.075  -6.282 1.00 . A A .  88 THR CB   1 1 
        2  3085 1 1  88 THR CG2  C   -6.573   0.002  -6.991 1.00 . A A .  88 THR CG2  1 1 
        2  3086 1 1  88 THR H    H   -9.238   2.681  -5.532 1.00 . A A .  88 THR H    1 1 
        2  3087 1 1  88 THR HA   H   -9.096   0.519  -7.357 1.00 . A A .  88 THR HA   1 1 
        2  3088 1 1  88 THR HB   H   -7.031   1.196  -5.255 1.00 . A A .  88 THR HB   1 1 
        2  3089 1 1  88 THR HG1  H   -7.464   3.001  -6.499 1.00 . A A .  88 THR HG1  1 1 
        2  3090 1 1  88 THR HG21 H   -6.962  -0.137  -7.996 1.00 . A A .  88 THR HG21 1 1 
        2  3091 1 1  88 THR HG22 H   -5.533   0.312  -7.034 1.00 . A A .  88 THR HG22 1 1 
        2  3092 1 1  88 THR HG23 H   -6.657  -0.934  -6.447 1.00 . A A .  88 THR HG23 1 1 
        2  3093 1 1  88 THR N    N   -9.698   1.862  -5.912 1.00 . A A .  88 THR N    1 1 
        2  3094 1 1  88 THR O    O   -9.151  -1.653  -6.084 1.00 . A A .  88 THR O    1 1 
        2  3095 1 1  88 THR OG1  O   -7.128   2.249  -7.024 1.00 . A A .  88 THR OG1  1 1 
        2  3096 1 1  89 ALA C    C  -11.416  -2.063  -3.914 1.00 . A A .  89 ALA C    1 1 
        2  3097 1 1  89 ALA CA   C  -10.051  -1.545  -3.433 1.00 . A A .  89 ALA CA   1 1 
        2  3098 1 1  89 ALA CB   C  -10.108  -1.075  -1.977 1.00 . A A .  89 ALA CB   1 1 
        2  3099 1 1  89 ALA H    H   -9.622   0.487  -3.842 1.00 . A A .  89 ALA H    1 1 
        2  3100 1 1  89 ALA HA   H   -9.337  -2.367  -3.504 1.00 . A A .  89 ALA HA   1 1 
        2  3101 1 1  89 ALA HB1  H  -10.807  -0.246  -1.876 1.00 . A A .  89 ALA HB1  1 1 
        2  3102 1 1  89 ALA HB2  H  -10.445  -1.898  -1.349 1.00 . A A .  89 ALA HB2  1 1 
        2  3103 1 1  89 ALA HB3  H   -9.119  -0.752  -1.655 1.00 . A A .  89 ALA HB3  1 1 
        2  3104 1 1  89 ALA N    N   -9.584  -0.434  -4.255 1.00 . A A .  89 ALA N    1 1 
        2  3105 1 1  89 ALA O    O  -11.630  -3.274  -3.982 1.00 . A A .  89 ALA O    1 1 
        2  3106 1 1  90 GLU C    C  -13.393  -2.127  -6.363 1.00 . A A .  90 GLU C    1 1 
        2  3107 1 1  90 GLU CA   C  -13.584  -1.522  -4.960 1.00 . A A .  90 GLU CA   1 1 
        2  3108 1 1  90 GLU CB   C  -14.511  -0.298  -5.032 1.00 . A A .  90 GLU CB   1 1 
        2  3109 1 1  90 GLU CD   C  -16.172  -0.823  -3.175 1.00 . A A .  90 GLU CD   1 1 
        2  3110 1 1  90 GLU CG   C  -15.071   0.136  -3.672 1.00 . A A .  90 GLU CG   1 1 
        2  3111 1 1  90 GLU H    H  -12.092  -0.172  -4.210 1.00 . A A .  90 GLU H    1 1 
        2  3112 1 1  90 GLU HA   H  -14.047  -2.285  -4.343 1.00 . A A .  90 GLU HA   1 1 
        2  3113 1 1  90 GLU HB2  H  -13.964   0.538  -5.467 1.00 . A A .  90 GLU HB2  1 1 
        2  3114 1 1  90 GLU HB3  H  -15.350  -0.520  -5.694 1.00 . A A .  90 GLU HB3  1 1 
        2  3115 1 1  90 GLU HG2  H  -14.263   0.197  -2.942 1.00 . A A .  90 GLU HG2  1 1 
        2  3116 1 1  90 GLU HG3  H  -15.486   1.141  -3.781 1.00 . A A .  90 GLU HG3  1 1 
        2  3117 1 1  90 GLU N    N  -12.309  -1.157  -4.330 1.00 . A A .  90 GLU N    1 1 
        2  3118 1 1  90 GLU O    O  -14.147  -3.011  -6.775 1.00 . A A .  90 GLU O    1 1 
        2  3119 1 1  90 GLU OE1  O  -17.359  -0.632  -3.540 1.00 . A A .  90 GLU OE1  1 1 
        2  3120 1 1  90 GLU OE2  O  -15.865  -1.772  -2.413 1.00 . A A .  90 GLU OE2  1 1 
        2  3121 1 1  91 ALA C    C  -11.312  -3.553  -8.383 1.00 . A A .  91 ALA C    1 1 
        2  3122 1 1  91 ALA CA   C  -11.975  -2.157  -8.406 1.00 . A A .  91 ALA CA   1 1 
        2  3123 1 1  91 ALA CB   C  -11.045  -1.093  -9.013 1.00 . A A .  91 ALA CB   1 1 
        2  3124 1 1  91 ALA H    H  -11.848  -0.888  -6.710 1.00 . A A .  91 ALA H    1 1 
        2  3125 1 1  91 ALA HA   H  -12.874  -2.224  -9.020 1.00 . A A .  91 ALA HA   1 1 
        2  3126 1 1  91 ALA HB1  H  -10.104  -1.050  -8.463 1.00 . A A .  91 ALA HB1  1 1 
        2  3127 1 1  91 ALA HB2  H  -10.828  -1.340 -10.053 1.00 . A A .  91 ALA HB2  1 1 
        2  3128 1 1  91 ALA HB3  H  -11.520  -0.111  -8.965 1.00 . A A .  91 ALA HB3  1 1 
        2  3129 1 1  91 ALA N    N  -12.359  -1.681  -7.080 1.00 . A A .  91 ALA N    1 1 
        2  3130 1 1  91 ALA O    O  -11.378  -4.284  -9.374 1.00 . A A .  91 ALA O    1 1 
        2  3131 1 1  92 GLY C    C   -8.665  -5.297  -7.967 1.00 . A A .  92 GLY C    1 1 
        2  3132 1 1  92 GLY CA   C   -9.937  -5.195  -7.106 1.00 . A A .  92 GLY CA   1 1 
        2  3133 1 1  92 GLY H    H  -10.632  -3.265  -6.505 1.00 . A A .  92 GLY H    1 1 
        2  3134 1 1  92 GLY HA2  H   -9.643  -5.294  -6.062 1.00 . A A .  92 GLY HA2  1 1 
        2  3135 1 1  92 GLY HA3  H  -10.593  -6.028  -7.360 1.00 . A A .  92 GLY HA3  1 1 
        2  3136 1 1  92 GLY N    N  -10.673  -3.931  -7.267 1.00 . A A .  92 GLY N    1 1 
        2  3137 1 1  92 GLY O    O   -8.159  -6.397  -8.201 1.00 . A A .  92 GLY O    1 1 
        2  3138 1 1  93 GLY C    C   -7.063  -2.626 -10.035 1.00 . A A .  93 GLY C    1 1 
        2  3139 1 1  93 GLY CA   C   -7.120  -4.053  -9.481 1.00 . A A .  93 GLY CA   1 1 
        2  3140 1 1  93 GLY H    H   -8.631  -3.302  -8.209 1.00 . A A .  93 GLY H    1 1 
        2  3141 1 1  93 GLY HA2  H   -6.164  -4.320  -9.035 1.00 . A A .  93 GLY HA2  1 1 
        2  3142 1 1  93 GLY HA3  H   -7.317  -4.736 -10.308 1.00 . A A .  93 GLY HA3  1 1 
        2  3143 1 1  93 GLY N    N   -8.177  -4.164  -8.476 1.00 . A A .  93 GLY N    1 1 
        2  3144 1 1  93 GLY O    O   -8.101  -2.006 -10.273 1.00 . A A .  93 GLY O    1 1 
        2  3145 1 1  94 VAL C    C   -5.767  -0.423 -12.092 1.00 . A A .  94 VAL C    1 1 
        2  3146 1 1  94 VAL CA   C   -5.650  -0.672 -10.583 1.00 . A A .  94 VAL CA   1 1 
        2  3147 1 1  94 VAL CB   C   -4.345  -0.143  -9.966 1.00 . A A .  94 VAL CB   1 1 
        2  3148 1 1  94 VAL CG1  C   -3.084  -0.773 -10.568 1.00 . A A .  94 VAL CG1  1 1 
        2  3149 1 1  94 VAL CG2  C   -4.237   1.381 -10.066 1.00 . A A .  94 VAL CG2  1 1 
        2  3150 1 1  94 VAL H    H   -5.047  -2.642  -9.989 1.00 . A A .  94 VAL H    1 1 
        2  3151 1 1  94 VAL HA   H   -6.451  -0.096 -10.123 1.00 . A A .  94 VAL HA   1 1 
        2  3152 1 1  94 VAL HB   H   -4.381  -0.396  -8.908 1.00 . A A .  94 VAL HB   1 1 
        2  3153 1 1  94 VAL HG11 H   -2.994  -0.508 -11.623 1.00 . A A .  94 VAL HG11 1 1 
        2  3154 1 1  94 VAL HG12 H   -2.207  -0.408 -10.038 1.00 . A A .  94 VAL HG12 1 1 
        2  3155 1 1  94 VAL HG13 H   -3.119  -1.858 -10.476 1.00 . A A .  94 VAL HG13 1 1 
        2  3156 1 1  94 VAL HG21 H   -5.134   1.843  -9.649 1.00 . A A .  94 VAL HG21 1 1 
        2  3157 1 1  94 VAL HG22 H   -3.372   1.715  -9.497 1.00 . A A .  94 VAL HG22 1 1 
        2  3158 1 1  94 VAL HG23 H   -4.111   1.688 -11.103 1.00 . A A .  94 VAL HG23 1 1 
        2  3159 1 1  94 VAL N    N   -5.858  -2.081 -10.203 1.00 . A A .  94 VAL N    1 1 
        2  3160 1 1  94 VAL O    O   -5.379  -1.259 -12.912 1.00 . A A .  94 VAL O    1 1 
        2  3161 1 1  95 THR C    C   -5.805   2.174 -14.479 1.00 . A A .  95 THR C    1 1 
        2  3162 1 1  95 THR CA   C   -6.690   1.116 -13.831 1.00 . A A .  95 THR CA   1 1 
        2  3163 1 1  95 THR CB   C   -8.156   1.570 -13.866 1.00 . A A .  95 THR CB   1 1 
        2  3164 1 1  95 THR CG2  C   -9.085   0.398 -13.558 1.00 . A A .  95 THR CG2  1 1 
        2  3165 1 1  95 THR H    H   -6.661   1.346 -11.719 1.00 . A A .  95 THR H    1 1 
        2  3166 1 1  95 THR HA   H   -6.587   0.258 -14.485 1.00 . A A .  95 THR HA   1 1 
        2  3167 1 1  95 THR HB   H   -8.390   1.971 -14.853 1.00 . A A .  95 THR HB   1 1 
        2  3168 1 1  95 THR HG1  H   -8.030   3.397 -13.193 1.00 . A A .  95 THR HG1  1 1 
        2  3169 1 1  95 THR HG21 H   -8.918   0.047 -12.537 1.00 . A A .  95 THR HG21 1 1 
        2  3170 1 1  95 THR HG22 H  -10.122   0.713 -13.672 1.00 . A A .  95 THR HG22 1 1 
        2  3171 1 1  95 THR HG23 H   -8.887  -0.419 -14.252 1.00 . A A .  95 THR HG23 1 1 
        2  3172 1 1  95 THR N    N   -6.316   0.740 -12.453 1.00 . A A .  95 THR N    1 1 
        2  3173 1 1  95 THR O    O   -5.865   2.356 -15.697 1.00 . A A .  95 THR O    1 1 
        2  3174 1 1  95 THR OG1  O   -8.411   2.556 -12.878 1.00 . A A .  95 THR OG1  1 1 
        2  3175 1 1  96 GLY C    C   -2.676   3.266 -14.632 1.00 . A A .  96 GLY C    1 1 
        2  3176 1 1  96 GLY CA   C   -4.029   3.853 -14.200 1.00 . A A .  96 GLY CA   1 1 
        2  3177 1 1  96 GLY H    H   -4.973   2.658 -12.705 1.00 . A A .  96 GLY H    1 1 
        2  3178 1 1  96 GLY HA2  H   -4.486   4.337 -15.062 1.00 . A A .  96 GLY HA2  1 1 
        2  3179 1 1  96 GLY HA3  H   -3.865   4.604 -13.430 1.00 . A A .  96 GLY HA3  1 1 
        2  3180 1 1  96 GLY N    N   -4.975   2.863 -13.693 1.00 . A A .  96 GLY N    1 1 
        2  3181 1 1  96 GLY O    O   -2.496   2.047 -14.709 1.00 . A A .  96 GLY O    1 1 
        2  3182 1 1  97 LYS C    C    0.556   3.150 -14.291 1.00 . A A .  97 LYS C    1 1 
        2  3183 1 1  97 LYS CA   C   -0.343   3.788 -15.367 1.00 . A A .  97 LYS CA   1 1 
        2  3184 1 1  97 LYS CB   C    0.344   5.034 -15.963 1.00 . A A .  97 LYS CB   1 1 
        2  3185 1 1  97 LYS CD   C   -0.556   4.763 -18.358 1.00 . A A .  97 LYS CD   1 1 
        2  3186 1 1  97 LYS CE   C   -1.177   5.536 -19.528 1.00 . A A .  97 LYS CE   1 1 
        2  3187 1 1  97 LYS CG   C   -0.389   5.693 -17.147 1.00 . A A .  97 LYS CG   1 1 
        2  3188 1 1  97 LYS H    H   -1.924   5.130 -14.807 1.00 . A A .  97 LYS H    1 1 
        2  3189 1 1  97 LYS HA   H   -0.435   3.034 -16.151 1.00 . A A .  97 LYS HA   1 1 
        2  3190 1 1  97 LYS HB2  H    0.462   5.780 -15.174 1.00 . A A .  97 LYS HB2  1 1 
        2  3191 1 1  97 LYS HB3  H    1.345   4.756 -16.300 1.00 . A A .  97 LYS HB3  1 1 
        2  3192 1 1  97 LYS HD2  H    0.422   4.377 -18.653 1.00 . A A .  97 LYS HD2  1 1 
        2  3193 1 1  97 LYS HD3  H   -1.207   3.928 -18.094 1.00 . A A .  97 LYS HD3  1 1 
        2  3194 1 1  97 LYS HE2  H   -2.147   5.930 -19.214 1.00 . A A .  97 LYS HE2  1 1 
        2  3195 1 1  97 LYS HE3  H   -0.532   6.387 -19.769 1.00 . A A .  97 LYS HE3  1 1 
        2  3196 1 1  97 LYS HG2  H   -1.371   6.041 -16.823 1.00 . A A .  97 LYS HG2  1 1 
        2  3197 1 1  97 LYS HG3  H    0.189   6.565 -17.454 1.00 . A A .  97 LYS HG3  1 1 
        2  3198 1 1  97 LYS HZ1  H   -1.948   3.887 -20.536 1.00 . A A .  97 LYS HZ1  1 1 
        2  3199 1 1  97 LYS HZ2  H   -1.750   5.193 -21.494 1.00 . A A .  97 LYS HZ2  1 1 
        2  3200 1 1  97 LYS HZ3  H   -0.454   4.311 -21.047 1.00 . A A .  97 LYS HZ3  1 1 
        2  3201 1 1  97 LYS N    N   -1.700   4.147 -14.896 1.00 . A A .  97 LYS N    1 1 
        2  3202 1 1  97 LYS NZ   N   -1.343   4.674 -20.728 1.00 . A A .  97 LYS NZ   1 1 
        2  3203 1 1  97 LYS O    O    1.560   2.521 -14.634 1.00 . A A .  97 LYS O    1 1 
        2  3204 1 1  98 GLY C    C    2.254   3.615 -11.575 1.00 . A A .  98 GLY C    1 1 
        2  3205 1 1  98 GLY CA   C    0.988   2.797 -11.870 1.00 . A A .  98 GLY CA   1 1 
        2  3206 1 1  98 GLY H    H   -0.625   3.831 -12.818 1.00 . A A .  98 GLY H    1 1 
        2  3207 1 1  98 GLY HA2  H    0.364   2.816 -10.977 1.00 . A A .  98 GLY HA2  1 1 
        2  3208 1 1  98 GLY HA3  H    1.281   1.763 -12.054 1.00 . A A .  98 GLY HA3  1 1 
        2  3209 1 1  98 GLY N    N    0.204   3.291 -13.011 1.00 . A A .  98 GLY N    1 1 
        2  3210 1 1  98 GLY O    O    2.469   4.683 -12.155 1.00 . A A .  98 GLY O    1 1 
        2  3211 1 1  99 GLN C    C    5.497   2.777 -10.114 1.00 . A A .  99 GLN C    1 1 
        2  3212 1 1  99 GLN CA   C    4.323   3.772 -10.194 1.00 . A A .  99 GLN CA   1 1 
        2  3213 1 1  99 GLN CB   C    4.103   4.492  -8.849 1.00 . A A .  99 GLN CB   1 1 
        2  3214 1 1  99 GLN CD   C    2.931   6.486  -7.705 1.00 . A A .  99 GLN CD   1 1 
        2  3215 1 1  99 GLN CG   C    3.032   5.597  -8.943 1.00 . A A .  99 GLN CG   1 1 
        2  3216 1 1  99 GLN H    H    2.850   2.223 -10.237 1.00 . A A .  99 GLN H    1 1 
        2  3217 1 1  99 GLN HA   H    4.610   4.529 -10.926 1.00 . A A .  99 GLN HA   1 1 
        2  3218 1 1  99 GLN HB2  H    3.809   3.767  -8.088 1.00 . A A .  99 GLN HB2  1 1 
        2  3219 1 1  99 GLN HB3  H    5.050   4.944  -8.548 1.00 . A A .  99 GLN HB3  1 1 
        2  3220 1 1  99 GLN HE21 H    1.241   7.381  -8.366 1.00 . A A .  99 GLN HE21 1 1 
        2  3221 1 1  99 GLN HE22 H    1.868   7.930  -6.818 1.00 . A A .  99 GLN HE22 1 1 
        2  3222 1 1  99 GLN HG2  H    3.256   6.240  -9.796 1.00 . A A .  99 GLN HG2  1 1 
        2  3223 1 1  99 GLN HG3  H    2.058   5.139  -9.110 1.00 . A A .  99 GLN HG3  1 1 
        2  3224 1 1  99 GLN N    N    3.080   3.124 -10.646 1.00 . A A .  99 GLN N    1 1 
        2  3225 1 1  99 GLN NE2  N    1.921   7.325  -7.622 1.00 . A A .  99 GLN NE2  1 1 
        2  3226 1 1  99 GLN O    O    5.310   1.591  -9.840 1.00 . A A .  99 GLN O    1 1 
        2  3227 1 1  99 GLN OE1  O    3.751   6.467  -6.798 1.00 . A A .  99 GLN OE1  1 1 
        2  3228 1 1 100 ASP C    C    9.198   3.295 -10.112 1.00 . A A . 100 ASP C    1 1 
        2  3229 1 1 100 ASP CA   C    7.946   2.474 -10.502 1.00 . A A . 100 ASP CA   1 1 
        2  3230 1 1 100 ASP CB   C    8.035   1.980 -11.961 1.00 . A A . 100 ASP CB   1 1 
        2  3231 1 1 100 ASP CG   C    9.225   1.044 -12.227 1.00 . A A . 100 ASP CG   1 1 
        2  3232 1 1 100 ASP H    H    6.802   4.261 -10.533 1.00 . A A . 100 ASP H    1 1 
        2  3233 1 1 100 ASP HA   H    7.891   1.607  -9.842 1.00 . A A . 100 ASP HA   1 1 
        2  3234 1 1 100 ASP HB2  H    7.117   1.443 -12.209 1.00 . A A . 100 ASP HB2  1 1 
        2  3235 1 1 100 ASP HB3  H    8.099   2.850 -12.619 1.00 . A A . 100 ASP HB3  1 1 
        2  3236 1 1 100 ASP N    N    6.714   3.267 -10.367 1.00 . A A . 100 ASP N    1 1 
        2  3237 1 1 100 ASP O    O    9.145   4.527 -10.051 1.00 . A A . 100 ASP O    1 1 
        2  3238 1 1 100 ASP OD1  O    9.567   0.231 -11.337 1.00 . A A . 100 ASP OD1  1 1 
        2  3239 1 1 100 ASP OD2  O    9.820   1.126 -13.328 1.00 . A A . 100 ASP OD2  1 1 
        2  3240 1 1 101 GLY C    C   12.731   2.327  -9.124 1.00 . A A . 101 GLY C    1 1 
        2  3241 1 1 101 GLY CA   C   11.619   3.280  -9.580 1.00 . A A . 101 GLY CA   1 1 
        2  3242 1 1 101 GLY H    H   10.333   1.624  -9.998 1.00 . A A . 101 GLY H    1 1 
        2  3243 1 1 101 GLY HA2  H   11.964   3.792 -10.478 1.00 . A A . 101 GLY HA2  1 1 
        2  3244 1 1 101 GLY HA3  H   11.481   4.031  -8.806 1.00 . A A . 101 GLY HA3  1 1 
        2  3245 1 1 101 GLY N    N   10.332   2.631  -9.859 1.00 . A A . 101 GLY N    1 1 
        2  3246 1 1 101 GLY O    O   12.642   1.111  -9.310 1.00 . A A . 101 GLY O    1 1 
        2  3247 1 1 102 ILE C    C   15.487   2.684  -6.689 1.00 . A A . 102 ILE C    1 1 
        2  3248 1 1 102 ILE CA   C   14.993   2.184  -8.066 1.00 . A A . 102 ILE CA   1 1 
        2  3249 1 1 102 ILE CB   C   16.050   2.167  -9.201 1.00 . A A . 102 ILE CB   1 1 
        2  3250 1 1 102 ILE CD1  C   17.958   0.780 -10.236 1.00 . A A . 102 ILE CD1  1 1 
        2  3251 1 1 102 ILE CG1  C   17.107   1.060  -8.991 1.00 . A A . 102 ILE CG1  1 1 
        2  3252 1 1 102 ILE CG2  C   16.677   3.557  -9.434 1.00 . A A . 102 ILE CG2  1 1 
        2  3253 1 1 102 ILE H    H   13.789   3.906  -8.455 1.00 . A A . 102 ILE H    1 1 
        2  3254 1 1 102 ILE HA   H   14.699   1.150  -7.887 1.00 . A A . 102 ILE HA   1 1 
        2  3255 1 1 102 ILE HB   H   15.516   1.905 -10.116 1.00 . A A . 102 ILE HB   1 1 
        2  3256 1 1 102 ILE HD11 H   17.313   0.539 -11.081 1.00 . A A . 102 ILE HD11 1 1 
        2  3257 1 1 102 ILE HD12 H   18.572   1.646 -10.479 1.00 . A A . 102 ILE HD12 1 1 
        2  3258 1 1 102 ILE HD13 H   18.613  -0.068 -10.037 1.00 . A A . 102 ILE HD13 1 1 
        2  3259 1 1 102 ILE HG12 H   17.780   1.323  -8.176 1.00 . A A . 102 ILE HG12 1 1 
        2  3260 1 1 102 ILE HG13 H   16.597   0.134  -8.724 1.00 . A A . 102 ILE HG13 1 1 
        2  3261 1 1 102 ILE HG21 H   15.897   4.310  -9.545 1.00 . A A . 102 ILE HG21 1 1 
        2  3262 1 1 102 ILE HG22 H   17.320   3.833  -8.599 1.00 . A A . 102 ILE HG22 1 1 
        2  3263 1 1 102 ILE HG23 H   17.270   3.552 -10.347 1.00 . A A . 102 ILE HG23 1 1 
        2  3264 1 1 102 ILE N    N   13.788   2.898  -8.533 1.00 . A A . 102 ILE N    1 1 
        2  3265 1 1 102 ILE O    O   16.678   2.660  -6.372 1.00 . A A . 102 ILE O    1 1 
        2  3266 1 1 103 GLY C    C   15.539   4.985  -4.449 1.00 . A A . 103 GLY C    1 1 
        2  3267 1 1 103 GLY CA   C   14.866   3.605  -4.481 1.00 . A A . 103 GLY CA   1 1 
        2  3268 1 1 103 GLY H    H   13.591   3.070  -6.123 1.00 . A A . 103 GLY H    1 1 
        2  3269 1 1 103 GLY HA2  H   13.957   3.646  -3.887 1.00 . A A . 103 GLY HA2  1 1 
        2  3270 1 1 103 GLY HA3  H   15.534   2.887  -4.004 1.00 . A A . 103 GLY HA3  1 1 
        2  3271 1 1 103 GLY N    N   14.559   3.125  -5.834 1.00 . A A . 103 GLY N    1 1 
        2  3272 1 1 103 GLY O    O   15.421   5.770  -5.393 1.00 . A A . 103 GLY O    1 1 
        2  3273 1 1 104 SER C    C   18.566   6.156  -3.064 1.00 . A A . 104 SER C    1 1 
        2  3274 1 1 104 SER CA   C   17.068   6.485  -3.165 1.00 . A A . 104 SER CA   1 1 
        2  3275 1 1 104 SER CB   C   16.610   7.272  -1.931 1.00 . A A . 104 SER CB   1 1 
        2  3276 1 1 104 SER H    H   16.264   4.583  -2.614 1.00 . A A . 104 SER H    1 1 
        2  3277 1 1 104 SER HA   H   16.948   7.139  -4.030 1.00 . A A . 104 SER HA   1 1 
        2  3278 1 1 104 SER HB2  H   16.582   6.612  -1.064 1.00 . A A . 104 SER HB2  1 1 
        2  3279 1 1 104 SER HB3  H   17.314   8.081  -1.729 1.00 . A A . 104 SER HB3  1 1 
        2  3280 1 1 104 SER HG   H   15.394   8.484  -2.869 1.00 . A A . 104 SER HG   1 1 
        2  3281 1 1 104 SER N    N   16.246   5.275  -3.353 1.00 . A A . 104 SER N    1 1 
        2  3282 1 1 104 SER O    O   18.949   5.053  -2.661 1.00 . A A . 104 SER O    1 1 
        2  3283 1 1 104 SER OG   O   15.323   7.832  -2.148 1.00 . A A . 104 SER OG   1 1 
        2  3284 1 1 105 LYS C    C   21.542   8.228  -2.769 1.00 . A A . 105 LYS C    1 1 
        2  3285 1 1 105 LYS CA   C   20.887   7.029  -3.472 1.00 . A A . 105 LYS CA   1 1 
        2  3286 1 1 105 LYS CB   C   21.306   6.914  -4.951 1.00 . A A . 105 LYS CB   1 1 
        2  3287 1 1 105 LYS CD   C   23.104   6.380  -6.646 1.00 . A A . 105 LYS CD   1 1 
        2  3288 1 1 105 LYS CE   C   24.565   5.985  -6.907 1.00 . A A . 105 LYS CE   1 1 
        2  3289 1 1 105 LYS CG   C   22.770   6.499  -5.150 1.00 . A A . 105 LYS CG   1 1 
        2  3290 1 1 105 LYS H    H   19.013   8.013  -3.707 1.00 . A A . 105 LYS H    1 1 
        2  3291 1 1 105 LYS HA   H   21.208   6.124  -2.950 1.00 . A A . 105 LYS HA   1 1 
        2  3292 1 1 105 LYS HB2  H   20.677   6.162  -5.432 1.00 . A A . 105 LYS HB2  1 1 
        2  3293 1 1 105 LYS HB3  H   21.128   7.869  -5.450 1.00 . A A . 105 LYS HB3  1 1 
        2  3294 1 1 105 LYS HD2  H   22.441   5.649  -7.114 1.00 . A A . 105 LYS HD2  1 1 
        2  3295 1 1 105 LYS HD3  H   22.926   7.347  -7.119 1.00 . A A . 105 LYS HD3  1 1 
        2  3296 1 1 105 LYS HE2  H   24.755   6.086  -7.979 1.00 . A A . 105 LYS HE2  1 1 
        2  3297 1 1 105 LYS HE3  H   25.223   6.687  -6.387 1.00 . A A . 105 LYS HE3  1 1 
        2  3298 1 1 105 LYS HG2  H   23.430   7.242  -4.699 1.00 . A A . 105 LYS HG2  1 1 
        2  3299 1 1 105 LYS HG3  H   22.924   5.535  -4.668 1.00 . A A . 105 LYS HG3  1 1 
        2  3300 1 1 105 LYS HZ1  H   24.216   3.930  -6.890 1.00 . A A . 105 LYS HZ1  1 1 
        2  3301 1 1 105 LYS HZ2  H   25.795   4.317  -6.767 1.00 . A A . 105 LYS HZ2  1 1 
        2  3302 1 1 105 LYS HZ3  H   24.828   4.487  -5.468 1.00 . A A . 105 LYS HZ3  1 1 
        2  3303 1 1 105 LYS N    N   19.416   7.130  -3.420 1.00 . A A . 105 LYS N    1 1 
        2  3304 1 1 105 LYS NZ   N   24.864   4.590  -6.485 1.00 . A A . 105 LYS NZ   1 1 
        2  3305 1 1 105 LYS O    O   21.024   9.345  -2.853 1.00 . A A . 105 LYS O    1 1 
        2  3306 1 1 106 ALA C    C   24.869   9.212  -1.815 1.00 . A A . 106 ALA C    1 1 
        2  3307 1 1 106 ALA CA   C   23.416   9.030  -1.342 1.00 . A A . 106 ALA CA   1 1 
        2  3308 1 1 106 ALA CB   C   23.337   8.674   0.148 1.00 . A A . 106 ALA CB   1 1 
        2  3309 1 1 106 ALA H    H   23.040   7.059  -2.080 1.00 . A A . 106 ALA H    1 1 
        2  3310 1 1 106 ALA HA   H   22.954  10.004  -1.482 1.00 . A A . 106 ALA HA   1 1 
        2  3311 1 1 106 ALA HB1  H   23.838   9.444   0.737 1.00 . A A . 106 ALA HB1  1 1 
        2  3312 1 1 106 ALA HB2  H   22.293   8.615   0.462 1.00 . A A . 106 ALA HB2  1 1 
        2  3313 1 1 106 ALA HB3  H   23.823   7.714   0.328 1.00 . A A . 106 ALA HB3  1 1 
        2  3314 1 1 106 ALA N    N   22.670   8.006  -2.092 1.00 . A A . 106 ALA N    1 1 
        2  3315 1 1 106 ALA O    O   25.523  10.197  -1.462 1.00 . A A . 106 ALA O    1 1 
        2  3316 1 1 107 GLU C    C   27.040   9.288  -4.193 1.00 . A A . 107 GLU C    1 1 
        2  3317 1 1 107 GLU CA   C   26.770   8.260  -3.075 1.00 . A A . 107 GLU CA   1 1 
        2  3318 1 1 107 GLU CB   C   27.190   6.845  -3.523 1.00 . A A . 107 GLU CB   1 1 
        2  3319 1 1 107 GLU CD   C   25.379   5.166  -2.878 1.00 . A A . 107 GLU CD   1 1 
        2  3320 1 1 107 GLU CG   C   26.792   5.701  -2.571 1.00 . A A . 107 GLU CG   1 1 
        2  3321 1 1 107 GLU H    H   24.809   7.461  -2.797 1.00 . A A . 107 GLU H    1 1 
        2  3322 1 1 107 GLU HA   H   27.378   8.539  -2.215 1.00 . A A . 107 GLU HA   1 1 
        2  3323 1 1 107 GLU HB2  H   26.776   6.641  -4.512 1.00 . A A . 107 GLU HB2  1 1 
        2  3324 1 1 107 GLU HB3  H   28.276   6.842  -3.619 1.00 . A A . 107 GLU HB3  1 1 
        2  3325 1 1 107 GLU HG2  H   27.510   4.888  -2.696 1.00 . A A . 107 GLU HG2  1 1 
        2  3326 1 1 107 GLU HG3  H   26.864   6.041  -1.534 1.00 . A A . 107 GLU HG3  1 1 
        2  3327 1 1 107 GLU N    N   25.381   8.280  -2.617 1.00 . A A . 107 GLU N    1 1 
        2  3328 1 1 107 GLU O    O   26.171   9.556  -5.030 1.00 . A A . 107 GLU O    1 1 
        2  3329 1 1 107 GLU OE1  O   25.250   4.283  -3.760 1.00 . A A . 107 GLU OE1  1 1 
        2  3330 1 1 107 GLU OE2  O   24.389   5.668  -2.293 1.00 . A A . 107 GLU OE2  1 1 
        2  3331 1 1 108 LYS C    C   30.196  10.678  -5.568 1.00 . A A . 108 LYS C    1 1 
        2  3332 1 1 108 LYS CA   C   28.721  10.866  -5.182 1.00 . A A . 108 LYS CA   1 1 
        2  3333 1 1 108 LYS CB   C   28.445  12.264  -4.587 1.00 . A A . 108 LYS CB   1 1 
        2  3334 1 1 108 LYS CD   C   27.986  13.557  -6.778 1.00 . A A . 108 LYS CD   1 1 
        2  3335 1 1 108 LYS CE   C   28.833  13.987  -7.982 1.00 . A A . 108 LYS CE   1 1 
        2  3336 1 1 108 LYS CG   C   28.841  13.437  -5.502 1.00 . A A . 108 LYS CG   1 1 
        2  3337 1 1 108 LYS H    H   28.932   9.546  -3.525 1.00 . A A . 108 LYS H    1 1 
        2  3338 1 1 108 LYS HA   H   28.149  10.752  -6.102 1.00 . A A . 108 LYS HA   1 1 
        2  3339 1 1 108 LYS HB2  H   27.383  12.354  -4.349 1.00 . A A . 108 LYS HB2  1 1 
        2  3340 1 1 108 LYS HB3  H   29.003  12.362  -3.653 1.00 . A A . 108 LYS HB3  1 1 
        2  3341 1 1 108 LYS HD2  H   27.476  12.622  -7.008 1.00 . A A . 108 LYS HD2  1 1 
        2  3342 1 1 108 LYS HD3  H   27.215  14.311  -6.602 1.00 . A A . 108 LYS HD3  1 1 
        2  3343 1 1 108 LYS HE2  H   28.173  14.410  -8.747 1.00 . A A . 108 LYS HE2  1 1 
        2  3344 1 1 108 LYS HE3  H   29.522  14.775  -7.663 1.00 . A A . 108 LYS HE3  1 1 
        2  3345 1 1 108 LYS HG2  H   28.736  14.364  -4.936 1.00 . A A . 108 LYS HG2  1 1 
        2  3346 1 1 108 LYS HG3  H   29.897  13.349  -5.757 1.00 . A A . 108 LYS HG3  1 1 
        2  3347 1 1 108 LYS HZ1  H   30.068  12.301  -7.838 1.00 . A A . 108 LYS HZ1  1 1 
        2  3348 1 1 108 LYS HZ2  H   28.967  12.199  -9.031 1.00 . A A . 108 LYS HZ2  1 1 
        2  3349 1 1 108 LYS HZ3  H   30.275  13.152  -9.230 1.00 . A A . 108 LYS HZ3  1 1 
        2  3350 1 1 108 LYS N    N   28.261   9.844  -4.221 1.00 . A A . 108 LYS N    1 1 
        2  3351 1 1 108 LYS NZ   N   29.587  12.842  -8.559 1.00 . A A . 108 LYS NZ   1 1 
        2  3352 1 1 108 LYS O    O   30.519  10.925  -6.753 1.00 . A A . 108 LYS O    1 1 
        2  3353 1 1 108 LYS OXT  O   31.010  10.292  -4.699 1.00 . A A . 108 LYS OXT  1 1 
        2  3354 2 2   1 ZN  ZN   ZN   7.179  -2.682  -7.703 1.00 . B A . 109 ZN  ZN   1 1 
        3  3355 1 1   1 MET C    C    1.058   2.121  21.068 1.00 . A A .   1 MET C    1 1 
        3  3356 1 1   1 MET CA   C    0.096   3.293  21.300 1.00 . A A .   1 MET CA   1 1 
        3  3357 1 1   1 MET CB   C   -0.886   3.028  22.462 1.00 . A A .   1 MET CB   1 1 
        3  3358 1 1   1 MET CE   C   -0.216   5.361  24.825 1.00 . A A .   1 MET CE   1 1 
        3  3359 1 1   1 MET CG   C   -0.177   2.755  23.798 1.00 . A A .   1 MET CG   1 1 
        3  3360 1 1   1 MET H1   H   -1.192   4.483  20.205 1.00 . A A .   1 MET H1   1 1 
        3  3361 1 1   1 MET H2   H   -1.218   2.910  19.748 1.00 . A A .   1 MET H2   1 1 
        3  3362 1 1   1 MET H3   H    0.038   3.875  19.315 1.00 . A A .   1 MET H3   1 1 
        3  3363 1 1   1 MET HA   H    0.718   4.140  21.592 1.00 . A A .   1 MET HA   1 1 
        3  3364 1 1   1 MET HB2  H   -1.532   3.897  22.587 1.00 . A A .   1 MET HB2  1 1 
        3  3365 1 1   1 MET HB3  H   -1.521   2.173  22.226 1.00 . A A .   1 MET HB3  1 1 
        3  3366 1 1   1 MET HE1  H    0.326   6.206  25.250 1.00 . A A .   1 MET HE1  1 1 
        3  3367 1 1   1 MET HE2  H   -0.758   5.696  23.940 1.00 . A A .   1 MET HE2  1 1 
        3  3368 1 1   1 MET HE3  H   -0.926   4.987  25.564 1.00 . A A .   1 MET HE3  1 1 
        3  3369 1 1   1 MET HG2  H   -0.938   2.596  24.564 1.00 . A A .   1 MET HG2  1 1 
        3  3370 1 1   1 MET HG3  H    0.388   1.826  23.709 1.00 . A A .   1 MET HG3  1 1 
        3  3371 1 1   1 MET N    N   -0.617   3.669  20.052 1.00 . A A .   1 MET N    1 1 
        3  3372 1 1   1 MET O    O    2.271   2.305  21.170 1.00 . A A .   1 MET O    1 1 
        3  3373 1 1   1 MET SD   S    0.959   4.051  24.381 1.00 . A A .   1 MET SD   1 1 
        3  3374 1 1   2 ALA C    C    0.806  -1.189  19.395 1.00 . A A .   2 ALA C    1 1 
        3  3375 1 1   2 ALA CA   C    1.305  -0.317  20.576 1.00 . A A .   2 ALA CA   1 1 
        3  3376 1 1   2 ALA CB   C    1.285  -1.083  21.908 1.00 . A A .   2 ALA CB   1 1 
        3  3377 1 1   2 ALA H    H   -0.469   0.859  20.647 1.00 . A A .   2 ALA H    1 1 
        3  3378 1 1   2 ALA HA   H    2.343  -0.065  20.348 1.00 . A A .   2 ALA HA   1 1 
        3  3379 1 1   2 ALA HB1  H    1.904  -1.978  21.831 1.00 . A A .   2 ALA HB1  1 1 
        3  3380 1 1   2 ALA HB2  H    1.683  -0.454  22.705 1.00 . A A .   2 ALA HB2  1 1 
        3  3381 1 1   2 ALA HB3  H    0.263  -1.375  22.155 1.00 . A A .   2 ALA HB3  1 1 
        3  3382 1 1   2 ALA N    N    0.541   0.925  20.759 1.00 . A A .   2 ALA N    1 1 
        3  3383 1 1   2 ALA O    O    1.272  -2.314  19.209 1.00 . A A .   2 ALA O    1 1 
        3  3384 1 1   3 GLU C    C    0.032  -1.503  16.194 1.00 . A A .   3 GLU C    1 1 
        3  3385 1 1   3 GLU CA   C   -0.811  -1.402  17.483 1.00 . A A .   3 GLU CA   1 1 
        3  3386 1 1   3 GLU CB   C   -2.208  -0.794  17.228 1.00 . A A .   3 GLU CB   1 1 
        3  3387 1 1   3 GLU CD   C   -3.024   0.818  19.051 1.00 . A A .   3 GLU CD   1 1 
        3  3388 1 1   3 GLU CG   C   -3.088  -0.614  18.480 1.00 . A A .   3 GLU CG   1 1 
        3  3389 1 1   3 GLU H    H   -0.507   0.226  18.816 1.00 . A A .   3 GLU H    1 1 
        3  3390 1 1   3 GLU HA   H   -0.940  -2.438  17.802 1.00 . A A .   3 GLU HA   1 1 
        3  3391 1 1   3 GLU HB2  H   -2.100   0.170  16.728 1.00 . A A .   3 GLU HB2  1 1 
        3  3392 1 1   3 GLU HB3  H   -2.737  -1.459  16.544 1.00 . A A .   3 GLU HB3  1 1 
        3  3393 1 1   3 GLU HG2  H   -4.120  -0.841  18.200 1.00 . A A .   3 GLU HG2  1 1 
        3  3394 1 1   3 GLU HG3  H   -2.798  -1.339  19.245 1.00 . A A .   3 GLU HG3  1 1 
        3  3395 1 1   3 GLU N    N   -0.133  -0.688  18.583 1.00 . A A .   3 GLU N    1 1 
        3  3396 1 1   3 GLU O    O   -0.466  -1.396  15.068 1.00 . A A .   3 GLU O    1 1 
        3  3397 1 1   3 GLU OE1  O   -1.932   1.255  19.492 1.00 . A A .   3 GLU OE1  1 1 
        3  3398 1 1   3 GLU OE2  O   -4.061   1.523  19.063 1.00 . A A .   3 GLU OE2  1 1 
        3  3399 1 1   4 SER C    C    2.107  -2.720  14.183 1.00 . A A .   4 SER C    1 1 
        3  3400 1 1   4 SER CA   C    2.380  -1.749  15.339 1.00 . A A .   4 SER CA   1 1 
        3  3401 1 1   4 SER CB   C    3.676  -2.172  16.034 1.00 . A A .   4 SER CB   1 1 
        3  3402 1 1   4 SER H    H    1.653  -1.801  17.324 1.00 . A A .   4 SER H    1 1 
        3  3403 1 1   4 SER HA   H    2.516  -0.751  14.923 1.00 . A A .   4 SER HA   1 1 
        3  3404 1 1   4 SER HB2  H    3.488  -3.116  16.552 1.00 . A A .   4 SER HB2  1 1 
        3  3405 1 1   4 SER HB3  H    4.465  -2.307  15.294 1.00 . A A .   4 SER HB3  1 1 
        3  3406 1 1   4 SER HG   H    4.910  -1.473  17.390 1.00 . A A .   4 SER HG   1 1 
        3  3407 1 1   4 SER N    N    1.335  -1.714  16.365 1.00 . A A .   4 SER N    1 1 
        3  3408 1 1   4 SER O    O    2.487  -2.431  13.048 1.00 . A A .   4 SER O    1 1 
        3  3409 1 1   4 SER OG   O    4.069  -1.188  16.981 1.00 . A A .   4 SER OG   1 1 
        3  3410 1 1   5 SER C    C   -0.253  -5.475  13.471 1.00 . A A .   5 SER C    1 1 
        3  3411 1 1   5 SER CA   C    1.168  -4.907  13.462 1.00 . A A .   5 SER CA   1 1 
        3  3412 1 1   5 SER CB   C    2.251  -5.984  13.589 1.00 . A A .   5 SER CB   1 1 
        3  3413 1 1   5 SER H    H    1.180  -4.024  15.408 1.00 . A A .   5 SER H    1 1 
        3  3414 1 1   5 SER HA   H    1.246  -4.487  12.466 1.00 . A A .   5 SER HA   1 1 
        3  3415 1 1   5 SER HB2  H    2.147  -6.678  12.764 1.00 . A A .   5 SER HB2  1 1 
        3  3416 1 1   5 SER HB3  H    3.228  -5.507  13.505 1.00 . A A .   5 SER HB3  1 1 
        3  3417 1 1   5 SER HG   H    1.317  -7.114  14.905 1.00 . A A .   5 SER HG   1 1 
        3  3418 1 1   5 SER N    N    1.424  -3.840  14.444 1.00 . A A .   5 SER N    1 1 
        3  3419 1 1   5 SER O    O   -0.498  -6.565  12.946 1.00 . A A .   5 SER O    1 1 
        3  3420 1 1   5 SER OG   O    2.195  -6.699  14.816 1.00 . A A .   5 SER OG   1 1 
        3  3421 1 1   6 ASP C    C   -3.523  -4.879  13.009 1.00 . A A .   6 ASP C    1 1 
        3  3422 1 1   6 ASP CA   C   -2.600  -5.172  14.219 1.00 . A A .   6 ASP CA   1 1 
        3  3423 1 1   6 ASP CB   C   -3.122  -4.630  15.562 1.00 . A A .   6 ASP CB   1 1 
        3  3424 1 1   6 ASP CG   C   -4.438  -5.292  16.016 1.00 . A A .   6 ASP CG   1 1 
        3  3425 1 1   6 ASP H    H   -0.953  -3.826  14.401 1.00 . A A .   6 ASP H    1 1 
        3  3426 1 1   6 ASP HA   H   -2.542  -6.256  14.298 1.00 . A A .   6 ASP HA   1 1 
        3  3427 1 1   6 ASP HB2  H   -2.368  -4.809  16.331 1.00 . A A .   6 ASP HB2  1 1 
        3  3428 1 1   6 ASP HB3  H   -3.257  -3.550  15.474 1.00 . A A .   6 ASP HB3  1 1 
        3  3429 1 1   6 ASP N    N   -1.211  -4.729  14.028 1.00 . A A .   6 ASP N    1 1 
        3  3430 1 1   6 ASP O    O   -4.670  -4.448  13.149 1.00 . A A .   6 ASP O    1 1 
        3  3431 1 1   6 ASP OD1  O   -4.574  -6.534  15.888 1.00 . A A .   6 ASP OD1  1 1 
        3  3432 1 1   6 ASP OD2  O   -5.321  -4.583  16.555 1.00 . A A .   6 ASP OD2  1 1 
        3  3433 1 1   7 LYS C    C   -3.093  -5.923   9.503 1.00 . A A .   7 LYS C    1 1 
        3  3434 1 1   7 LYS CA   C   -3.591  -4.860  10.480 1.00 . A A .   7 LYS CA   1 1 
        3  3435 1 1   7 LYS CB   C   -3.332  -3.421   9.994 1.00 . A A .   7 LYS CB   1 1 
        3  3436 1 1   7 LYS CD   C   -1.660  -2.064  11.329 1.00 . A A .   7 LYS CD   1 1 
        3  3437 1 1   7 LYS CE   C   -0.200  -1.608  11.409 1.00 . A A .   7 LYS CE   1 1 
        3  3438 1 1   7 LYS CG   C   -1.869  -2.980  10.119 1.00 . A A .   7 LYS CG   1 1 
        3  3439 1 1   7 LYS H    H   -2.044  -5.445  11.767 1.00 . A A .   7 LYS H    1 1 
        3  3440 1 1   7 LYS HA   H   -4.663  -4.972  10.525 1.00 . A A .   7 LYS HA   1 1 
        3  3441 1 1   7 LYS HB2  H   -3.628  -3.336   8.950 1.00 . A A .   7 LYS HB2  1 1 
        3  3442 1 1   7 LYS HB3  H   -3.973  -2.739  10.554 1.00 . A A .   7 LYS HB3  1 1 
        3  3443 1 1   7 LYS HD2  H   -2.317  -1.202  11.226 1.00 . A A .   7 LYS HD2  1 1 
        3  3444 1 1   7 LYS HD3  H   -1.935  -2.594  12.239 1.00 . A A .   7 LYS HD3  1 1 
        3  3445 1 1   7 LYS HE2  H    0.428  -2.462  11.678 1.00 . A A .   7 LYS HE2  1 1 
        3  3446 1 1   7 LYS HE3  H    0.115  -1.263  10.419 1.00 . A A .   7 LYS HE3  1 1 
        3  3447 1 1   7 LYS HG2  H   -1.239  -3.858  10.223 1.00 . A A .   7 LYS HG2  1 1 
        3  3448 1 1   7 LYS HG3  H   -1.584  -2.450   9.211 1.00 . A A .   7 LYS HG3  1 1 
        3  3449 1 1   7 LYS HZ1  H   -0.354  -0.779  13.317 1.00 . A A .   7 LYS HZ1  1 1 
        3  3450 1 1   7 LYS HZ2  H    0.938  -0.238  12.463 1.00 . A A .   7 LYS HZ2  1 1 
        3  3451 1 1   7 LYS HZ3  H   -0.558   0.314  12.088 1.00 . A A .   7 LYS HZ3  1 1 
        3  3452 1 1   7 LYS N    N   -2.983  -5.073  11.800 1.00 . A A .   7 LYS N    1 1 
        3  3453 1 1   7 LYS NZ   N   -0.033  -0.508  12.391 1.00 . A A .   7 LYS NZ   1 1 
        3  3454 1 1   7 LYS O    O   -2.253  -6.756   9.860 1.00 . A A .   7 LYS O    1 1 
        3  3455 1 1   8 LEU C    C   -2.325  -5.819   6.132 1.00 . A A .   8 LEU C    1 1 
        3  3456 1 1   8 LEU CA   C   -3.093  -6.671   7.137 1.00 . A A .   8 LEU CA   1 1 
        3  3457 1 1   8 LEU CB   C   -4.300  -7.276   6.409 1.00 . A A .   8 LEU CB   1 1 
        3  3458 1 1   8 LEU CD1  C   -6.391  -8.578   6.388 1.00 . A A .   8 LEU CD1  1 1 
        3  3459 1 1   8 LEU CD2  C   -4.415  -9.503   7.605 1.00 . A A .   8 LEU CD2  1 1 
        3  3460 1 1   8 LEU CG   C   -5.172  -8.229   7.235 1.00 . A A .   8 LEU CG   1 1 
        3  3461 1 1   8 LEU H    H   -4.358  -5.260   8.106 1.00 . A A .   8 LEU H    1 1 
        3  3462 1 1   8 LEU HA   H   -2.412  -7.456   7.470 1.00 . A A .   8 LEU HA   1 1 
        3  3463 1 1   8 LEU HB2  H   -4.927  -6.452   6.063 1.00 . A A .   8 LEU HB2  1 1 
        3  3464 1 1   8 LEU HB3  H   -3.945  -7.809   5.526 1.00 . A A .   8 LEU HB3  1 1 
        3  3465 1 1   8 LEU HD11 H   -6.912  -7.655   6.125 1.00 . A A .   8 LEU HD11 1 1 
        3  3466 1 1   8 LEU HD12 H   -6.069  -9.081   5.477 1.00 . A A .   8 LEU HD12 1 1 
        3  3467 1 1   8 LEU HD13 H   -7.060  -9.224   6.955 1.00 . A A .   8 LEU HD13 1 1 
        3  3468 1 1   8 LEU HD21 H   -3.580  -9.252   8.258 1.00 . A A .   8 LEU HD21 1 1 
        3  3469 1 1   8 LEU HD22 H   -5.081 -10.184   8.133 1.00 . A A .   8 LEU HD22 1 1 
        3  3470 1 1   8 LEU HD23 H   -4.037  -9.986   6.703 1.00 . A A .   8 LEU HD23 1 1 
        3  3471 1 1   8 LEU HG   H   -5.513  -7.743   8.148 1.00 . A A .   8 LEU HG   1 1 
        3  3472 1 1   8 LEU N    N   -3.582  -5.887   8.271 1.00 . A A .   8 LEU N    1 1 
        3  3473 1 1   8 LEU O    O   -1.502  -6.357   5.396 1.00 . A A .   8 LEU O    1 1 
        3  3474 1 1   9 TYR C    C   -1.730  -2.308   5.429 1.00 . A A .   9 TYR C    1 1 
        3  3475 1 1   9 TYR CA   C   -2.265  -3.662   4.949 1.00 . A A .   9 TYR CA   1 1 
        3  3476 1 1   9 TYR CB   C   -3.507  -3.492   4.050 1.00 . A A .   9 TYR CB   1 1 
        3  3477 1 1   9 TYR CD1  C   -3.464  -5.804   2.998 1.00 . A A .   9 TYR CD1  1 1 
        3  3478 1 1   9 TYR CD2  C   -5.600  -4.895   3.719 1.00 . A A .   9 TYR CD2  1 1 
        3  3479 1 1   9 TYR CE1  C   -4.099  -6.992   2.587 1.00 . A A .   9 TYR CE1  1 1 
        3  3480 1 1   9 TYR CE2  C   -6.243  -6.086   3.323 1.00 . A A .   9 TYR CE2  1 1 
        3  3481 1 1   9 TYR CG   C   -4.204  -4.761   3.580 1.00 . A A .   9 TYR CG   1 1 
        3  3482 1 1   9 TYR CZ   C   -5.491  -7.141   2.761 1.00 . A A .   9 TYR CZ   1 1 
        3  3483 1 1   9 TYR H    H   -3.190  -4.105   6.797 1.00 . A A .   9 TYR H    1 1 
        3  3484 1 1   9 TYR HA   H   -1.481  -4.135   4.358 1.00 . A A .   9 TYR HA   1 1 
        3  3485 1 1   9 TYR HB2  H   -4.242  -2.916   4.605 1.00 . A A .   9 TYR HB2  1 1 
        3  3486 1 1   9 TYR HB3  H   -3.225  -2.919   3.167 1.00 . A A .   9 TYR HB3  1 1 
        3  3487 1 1   9 TYR HD1  H   -2.400  -5.692   2.876 1.00 . A A .   9 TYR HD1  1 1 
        3  3488 1 1   9 TYR HD2  H   -6.180  -4.086   4.137 1.00 . A A .   9 TYR HD2  1 1 
        3  3489 1 1   9 TYR HE1  H   -3.521  -7.792   2.149 1.00 . A A .   9 TYR HE1  1 1 
        3  3490 1 1   9 TYR HE2  H   -7.309  -6.197   3.448 1.00 . A A .   9 TYR HE2  1 1 
        3  3491 1 1   9 TYR HH   H   -5.490  -8.907   1.957 1.00 . A A .   9 TYR HH   1 1 
        3  3492 1 1   9 TYR N    N   -2.600  -4.516   6.083 1.00 . A A .   9 TYR N    1 1 
        3  3493 1 1   9 TYR O    O   -2.051  -1.839   6.522 1.00 . A A .   9 TYR O    1 1 
        3  3494 1 1   9 TYR OH   O   -6.111  -8.294   2.390 1.00 . A A .   9 TYR OH   1 1 
        3  3495 1 1  10 ARG C    C   -0.296   0.448   3.533 1.00 . A A .  10 ARG C    1 1 
        3  3496 1 1  10 ARG CA   C   -0.274  -0.364   4.829 1.00 . A A .  10 ARG CA   1 1 
        3  3497 1 1  10 ARG CB   C    1.158  -0.616   5.352 1.00 . A A .  10 ARG CB   1 1 
        3  3498 1 1  10 ARG CD   C    1.760   1.637   6.403 1.00 . A A .  10 ARG CD   1 1 
        3  3499 1 1  10 ARG CG   C    2.153   0.565   5.374 1.00 . A A .  10 ARG CG   1 1 
        3  3500 1 1  10 ARG CZ   C    2.435   3.918   7.123 1.00 . A A .  10 ARG CZ   1 1 
        3  3501 1 1  10 ARG H    H   -0.662  -2.154   3.738 1.00 . A A .  10 ARG H    1 1 
        3  3502 1 1  10 ARG HA   H   -0.850   0.162   5.588 1.00 . A A .  10 ARG HA   1 1 
        3  3503 1 1  10 ARG HB2  H    1.090  -1.033   6.360 1.00 . A A .  10 ARG HB2  1 1 
        3  3504 1 1  10 ARG HB3  H    1.593  -1.387   4.724 1.00 . A A .  10 ARG HB3  1 1 
        3  3505 1 1  10 ARG HD2  H    0.757   1.976   6.169 1.00 . A A .  10 ARG HD2  1 1 
        3  3506 1 1  10 ARG HD3  H    1.761   1.180   7.392 1.00 . A A .  10 ARG HD3  1 1 
        3  3507 1 1  10 ARG HE   H    3.410   2.847   5.760 1.00 . A A .  10 ARG HE   1 1 
        3  3508 1 1  10 ARG HG2  H    3.136   0.170   5.632 1.00 . A A .  10 ARG HG2  1 1 
        3  3509 1 1  10 ARG HG3  H    2.228   1.001   4.377 1.00 . A A .  10 ARG HG3  1 1 
        3  3510 1 1  10 ARG HH11 H    0.973   3.227   8.338 1.00 . A A .  10 ARG HH11 1 1 
        3  3511 1 1  10 ARG HH12 H    1.358   4.957   8.418 1.00 . A A .  10 ARG HH12 1 1 
        3  3512 1 1  10 ARG HH21 H    3.927   5.039   6.323 1.00 . A A .  10 ARG HH21 1 1 
        3  3513 1 1  10 ARG HH22 H    2.813   5.838   7.426 1.00 . A A .  10 ARG HH22 1 1 
        3  3514 1 1  10 ARG N    N   -0.915  -1.667   4.594 1.00 . A A .  10 ARG N    1 1 
        3  3515 1 1  10 ARG NE   N    2.647   2.818   6.413 1.00 . A A .  10 ARG NE   1 1 
        3  3516 1 1  10 ARG NH1  N    1.504   4.036   8.015 1.00 . A A .  10 ARG NH1  1 1 
        3  3517 1 1  10 ARG NH2  N    3.152   4.988   6.980 1.00 . A A .  10 ARG NH2  1 1 
        3  3518 1 1  10 ARG O    O   -0.172  -0.136   2.460 1.00 . A A .  10 ARG O    1 1 
        3  3519 1 1  11 VAL C    C    0.414   4.001   3.001 1.00 . A A .  11 VAL C    1 1 
        3  3520 1 1  11 VAL CA   C   -0.274   2.727   2.509 1.00 . A A .  11 VAL CA   1 1 
        3  3521 1 1  11 VAL CB   C   -1.645   3.031   1.872 1.00 . A A .  11 VAL CB   1 1 
        3  3522 1 1  11 VAL CG1  C   -2.529   3.967   2.709 1.00 . A A .  11 VAL CG1  1 1 
        3  3523 1 1  11 VAL CG2  C   -1.504   3.679   0.488 1.00 . A A .  11 VAL CG2  1 1 
        3  3524 1 1  11 VAL H    H   -0.647   2.159   4.531 1.00 . A A .  11 VAL H    1 1 
        3  3525 1 1  11 VAL HA   H    0.362   2.278   1.745 1.00 . A A .  11 VAL HA   1 1 
        3  3526 1 1  11 VAL HB   H   -2.166   2.073   1.775 1.00 . A A .  11 VAL HB   1 1 
        3  3527 1 1  11 VAL HG11 H   -2.133   4.983   2.701 1.00 . A A .  11 VAL HG11 1 1 
        3  3528 1 1  11 VAL HG12 H   -3.541   3.975   2.307 1.00 . A A .  11 VAL HG12 1 1 
        3  3529 1 1  11 VAL HG13 H   -2.556   3.628   3.741 1.00 . A A .  11 VAL HG13 1 1 
        3  3530 1 1  11 VAL HG21 H   -1.119   4.694   0.583 1.00 . A A .  11 VAL HG21 1 1 
        3  3531 1 1  11 VAL HG22 H   -0.814   3.119  -0.136 1.00 . A A .  11 VAL HG22 1 1 
        3  3532 1 1  11 VAL HG23 H   -2.476   3.710  -0.004 1.00 . A A .  11 VAL HG23 1 1 
        3  3533 1 1  11 VAL N    N   -0.430   1.769   3.618 1.00 . A A .  11 VAL N    1 1 
        3  3534 1 1  11 VAL O    O    0.179   4.435   4.127 1.00 . A A .  11 VAL O    1 1 
        3  3535 1 1  12 GLU C    C    2.429   6.647   1.260 1.00 . A A .  12 GLU C    1 1 
        3  3536 1 1  12 GLU CA   C    1.861   5.919   2.473 1.00 . A A .  12 GLU CA   1 1 
        3  3537 1 1  12 GLU CB   C    2.979   5.787   3.529 1.00 . A A .  12 GLU CB   1 1 
        3  3538 1 1  12 GLU CD   C    5.395   5.095   4.062 1.00 . A A .  12 GLU CD   1 1 
        3  3539 1 1  12 GLU CG   C    4.224   4.999   3.073 1.00 . A A .  12 GLU CG   1 1 
        3  3540 1 1  12 GLU H    H    1.481   4.181   1.281 1.00 . A A .  12 GLU H    1 1 
        3  3541 1 1  12 GLU HA   H    1.082   6.579   2.864 1.00 . A A .  12 GLU HA   1 1 
        3  3542 1 1  12 GLU HB2  H    3.286   6.791   3.814 1.00 . A A .  12 GLU HB2  1 1 
        3  3543 1 1  12 GLU HB3  H    2.574   5.311   4.418 1.00 . A A .  12 GLU HB3  1 1 
        3  3544 1 1  12 GLU HG2  H    3.947   3.953   2.935 1.00 . A A .  12 GLU HG2  1 1 
        3  3545 1 1  12 GLU HG3  H    4.570   5.384   2.114 1.00 . A A .  12 GLU HG3  1 1 
        3  3546 1 1  12 GLU N    N    1.266   4.612   2.177 1.00 . A A .  12 GLU N    1 1 
        3  3547 1 1  12 GLU O    O    2.834   6.047   0.263 1.00 . A A .  12 GLU O    1 1 
        3  3548 1 1  12 GLU OE1  O    5.189   5.507   5.228 1.00 . A A .  12 GLU OE1  1 1 
        3  3549 1 1  12 GLU OE2  O    6.538   4.779   3.661 1.00 . A A .  12 GLU OE2  1 1 
        3  3550 1 1  13 TYR C    C    4.979   8.342   1.432 1.00 . A A .  13 TYR C    1 1 
        3  3551 1 1  13 TYR CA   C    3.633   8.726   0.796 1.00 . A A .  13 TYR CA   1 1 
        3  3552 1 1  13 TYR CB   C    3.320  10.221   0.934 1.00 . A A .  13 TYR CB   1 1 
        3  3553 1 1  13 TYR CD1  C    1.317  10.001  -0.642 1.00 . A A .  13 TYR CD1  1 1 
        3  3554 1 1  13 TYR CD2  C    1.294  11.738   1.066 1.00 . A A .  13 TYR CD2  1 1 
        3  3555 1 1  13 TYR CE1  C    0.089  10.472  -1.142 1.00 . A A .  13 TYR CE1  1 1 
        3  3556 1 1  13 TYR CE2  C    0.049  12.192   0.588 1.00 . A A .  13 TYR CE2  1 1 
        3  3557 1 1  13 TYR CG   C    1.945  10.656   0.440 1.00 . A A .  13 TYR CG   1 1 
        3  3558 1 1  13 TYR CZ   C   -0.544  11.574  -0.533 1.00 . A A .  13 TYR CZ   1 1 
        3  3559 1 1  13 TYR H    H    2.153   8.381   2.252 1.00 . A A .  13 TYR H    1 1 
        3  3560 1 1  13 TYR HA   H    3.669   8.474  -0.263 1.00 . A A .  13 TYR HA   1 1 
        3  3561 1 1  13 TYR HB2  H    3.413  10.497   1.986 1.00 . A A .  13 TYR HB2  1 1 
        3  3562 1 1  13 TYR HB3  H    4.073  10.783   0.380 1.00 . A A .  13 TYR HB3  1 1 
        3  3563 1 1  13 TYR HD1  H    1.766   9.122  -1.082 1.00 . A A .  13 TYR HD1  1 1 
        3  3564 1 1  13 TYR HD2  H    1.753  12.222   1.918 1.00 . A A .  13 TYR HD2  1 1 
        3  3565 1 1  13 TYR HE1  H   -0.381   9.982  -1.981 1.00 . A A .  13 TYR HE1  1 1 
        3  3566 1 1  13 TYR HE2  H   -0.448  13.024   1.064 1.00 . A A .  13 TYR HE2  1 1 
        3  3567 1 1  13 TYR HH   H   -1.951  11.626  -1.875 1.00 . A A .  13 TYR HH   1 1 
        3  3568 1 1  13 TYR N    N    2.576   7.959   1.438 1.00 . A A .  13 TYR N    1 1 
        3  3569 1 1  13 TYR O    O    5.158   8.427   2.652 1.00 . A A .  13 TYR O    1 1 
        3  3570 1 1  13 TYR OH   O   -1.730  12.031  -1.011 1.00 . A A .  13 TYR OH   1 1 
        3  3571 1 1  14 ALA C    C    8.110   8.179   1.722 1.00 . A A .  14 ALA C    1 1 
        3  3572 1 1  14 ALA CA   C    7.146   7.218   1.001 1.00 . A A .  14 ALA CA   1 1 
        3  3573 1 1  14 ALA CB   C    7.761   6.619  -0.267 1.00 . A A .  14 ALA CB   1 1 
        3  3574 1 1  14 ALA H    H    5.643   7.781  -0.376 1.00 . A A .  14 ALA H    1 1 
        3  3575 1 1  14 ALA HA   H    6.909   6.401   1.682 1.00 . A A .  14 ALA HA   1 1 
        3  3576 1 1  14 ALA HB1  H    7.875   7.393  -1.025 1.00 . A A .  14 ALA HB1  1 1 
        3  3577 1 1  14 ALA HB2  H    8.737   6.186  -0.049 1.00 . A A .  14 ALA HB2  1 1 
        3  3578 1 1  14 ALA HB3  H    7.104   5.850  -0.669 1.00 . A A .  14 ALA HB3  1 1 
        3  3579 1 1  14 ALA N    N    5.899   7.857   0.603 1.00 . A A .  14 ALA N    1 1 
        3  3580 1 1  14 ALA O    O    8.396   9.272   1.226 1.00 . A A .  14 ALA O    1 1 
        3  3581 1 1  15 LYS C    C   10.969   8.594   3.357 1.00 . A A .  15 LYS C    1 1 
        3  3582 1 1  15 LYS CA   C    9.492   8.575   3.764 1.00 . A A .  15 LYS CA   1 1 
        3  3583 1 1  15 LYS CB   C    9.357   8.084   5.220 1.00 . A A .  15 LYS CB   1 1 
        3  3584 1 1  15 LYS CD   C    7.137   9.310   5.611 1.00 . A A .  15 LYS CD   1 1 
        3  3585 1 1  15 LYS CE   C    5.746   9.214   6.242 1.00 . A A .  15 LYS CE   1 1 
        3  3586 1 1  15 LYS CG   C    7.915   7.991   5.745 1.00 . A A .  15 LYS CG   1 1 
        3  3587 1 1  15 LYS H    H    8.331   6.850   3.220 1.00 . A A .  15 LYS H    1 1 
        3  3588 1 1  15 LYS HA   H    9.148   9.611   3.724 1.00 . A A .  15 LYS HA   1 1 
        3  3589 1 1  15 LYS HB2  H    9.811   7.096   5.310 1.00 . A A .  15 LYS HB2  1 1 
        3  3590 1 1  15 LYS HB3  H    9.914   8.762   5.869 1.00 . A A .  15 LYS HB3  1 1 
        3  3591 1 1  15 LYS HD2  H    7.694  10.101   6.117 1.00 . A A .  15 LYS HD2  1 1 
        3  3592 1 1  15 LYS HD3  H    7.030   9.581   4.561 1.00 . A A .  15 LYS HD3  1 1 
        3  3593 1 1  15 LYS HE2  H    5.850   8.915   7.288 1.00 . A A .  15 LYS HE2  1 1 
        3  3594 1 1  15 LYS HE3  H    5.296  10.209   6.217 1.00 . A A .  15 LYS HE3  1 1 
        3  3595 1 1  15 LYS HG2  H    7.392   7.203   5.205 1.00 . A A .  15 LYS HG2  1 1 
        3  3596 1 1  15 LYS HG3  H    7.952   7.708   6.798 1.00 . A A .  15 LYS HG3  1 1 
        3  3597 1 1  15 LYS HZ1  H    5.216   7.300   5.583 1.00 . A A .  15 LYS HZ1  1 1 
        3  3598 1 1  15 LYS HZ2  H    3.934   8.249   5.930 1.00 . A A .  15 LYS HZ2  1 1 
        3  3599 1 1  15 LYS HZ3  H    4.804   8.490   4.536 1.00 . A A .  15 LYS HZ3  1 1 
        3  3600 1 1  15 LYS N    N    8.639   7.752   2.879 1.00 . A A .  15 LYS N    1 1 
        3  3601 1 1  15 LYS NZ   N    4.871   8.258   5.522 1.00 . A A .  15 LYS NZ   1 1 
        3  3602 1 1  15 LYS O    O   11.632   9.626   3.475 1.00 . A A .  15 LYS O    1 1 
        3  3603 1 1  16 SER C    C   12.976   6.122   1.432 1.00 . A A .  16 SER C    1 1 
        3  3604 1 1  16 SER CA   C   12.877   7.243   2.475 1.00 . A A .  16 SER CA   1 1 
        3  3605 1 1  16 SER CB   C   13.731   6.911   3.703 1.00 . A A .  16 SER CB   1 1 
        3  3606 1 1  16 SER H    H   10.844   6.685   2.769 1.00 . A A .  16 SER H    1 1 
        3  3607 1 1  16 SER HA   H   13.272   8.160   2.038 1.00 . A A .  16 SER HA   1 1 
        3  3608 1 1  16 SER HB2  H   13.552   7.658   4.478 1.00 . A A .  16 SER HB2  1 1 
        3  3609 1 1  16 SER HB3  H   13.461   5.925   4.091 1.00 . A A .  16 SER HB3  1 1 
        3  3610 1 1  16 SER HG   H   15.632   6.877   4.165 1.00 . A A .  16 SER HG   1 1 
        3  3611 1 1  16 SER N    N   11.478   7.461   2.876 1.00 . A A .  16 SER N    1 1 
        3  3612 1 1  16 SER O    O   12.123   5.231   1.388 1.00 . A A .  16 SER O    1 1 
        3  3613 1 1  16 SER OG   O   15.101   6.936   3.348 1.00 . A A .  16 SER OG   1 1 
        3  3614 1 1  17 GLY C    C   14.669   3.807  -0.200 1.00 . A A .  17 GLY C    1 1 
        3  3615 1 1  17 GLY CA   C   14.221   5.238  -0.541 1.00 . A A .  17 GLY CA   1 1 
        3  3616 1 1  17 GLY H    H   14.725   6.853   0.765 1.00 . A A .  17 GLY H    1 1 
        3  3617 1 1  17 GLY HA2  H   13.289   5.175  -1.098 1.00 . A A .  17 GLY HA2  1 1 
        3  3618 1 1  17 GLY HA3  H   14.974   5.670  -1.200 1.00 . A A .  17 GLY HA3  1 1 
        3  3619 1 1  17 GLY N    N   14.021   6.144   0.602 1.00 . A A .  17 GLY N    1 1 
        3  3620 1 1  17 GLY O    O   15.097   3.073  -1.093 1.00 . A A .  17 GLY O    1 1 
        3  3621 1 1  18 ARG C    C   14.316   0.909   1.335 1.00 . A A .  18 ARG C    1 1 
        3  3622 1 1  18 ARG CA   C   15.186   2.146   1.601 1.00 . A A .  18 ARG CA   1 1 
        3  3623 1 1  18 ARG CB   C   15.459   2.279   3.113 1.00 . A A .  18 ARG CB   1 1 
        3  3624 1 1  18 ARG CD   C   17.774   3.364   2.861 1.00 . A A .  18 ARG CD   1 1 
        3  3625 1 1  18 ARG CG   C   16.391   3.434   3.521 1.00 . A A .  18 ARG CG   1 1 
        3  3626 1 1  18 ARG CZ   C   19.448   4.412   4.414 1.00 . A A .  18 ARG CZ   1 1 
        3  3627 1 1  18 ARG H    H   14.247   4.072   1.746 1.00 . A A .  18 ARG H    1 1 
        3  3628 1 1  18 ARG HA   H   16.130   1.946   1.093 1.00 . A A .  18 ARG HA   1 1 
        3  3629 1 1  18 ARG HB2  H   14.508   2.410   3.634 1.00 . A A .  18 ARG HB2  1 1 
        3  3630 1 1  18 ARG HB3  H   15.901   1.347   3.472 1.00 . A A .  18 ARG HB3  1 1 
        3  3631 1 1  18 ARG HD2  H   18.221   2.385   3.048 1.00 . A A .  18 ARG HD2  1 1 
        3  3632 1 1  18 ARG HD3  H   17.657   3.477   1.782 1.00 . A A .  18 ARG HD3  1 1 
        3  3633 1 1  18 ARG HE   H   18.667   5.295   2.819 1.00 . A A .  18 ARG HE   1 1 
        3  3634 1 1  18 ARG HG2  H   15.925   4.384   3.263 1.00 . A A .  18 ARG HG2  1 1 
        3  3635 1 1  18 ARG HG3  H   16.513   3.406   4.604 1.00 . A A .  18 ARG HG3  1 1 
        3  3636 1 1  18 ARG HH11 H   18.986   2.554   4.986 1.00 . A A .  18 ARG HH11 1 1 
        3  3637 1 1  18 ARG HH12 H   20.142   3.377   5.995 1.00 . A A .  18 ARG HH12 1 1 
        3  3638 1 1  18 ARG HH21 H   20.143   6.275   4.150 1.00 . A A .  18 ARG HH21 1 1 
        3  3639 1 1  18 ARG HH22 H   20.774   5.426   5.529 1.00 . A A .  18 ARG HH22 1 1 
        3  3640 1 1  18 ARG N    N   14.627   3.413   1.082 1.00 . A A .  18 ARG N    1 1 
        3  3641 1 1  18 ARG NE   N   18.660   4.440   3.352 1.00 . A A .  18 ARG NE   1 1 
        3  3642 1 1  18 ARG NH1  N   19.533   3.369   5.195 1.00 . A A .  18 ARG NH1  1 1 
        3  3643 1 1  18 ARG NH2  N   20.175   5.447   4.720 1.00 . A A .  18 ARG NH2  1 1 
        3  3644 1 1  18 ARG O    O   14.834  -0.208   1.371 1.00 . A A .  18 ARG O    1 1 
        3  3645 1 1  19 ALA C    C   12.290  -0.659  -0.544 1.00 . A A .  19 ALA C    1 1 
        3  3646 1 1  19 ALA CA   C   12.091  -0.027   0.846 1.00 . A A .  19 ALA CA   1 1 
        3  3647 1 1  19 ALA CB   C   10.647   0.445   1.055 1.00 . A A .  19 ALA CB   1 1 
        3  3648 1 1  19 ALA H    H   12.661   2.022   1.040 1.00 . A A .  19 ALA H    1 1 
        3  3649 1 1  19 ALA HA   H   12.291  -0.798   1.595 1.00 . A A .  19 ALA HA   1 1 
        3  3650 1 1  19 ALA HB1  H    9.971  -0.407   0.984 1.00 . A A .  19 ALA HB1  1 1 
        3  3651 1 1  19 ALA HB2  H   10.537   0.896   2.043 1.00 . A A .  19 ALA HB2  1 1 
        3  3652 1 1  19 ALA HB3  H   10.380   1.170   0.288 1.00 . A A .  19 ALA HB3  1 1 
        3  3653 1 1  19 ALA N    N   13.015   1.082   1.085 1.00 . A A .  19 ALA N    1 1 
        3  3654 1 1  19 ALA O    O   12.528   0.036  -1.536 1.00 . A A .  19 ALA O    1 1 
        3  3655 1 1  20 SER C    C   10.881  -3.389  -2.210 1.00 . A A .  20 SER C    1 1 
        3  3656 1 1  20 SER CA   C   12.233  -2.780  -1.845 1.00 . A A .  20 SER CA   1 1 
        3  3657 1 1  20 SER CB   C   13.334  -3.842  -1.738 1.00 . A A .  20 SER CB   1 1 
        3  3658 1 1  20 SER H    H   11.885  -2.470   0.228 1.00 . A A .  20 SER H    1 1 
        3  3659 1 1  20 SER HA   H   12.527  -2.131  -2.664 1.00 . A A .  20 SER HA   1 1 
        3  3660 1 1  20 SER HB2  H   13.389  -4.396  -2.675 1.00 . A A .  20 SER HB2  1 1 
        3  3661 1 1  20 SER HB3  H   14.289  -3.337  -1.580 1.00 . A A .  20 SER HB3  1 1 
        3  3662 1 1  20 SER HG   H   13.910  -5.282  -0.551 1.00 . A A .  20 SER HG   1 1 
        3  3663 1 1  20 SER N    N   12.138  -1.981  -0.616 1.00 . A A .  20 SER N    1 1 
        3  3664 1 1  20 SER O    O   10.145  -3.848  -1.331 1.00 . A A .  20 SER O    1 1 
        3  3665 1 1  20 SER OG   O   13.101  -4.746  -0.664 1.00 . A A .  20 SER OG   1 1 
        3  3666 1 1  21 CYS C    C    9.380  -5.458  -4.129 1.00 . A A .  21 CYS C    1 1 
        3  3667 1 1  21 CYS CA   C    9.302  -3.930  -4.024 1.00 . A A .  21 CYS CA   1 1 
        3  3668 1 1  21 CYS CB   C    9.017  -3.252  -5.362 1.00 . A A .  21 CYS CB   1 1 
        3  3669 1 1  21 CYS H    H   11.239  -3.070  -4.180 1.00 . A A .  21 CYS H    1 1 
        3  3670 1 1  21 CYS HA   H    8.497  -3.666  -3.339 1.00 . A A .  21 CYS HA   1 1 
        3  3671 1 1  21 CYS HB2  H    9.067  -2.169  -5.232 1.00 . A A .  21 CYS HB2  1 1 
        3  3672 1 1  21 CYS HB3  H    9.783  -3.552  -6.082 1.00 . A A .  21 CYS HB3  1 1 
        3  3673 1 1  21 CYS N    N   10.552  -3.392  -3.502 1.00 . A A .  21 CYS N    1 1 
        3  3674 1 1  21 CYS O    O   10.165  -6.016  -4.903 1.00 . A A .  21 CYS O    1 1 
        3  3675 1 1  21 CYS SG   S    7.360  -3.720  -5.979 1.00 . A A .  21 CYS SG   1 1 
        3  3676 1 1  22 LYS C    C    7.916  -8.332  -4.422 1.00 . A A .  22 LYS C    1 1 
        3  3677 1 1  22 LYS CA   C    8.565  -7.623  -3.222 1.00 . A A .  22 LYS CA   1 1 
        3  3678 1 1  22 LYS CB   C    7.888  -8.038  -1.902 1.00 . A A .  22 LYS CB   1 1 
        3  3679 1 1  22 LYS CD   C    9.753  -7.836  -0.199 1.00 . A A .  22 LYS CD   1 1 
        3  3680 1 1  22 LYS CE   C   10.238  -7.068   1.029 1.00 . A A .  22 LYS CE   1 1 
        3  3681 1 1  22 LYS CG   C    8.392  -7.309  -0.656 1.00 . A A .  22 LYS CG   1 1 
        3  3682 1 1  22 LYS H    H    7.963  -5.613  -2.710 1.00 . A A .  22 LYS H    1 1 
        3  3683 1 1  22 LYS HA   H    9.604  -7.957  -3.207 1.00 . A A .  22 LYS HA   1 1 
        3  3684 1 1  22 LYS HB2  H    6.828  -7.830  -1.980 1.00 . A A .  22 LYS HB2  1 1 
        3  3685 1 1  22 LYS HB3  H    8.009  -9.109  -1.740 1.00 . A A .  22 LYS HB3  1 1 
        3  3686 1 1  22 LYS HD2  H    9.634  -8.884   0.087 1.00 . A A .  22 LYS HD2  1 1 
        3  3687 1 1  22 LYS HD3  H   10.482  -7.763  -1.007 1.00 . A A .  22 LYS HD3  1 1 
        3  3688 1 1  22 LYS HE2  H    9.394  -6.994   1.719 1.00 . A A .  22 LYS HE2  1 1 
        3  3689 1 1  22 LYS HE3  H   11.020  -7.656   1.514 1.00 . A A .  22 LYS HE3  1 1 
        3  3690 1 1  22 LYS HG2  H    8.444  -6.243  -0.851 1.00 . A A .  22 LYS HG2  1 1 
        3  3691 1 1  22 LYS HG3  H    7.664  -7.455   0.139 1.00 . A A .  22 LYS HG3  1 1 
        3  3692 1 1  22 LYS HZ1  H   11.619  -5.770   0.143 1.00 . A A .  22 LYS HZ1  1 1 
        3  3693 1 1  22 LYS HZ2  H   10.117  -5.176   0.116 1.00 . A A .  22 LYS HZ2  1 1 
        3  3694 1 1  22 LYS HZ3  H   10.986  -5.189   1.519 1.00 . A A .  22 LYS HZ3  1 1 
        3  3695 1 1  22 LYS N    N    8.554  -6.150  -3.341 1.00 . A A .  22 LYS N    1 1 
        3  3696 1 1  22 LYS NZ   N   10.761  -5.719   0.688 1.00 . A A .  22 LYS NZ   1 1 
        3  3697 1 1  22 LYS O    O    7.944  -9.562  -4.501 1.00 . A A .  22 LYS O    1 1 
        3  3698 1 1  23 LYS C    C    7.359  -7.912  -7.820 1.00 . A A .  23 LYS C    1 1 
        3  3699 1 1  23 LYS CA   C    6.562  -8.027  -6.514 1.00 . A A .  23 LYS CA   1 1 
        3  3700 1 1  23 LYS CB   C    5.229  -7.260  -6.551 1.00 . A A .  23 LYS CB   1 1 
        3  3701 1 1  23 LYS CD   C    3.941  -8.908  -8.117 1.00 . A A .  23 LYS CD   1 1 
        3  3702 1 1  23 LYS CE   C    3.100  -9.542  -7.001 1.00 . A A .  23 LYS CE   1 1 
        3  3703 1 1  23 LYS CG   C    4.370  -7.463  -7.809 1.00 . A A .  23 LYS CG   1 1 
        3  3704 1 1  23 LYS H    H    7.385  -6.564  -5.179 1.00 . A A .  23 LYS H    1 1 
        3  3705 1 1  23 LYS HA   H    6.334  -9.088  -6.391 1.00 . A A .  23 LYS HA   1 1 
        3  3706 1 1  23 LYS HB2  H    4.639  -7.534  -5.676 1.00 . A A .  23 LYS HB2  1 1 
        3  3707 1 1  23 LYS HB3  H    5.453  -6.197  -6.474 1.00 . A A .  23 LYS HB3  1 1 
        3  3708 1 1  23 LYS HD2  H    3.355  -8.899  -9.036 1.00 . A A .  23 LYS HD2  1 1 
        3  3709 1 1  23 LYS HD3  H    4.826  -9.521  -8.293 1.00 . A A .  23 LYS HD3  1 1 
        3  3710 1 1  23 LYS HE2  H    3.709  -9.600  -6.093 1.00 . A A .  23 LYS HE2  1 1 
        3  3711 1 1  23 LYS HE3  H    2.243  -8.892  -6.793 1.00 . A A .  23 LYS HE3  1 1 
        3  3712 1 1  23 LYS HG2  H    3.479  -6.851  -7.688 1.00 . A A .  23 LYS HG2  1 1 
        3  3713 1 1  23 LYS HG3  H    4.907  -7.072  -8.674 1.00 . A A .  23 LYS HG3  1 1 
        3  3714 1 1  23 LYS HZ1  H    3.407 -11.490  -7.669 1.00 . A A .  23 LYS HZ1  1 1 
        3  3715 1 1  23 LYS HZ2  H    2.170 -11.369  -6.621 1.00 . A A .  23 LYS HZ2  1 1 
        3  3716 1 1  23 LYS HZ3  H    1.977 -10.863  -8.159 1.00 . A A .  23 LYS HZ3  1 1 
        3  3717 1 1  23 LYS N    N    7.322  -7.561  -5.342 1.00 . A A .  23 LYS N    1 1 
        3  3718 1 1  23 LYS NZ   N    2.633 -10.901  -7.389 1.00 . A A .  23 LYS NZ   1 1 
        3  3719 1 1  23 LYS O    O    7.494  -8.918  -8.518 1.00 . A A .  23 LYS O    1 1 
        3  3720 1 1  24 CYS C    C   10.191  -6.423  -9.178 1.00 . A A .  24 CYS C    1 1 
        3  3721 1 1  24 CYS CA   C    8.652  -6.473  -9.372 1.00 . A A .  24 CYS CA   1 1 
        3  3722 1 1  24 CYS CB   C    8.036  -5.283 -10.132 1.00 . A A .  24 CYS CB   1 1 
        3  3723 1 1  24 CYS H    H    7.742  -5.950  -7.509 1.00 . A A .  24 CYS H    1 1 
        3  3724 1 1  24 CYS HA   H    8.491  -7.330 -10.028 1.00 . A A .  24 CYS HA   1 1 
        3  3725 1 1  24 CYS HB2  H    8.406  -5.329 -11.159 1.00 . A A .  24 CYS HB2  1 1 
        3  3726 1 1  24 CYS HB3  H    6.950  -5.397 -10.172 1.00 . A A .  24 CYS HB3  1 1 
        3  3727 1 1  24 CYS N    N    7.894  -6.727  -8.135 1.00 . A A .  24 CYS N    1 1 
        3  3728 1 1  24 CYS O    O   10.942  -6.275 -10.147 1.00 . A A .  24 CYS O    1 1 
        3  3729 1 1  24 CYS SG   S    8.489  -3.649  -9.435 1.00 . A A .  24 CYS SG   1 1 
        3  3730 1 1  25 SER C    C   12.884  -5.383  -7.785 1.00 . A A .  25 SER C    1 1 
        3  3731 1 1  25 SER CA   C   12.081  -6.674  -7.530 1.00 . A A .  25 SER CA   1 1 
        3  3732 1 1  25 SER CB   C   12.785  -7.929  -8.073 1.00 . A A .  25 SER CB   1 1 
        3  3733 1 1  25 SER H    H    9.982  -6.741  -7.203 1.00 . A A .  25 SER H    1 1 
        3  3734 1 1  25 SER HA   H   12.069  -6.784  -6.445 1.00 . A A .  25 SER HA   1 1 
        3  3735 1 1  25 SER HB2  H   12.849  -7.869  -9.161 1.00 . A A .  25 SER HB2  1 1 
        3  3736 1 1  25 SER HB3  H   13.797  -7.975  -7.669 1.00 . A A .  25 SER HB3  1 1 
        3  3737 1 1  25 SER HG   H   12.569  -9.879  -8.061 1.00 . A A .  25 SER HG   1 1 
        3  3738 1 1  25 SER N    N   10.662  -6.623  -7.939 1.00 . A A .  25 SER N    1 1 
        3  3739 1 1  25 SER O    O   14.117  -5.395  -7.803 1.00 . A A .  25 SER O    1 1 
        3  3740 1 1  25 SER OG   O   12.087  -9.110  -7.699 1.00 . A A .  25 SER OG   1 1 
        3  3741 1 1  26 GLU C    C   12.843  -2.358  -6.491 1.00 . A A .  26 GLU C    1 1 
        3  3742 1 1  26 GLU CA   C   12.759  -2.899  -7.938 1.00 . A A .  26 GLU CA   1 1 
        3  3743 1 1  26 GLU CB   C   11.894  -1.991  -8.834 1.00 . A A .  26 GLU CB   1 1 
        3  3744 1 1  26 GLU CD   C   11.139  -1.428 -11.244 1.00 . A A .  26 GLU CD   1 1 
        3  3745 1 1  26 GLU CG   C   11.968  -2.359 -10.326 1.00 . A A .  26 GLU CG   1 1 
        3  3746 1 1  26 GLU H    H   11.186  -4.327  -7.921 1.00 . A A .  26 GLU H    1 1 
        3  3747 1 1  26 GLU HA   H   13.773  -2.911  -8.341 1.00 . A A .  26 GLU HA   1 1 
        3  3748 1 1  26 GLU HB2  H   10.863  -2.061  -8.493 1.00 . A A .  26 GLU HB2  1 1 
        3  3749 1 1  26 GLU HB3  H   12.221  -0.960  -8.725 1.00 . A A .  26 GLU HB3  1 1 
        3  3750 1 1  26 GLU HG2  H   13.015  -2.322 -10.635 1.00 . A A .  26 GLU HG2  1 1 
        3  3751 1 1  26 GLU HG3  H   11.621  -3.386 -10.461 1.00 . A A .  26 GLU HG3  1 1 
        3  3752 1 1  26 GLU N    N   12.193  -4.254  -7.952 1.00 . A A .  26 GLU N    1 1 
        3  3753 1 1  26 GLU O    O   12.489  -3.052  -5.534 1.00 . A A .  26 GLU O    1 1 
        3  3754 1 1  26 GLU OE1  O   10.477  -0.474 -10.764 1.00 . A A .  26 GLU OE1  1 1 
        3  3755 1 1  26 GLU OE2  O   11.175  -1.634 -12.483 1.00 . A A .  26 GLU OE2  1 1 
        3  3756 1 1  27 SER C    C   12.462   0.936  -5.140 1.00 . A A .  27 SER C    1 1 
        3  3757 1 1  27 SER CA   C   13.226  -0.388  -5.028 1.00 . A A .  27 SER CA   1 1 
        3  3758 1 1  27 SER CB   C   14.613  -0.223  -4.404 1.00 . A A .  27 SER CB   1 1 
        3  3759 1 1  27 SER H    H   13.547  -0.572  -7.124 1.00 . A A .  27 SER H    1 1 
        3  3760 1 1  27 SER HA   H   12.647  -0.981  -4.329 1.00 . A A .  27 SER HA   1 1 
        3  3761 1 1  27 SER HB2  H   15.274   0.287  -5.103 1.00 . A A .  27 SER HB2  1 1 
        3  3762 1 1  27 SER HB3  H   14.517   0.369  -3.493 1.00 . A A .  27 SER HB3  1 1 
        3  3763 1 1  27 SER HG   H   16.068  -1.350  -3.727 1.00 . A A .  27 SER HG   1 1 
        3  3764 1 1  27 SER N    N   13.277  -1.107  -6.313 1.00 . A A .  27 SER N    1 1 
        3  3765 1 1  27 SER O    O   12.293   1.489  -6.230 1.00 . A A .  27 SER O    1 1 
        3  3766 1 1  27 SER OG   O   15.163  -1.488  -4.067 1.00 . A A .  27 SER OG   1 1 
        3  3767 1 1  28 ILE C    C   11.257   3.695  -3.429 1.00 . A A .  28 ILE C    1 1 
        3  3768 1 1  28 ILE CA   C   10.774   2.330  -3.971 1.00 . A A .  28 ILE CA   1 1 
        3  3769 1 1  28 ILE CB   C    9.615   1.740  -3.131 1.00 . A A .  28 ILE CB   1 1 
        3  3770 1 1  28 ILE CD1  C    8.299  -0.392  -2.522 1.00 . A A .  28 ILE CD1  1 1 
        3  3771 1 1  28 ILE CG1  C    9.217   0.297  -3.540 1.00 . A A .  28 ILE CG1  1 1 
        3  3772 1 1  28 ILE CG2  C    8.391   2.666  -3.262 1.00 . A A .  28 ILE CG2  1 1 
        3  3773 1 1  28 ILE H    H   12.131   0.911  -3.147 1.00 . A A .  28 ILE H    1 1 
        3  3774 1 1  28 ILE HA   H   10.387   2.449  -4.980 1.00 . A A .  28 ILE HA   1 1 
        3  3775 1 1  28 ILE HB   H    9.929   1.703  -2.086 1.00 . A A .  28 ILE HB   1 1 
        3  3776 1 1  28 ILE HD11 H    8.763  -0.379  -1.535 1.00 . A A .  28 ILE HD11 1 1 
        3  3777 1 1  28 ILE HD12 H    7.327   0.096  -2.476 1.00 . A A .  28 ILE HD12 1 1 
        3  3778 1 1  28 ILE HD13 H    8.150  -1.428  -2.820 1.00 . A A .  28 ILE HD13 1 1 
        3  3779 1 1  28 ILE HG12 H    8.729   0.312  -4.516 1.00 . A A .  28 ILE HG12 1 1 
        3  3780 1 1  28 ILE HG13 H   10.104  -0.330  -3.619 1.00 . A A .  28 ILE HG13 1 1 
        3  3781 1 1  28 ILE HG21 H    7.569   2.271  -2.675 1.00 . A A .  28 ILE HG21 1 1 
        3  3782 1 1  28 ILE HG22 H    8.615   3.673  -2.904 1.00 . A A .  28 ILE HG22 1 1 
        3  3783 1 1  28 ILE HG23 H    8.070   2.732  -4.303 1.00 . A A .  28 ILE HG23 1 1 
        3  3784 1 1  28 ILE N    N   11.894   1.381  -4.016 1.00 . A A .  28 ILE N    1 1 
        3  3785 1 1  28 ILE O    O   11.553   3.791  -2.233 1.00 . A A .  28 ILE O    1 1 
        3  3786 1 1  29 PRO C    C   10.895   6.833  -2.927 1.00 . A A .  29 PRO C    1 1 
        3  3787 1 1  29 PRO CA   C   11.848   6.076  -3.869 1.00 . A A .  29 PRO CA   1 1 
        3  3788 1 1  29 PRO CB   C   12.043   6.842  -5.182 1.00 . A A .  29 PRO CB   1 1 
        3  3789 1 1  29 PRO CD   C   10.976   4.774  -5.674 1.00 . A A .  29 PRO CD   1 1 
        3  3790 1 1  29 PRO CG   C   10.966   6.244  -6.085 1.00 . A A .  29 PRO CG   1 1 
        3  3791 1 1  29 PRO HA   H   12.815   5.974  -3.373 1.00 . A A .  29 PRO HA   1 1 
        3  3792 1 1  29 PRO HB2  H   11.921   7.919  -5.062 1.00 . A A .  29 PRO HB2  1 1 
        3  3793 1 1  29 PRO HB3  H   13.025   6.617  -5.596 1.00 . A A .  29 PRO HB3  1 1 
        3  3794 1 1  29 PRO HD2  H    9.986   4.346  -5.837 1.00 . A A .  29 PRO HD2  1 1 
        3  3795 1 1  29 PRO HD3  H   11.725   4.233  -6.254 1.00 . A A .  29 PRO HD3  1 1 
        3  3796 1 1  29 PRO HG2  H    9.994   6.681  -5.850 1.00 . A A .  29 PRO HG2  1 1 
        3  3797 1 1  29 PRO HG3  H   11.200   6.374  -7.141 1.00 . A A .  29 PRO HG3  1 1 
        3  3798 1 1  29 PRO N    N   11.348   4.753  -4.263 1.00 . A A .  29 PRO N    1 1 
        3  3799 1 1  29 PRO O    O    9.686   6.578  -2.909 1.00 . A A .  29 PRO O    1 1 
        3  3800 1 1  30 LYS C    C    9.800   9.705  -2.146 1.00 . A A .  30 LYS C    1 1 
        3  3801 1 1  30 LYS CA   C   10.643   8.718  -1.327 1.00 . A A .  30 LYS CA   1 1 
        3  3802 1 1  30 LYS CB   C   11.517   9.398  -0.260 1.00 . A A .  30 LYS CB   1 1 
        3  3803 1 1  30 LYS CD   C   12.974  11.322   0.508 1.00 . A A .  30 LYS CD   1 1 
        3  3804 1 1  30 LYS CE   C   11.925  12.139   1.283 1.00 . A A .  30 LYS CE   1 1 
        3  3805 1 1  30 LYS CG   C   12.345  10.616  -0.708 1.00 . A A .  30 LYS CG   1 1 
        3  3806 1 1  30 LYS H    H   12.431   7.960  -2.248 1.00 . A A .  30 LYS H    1 1 
        3  3807 1 1  30 LYS HA   H    9.936   8.102  -0.778 1.00 . A A .  30 LYS HA   1 1 
        3  3808 1 1  30 LYS HB2  H   10.859   9.708   0.548 1.00 . A A .  30 LYS HB2  1 1 
        3  3809 1 1  30 LYS HB3  H   12.197   8.653   0.147 1.00 . A A .  30 LYS HB3  1 1 
        3  3810 1 1  30 LYS HD2  H   13.429  10.571   1.158 1.00 . A A .  30 LYS HD2  1 1 
        3  3811 1 1  30 LYS HD3  H   13.759  11.997   0.165 1.00 . A A .  30 LYS HD3  1 1 
        3  3812 1 1  30 LYS HE2  H   11.822  13.119   0.808 1.00 . A A .  30 LYS HE2  1 1 
        3  3813 1 1  30 LYS HE3  H   10.957  11.638   1.215 1.00 . A A .  30 LYS HE3  1 1 
        3  3814 1 1  30 LYS HG2  H   13.136  10.281  -1.376 1.00 . A A .  30 LYS HG2  1 1 
        3  3815 1 1  30 LYS HG3  H   11.718  11.331  -1.244 1.00 . A A .  30 LYS HG3  1 1 
        3  3816 1 1  30 LYS HZ1  H   11.595  12.849   3.207 1.00 . A A .  30 LYS HZ1  1 1 
        3  3817 1 1  30 LYS HZ2  H   12.320  11.392   3.178 1.00 . A A .  30 LYS HZ2  1 1 
        3  3818 1 1  30 LYS HZ3  H   13.178  12.763   2.853 1.00 . A A .  30 LYS HZ3  1 1 
        3  3819 1 1  30 LYS N    N   11.431   7.799  -2.168 1.00 . A A .  30 LYS N    1 1 
        3  3820 1 1  30 LYS NZ   N   12.280  12.295   2.715 1.00 . A A .  30 LYS NZ   1 1 
        3  3821 1 1  30 LYS O    O   10.036   9.902  -3.339 1.00 . A A .  30 LYS O    1 1 
        3  3822 1 1  31 ASP C    C    7.068  10.636  -3.301 1.00 . A A .  31 ASP C    1 1 
        3  3823 1 1  31 ASP CA   C    7.844  11.254  -2.108 1.00 . A A .  31 ASP CA   1 1 
        3  3824 1 1  31 ASP CB   C    8.512  12.614  -2.392 1.00 . A A .  31 ASP CB   1 1 
        3  3825 1 1  31 ASP CG   C    7.503  13.732  -2.717 1.00 . A A .  31 ASP CG   1 1 
        3  3826 1 1  31 ASP H    H    8.704  10.117  -0.507 1.00 . A A .  31 ASP H    1 1 
        3  3827 1 1  31 ASP HA   H    7.088  11.435  -1.343 1.00 . A A .  31 ASP HA   1 1 
        3  3828 1 1  31 ASP HB2  H    9.081  12.915  -1.510 1.00 . A A .  31 ASP HB2  1 1 
        3  3829 1 1  31 ASP HB3  H    9.218  12.501  -3.217 1.00 . A A .  31 ASP HB3  1 1 
        3  3830 1 1  31 ASP N    N    8.816  10.329  -1.494 1.00 . A A .  31 ASP N    1 1 
        3  3831 1 1  31 ASP O    O    6.749  11.298  -4.291 1.00 . A A .  31 ASP O    1 1 
        3  3832 1 1  31 ASP OD1  O    6.479  13.859  -2.001 1.00 . A A .  31 ASP OD1  1 1 
        3  3833 1 1  31 ASP OD2  O    7.758  14.528  -3.654 1.00 . A A .  31 ASP OD2  1 1 
        3  3834 1 1  32 SER C    C    4.985   7.651  -3.304 1.00 . A A .  32 SER C    1 1 
        3  3835 1 1  32 SER CA   C    5.951   8.533  -4.109 1.00 . A A .  32 SER CA   1 1 
        3  3836 1 1  32 SER CB   C    6.859   7.692  -5.012 1.00 . A A .  32 SER CB   1 1 
        3  3837 1 1  32 SER H    H    7.066   8.871  -2.346 1.00 . A A .  32 SER H    1 1 
        3  3838 1 1  32 SER HA   H    5.357   9.194  -4.741 1.00 . A A .  32 SER HA   1 1 
        3  3839 1 1  32 SER HB2  H    7.624   8.336  -5.451 1.00 . A A .  32 SER HB2  1 1 
        3  3840 1 1  32 SER HB3  H    7.347   6.914  -4.422 1.00 . A A .  32 SER HB3  1 1 
        3  3841 1 1  32 SER HG   H    6.704   6.631  -6.655 1.00 . A A .  32 SER HG   1 1 
        3  3842 1 1  32 SER N    N    6.772   9.337  -3.192 1.00 . A A .  32 SER N    1 1 
        3  3843 1 1  32 SER O    O    5.157   7.497  -2.094 1.00 . A A .  32 SER O    1 1 
        3  3844 1 1  32 SER OG   O    6.097   7.104  -6.055 1.00 . A A .  32 SER OG   1 1 
        3  3845 1 1  33 LEU C    C    3.285   4.815  -3.223 1.00 . A A .  33 LEU C    1 1 
        3  3846 1 1  33 LEU CA   C    2.914   6.306  -3.257 1.00 . A A .  33 LEU CA   1 1 
        3  3847 1 1  33 LEU CB   C    1.558   6.573  -3.934 1.00 . A A .  33 LEU CB   1 1 
        3  3848 1 1  33 LEU CD1  C    0.022   6.604  -1.885 1.00 . A A .  33 LEU CD1  1 1 
        3  3849 1 1  33 LEU CD2  C   -0.879   5.984  -4.071 1.00 . A A .  33 LEU CD2  1 1 
        3  3850 1 1  33 LEU CG   C    0.372   5.918  -3.203 1.00 . A A .  33 LEU CG   1 1 
        3  3851 1 1  33 LEU H    H    3.955   7.104  -4.943 1.00 . A A .  33 LEU H    1 1 
        3  3852 1 1  33 LEU HA   H    2.843   6.658  -2.227 1.00 . A A .  33 LEU HA   1 1 
        3  3853 1 1  33 LEU HB2  H    1.388   7.649  -3.991 1.00 . A A .  33 LEU HB2  1 1 
        3  3854 1 1  33 LEU HB3  H    1.604   6.184  -4.952 1.00 . A A .  33 LEU HB3  1 1 
        3  3855 1 1  33 LEU HD11 H    0.855   6.542  -1.193 1.00 . A A .  33 LEU HD11 1 1 
        3  3856 1 1  33 LEU HD12 H   -0.221   7.651  -2.061 1.00 . A A .  33 LEU HD12 1 1 
        3  3857 1 1  33 LEU HD13 H   -0.839   6.112  -1.435 1.00 . A A .  33 LEU HD13 1 1 
        3  3858 1 1  33 LEU HD21 H   -1.164   7.027  -4.216 1.00 . A A .  33 LEU HD21 1 1 
        3  3859 1 1  33 LEU HD22 H   -0.681   5.513  -5.033 1.00 . A A .  33 LEU HD22 1 1 
        3  3860 1 1  33 LEU HD23 H   -1.690   5.449  -3.576 1.00 . A A .  33 LEU HD23 1 1 
        3  3861 1 1  33 LEU HG   H    0.605   4.876  -3.006 1.00 . A A .  33 LEU HG   1 1 
        3  3862 1 1  33 LEU N    N    3.955   7.084  -3.935 1.00 . A A .  33 LEU N    1 1 
        3  3863 1 1  33 LEU O    O    3.586   4.212  -4.259 1.00 . A A .  33 LEU O    1 1 
        3  3864 1 1  34 ARG C    C    2.646   2.163  -0.761 1.00 . A A .  34 ARG C    1 1 
        3  3865 1 1  34 ARG CA   C    3.568   2.800  -1.790 1.00 . A A .  34 ARG CA   1 1 
        3  3866 1 1  34 ARG CB   C    5.060   2.669  -1.435 1.00 . A A .  34 ARG CB   1 1 
        3  3867 1 1  34 ARG CD   C    7.021   3.034   0.070 1.00 . A A .  34 ARG CD   1 1 
        3  3868 1 1  34 ARG CG   C    5.504   3.239  -0.076 1.00 . A A .  34 ARG CG   1 1 
        3  3869 1 1  34 ARG CZ   C    8.806   3.858   1.622 1.00 . A A .  34 ARG CZ   1 1 
        3  3870 1 1  34 ARG H    H    2.905   4.748  -1.236 1.00 . A A .  34 ARG H    1 1 
        3  3871 1 1  34 ARG HA   H    3.412   2.242  -2.714 1.00 . A A .  34 ARG HA   1 1 
        3  3872 1 1  34 ARG HB2  H    5.331   1.614  -1.465 1.00 . A A .  34 ARG HB2  1 1 
        3  3873 1 1  34 ARG HB3  H    5.620   3.179  -2.219 1.00 . A A .  34 ARG HB3  1 1 
        3  3874 1 1  34 ARG HD2  H    7.244   1.966   0.013 1.00 . A A .  34 ARG HD2  1 1 
        3  3875 1 1  34 ARG HD3  H    7.513   3.539  -0.760 1.00 . A A .  34 ARG HD3  1 1 
        3  3876 1 1  34 ARG HE   H    6.900   3.736   2.099 1.00 . A A .  34 ARG HE   1 1 
        3  3877 1 1  34 ARG HG2  H    5.272   4.303  -0.029 1.00 . A A .  34 ARG HG2  1 1 
        3  3878 1 1  34 ARG HG3  H    4.987   2.722   0.734 1.00 . A A .  34 ARG HG3  1 1 
        3  3879 1 1  34 ARG HH11 H    9.590   3.486  -0.183 1.00 . A A .  34 ARG HH11 1 1 
        3  3880 1 1  34 ARG HH12 H   10.690   4.157   0.989 1.00 . A A .  34 ARG HH12 1 1 
        3  3881 1 1  34 ARG HH21 H    8.297   4.385   3.454 1.00 . A A .  34 ARG HH21 1 1 
        3  3882 1 1  34 ARG HH22 H   10.040   4.346   3.126 1.00 . A A .  34 ARG HH22 1 1 
        3  3883 1 1  34 ARG N    N    3.227   4.208  -2.034 1.00 . A A .  34 ARG N    1 1 
        3  3884 1 1  34 ARG NE   N    7.551   3.565   1.336 1.00 . A A .  34 ARG NE   1 1 
        3  3885 1 1  34 ARG NH1  N    9.779   3.771   0.761 1.00 . A A .  34 ARG NH1  1 1 
        3  3886 1 1  34 ARG NH2  N    9.089   4.287   2.812 1.00 . A A .  34 ARG NH2  1 1 
        3  3887 1 1  34 ARG O    O    1.984   2.853   0.011 1.00 . A A .  34 ARG O    1 1 
        3  3888 1 1  35 MET C    C    2.618  -1.129   0.696 1.00 . A A .  35 MET C    1 1 
        3  3889 1 1  35 MET CA   C    1.784  -0.003   0.091 1.00 . A A .  35 MET CA   1 1 
        3  3890 1 1  35 MET CB   C    0.576  -0.551  -0.686 1.00 . A A .  35 MET CB   1 1 
        3  3891 1 1  35 MET CE   C   -2.859  -0.759  -0.467 1.00 . A A .  35 MET CE   1 1 
        3  3892 1 1  35 MET CG   C   -0.456   0.538  -0.987 1.00 . A A .  35 MET CG   1 1 
        3  3893 1 1  35 MET H    H    3.231   0.357  -1.408 1.00 . A A .  35 MET H    1 1 
        3  3894 1 1  35 MET HA   H    1.436   0.588   0.933 1.00 . A A .  35 MET HA   1 1 
        3  3895 1 1  35 MET HB2  H    0.923  -0.988  -1.621 1.00 . A A .  35 MET HB2  1 1 
        3  3896 1 1  35 MET HB3  H    0.090  -1.323  -0.091 1.00 . A A .  35 MET HB3  1 1 
        3  3897 1 1  35 MET HE1  H   -3.078  -0.004   0.292 1.00 . A A .  35 MET HE1  1 1 
        3  3898 1 1  35 MET HE2  H   -3.800  -1.179  -0.828 1.00 . A A .  35 MET HE2  1 1 
        3  3899 1 1  35 MET HE3  H   -2.251  -1.552  -0.030 1.00 . A A .  35 MET HE3  1 1 
        3  3900 1 1  35 MET HG2  H   -0.756   0.980  -0.040 1.00 . A A .  35 MET HG2  1 1 
        3  3901 1 1  35 MET HG3  H    0.020   1.309  -1.594 1.00 . A A .  35 MET HG3  1 1 
        3  3902 1 1  35 MET N    N    2.605   0.838  -0.774 1.00 . A A .  35 MET N    1 1 
        3  3903 1 1  35 MET O    O    3.700  -1.435   0.207 1.00 . A A .  35 MET O    1 1 
        3  3904 1 1  35 MET SD   S   -1.960   0.001  -1.848 1.00 . A A .  35 MET SD   1 1 
        3  3905 1 1  36 ALA C    C    1.771  -3.898   2.931 1.00 . A A .  36 ALA C    1 1 
        3  3906 1 1  36 ALA CA   C    2.788  -2.864   2.427 1.00 . A A .  36 ALA CA   1 1 
        3  3907 1 1  36 ALA CB   C    3.737  -2.370   3.533 1.00 . A A .  36 ALA CB   1 1 
        3  3908 1 1  36 ALA H    H    1.217  -1.448   2.112 1.00 . A A .  36 ALA H    1 1 
        3  3909 1 1  36 ALA HA   H    3.394  -3.358   1.677 1.00 . A A .  36 ALA HA   1 1 
        3  3910 1 1  36 ALA HB1  H    3.749  -1.279   3.557 1.00 . A A .  36 ALA HB1  1 1 
        3  3911 1 1  36 ALA HB2  H    3.424  -2.744   4.509 1.00 . A A .  36 ALA HB2  1 1 
        3  3912 1 1  36 ALA HB3  H    4.747  -2.726   3.338 1.00 . A A .  36 ALA HB3  1 1 
        3  3913 1 1  36 ALA N    N    2.135  -1.728   1.781 1.00 . A A .  36 ALA N    1 1 
        3  3914 1 1  36 ALA O    O    0.581  -3.593   3.059 1.00 . A A .  36 ALA O    1 1 
        3  3915 1 1  37 ILE C    C    2.022  -6.741   5.074 1.00 . A A .  37 ILE C    1 1 
        3  3916 1 1  37 ILE CA   C    1.423  -6.203   3.784 1.00 . A A .  37 ILE CA   1 1 
        3  3917 1 1  37 ILE CB   C    1.219  -7.296   2.713 1.00 . A A .  37 ILE CB   1 1 
        3  3918 1 1  37 ILE CD1  C   -0.319  -7.750   0.704 1.00 . A A .  37 ILE CD1  1 1 
        3  3919 1 1  37 ILE CG1  C   -0.137  -7.034   2.042 1.00 . A A .  37 ILE CG1  1 1 
        3  3920 1 1  37 ILE CG2  C    1.290  -8.736   3.240 1.00 . A A .  37 ILE CG2  1 1 
        3  3921 1 1  37 ILE H    H    3.222  -5.309   3.062 1.00 . A A .  37 ILE H    1 1 
        3  3922 1 1  37 ILE HA   H    0.447  -5.803   4.054 1.00 . A A .  37 ILE HA   1 1 
        3  3923 1 1  37 ILE HB   H    2.013  -7.202   1.977 1.00 . A A .  37 ILE HB   1 1 
        3  3924 1 1  37 ILE HD11 H    0.478  -7.455   0.025 1.00 . A A .  37 ILE HD11 1 1 
        3  3925 1 1  37 ILE HD12 H   -0.291  -8.829   0.846 1.00 . A A .  37 ILE HD12 1 1 
        3  3926 1 1  37 ILE HD13 H   -1.278  -7.467   0.273 1.00 . A A .  37 ILE HD13 1 1 
        3  3927 1 1  37 ILE HG12 H   -0.936  -7.327   2.727 1.00 . A A .  37 ILE HG12 1 1 
        3  3928 1 1  37 ILE HG13 H   -0.228  -5.966   1.858 1.00 . A A .  37 ILE HG13 1 1 
        3  3929 1 1  37 ILE HG21 H    0.507  -8.908   3.980 1.00 . A A .  37 ILE HG21 1 1 
        3  3930 1 1  37 ILE HG22 H    1.181  -9.425   2.405 1.00 . A A .  37 ILE HG22 1 1 
        3  3931 1 1  37 ILE HG23 H    2.270  -8.913   3.685 1.00 . A A .  37 ILE HG23 1 1 
        3  3932 1 1  37 ILE N    N    2.240  -5.111   3.238 1.00 . A A .  37 ILE N    1 1 
        3  3933 1 1  37 ILE O    O    3.235  -6.889   5.177 1.00 . A A .  37 ILE O    1 1 
        3  3934 1 1  38 MET C    C    1.614  -9.073   7.379 1.00 . A A .  38 MET C    1 1 
        3  3935 1 1  38 MET CA   C    1.580  -7.542   7.355 1.00 . A A .  38 MET CA   1 1 
        3  3936 1 1  38 MET CB   C    0.629  -6.956   8.415 1.00 . A A .  38 MET CB   1 1 
        3  3937 1 1  38 MET CE   C    3.149  -4.952   8.675 1.00 . A A .  38 MET CE   1 1 
        3  3938 1 1  38 MET CG   C    0.458  -5.427   8.384 1.00 . A A .  38 MET CG   1 1 
        3  3939 1 1  38 MET H    H    0.174  -6.933   5.876 1.00 . A A .  38 MET H    1 1 
        3  3940 1 1  38 MET HA   H    2.590  -7.202   7.554 1.00 . A A .  38 MET HA   1 1 
        3  3941 1 1  38 MET HB2  H   -0.351  -7.397   8.252 1.00 . A A .  38 MET HB2  1 1 
        3  3942 1 1  38 MET HB3  H    0.966  -7.247   9.408 1.00 . A A .  38 MET HB3  1 1 
        3  3943 1 1  38 MET HE1  H    3.935  -4.261   8.972 1.00 . A A .  38 MET HE1  1 1 
        3  3944 1 1  38 MET HE2  H    3.407  -5.957   9.006 1.00 . A A .  38 MET HE2  1 1 
        3  3945 1 1  38 MET HE3  H    3.034  -4.955   7.589 1.00 . A A .  38 MET HE3  1 1 
        3  3946 1 1  38 MET HG2  H    0.529  -5.052   7.365 1.00 . A A .  38 MET HG2  1 1 
        3  3947 1 1  38 MET HG3  H   -0.553  -5.210   8.716 1.00 . A A .  38 MET HG3  1 1 
        3  3948 1 1  38 MET N    N    1.170  -7.063   6.042 1.00 . A A .  38 MET N    1 1 
        3  3949 1 1  38 MET O    O    0.574  -9.721   7.506 1.00 . A A .  38 MET O    1 1 
        3  3950 1 1  38 MET SD   S    1.585  -4.470   9.433 1.00 . A A .  38 MET SD   1 1 
        3  3951 1 1  39 VAL C    C    3.631 -11.469   8.783 1.00 . A A .  39 VAL C    1 1 
        3  3952 1 1  39 VAL CA   C    3.031 -11.110   7.425 1.00 . A A .  39 VAL CA   1 1 
        3  3953 1 1  39 VAL CB   C    3.836 -11.682   6.243 1.00 . A A .  39 VAL CB   1 1 
        3  3954 1 1  39 VAL CG1  C    5.221 -11.054   6.094 1.00 . A A .  39 VAL CG1  1 1 
        3  3955 1 1  39 VAL CG2  C    3.990 -13.206   6.323 1.00 . A A .  39 VAL CG2  1 1 
        3  3956 1 1  39 VAL H    H    3.629  -9.049   7.184 1.00 . A A .  39 VAL H    1 1 
        3  3957 1 1  39 VAL HA   H    2.059 -11.604   7.378 1.00 . A A .  39 VAL HA   1 1 
        3  3958 1 1  39 VAL HB   H    3.276 -11.475   5.334 1.00 . A A .  39 VAL HB   1 1 
        3  3959 1 1  39 VAL HG11 H    5.125  -9.980   5.929 1.00 . A A .  39 VAL HG11 1 1 
        3  3960 1 1  39 VAL HG12 H    5.824 -11.235   6.982 1.00 . A A .  39 VAL HG12 1 1 
        3  3961 1 1  39 VAL HG13 H    5.714 -11.496   5.232 1.00 . A A .  39 VAL HG13 1 1 
        3  3962 1 1  39 VAL HG21 H    4.439 -13.574   5.400 1.00 . A A .  39 VAL HG21 1 1 
        3  3963 1 1  39 VAL HG22 H    4.634 -13.487   7.158 1.00 . A A .  39 VAL HG22 1 1 
        3  3964 1 1  39 VAL HG23 H    3.012 -13.674   6.440 1.00 . A A .  39 VAL HG23 1 1 
        3  3965 1 1  39 VAL N    N    2.815  -9.654   7.299 1.00 . A A .  39 VAL N    1 1 
        3  3966 1 1  39 VAL O    O    4.516 -10.782   9.287 1.00 . A A .  39 VAL O    1 1 
        3  3967 1 1  40 GLN C    C    5.043 -13.556  10.616 1.00 . A A .  40 GLN C    1 1 
        3  3968 1 1  40 GLN CA   C    3.598 -13.035  10.699 1.00 . A A .  40 GLN CA   1 1 
        3  3969 1 1  40 GLN CB   C    2.614 -14.079  11.262 1.00 . A A .  40 GLN CB   1 1 
        3  3970 1 1  40 GLN CD   C    1.277 -16.203  10.859 1.00 . A A .  40 GLN CD   1 1 
        3  3971 1 1  40 GLN CG   C    2.041 -15.049  10.211 1.00 . A A .  40 GLN CG   1 1 
        3  3972 1 1  40 GLN H    H    2.428 -13.074   8.914 1.00 . A A .  40 GLN H    1 1 
        3  3973 1 1  40 GLN HA   H    3.607 -12.198  11.398 1.00 . A A .  40 GLN HA   1 1 
        3  3974 1 1  40 GLN HB2  H    3.118 -14.647  12.044 1.00 . A A .  40 GLN HB2  1 1 
        3  3975 1 1  40 GLN HB3  H    1.778 -13.551  11.724 1.00 . A A .  40 GLN HB3  1 1 
        3  3976 1 1  40 GLN HE21 H   -0.400 -15.100  11.143 1.00 . A A .  40 GLN HE21 1 1 
        3  3977 1 1  40 GLN HE22 H   -0.455 -16.767  11.696 1.00 . A A .  40 GLN HE22 1 1 
        3  3978 1 1  40 GLN HG2  H    1.364 -14.501   9.549 1.00 . A A .  40 GLN HG2  1 1 
        3  3979 1 1  40 GLN HG3  H    2.851 -15.456   9.605 1.00 . A A .  40 GLN HG3  1 1 
        3  3980 1 1  40 GLN N    N    3.134 -12.539   9.398 1.00 . A A .  40 GLN N    1 1 
        3  3981 1 1  40 GLN NE2  N    0.040 -16.000  11.266 1.00 . A A .  40 GLN NE2  1 1 
        3  3982 1 1  40 GLN O    O    5.367 -14.395   9.774 1.00 . A A .  40 GLN O    1 1 
        3  3983 1 1  40 GLN OE1  O    1.782 -17.307  11.023 1.00 . A A .  40 GLN OE1  1 1 
        3  3984 1 1  41 SER C    C    7.825 -14.381  12.408 1.00 . A A .  41 SER C    1 1 
        3  3985 1 1  41 SER CA   C    7.363 -13.287  11.442 1.00 . A A .  41 SER CA   1 1 
        3  3986 1 1  41 SER CB   C    8.113 -11.990  11.729 1.00 . A A .  41 SER CB   1 1 
        3  3987 1 1  41 SER H    H    5.578 -12.382  12.176 1.00 . A A .  41 SER H    1 1 
        3  3988 1 1  41 SER HA   H    7.638 -13.585  10.437 1.00 . A A .  41 SER HA   1 1 
        3  3989 1 1  41 SER HB2  H    7.849 -11.258  10.969 1.00 . A A .  41 SER HB2  1 1 
        3  3990 1 1  41 SER HB3  H    7.814 -11.615  12.707 1.00 . A A .  41 SER HB3  1 1 
        3  3991 1 1  41 SER HG   H    9.948 -11.401  11.373 1.00 . A A .  41 SER HG   1 1 
        3  3992 1 1  41 SER N    N    5.917 -13.042  11.487 1.00 . A A .  41 SER N    1 1 
        3  3993 1 1  41 SER O    O    7.441 -14.362  13.582 1.00 . A A .  41 SER O    1 1 
        3  3994 1 1  41 SER OG   O    9.515 -12.211  11.707 1.00 . A A .  41 SER OG   1 1 
        3  3995 1 1  42 PRO C    C   10.511 -15.493  13.725 1.00 . A A .  42 PRO C    1 1 
        3  3996 1 1  42 PRO CA   C    9.433 -16.186  12.865 1.00 . A A .  42 PRO CA   1 1 
        3  3997 1 1  42 PRO CB   C   10.038 -17.282  11.975 1.00 . A A .  42 PRO CB   1 1 
        3  3998 1 1  42 PRO CD   C    8.885 -15.724  10.588 1.00 . A A .  42 PRO CD   1 1 
        3  3999 1 1  42 PRO CG   C    9.232 -17.207  10.679 1.00 . A A .  42 PRO CG   1 1 
        3  4000 1 1  42 PRO HA   H    8.683 -16.627  13.517 1.00 . A A .  42 PRO HA   1 1 
        3  4001 1 1  42 PRO HB2  H   11.081 -17.057  11.757 1.00 . A A .  42 PRO HB2  1 1 
        3  4002 1 1  42 PRO HB3  H    9.956 -18.265  12.440 1.00 . A A .  42 PRO HB3  1 1 
        3  4003 1 1  42 PRO HD2  H    9.701 -15.170  10.124 1.00 . A A .  42 PRO HD2  1 1 
        3  4004 1 1  42 PRO HD3  H    7.967 -15.603  10.011 1.00 . A A .  42 PRO HD3  1 1 
        3  4005 1 1  42 PRO HG2  H    9.811 -17.542   9.819 1.00 . A A .  42 PRO HG2  1 1 
        3  4006 1 1  42 PRO HG3  H    8.316 -17.791  10.782 1.00 . A A .  42 PRO HG3  1 1 
        3  4007 1 1  42 PRO N    N    8.716 -15.290  11.965 1.00 . A A .  42 PRO N    1 1 
        3  4008 1 1  42 PRO O    O   10.965 -16.075  14.713 1.00 . A A .  42 PRO O    1 1 
        3  4009 1 1  43 MET C    C   11.487 -12.390  14.954 1.00 . A A .  43 MET C    1 1 
        3  4010 1 1  43 MET CA   C   12.006 -13.513  14.036 1.00 . A A .  43 MET CA   1 1 
        3  4011 1 1  43 MET CB   C   12.973 -12.913  12.997 1.00 . A A .  43 MET CB   1 1 
        3  4012 1 1  43 MET CE   C   12.413 -14.279  10.083 1.00 . A A .  43 MET CE   1 1 
        3  4013 1 1  43 MET CG   C   13.955 -13.921  12.379 1.00 . A A .  43 MET CG   1 1 
        3  4014 1 1  43 MET H    H   10.498 -13.843  12.555 1.00 . A A .  43 MET H    1 1 
        3  4015 1 1  43 MET HA   H   12.587 -14.192  14.657 1.00 . A A .  43 MET HA   1 1 
        3  4016 1 1  43 MET HB2  H   12.411 -12.406  12.213 1.00 . A A .  43 MET HB2  1 1 
        3  4017 1 1  43 MET HB3  H   13.580 -12.157  13.495 1.00 . A A .  43 MET HB3  1 1 
        3  4018 1 1  43 MET HE1  H   13.104 -13.576   9.619 1.00 . A A .  43 MET HE1  1 1 
        3  4019 1 1  43 MET HE2  H   12.011 -14.946   9.321 1.00 . A A .  43 MET HE2  1 1 
        3  4020 1 1  43 MET HE3  H   11.594 -13.732  10.548 1.00 . A A .  43 MET HE3  1 1 
        3  4021 1 1  43 MET HG2  H   14.664 -13.358  11.771 1.00 . A A .  43 MET HG2  1 1 
        3  4022 1 1  43 MET HG3  H   14.522 -14.382  13.190 1.00 . A A .  43 MET HG3  1 1 
        3  4023 1 1  43 MET N    N   10.929 -14.268  13.367 1.00 . A A .  43 MET N    1 1 
        3  4024 1 1  43 MET O    O   12.116 -12.093  15.972 1.00 . A A .  43 MET O    1 1 
        3  4025 1 1  43 MET SD   S   13.283 -15.252  11.340 1.00 . A A .  43 MET SD   1 1 
        3  4026 1 1  44 PHE C    C    8.516 -11.046  16.128 1.00 . A A .  44 PHE C    1 1 
        3  4027 1 1  44 PHE CA   C    9.760 -10.628  15.322 1.00 . A A .  44 PHE CA   1 1 
        3  4028 1 1  44 PHE CB   C    9.481  -9.491  14.323 1.00 . A A .  44 PHE CB   1 1 
        3  4029 1 1  44 PHE CD1  C    9.427  -7.431  15.804 1.00 . A A .  44 PHE CD1  1 1 
        3  4030 1 1  44 PHE CD2  C    7.418  -8.037  14.568 1.00 . A A .  44 PHE CD2  1 1 
        3  4031 1 1  44 PHE CE1  C    8.744  -6.341  16.374 1.00 . A A .  44 PHE CE1  1 1 
        3  4032 1 1  44 PHE CE2  C    6.736  -6.945  15.135 1.00 . A A .  44 PHE CE2  1 1 
        3  4033 1 1  44 PHE CG   C    8.764  -8.286  14.903 1.00 . A A .  44 PHE CG   1 1 
        3  4034 1 1  44 PHE CZ   C    7.400  -6.099  16.040 1.00 . A A .  44 PHE CZ   1 1 
        3  4035 1 1  44 PHE H    H    9.883 -12.080  13.774 1.00 . A A .  44 PHE H    1 1 
        3  4036 1 1  44 PHE HA   H   10.483 -10.244  16.044 1.00 . A A .  44 PHE HA   1 1 
        3  4037 1 1  44 PHE HB2  H   10.431  -9.155  13.902 1.00 . A A .  44 PHE HB2  1 1 
        3  4038 1 1  44 PHE HB3  H    8.887  -9.881  13.500 1.00 . A A .  44 PHE HB3  1 1 
        3  4039 1 1  44 PHE HD1  H   10.462  -7.612  16.063 1.00 . A A .  44 PHE HD1  1 1 
        3  4040 1 1  44 PHE HD2  H    6.903  -8.687  13.876 1.00 . A A .  44 PHE HD2  1 1 
        3  4041 1 1  44 PHE HE1  H    9.255  -5.686  17.068 1.00 . A A .  44 PHE HE1  1 1 
        3  4042 1 1  44 PHE HE2  H    5.704  -6.754  14.872 1.00 . A A .  44 PHE HE2  1 1 
        3  4043 1 1  44 PHE HZ   H    6.876  -5.258  16.478 1.00 . A A .  44 PHE HZ   1 1 
        3  4044 1 1  44 PHE N    N   10.360 -11.761  14.605 1.00 . A A .  44 PHE N    1 1 
        3  4045 1 1  44 PHE O    O    7.829 -12.015  15.802 1.00 . A A .  44 PHE O    1 1 
        3  4046 1 1  45 ASP C    C    5.755 -10.024  17.654 1.00 . A A .  45 ASP C    1 1 
        3  4047 1 1  45 ASP CA   C    7.123 -10.557  18.145 1.00 . A A .  45 ASP CA   1 1 
        3  4048 1 1  45 ASP CB   C    7.543 -10.030  19.529 1.00 . A A .  45 ASP CB   1 1 
        3  4049 1 1  45 ASP CG   C    6.583 -10.454  20.659 1.00 . A A .  45 ASP CG   1 1 
        3  4050 1 1  45 ASP H    H    8.765  -9.463  17.323 1.00 . A A .  45 ASP H    1 1 
        3  4051 1 1  45 ASP HA   H    7.017 -11.640  18.232 1.00 . A A .  45 ASP HA   1 1 
        3  4052 1 1  45 ASP HB2  H    8.537 -10.419  19.765 1.00 . A A .  45 ASP HB2  1 1 
        3  4053 1 1  45 ASP HB3  H    7.615  -8.941  19.487 1.00 . A A .  45 ASP HB3  1 1 
        3  4054 1 1  45 ASP N    N    8.209 -10.294  17.185 1.00 . A A .  45 ASP N    1 1 
        3  4055 1 1  45 ASP O    O    5.046  -9.296  18.354 1.00 . A A .  45 ASP O    1 1 
        3  4056 1 1  45 ASP OD1  O    6.125 -11.623  20.670 1.00 . A A .  45 ASP OD1  1 1 
        3  4057 1 1  45 ASP OD2  O    6.324  -9.635  21.574 1.00 . A A .  45 ASP OD2  1 1 
        3  4058 1 1  46 GLY C    C    4.381 -10.006  14.178 1.00 . A A .  46 GLY C    1 1 
        3  4059 1 1  46 GLY CA   C    4.233  -9.849  15.690 1.00 . A A .  46 GLY CA   1 1 
        3  4060 1 1  46 GLY H    H    6.037 -10.963  15.896 1.00 . A A .  46 GLY H    1 1 
        3  4061 1 1  46 GLY HA2  H    3.343 -10.398  15.999 1.00 . A A .  46 GLY HA2  1 1 
        3  4062 1 1  46 GLY HA3  H    4.084  -8.794  15.920 1.00 . A A .  46 GLY HA3  1 1 
        3  4063 1 1  46 GLY N    N    5.410 -10.349  16.405 1.00 . A A .  46 GLY N    1 1 
        3  4064 1 1  46 GLY O    O    4.972 -10.981  13.697 1.00 . A A .  46 GLY O    1 1 
        3  4065 1 1  47 LYS C    C    4.714  -7.927  11.352 1.00 . A A .  47 LYS C    1 1 
        3  4066 1 1  47 LYS CA   C    3.869  -9.056  11.944 1.00 . A A .  47 LYS CA   1 1 
        3  4067 1 1  47 LYS CB   C    2.448  -9.118  11.354 1.00 . A A .  47 LYS CB   1 1 
        3  4068 1 1  47 LYS CD   C    0.473 -10.729  11.215 1.00 . A A .  47 LYS CD   1 1 
        3  4069 1 1  47 LYS CE   C   -0.461  -9.745  10.501 1.00 . A A .  47 LYS CE   1 1 
        3  4070 1 1  47 LYS CG   C    1.536 -10.097  12.114 1.00 . A A .  47 LYS CG   1 1 
        3  4071 1 1  47 LYS H    H    3.412  -8.253  13.886 1.00 . A A .  47 LYS H    1 1 
        3  4072 1 1  47 LYS HA   H    4.366  -9.974  11.630 1.00 . A A .  47 LYS HA   1 1 
        3  4073 1 1  47 LYS HB2  H    1.987  -8.135  11.352 1.00 . A A .  47 LYS HB2  1 1 
        3  4074 1 1  47 LYS HB3  H    2.528  -9.426  10.314 1.00 . A A .  47 LYS HB3  1 1 
        3  4075 1 1  47 LYS HD2  H    1.008 -11.295  10.453 1.00 . A A .  47 LYS HD2  1 1 
        3  4076 1 1  47 LYS HD3  H   -0.111 -11.427  11.815 1.00 . A A .  47 LYS HD3  1 1 
        3  4077 1 1  47 LYS HE2  H    0.142  -9.106   9.853 1.00 . A A .  47 LYS HE2  1 1 
        3  4078 1 1  47 LYS HE3  H   -1.120 -10.328   9.849 1.00 . A A .  47 LYS HE3  1 1 
        3  4079 1 1  47 LYS HG2  H    2.131 -10.914  12.521 1.00 . A A .  47 LYS HG2  1 1 
        3  4080 1 1  47 LYS HG3  H    1.063  -9.580  12.950 1.00 . A A .  47 LYS HG3  1 1 
        3  4081 1 1  47 LYS HZ1  H   -1.886  -9.476  12.000 1.00 . A A .  47 LYS HZ1  1 1 
        3  4082 1 1  47 LYS HZ2  H   -0.703  -8.335  12.042 1.00 . A A .  47 LYS HZ2  1 1 
        3  4083 1 1  47 LYS HZ3  H   -1.847  -8.257  10.899 1.00 . A A .  47 LYS HZ3  1 1 
        3  4084 1 1  47 LYS N    N    3.850  -9.040  13.417 1.00 . A A .  47 LYS N    1 1 
        3  4085 1 1  47 LYS NZ   N   -1.273  -8.910  11.428 1.00 . A A .  47 LYS NZ   1 1 
        3  4086 1 1  47 LYS O    O    4.860  -6.863  11.953 1.00 . A A .  47 LYS O    1 1 
        3  4087 1 1  48 VAL C    C    5.901  -6.934   8.106 1.00 . A A .  48 VAL C    1 1 
        3  4088 1 1  48 VAL CA   C    6.313  -7.350   9.527 1.00 . A A .  48 VAL CA   1 1 
        3  4089 1 1  48 VAL CB   C    7.681  -8.064   9.538 1.00 . A A .  48 VAL CB   1 1 
        3  4090 1 1  48 VAL CG1  C    8.150  -8.307  10.980 1.00 . A A .  48 VAL CG1  1 1 
        3  4091 1 1  48 VAL CG2  C    7.666  -9.408   8.796 1.00 . A A .  48 VAL CG2  1 1 
        3  4092 1 1  48 VAL H    H    5.065  -9.079   9.750 1.00 . A A .  48 VAL H    1 1 
        3  4093 1 1  48 VAL HA   H    6.430  -6.441  10.115 1.00 . A A .  48 VAL HA   1 1 
        3  4094 1 1  48 VAL HB   H    8.411  -7.417   9.053 1.00 . A A .  48 VAL HB   1 1 
        3  4095 1 1  48 VAL HG11 H    8.171  -7.364  11.528 1.00 . A A .  48 VAL HG11 1 1 
        3  4096 1 1  48 VAL HG12 H    7.478  -8.996  11.492 1.00 . A A .  48 VAL HG12 1 1 
        3  4097 1 1  48 VAL HG13 H    9.155  -8.728  10.978 1.00 . A A .  48 VAL HG13 1 1 
        3  4098 1 1  48 VAL HG21 H    8.658  -9.859   8.831 1.00 . A A .  48 VAL HG21 1 1 
        3  4099 1 1  48 VAL HG22 H    6.951 -10.091   9.253 1.00 . A A .  48 VAL HG22 1 1 
        3  4100 1 1  48 VAL HG23 H    7.391  -9.259   7.752 1.00 . A A .  48 VAL HG23 1 1 
        3  4101 1 1  48 VAL N    N    5.279  -8.180  10.175 1.00 . A A .  48 VAL N    1 1 
        3  4102 1 1  48 VAL O    O    5.189  -7.697   7.444 1.00 . A A .  48 VAL O    1 1 
        3  4103 1 1  49 PRO C    C    6.512  -5.693   5.125 1.00 . A A .  49 PRO C    1 1 
        3  4104 1 1  49 PRO CA   C    5.777  -5.180   6.372 1.00 . A A .  49 PRO CA   1 1 
        3  4105 1 1  49 PRO CB   C    5.901  -3.659   6.514 1.00 . A A .  49 PRO CB   1 1 
        3  4106 1 1  49 PRO CD   C    7.033  -4.707   8.349 1.00 . A A .  49 PRO CD   1 1 
        3  4107 1 1  49 PRO CG   C    7.121  -3.496   7.419 1.00 . A A .  49 PRO CG   1 1 
        3  4108 1 1  49 PRO HA   H    4.724  -5.436   6.281 1.00 . A A .  49 PRO HA   1 1 
        3  4109 1 1  49 PRO HB2  H    6.041  -3.162   5.552 1.00 . A A .  49 PRO HB2  1 1 
        3  4110 1 1  49 PRO HB3  H    5.019  -3.262   7.017 1.00 . A A .  49 PRO HB3  1 1 
        3  4111 1 1  49 PRO HD2  H    8.033  -5.053   8.612 1.00 . A A .  49 PRO HD2  1 1 
        3  4112 1 1  49 PRO HD3  H    6.484  -4.423   9.249 1.00 . A A .  49 PRO HD3  1 1 
        3  4113 1 1  49 PRO HG2  H    8.034  -3.556   6.825 1.00 . A A .  49 PRO HG2  1 1 
        3  4114 1 1  49 PRO HG3  H    7.090  -2.558   7.974 1.00 . A A .  49 PRO HG3  1 1 
        3  4115 1 1  49 PRO N    N    6.289  -5.733   7.624 1.00 . A A .  49 PRO N    1 1 
        3  4116 1 1  49 PRO O    O    7.738  -5.602   5.021 1.00 . A A .  49 PRO O    1 1 
        3  4117 1 1  50 HIS C    C    5.825  -5.274   1.879 1.00 . A A .  50 HIS C    1 1 
        3  4118 1 1  50 HIS CA   C    6.230  -6.435   2.770 1.00 . A A .  50 HIS CA   1 1 
        3  4119 1 1  50 HIS CB   C    5.662  -7.776   2.269 1.00 . A A .  50 HIS CB   1 1 
        3  4120 1 1  50 HIS CD2  C    7.075  -9.070   3.948 1.00 . A A .  50 HIS CD2  1 1 
        3  4121 1 1  50 HIS CE1  C    7.468 -10.905   2.794 1.00 . A A .  50 HIS CE1  1 1 
        3  4122 1 1  50 HIS CG   C    6.455  -8.968   2.740 1.00 . A A .  50 HIS CG   1 1 
        3  4123 1 1  50 HIS H    H    4.766  -6.326   4.315 1.00 . A A .  50 HIS H    1 1 
        3  4124 1 1  50 HIS HA   H    7.313  -6.484   2.742 1.00 . A A .  50 HIS HA   1 1 
        3  4125 1 1  50 HIS HB2  H    4.625  -7.885   2.590 1.00 . A A .  50 HIS HB2  1 1 
        3  4126 1 1  50 HIS HB3  H    5.666  -7.781   1.179 1.00 . A A .  50 HIS HB3  1 1 
        3  4127 1 1  50 HIS HD2  H    7.038  -8.326   4.732 1.00 . A A .  50 HIS HD2  1 1 
        3  4128 1 1  50 HIS HE1  H    7.811 -11.901   2.540 1.00 . A A .  50 HIS HE1  1 1 
        3  4129 1 1  50 HIS HE2  H    8.269 -10.672   4.722 1.00 . A A .  50 HIS HE2  1 1 
        3  4130 1 1  50 HIS N    N    5.756  -6.168   4.132 1.00 . A A .  50 HIS N    1 1 
        3  4131 1 1  50 HIS ND1  N    6.706 -10.130   2.004 1.00 . A A .  50 HIS ND1  1 1 
        3  4132 1 1  50 HIS NE2  N    7.724 -10.285   3.959 1.00 . A A .  50 HIS NE2  1 1 
        3  4133 1 1  50 HIS O    O    4.656  -5.183   1.536 1.00 . A A .  50 HIS O    1 1 
        3  4134 1 1  51 TRP C    C    6.382  -3.493  -0.727 1.00 . A A .  51 TRP C    1 1 
        3  4135 1 1  51 TRP CA   C    6.478  -3.171   0.767 1.00 . A A .  51 TRP CA   1 1 
        3  4136 1 1  51 TRP CB   C    7.555  -2.105   1.001 1.00 . A A .  51 TRP CB   1 1 
        3  4137 1 1  51 TRP CD1  C    8.542  -2.042   3.331 1.00 . A A .  51 TRP CD1  1 1 
        3  4138 1 1  51 TRP CD2  C    6.870  -0.560   3.066 1.00 . A A .  51 TRP CD2  1 1 
        3  4139 1 1  51 TRP CE2  C    7.322  -0.455   4.418 1.00 . A A .  51 TRP CE2  1 1 
        3  4140 1 1  51 TRP CE3  C    5.804   0.288   2.678 1.00 . A A .  51 TRP CE3  1 1 
        3  4141 1 1  51 TRP CG   C    7.662  -1.598   2.404 1.00 . A A .  51 TRP CG   1 1 
        3  4142 1 1  51 TRP CH2  C    5.686   1.251   4.925 1.00 . A A .  51 TRP CH2  1 1 
        3  4143 1 1  51 TRP CZ2  C    6.748   0.433   5.336 1.00 . A A .  51 TRP CZ2  1 1 
        3  4144 1 1  51 TRP CZ3  C    5.202   1.166   3.607 1.00 . A A .  51 TRP CZ3  1 1 
        3  4145 1 1  51 TRP H    H    7.701  -4.506   1.866 1.00 . A A .  51 TRP H    1 1 
        3  4146 1 1  51 TRP HA   H    5.529  -2.745   1.102 1.00 . A A .  51 TRP HA   1 1 
        3  4147 1 1  51 TRP HB2  H    8.523  -2.504   0.690 1.00 . A A .  51 TRP HB2  1 1 
        3  4148 1 1  51 TRP HB3  H    7.335  -1.250   0.360 1.00 . A A .  51 TRP HB3  1 1 
        3  4149 1 1  51 TRP HD1  H    9.285  -2.816   3.166 1.00 . A A .  51 TRP HD1  1 1 
        3  4150 1 1  51 TRP HE1  H    8.903  -1.532   5.351 1.00 . A A .  51 TRP HE1  1 1 
        3  4151 1 1  51 TRP HE3  H    5.436   0.237   1.660 1.00 . A A .  51 TRP HE3  1 1 
        3  4152 1 1  51 TRP HH2  H    5.240   1.937   5.630 1.00 . A A .  51 TRP HH2  1 1 
        3  4153 1 1  51 TRP HZ2  H    7.116   0.477   6.351 1.00 . A A .  51 TRP HZ2  1 1 
        3  4154 1 1  51 TRP HZ3  H    4.348   1.765   3.321 1.00 . A A .  51 TRP HZ3  1 1 
        3  4155 1 1  51 TRP N    N    6.755  -4.372   1.556 1.00 . A A .  51 TRP N    1 1 
        3  4156 1 1  51 TRP NE1  N    8.349  -1.366   4.517 1.00 . A A .  51 TRP NE1  1 1 
        3  4157 1 1  51 TRP O    O    7.102  -4.340  -1.254 1.00 . A A .  51 TRP O    1 1 
        3  4158 1 1  52 TYR C    C    4.988  -1.392  -3.379 1.00 . A A .  52 TYR C    1 1 
        3  4159 1 1  52 TYR CA   C    5.433  -2.779  -2.880 1.00 . A A .  52 TYR CA   1 1 
        3  4160 1 1  52 TYR CB   C    4.503  -3.907  -3.384 1.00 . A A .  52 TYR CB   1 1 
        3  4161 1 1  52 TYR CD1  C    3.269  -4.933  -1.389 1.00 . A A .  52 TYR CD1  1 1 
        3  4162 1 1  52 TYR CD2  C    4.635  -6.369  -2.801 1.00 . A A .  52 TYR CD2  1 1 
        3  4163 1 1  52 TYR CE1  C    2.877  -6.057  -0.630 1.00 . A A .  52 TYR CE1  1 1 
        3  4164 1 1  52 TYR CE2  C    4.246  -7.493  -2.047 1.00 . A A .  52 TYR CE2  1 1 
        3  4165 1 1  52 TYR CG   C    4.150  -5.086  -2.480 1.00 . A A .  52 TYR CG   1 1 
        3  4166 1 1  52 TYR CZ   C    3.378  -7.337  -0.948 1.00 . A A .  52 TYR CZ   1 1 
        3  4167 1 1  52 TYR H    H    4.942  -2.099  -0.937 1.00 . A A .  52 TYR H    1 1 
        3  4168 1 1  52 TYR HA   H    6.425  -2.965  -3.290 1.00 . A A .  52 TYR HA   1 1 
        3  4169 1 1  52 TYR HB2  H    3.566  -3.470  -3.720 1.00 . A A .  52 TYR HB2  1 1 
        3  4170 1 1  52 TYR HB3  H    5.010  -4.331  -4.249 1.00 . A A .  52 TYR HB3  1 1 
        3  4171 1 1  52 TYR HD1  H    2.916  -3.949  -1.116 1.00 . A A .  52 TYR HD1  1 1 
        3  4172 1 1  52 TYR HD2  H    5.312  -6.491  -3.631 1.00 . A A .  52 TYR HD2  1 1 
        3  4173 1 1  52 TYR HE1  H    2.226  -5.954   0.223 1.00 . A A .  52 TYR HE1  1 1 
        3  4174 1 1  52 TYR HE2  H    4.611  -8.477  -2.303 1.00 . A A .  52 TYR HE2  1 1 
        3  4175 1 1  52 TYR HH   H    3.428  -9.239  -0.526 1.00 . A A .  52 TYR HH   1 1 
        3  4176 1 1  52 TYR N    N    5.529  -2.764  -1.430 1.00 . A A .  52 TYR N    1 1 
        3  4177 1 1  52 TYR O    O    4.426  -0.593  -2.620 1.00 . A A .  52 TYR O    1 1 
        3  4178 1 1  52 TYR OH   O    3.019  -8.421  -0.207 1.00 . A A .  52 TYR OH   1 1 
        3  4179 1 1  53 HIS C    C    3.060   0.034  -5.176 1.00 . A A .  53 HIS C    1 1 
        3  4180 1 1  53 HIS CA   C    4.598   0.083  -5.311 1.00 . A A .  53 HIS CA   1 1 
        3  4181 1 1  53 HIS CB   C    4.983   0.151  -6.799 1.00 . A A .  53 HIS CB   1 1 
        3  4182 1 1  53 HIS CD2  C    7.173   1.441  -6.967 1.00 . A A .  53 HIS CD2  1 1 
        3  4183 1 1  53 HIS CE1  C    8.489  -0.090  -7.846 1.00 . A A .  53 HIS CE1  1 1 
        3  4184 1 1  53 HIS CG   C    6.459   0.283  -7.104 1.00 . A A .  53 HIS CG   1 1 
        3  4185 1 1  53 HIS H    H    5.714  -1.767  -5.219 1.00 . A A .  53 HIS H    1 1 
        3  4186 1 1  53 HIS HA   H    4.950   0.991  -4.814 1.00 . A A .  53 HIS HA   1 1 
        3  4187 1 1  53 HIS HB2  H    4.582  -0.719  -7.309 1.00 . A A .  53 HIS HB2  1 1 
        3  4188 1 1  53 HIS HB3  H    4.488   1.020  -7.238 1.00 . A A .  53 HIS HB3  1 1 
        3  4189 1 1  53 HIS HD2  H    6.804   2.389  -6.590 1.00 . A A .  53 HIS HD2  1 1 
        3  4190 1 1  53 HIS HE1  H    9.369  -0.561  -8.262 1.00 . A A .  53 HIS HE1  1 1 
        3  4191 1 1  53 HIS HE2  H    9.209   1.848  -7.502 1.00 . A A .  53 HIS HE2  1 1 
        3  4192 1 1  53 HIS N    N    5.217  -1.088  -4.659 1.00 . A A .  53 HIS N    1 1 
        3  4193 1 1  53 HIS ND1  N    7.304  -0.691  -7.653 1.00 . A A .  53 HIS ND1  1 1 
        3  4194 1 1  53 HIS NE2  N    8.441   1.187  -7.438 1.00 . A A .  53 HIS NE2  1 1 
        3  4195 1 1  53 HIS O    O    2.486  -1.049  -5.031 1.00 . A A .  53 HIS O    1 1 
        3  4196 1 1  54 PHE C    C    0.217   0.245  -6.143 1.00 . A A .  54 PHE C    1 1 
        3  4197 1 1  54 PHE CA   C    0.904   1.236  -5.179 1.00 . A A .  54 PHE CA   1 1 
        3  4198 1 1  54 PHE CB   C    0.404   2.663  -5.460 1.00 . A A .  54 PHE CB   1 1 
        3  4199 1 1  54 PHE CD1  C   -2.049   2.547  -4.757 1.00 . A A .  54 PHE CD1  1 1 
        3  4200 1 1  54 PHE CD2  C   -1.513   2.915  -7.104 1.00 . A A .  54 PHE CD2  1 1 
        3  4201 1 1  54 PHE CE1  C   -3.418   2.507  -5.080 1.00 . A A .  54 PHE CE1  1 1 
        3  4202 1 1  54 PHE CE2  C   -2.883   2.880  -7.423 1.00 . A A .  54 PHE CE2  1 1 
        3  4203 1 1  54 PHE CG   C   -1.088   2.740  -5.772 1.00 . A A .  54 PHE CG   1 1 
        3  4204 1 1  54 PHE CZ   C   -3.834   2.668  -6.413 1.00 . A A .  54 PHE CZ   1 1 
        3  4205 1 1  54 PHE H    H    2.881   2.054  -5.370 1.00 . A A .  54 PHE H    1 1 
        3  4206 1 1  54 PHE HA   H    0.611   0.980  -4.159 1.00 . A A .  54 PHE HA   1 1 
        3  4207 1 1  54 PHE HB2  H    0.624   3.282  -4.594 1.00 . A A .  54 PHE HB2  1 1 
        3  4208 1 1  54 PHE HB3  H    0.956   3.074  -6.307 1.00 . A A .  54 PHE HB3  1 1 
        3  4209 1 1  54 PHE HD1  H   -1.742   2.406  -3.731 1.00 . A A .  54 PHE HD1  1 1 
        3  4210 1 1  54 PHE HD2  H   -0.787   3.053  -7.893 1.00 . A A .  54 PHE HD2  1 1 
        3  4211 1 1  54 PHE HE1  H   -4.154   2.341  -4.307 1.00 . A A .  54 PHE HE1  1 1 
        3  4212 1 1  54 PHE HE2  H   -3.207   3.009  -8.448 1.00 . A A .  54 PHE HE2  1 1 
        3  4213 1 1  54 PHE HZ   H   -4.885   2.637  -6.660 1.00 . A A .  54 PHE HZ   1 1 
        3  4214 1 1  54 PHE N    N    2.375   1.183  -5.268 1.00 . A A .  54 PHE N    1 1 
        3  4215 1 1  54 PHE O    O   -0.698  -0.469  -5.742 1.00 . A A .  54 PHE O    1 1 
        3  4216 1 1  55 SER C    C    0.507  -2.179  -8.225 1.00 . A A .  55 SER C    1 1 
        3  4217 1 1  55 SER CA   C    0.106  -0.714  -8.426 1.00 . A A .  55 SER CA   1 1 
        3  4218 1 1  55 SER CB   C    0.534  -0.218  -9.808 1.00 . A A .  55 SER CB   1 1 
        3  4219 1 1  55 SER H    H    1.494   0.693  -7.659 1.00 . A A .  55 SER H    1 1 
        3  4220 1 1  55 SER HA   H   -0.981  -0.658  -8.384 1.00 . A A .  55 SER HA   1 1 
        3  4221 1 1  55 SER HB2  H    0.142  -0.889 -10.571 1.00 . A A .  55 SER HB2  1 1 
        3  4222 1 1  55 SER HB3  H    0.121   0.779  -9.974 1.00 . A A .  55 SER HB3  1 1 
        3  4223 1 1  55 SER HG   H    2.193   0.247 -10.751 1.00 . A A .  55 SER HG   1 1 
        3  4224 1 1  55 SER N    N    0.674   0.165  -7.398 1.00 . A A .  55 SER N    1 1 
        3  4225 1 1  55 SER O    O   -0.286  -3.082  -8.492 1.00 . A A .  55 SER O    1 1 
        3  4226 1 1  55 SER OG   O    1.949  -0.161  -9.899 1.00 . A A .  55 SER OG   1 1 
        3  4227 1 1  56 CYS C    C    1.487  -4.473  -6.291 1.00 . A A .  56 CYS C    1 1 
        3  4228 1 1  56 CYS CA   C    2.253  -3.737  -7.407 1.00 . A A .  56 CYS CA   1 1 
        3  4229 1 1  56 CYS CB   C    3.740  -3.601  -7.080 1.00 . A A .  56 CYS CB   1 1 
        3  4230 1 1  56 CYS H    H    2.331  -1.634  -7.566 1.00 . A A .  56 CYS H    1 1 
        3  4231 1 1  56 CYS HA   H    2.157  -4.326  -8.309 1.00 . A A .  56 CYS HA   1 1 
        3  4232 1 1  56 CYS HB2  H    3.866  -2.860  -6.290 1.00 . A A .  56 CYS HB2  1 1 
        3  4233 1 1  56 CYS HB3  H    4.097  -4.555  -6.691 1.00 . A A .  56 CYS HB3  1 1 
        3  4234 1 1  56 CYS N    N    1.716  -2.419  -7.707 1.00 . A A .  56 CYS N    1 1 
        3  4235 1 1  56 CYS O    O    1.309  -5.686  -6.378 1.00 . A A .  56 CYS O    1 1 
        3  4236 1 1  56 CYS SG   S    4.721  -3.145  -8.562 1.00 . A A .  56 CYS SG   1 1 
        3  4237 1 1  57 PHE C    C   -1.108  -5.048  -4.899 1.00 . A A .  57 PHE C    1 1 
        3  4238 1 1  57 PHE CA   C    0.081  -4.314  -4.258 1.00 . A A .  57 PHE CA   1 1 
        3  4239 1 1  57 PHE CB   C   -0.412  -3.182  -3.350 1.00 . A A .  57 PHE CB   1 1 
        3  4240 1 1  57 PHE CD1  C   -2.713  -3.909  -2.580 1.00 . A A .  57 PHE CD1  1 1 
        3  4241 1 1  57 PHE CD2  C   -0.907  -3.864  -0.951 1.00 . A A .  57 PHE CD2  1 1 
        3  4242 1 1  57 PHE CE1  C   -3.580  -4.437  -1.614 1.00 . A A .  57 PHE CE1  1 1 
        3  4243 1 1  57 PHE CE2  C   -1.799  -4.312   0.038 1.00 . A A .  57 PHE CE2  1 1 
        3  4244 1 1  57 PHE CG   C   -1.365  -3.652  -2.266 1.00 . A A .  57 PHE CG   1 1 
        3  4245 1 1  57 PHE CZ   C   -3.127  -4.627  -0.298 1.00 . A A .  57 PHE CZ   1 1 
        3  4246 1 1  57 PHE H    H    1.187  -2.778  -5.255 1.00 . A A .  57 PHE H    1 1 
        3  4247 1 1  57 PHE HA   H    0.619  -5.022  -3.629 1.00 . A A .  57 PHE HA   1 1 
        3  4248 1 1  57 PHE HB2  H    0.458  -2.718  -2.890 1.00 . A A .  57 PHE HB2  1 1 
        3  4249 1 1  57 PHE HB3  H   -0.919  -2.426  -3.951 1.00 . A A .  57 PHE HB3  1 1 
        3  4250 1 1  57 PHE HD1  H   -3.086  -3.727  -3.577 1.00 . A A .  57 PHE HD1  1 1 
        3  4251 1 1  57 PHE HD2  H    0.124  -3.667  -0.695 1.00 . A A .  57 PHE HD2  1 1 
        3  4252 1 1  57 PHE HE1  H   -4.604  -4.665  -1.877 1.00 . A A .  57 PHE HE1  1 1 
        3  4253 1 1  57 PHE HE2  H   -1.465  -4.415   1.058 1.00 . A A .  57 PHE HE2  1 1 
        3  4254 1 1  57 PHE HZ   H   -3.810  -4.995   0.455 1.00 . A A .  57 PHE HZ   1 1 
        3  4255 1 1  57 PHE N    N    0.982  -3.763  -5.278 1.00 . A A .  57 PHE N    1 1 
        3  4256 1 1  57 PHE O    O   -1.422  -6.182  -4.541 1.00 . A A .  57 PHE O    1 1 
        3  4257 1 1  58 TRP C    C   -2.481  -6.179  -7.543 1.00 . A A .  58 TRP C    1 1 
        3  4258 1 1  58 TRP CA   C   -2.887  -5.028  -6.599 1.00 . A A .  58 TRP CA   1 1 
        3  4259 1 1  58 TRP CB   C   -3.676  -3.917  -7.296 1.00 . A A .  58 TRP CB   1 1 
        3  4260 1 1  58 TRP CD1  C   -3.433  -1.544  -6.475 1.00 . A A .  58 TRP CD1  1 1 
        3  4261 1 1  58 TRP CD2  C   -4.984  -2.647  -5.292 1.00 . A A .  58 TRP CD2  1 1 
        3  4262 1 1  58 TRP CE2  C   -4.837  -1.356  -4.691 1.00 . A A .  58 TRP CE2  1 1 
        3  4263 1 1  58 TRP CE3  C   -5.967  -3.495  -4.724 1.00 . A A .  58 TRP CE3  1 1 
        3  4264 1 1  58 TRP CG   C   -4.033  -2.751  -6.408 1.00 . A A .  58 TRP CG   1 1 
        3  4265 1 1  58 TRP CH2  C   -6.557  -1.814  -3.056 1.00 . A A .  58 TRP CH2  1 1 
        3  4266 1 1  58 TRP CZ2  C   -5.599  -0.940  -3.587 1.00 . A A .  58 TRP CZ2  1 1 
        3  4267 1 1  58 TRP CZ3  C   -6.744  -3.082  -3.628 1.00 . A A .  58 TRP CZ3  1 1 
        3  4268 1 1  58 TRP H    H   -1.463  -3.497  -6.152 1.00 . A A .  58 TRP H    1 1 
        3  4269 1 1  58 TRP HA   H   -3.552  -5.458  -5.848 1.00 . A A .  58 TRP HA   1 1 
        3  4270 1 1  58 TRP HB2  H   -3.080  -3.550  -8.132 1.00 . A A .  58 TRP HB2  1 1 
        3  4271 1 1  58 TRP HB3  H   -4.583  -4.347  -7.709 1.00 . A A .  58 TRP HB3  1 1 
        3  4272 1 1  58 TRP HD1  H   -2.666  -1.278  -7.189 1.00 . A A .  58 TRP HD1  1 1 
        3  4273 1 1  58 TRP HE1  H   -3.497   0.195  -5.286 1.00 . A A .  58 TRP HE1  1 1 
        3  4274 1 1  58 TRP HE3  H   -6.150  -4.471  -5.141 1.00 . A A .  58 TRP HE3  1 1 
        3  4275 1 1  58 TRP HH2  H   -7.146  -1.506  -2.209 1.00 . A A .  58 TRP HH2  1 1 
        3  4276 1 1  58 TRP HZ2  H   -5.465   0.037  -3.145 1.00 . A A .  58 TRP HZ2  1 1 
        3  4277 1 1  58 TRP HZ3  H   -7.489  -3.752  -3.222 1.00 . A A .  58 TRP HZ3  1 1 
        3  4278 1 1  58 TRP N    N   -1.742  -4.436  -5.903 1.00 . A A .  58 TRP N    1 1 
        3  4279 1 1  58 TRP NE1  N   -3.876  -0.732  -5.452 1.00 . A A .  58 TRP NE1  1 1 
        3  4280 1 1  58 TRP O    O   -3.312  -7.038  -7.837 1.00 . A A .  58 TRP O    1 1 
        3  4281 1 1  59 LYS C    C   -0.445  -8.655  -7.608 1.00 . A A .  59 LYS C    1 1 
        3  4282 1 1  59 LYS CA   C   -0.616  -7.480  -8.582 1.00 . A A .  59 LYS CA   1 1 
        3  4283 1 1  59 LYS CB   C    0.743  -7.194  -9.238 1.00 . A A .  59 LYS CB   1 1 
        3  4284 1 1  59 LYS CD   C    2.130  -5.681 -10.697 1.00 . A A .  59 LYS CD   1 1 
        3  4285 1 1  59 LYS CE   C    2.054  -4.271 -11.276 1.00 . A A .  59 LYS CE   1 1 
        3  4286 1 1  59 LYS CG   C    0.709  -6.067 -10.269 1.00 . A A .  59 LYS CG   1 1 
        3  4287 1 1  59 LYS H    H   -0.565  -5.536  -7.661 1.00 . A A .  59 LYS H    1 1 
        3  4288 1 1  59 LYS HA   H   -1.282  -7.793  -9.384 1.00 . A A .  59 LYS HA   1 1 
        3  4289 1 1  59 LYS HB2  H    1.454  -6.946  -8.462 1.00 . A A .  59 LYS HB2  1 1 
        3  4290 1 1  59 LYS HB3  H    1.095  -8.098  -9.738 1.00 . A A .  59 LYS HB3  1 1 
        3  4291 1 1  59 LYS HD2  H    2.799  -5.685  -9.836 1.00 . A A .  59 LYS HD2  1 1 
        3  4292 1 1  59 LYS HD3  H    2.508  -6.384 -11.441 1.00 . A A .  59 LYS HD3  1 1 
        3  4293 1 1  59 LYS HE2  H    1.638  -4.338 -12.283 1.00 . A A .  59 LYS HE2  1 1 
        3  4294 1 1  59 LYS HE3  H    1.362  -3.696 -10.655 1.00 . A A .  59 LYS HE3  1 1 
        3  4295 1 1  59 LYS HG2  H    0.132  -6.378 -11.140 1.00 . A A .  59 LYS HG2  1 1 
        3  4296 1 1  59 LYS HG3  H    0.227  -5.203  -9.820 1.00 . A A .  59 LYS HG3  1 1 
        3  4297 1 1  59 LYS HZ1  H    3.318  -2.710 -11.764 1.00 . A A .  59 LYS HZ1  1 1 
        3  4298 1 1  59 LYS HZ2  H    3.719  -3.435 -10.337 1.00 . A A .  59 LYS HZ2  1 1 
        3  4299 1 1  59 LYS HZ3  H    4.070  -4.161 -11.770 1.00 . A A .  59 LYS HZ3  1 1 
        3  4300 1 1  59 LYS N    N   -1.195  -6.282  -7.930 1.00 . A A .  59 LYS N    1 1 
        3  4301 1 1  59 LYS NZ   N    3.380  -3.605 -11.287 1.00 . A A .  59 LYS NZ   1 1 
        3  4302 1 1  59 LYS O    O   -0.369  -9.800  -8.052 1.00 . A A .  59 LYS O    1 1 
        3  4303 1 1  60 VAL C    C   -1.843 -10.114  -5.203 1.00 . A A .  60 VAL C    1 1 
        3  4304 1 1  60 VAL CA   C   -0.438  -9.477  -5.264 1.00 . A A .  60 VAL CA   1 1 
        3  4305 1 1  60 VAL CB   C    0.003  -8.986  -3.862 1.00 . A A .  60 VAL CB   1 1 
        3  4306 1 1  60 VAL CG1  C    0.279 -10.149  -2.895 1.00 . A A .  60 VAL CG1  1 1 
        3  4307 1 1  60 VAL CG2  C    1.297  -8.165  -3.893 1.00 . A A .  60 VAL CG2  1 1 
        3  4308 1 1  60 VAL H    H   -0.333  -7.432  -5.986 1.00 . A A .  60 VAL H    1 1 
        3  4309 1 1  60 VAL HA   H    0.254 -10.262  -5.563 1.00 . A A .  60 VAL HA   1 1 
        3  4310 1 1  60 VAL HB   H   -0.785  -8.371  -3.434 1.00 . A A .  60 VAL HB   1 1 
        3  4311 1 1  60 VAL HG11 H   -0.622 -10.738  -2.733 1.00 . A A .  60 VAL HG11 1 1 
        3  4312 1 1  60 VAL HG12 H    1.060 -10.796  -3.294 1.00 . A A .  60 VAL HG12 1 1 
        3  4313 1 1  60 VAL HG13 H    0.600  -9.759  -1.929 1.00 . A A .  60 VAL HG13 1 1 
        3  4314 1 1  60 VAL HG21 H    1.169  -7.275  -4.499 1.00 . A A .  60 VAL HG21 1 1 
        3  4315 1 1  60 VAL HG22 H    1.534  -7.834  -2.884 1.00 . A A .  60 VAL HG22 1 1 
        3  4316 1 1  60 VAL HG23 H    2.122  -8.759  -4.282 1.00 . A A .  60 VAL HG23 1 1 
        3  4317 1 1  60 VAL N    N   -0.378  -8.405  -6.290 1.00 . A A .  60 VAL N    1 1 
        3  4318 1 1  60 VAL O    O   -1.989 -11.267  -4.796 1.00 . A A .  60 VAL O    1 1 
        3  4319 1 1  61 GLY C    C   -5.185  -9.805  -4.687 1.00 . A A .  61 GLY C    1 1 
        3  4320 1 1  61 GLY CA   C   -4.231  -9.934  -5.882 1.00 . A A .  61 GLY CA   1 1 
        3  4321 1 1  61 GLY H    H   -2.690  -8.471  -6.015 1.00 . A A .  61 GLY H    1 1 
        3  4322 1 1  61 GLY HA2  H   -4.681  -9.398  -6.718 1.00 . A A .  61 GLY HA2  1 1 
        3  4323 1 1  61 GLY HA3  H   -4.172 -10.988  -6.158 1.00 . A A .  61 GLY HA3  1 1 
        3  4324 1 1  61 GLY N    N   -2.877  -9.404  -5.675 1.00 . A A .  61 GLY N    1 1 
        3  4325 1 1  61 GLY O    O   -6.250 -10.428  -4.692 1.00 . A A .  61 GLY O    1 1 
        3  4326 1 1  62 HIS C    C   -6.815  -7.690  -2.968 1.00 . A A .  62 HIS C    1 1 
        3  4327 1 1  62 HIS CA   C   -5.737  -8.701  -2.547 1.00 . A A .  62 HIS CA   1 1 
        3  4328 1 1  62 HIS CB   C   -4.945  -8.166  -1.341 1.00 . A A .  62 HIS CB   1 1 
        3  4329 1 1  62 HIS CD2  C   -2.833  -9.569  -1.030 1.00 . A A .  62 HIS CD2  1 1 
        3  4330 1 1  62 HIS CE1  C   -3.389 -10.706   0.776 1.00 . A A .  62 HIS CE1  1 1 
        3  4331 1 1  62 HIS CG   C   -4.092  -9.204  -0.655 1.00 . A A .  62 HIS CG   1 1 
        3  4332 1 1  62 HIS H    H   -3.963  -8.512  -3.730 1.00 . A A .  62 HIS H    1 1 
        3  4333 1 1  62 HIS HA   H   -6.240  -9.617  -2.228 1.00 . A A .  62 HIS HA   1 1 
        3  4334 1 1  62 HIS HB2  H   -4.311  -7.339  -1.661 1.00 . A A .  62 HIS HB2  1 1 
        3  4335 1 1  62 HIS HB3  H   -5.650  -7.774  -0.606 1.00 . A A .  62 HIS HB3  1 1 
        3  4336 1 1  62 HIS HD2  H   -2.278  -9.169  -1.865 1.00 . A A .  62 HIS HD2  1 1 
        3  4337 1 1  62 HIS HE1  H   -3.325 -11.381   1.622 1.00 . A A .  62 HIS HE1  1 1 
        3  4338 1 1  62 HIS HE2  H   -1.513 -10.989  -0.119 1.00 . A A .  62 HIS HE2  1 1 
        3  4339 1 1  62 HIS N    N   -4.837  -9.010  -3.668 1.00 . A A .  62 HIS N    1 1 
        3  4340 1 1  62 HIS ND1  N   -4.446  -9.925   0.490 1.00 . A A .  62 HIS ND1  1 1 
        3  4341 1 1  62 HIS NE2  N   -2.411 -10.518  -0.126 1.00 . A A .  62 HIS NE2  1 1 
        3  4342 1 1  62 HIS O    O   -6.495  -6.606  -3.458 1.00 . A A .  62 HIS O    1 1 
        3  4343 1 1  63 SER C    C   -9.561  -6.638  -1.351 1.00 . A A .  63 SER C    1 1 
        3  4344 1 1  63 SER CA   C   -9.215  -7.075  -2.771 1.00 . A A .  63 SER CA   1 1 
        3  4345 1 1  63 SER CB   C  -10.433  -7.707  -3.456 1.00 . A A .  63 SER CB   1 1 
        3  4346 1 1  63 SER H    H   -8.272  -8.936  -2.339 1.00 . A A .  63 SER H    1 1 
        3  4347 1 1  63 SER HA   H   -8.935  -6.186  -3.338 1.00 . A A .  63 SER HA   1 1 
        3  4348 1 1  63 SER HB2  H  -10.707  -8.628  -2.937 1.00 . A A .  63 SER HB2  1 1 
        3  4349 1 1  63 SER HB3  H  -11.273  -7.013  -3.405 1.00 . A A .  63 SER HB3  1 1 
        3  4350 1 1  63 SER HG   H  -10.910  -8.462  -5.201 1.00 . A A .  63 SER HG   1 1 
        3  4351 1 1  63 SER N    N   -8.084  -8.016  -2.710 1.00 . A A .  63 SER N    1 1 
        3  4352 1 1  63 SER O    O   -9.857  -7.470  -0.490 1.00 . A A .  63 SER O    1 1 
        3  4353 1 1  63 SER OG   O  -10.146  -7.990  -4.817 1.00 . A A .  63 SER OG   1 1 
        3  4354 1 1  64 ILE C    C  -11.040  -4.401   0.517 1.00 . A A .  64 ILE C    1 1 
        3  4355 1 1  64 ILE CA   C   -9.576  -4.779   0.271 1.00 . A A .  64 ILE CA   1 1 
        3  4356 1 1  64 ILE CB   C   -8.592  -3.595   0.420 1.00 . A A .  64 ILE CB   1 1 
        3  4357 1 1  64 ILE CD1  C   -6.157  -2.818   0.236 1.00 . A A .  64 ILE CD1  1 1 
        3  4358 1 1  64 ILE CG1  C   -7.139  -3.985   0.064 1.00 . A A .  64 ILE CG1  1 1 
        3  4359 1 1  64 ILE CG2  C   -8.638  -3.016   1.843 1.00 . A A .  64 ILE CG2  1 1 
        3  4360 1 1  64 ILE H    H   -9.415  -4.686  -1.848 1.00 . A A .  64 ILE H    1 1 
        3  4361 1 1  64 ILE HA   H   -9.280  -5.538   0.995 1.00 . A A .  64 ILE HA   1 1 
        3  4362 1 1  64 ILE HB   H   -8.895  -2.819  -0.278 1.00 . A A .  64 ILE HB   1 1 
        3  4363 1 1  64 ILE HD11 H   -5.297  -2.956  -0.407 1.00 . A A .  64 ILE HD11 1 1 
        3  4364 1 1  64 ILE HD12 H   -6.631  -1.876  -0.038 1.00 . A A .  64 ILE HD12 1 1 
        3  4365 1 1  64 ILE HD13 H   -5.817  -2.776   1.268 1.00 . A A .  64 ILE HD13 1 1 
        3  4366 1 1  64 ILE HG12 H   -6.812  -4.820   0.685 1.00 . A A .  64 ILE HG12 1 1 
        3  4367 1 1  64 ILE HG13 H   -7.096  -4.303  -0.976 1.00 . A A .  64 ILE HG13 1 1 
        3  4368 1 1  64 ILE HG21 H   -8.267  -3.744   2.564 1.00 . A A .  64 ILE HG21 1 1 
        3  4369 1 1  64 ILE HG22 H   -8.007  -2.127   1.888 1.00 . A A .  64 ILE HG22 1 1 
        3  4370 1 1  64 ILE HG23 H   -9.652  -2.719   2.102 1.00 . A A .  64 ILE HG23 1 1 
        3  4371 1 1  64 ILE N    N   -9.492  -5.335  -1.081 1.00 . A A .  64 ILE N    1 1 
        3  4372 1 1  64 ILE O    O  -11.608  -3.570  -0.192 1.00 . A A .  64 ILE O    1 1 
        3  4373 1 1  65 ARG C    C  -13.584  -3.784   2.585 1.00 . A A .  65 ARG C    1 1 
        3  4374 1 1  65 ARG CA   C  -13.126  -4.972   1.728 1.00 . A A .  65 ARG CA   1 1 
        3  4375 1 1  65 ARG CB   C  -13.682  -6.317   2.254 1.00 . A A .  65 ARG CB   1 1 
        3  4376 1 1  65 ARG CD   C  -11.849  -8.079   2.492 1.00 . A A .  65 ARG CD   1 1 
        3  4377 1 1  65 ARG CG   C  -12.787  -7.106   3.230 1.00 . A A .  65 ARG CG   1 1 
        3  4378 1 1  65 ARG CZ   C   -9.494  -8.655   3.144 1.00 . A A .  65 ARG CZ   1 1 
        3  4379 1 1  65 ARG H    H  -11.122  -5.682   2.068 1.00 . A A .  65 ARG H    1 1 
        3  4380 1 1  65 ARG HA   H  -13.579  -4.801   0.748 1.00 . A A .  65 ARG HA   1 1 
        3  4381 1 1  65 ARG HB2  H  -14.627  -6.118   2.761 1.00 . A A .  65 ARG HB2  1 1 
        3  4382 1 1  65 ARG HB3  H  -13.912  -6.957   1.401 1.00 . A A .  65 ARG HB3  1 1 
        3  4383 1 1  65 ARG HD2  H  -12.437  -8.917   2.116 1.00 . A A .  65 ARG HD2  1 1 
        3  4384 1 1  65 ARG HD3  H  -11.409  -7.578   1.630 1.00 . A A .  65 ARG HD3  1 1 
        3  4385 1 1  65 ARG HE   H  -11.089  -8.912   4.296 1.00 . A A .  65 ARG HE   1 1 
        3  4386 1 1  65 ARG HG2  H  -12.213  -6.412   3.845 1.00 . A A .  65 ARG HG2  1 1 
        3  4387 1 1  65 ARG HG3  H  -13.423  -7.692   3.895 1.00 . A A .  65 ARG HG3  1 1 
        3  4388 1 1  65 ARG HH11 H   -9.535  -8.100   1.203 1.00 . A A .  65 ARG HH11 1 1 
        3  4389 1 1  65 ARG HH12 H   -7.956  -8.368   1.905 1.00 . A A .  65 ARG HH12 1 1 
        3  4390 1 1  65 ARG HH21 H   -8.996  -9.343   4.963 1.00 . A A .  65 ARG HH21 1 1 
        3  4391 1 1  65 ARG HH22 H   -7.680  -9.076   3.845 1.00 . A A .  65 ARG HH22 1 1 
        3  4392 1 1  65 ARG N    N  -11.663  -5.029   1.518 1.00 . A A .  65 ARG N    1 1 
        3  4393 1 1  65 ARG NE   N  -10.792  -8.587   3.389 1.00 . A A .  65 ARG NE   1 1 
        3  4394 1 1  65 ARG NH1  N   -8.960  -8.323   2.006 1.00 . A A .  65 ARG NH1  1 1 
        3  4395 1 1  65 ARG NH2  N   -8.666  -9.054   4.059 1.00 . A A .  65 ARG NH2  1 1 
        3  4396 1 1  65 ARG O    O  -14.741  -3.371   2.510 1.00 . A A .  65 ARG O    1 1 
        3  4397 1 1  66 HIS C    C  -11.520  -1.299   4.397 1.00 . A A .  66 HIS C    1 1 
        3  4398 1 1  66 HIS CA   C  -12.854  -2.050   4.231 1.00 . A A .  66 HIS CA   1 1 
        3  4399 1 1  66 HIS CB   C  -13.526  -2.444   5.565 1.00 . A A .  66 HIS CB   1 1 
        3  4400 1 1  66 HIS CD2  C  -11.877  -4.366   6.130 1.00 . A A .  66 HIS CD2  1 1 
        3  4401 1 1  66 HIS CE1  C  -13.082  -5.415   7.653 1.00 . A A .  66 HIS CE1  1 1 
        3  4402 1 1  66 HIS CG   C  -13.058  -3.696   6.288 1.00 . A A .  66 HIS CG   1 1 
        3  4403 1 1  66 HIS H    H  -11.753  -3.652   3.357 1.00 . A A .  66 HIS H    1 1 
        3  4404 1 1  66 HIS HA   H  -13.538  -1.359   3.739 1.00 . A A .  66 HIS HA   1 1 
        3  4405 1 1  66 HIS HB2  H  -13.451  -1.605   6.253 1.00 . A A .  66 HIS HB2  1 1 
        3  4406 1 1  66 HIS HB3  H  -14.588  -2.583   5.361 1.00 . A A .  66 HIS HB3  1 1 
        3  4407 1 1  66 HIS HD2  H  -11.072  -4.104   5.460 1.00 . A A .  66 HIS HD2  1 1 
        3  4408 1 1  66 HIS HE1  H  -13.384  -6.138   8.403 1.00 . A A .  66 HIS HE1  1 1 
        3  4409 1 1  66 HIS HE2  H  -11.183  -6.131   7.130 1.00 . A A .  66 HIS HE2  1 1 
        3  4410 1 1  66 HIS N    N  -12.668  -3.229   3.375 1.00 . A A .  66 HIS N    1 1 
        3  4411 1 1  66 HIS ND1  N  -13.818  -4.365   7.254 1.00 . A A .  66 HIS ND1  1 1 
        3  4412 1 1  66 HIS NE2  N  -11.913  -5.441   6.992 1.00 . A A .  66 HIS NE2  1 1 
        3  4413 1 1  66 HIS O    O  -10.837  -1.451   5.414 1.00 . A A .  66 HIS O    1 1 
        3  4414 1 1  67 PRO C    C   -9.397   1.005   4.435 1.00 . A A .  67 PRO C    1 1 
        3  4415 1 1  67 PRO CA   C   -9.720  -0.004   3.331 1.00 . A A .  67 PRO CA   1 1 
        3  4416 1 1  67 PRO CB   C   -9.550   0.591   1.926 1.00 . A A .  67 PRO CB   1 1 
        3  4417 1 1  67 PRO CD   C  -11.788  -0.213   2.145 1.00 . A A .  67 PRO CD   1 1 
        3  4418 1 1  67 PRO CG   C  -10.981   0.911   1.502 1.00 . A A .  67 PRO CG   1 1 
        3  4419 1 1  67 PRO HA   H   -9.040  -0.839   3.467 1.00 . A A .  67 PRO HA   1 1 
        3  4420 1 1  67 PRO HB2  H   -8.920   1.483   1.925 1.00 . A A .  67 PRO HB2  1 1 
        3  4421 1 1  67 PRO HB3  H   -9.136  -0.159   1.252 1.00 . A A .  67 PRO HB3  1 1 
        3  4422 1 1  67 PRO HD2  H  -12.807   0.125   2.330 1.00 . A A .  67 PRO HD2  1 1 
        3  4423 1 1  67 PRO HD3  H  -11.789  -1.087   1.491 1.00 . A A .  67 PRO HD3  1 1 
        3  4424 1 1  67 PRO HG2  H  -11.285   1.865   1.933 1.00 . A A .  67 PRO HG2  1 1 
        3  4425 1 1  67 PRO HG3  H  -11.094   0.922   0.418 1.00 . A A .  67 PRO HG3  1 1 
        3  4426 1 1  67 PRO N    N  -11.084  -0.527   3.382 1.00 . A A .  67 PRO N    1 1 
        3  4427 1 1  67 PRO O    O   -8.280   1.007   4.941 1.00 . A A .  67 PRO O    1 1 
        3  4428 1 1  68 ASP C    C   -9.978   1.999   7.369 1.00 . A A .  68 ASP C    1 1 
        3  4429 1 1  68 ASP CA   C  -10.175   2.723   6.014 1.00 . A A .  68 ASP CA   1 1 
        3  4430 1 1  68 ASP CB   C  -11.380   3.677   6.042 1.00 . A A .  68 ASP CB   1 1 
        3  4431 1 1  68 ASP CG   C  -11.328   4.707   7.186 1.00 . A A .  68 ASP CG   1 1 
        3  4432 1 1  68 ASP H    H  -11.292   1.708   4.500 1.00 . A A .  68 ASP H    1 1 
        3  4433 1 1  68 ASP HA   H   -9.268   3.294   5.804 1.00 . A A .  68 ASP HA   1 1 
        3  4434 1 1  68 ASP HB2  H  -11.429   4.209   5.089 1.00 . A A .  68 ASP HB2  1 1 
        3  4435 1 1  68 ASP HB3  H  -12.292   3.082   6.133 1.00 . A A .  68 ASP HB3  1 1 
        3  4436 1 1  68 ASP N    N  -10.372   1.787   4.900 1.00 . A A .  68 ASP N    1 1 
        3  4437 1 1  68 ASP O    O   -9.513   2.600   8.340 1.00 . A A .  68 ASP O    1 1 
        3  4438 1 1  68 ASP OD1  O  -10.471   5.621   7.148 1.00 . A A .  68 ASP OD1  1 1 
        3  4439 1 1  68 ASP OD2  O  -12.182   4.633   8.104 1.00 . A A .  68 ASP OD2  1 1 
        3  4440 1 1  69 VAL C    C   -8.922  -0.964   8.644 1.00 . A A .  69 VAL C    1 1 
        3  4441 1 1  69 VAL CA   C  -10.217  -0.144   8.633 1.00 . A A .  69 VAL CA   1 1 
        3  4442 1 1  69 VAL CB   C  -11.449  -1.069   8.738 1.00 . A A .  69 VAL CB   1 1 
        3  4443 1 1  69 VAL CG1  C  -11.464  -1.873  10.043 1.00 . A A .  69 VAL CG1  1 1 
        3  4444 1 1  69 VAL CG2  C  -12.760  -0.269   8.670 1.00 . A A .  69 VAL CG2  1 1 
        3  4445 1 1  69 VAL H    H  -10.612   0.249   6.581 1.00 . A A .  69 VAL H    1 1 
        3  4446 1 1  69 VAL HA   H  -10.211   0.502   9.509 1.00 . A A .  69 VAL HA   1 1 
        3  4447 1 1  69 VAL HB   H  -11.437  -1.777   7.912 1.00 . A A .  69 VAL HB   1 1 
        3  4448 1 1  69 VAL HG11 H  -11.439  -1.202  10.900 1.00 . A A .  69 VAL HG11 1 1 
        3  4449 1 1  69 VAL HG12 H  -12.367  -2.484  10.089 1.00 . A A .  69 VAL HG12 1 1 
        3  4450 1 1  69 VAL HG13 H  -10.606  -2.543  10.080 1.00 . A A .  69 VAL HG13 1 1 
        3  4451 1 1  69 VAL HG21 H  -12.786   0.475   9.466 1.00 . A A .  69 VAL HG21 1 1 
        3  4452 1 1  69 VAL HG22 H  -12.845   0.232   7.706 1.00 . A A .  69 VAL HG22 1 1 
        3  4453 1 1  69 VAL HG23 H  -13.610  -0.943   8.776 1.00 . A A .  69 VAL HG23 1 1 
        3  4454 1 1  69 VAL N    N  -10.303   0.700   7.433 1.00 . A A .  69 VAL N    1 1 
        3  4455 1 1  69 VAL O    O   -8.307  -1.124   9.699 1.00 . A A .  69 VAL O    1 1 
        3  4456 1 1  70 GLU C    C   -6.083  -1.835   6.723 1.00 . A A .  70 GLU C    1 1 
        3  4457 1 1  70 GLU CA   C   -7.351  -2.401   7.377 1.00 . A A .  70 GLU CA   1 1 
        3  4458 1 1  70 GLU CB   C   -7.792  -3.690   6.661 1.00 . A A .  70 GLU CB   1 1 
        3  4459 1 1  70 GLU CD   C   -7.747  -5.222   8.740 1.00 . A A .  70 GLU CD   1 1 
        3  4460 1 1  70 GLU CG   C   -8.579  -4.642   7.574 1.00 . A A .  70 GLU CG   1 1 
        3  4461 1 1  70 GLU H    H   -9.050  -1.283   6.657 1.00 . A A .  70 GLU H    1 1 
        3  4462 1 1  70 GLU HA   H   -7.027  -2.670   8.379 1.00 . A A .  70 GLU HA   1 1 
        3  4463 1 1  70 GLU HB2  H   -8.403  -3.431   5.795 1.00 . A A .  70 GLU HB2  1 1 
        3  4464 1 1  70 GLU HB3  H   -6.916  -4.225   6.295 1.00 . A A .  70 GLU HB3  1 1 
        3  4465 1 1  70 GLU HG2  H   -9.448  -4.109   7.967 1.00 . A A .  70 GLU HG2  1 1 
        3  4466 1 1  70 GLU HG3  H   -8.944  -5.469   6.960 1.00 . A A .  70 GLU HG3  1 1 
        3  4467 1 1  70 GLU N    N   -8.488  -1.466   7.482 1.00 . A A .  70 GLU N    1 1 
        3  4468 1 1  70 GLU O    O   -4.997  -2.351   6.985 1.00 . A A .  70 GLU O    1 1 
        3  4469 1 1  70 GLU OE1  O   -6.494  -5.212   8.683 1.00 . A A .  70 GLU OE1  1 1 
        3  4470 1 1  70 GLU OE2  O   -8.361  -5.712   9.719 1.00 . A A .  70 GLU OE2  1 1 
        3  4471 1 1  71 VAL C    C   -4.538   0.980   6.380 1.00 . A A .  71 VAL C    1 1 
        3  4472 1 1  71 VAL CA   C   -5.015  -0.060   5.371 1.00 . A A .  71 VAL CA   1 1 
        3  4473 1 1  71 VAL CB   C   -5.284   0.526   3.983 1.00 . A A .  71 VAL CB   1 1 
        3  4474 1 1  71 VAL CG1  C   -3.957   0.997   3.406 1.00 . A A .  71 VAL CG1  1 1 
        3  4475 1 1  71 VAL CG2  C   -5.822  -0.549   3.034 1.00 . A A .  71 VAL CG2  1 1 
        3  4476 1 1  71 VAL H    H   -7.096  -0.389   5.714 1.00 . A A .  71 VAL H    1 1 
        3  4477 1 1  71 VAL HA   H   -4.178  -0.736   5.200 1.00 . A A .  71 VAL HA   1 1 
        3  4478 1 1  71 VAL HB   H   -5.973   1.367   4.029 1.00 . A A .  71 VAL HB   1 1 
        3  4479 1 1  71 VAL HG11 H   -3.279   0.153   3.274 1.00 . A A .  71 VAL HG11 1 1 
        3  4480 1 1  71 VAL HG12 H   -4.152   1.473   2.446 1.00 . A A .  71 VAL HG12 1 1 
        3  4481 1 1  71 VAL HG13 H   -3.502   1.713   4.089 1.00 . A A .  71 VAL HG13 1 1 
        3  4482 1 1  71 VAL HG21 H   -5.138  -1.398   3.022 1.00 . A A .  71 VAL HG21 1 1 
        3  4483 1 1  71 VAL HG22 H   -6.791  -0.891   3.380 1.00 . A A .  71 VAL HG22 1 1 
        3  4484 1 1  71 VAL HG23 H   -5.927  -0.143   2.028 1.00 . A A .  71 VAL HG23 1 1 
        3  4485 1 1  71 VAL N    N   -6.180  -0.777   5.912 1.00 . A A .  71 VAL N    1 1 
        3  4486 1 1  71 VAL O    O   -5.054   2.095   6.476 1.00 . A A .  71 VAL O    1 1 
        3  4487 1 1  72 ASP C    C   -2.101   2.629   7.174 1.00 . A A .  72 ASP C    1 1 
        3  4488 1 1  72 ASP CA   C   -2.757   1.506   7.998 1.00 . A A .  72 ASP CA   1 1 
        3  4489 1 1  72 ASP CB   C   -1.725   0.662   8.747 1.00 . A A .  72 ASP CB   1 1 
        3  4490 1 1  72 ASP CG   C   -0.905   1.481   9.743 1.00 . A A .  72 ASP CG   1 1 
        3  4491 1 1  72 ASP H    H   -3.158  -0.341   7.020 1.00 . A A .  72 ASP H    1 1 
        3  4492 1 1  72 ASP HA   H   -3.436   1.953   8.726 1.00 . A A .  72 ASP HA   1 1 
        3  4493 1 1  72 ASP HB2  H   -2.261  -0.129   9.272 1.00 . A A .  72 ASP HB2  1 1 
        3  4494 1 1  72 ASP HB3  H   -1.050   0.190   8.031 1.00 . A A .  72 ASP HB3  1 1 
        3  4495 1 1  72 ASP N    N   -3.513   0.605   7.136 1.00 . A A .  72 ASP N    1 1 
        3  4496 1 1  72 ASP O    O   -1.639   2.400   6.058 1.00 . A A .  72 ASP O    1 1 
        3  4497 1 1  72 ASP OD1  O    0.126   2.052   9.328 1.00 . A A .  72 ASP OD1  1 1 
        3  4498 1 1  72 ASP OD2  O   -1.269   1.522  10.941 1.00 . A A .  72 ASP OD2  1 1 
        3  4499 1 1  73 GLY C    C   -2.393   5.663   5.960 1.00 . A A .  73 GLY C    1 1 
        3  4500 1 1  73 GLY CA   C   -1.492   5.017   7.018 1.00 . A A .  73 GLY CA   1 1 
        3  4501 1 1  73 GLY H    H   -2.501   3.989   8.598 1.00 . A A .  73 GLY H    1 1 
        3  4502 1 1  73 GLY HA2  H   -1.255   5.774   7.765 1.00 . A A .  73 GLY HA2  1 1 
        3  4503 1 1  73 GLY HA3  H   -0.567   4.723   6.528 1.00 . A A .  73 GLY HA3  1 1 
        3  4504 1 1  73 GLY N    N   -2.075   3.852   7.697 1.00 . A A .  73 GLY N    1 1 
        3  4505 1 1  73 GLY O    O   -2.006   6.662   5.356 1.00 . A A .  73 GLY O    1 1 
        3  4506 1 1  74 PHE C    C   -4.955   7.272   5.410 1.00 . A A .  74 PHE C    1 1 
        3  4507 1 1  74 PHE CA   C   -4.645   5.832   4.943 1.00 . A A .  74 PHE CA   1 1 
        3  4508 1 1  74 PHE CB   C   -5.891   4.936   4.950 1.00 . A A .  74 PHE CB   1 1 
        3  4509 1 1  74 PHE CD1  C   -7.008   5.157   2.692 1.00 . A A .  74 PHE CD1  1 1 
        3  4510 1 1  74 PHE CD2  C   -8.104   6.128   4.641 1.00 . A A .  74 PHE CD2  1 1 
        3  4511 1 1  74 PHE CE1  C   -8.058   5.613   1.878 1.00 . A A .  74 PHE CE1  1 1 
        3  4512 1 1  74 PHE CE2  C   -9.154   6.584   3.825 1.00 . A A .  74 PHE CE2  1 1 
        3  4513 1 1  74 PHE CG   C   -7.027   5.421   4.075 1.00 . A A .  74 PHE CG   1 1 
        3  4514 1 1  74 PHE CZ   C   -9.120   6.337   2.444 1.00 . A A .  74 PHE CZ   1 1 
        3  4515 1 1  74 PHE H    H   -3.885   4.331   6.265 1.00 . A A .  74 PHE H    1 1 
        3  4516 1 1  74 PHE HA   H   -4.272   5.897   3.920 1.00 . A A .  74 PHE HA   1 1 
        3  4517 1 1  74 PHE HB2  H   -5.605   3.942   4.603 1.00 . A A .  74 PHE HB2  1 1 
        3  4518 1 1  74 PHE HB3  H   -6.252   4.834   5.975 1.00 . A A .  74 PHE HB3  1 1 
        3  4519 1 1  74 PHE HD1  H   -6.186   4.608   2.254 1.00 . A A .  74 PHE HD1  1 1 
        3  4520 1 1  74 PHE HD2  H   -8.129   6.325   5.704 1.00 . A A .  74 PHE HD2  1 1 
        3  4521 1 1  74 PHE HE1  H   -8.048   5.423   0.816 1.00 . A A .  74 PHE HE1  1 1 
        3  4522 1 1  74 PHE HE2  H   -9.985   7.127   4.256 1.00 . A A .  74 PHE HE2  1 1 
        3  4523 1 1  74 PHE HZ   H   -9.907   6.718   1.813 1.00 . A A .  74 PHE HZ   1 1 
        3  4524 1 1  74 PHE N    N   -3.628   5.179   5.780 1.00 . A A .  74 PHE N    1 1 
        3  4525 1 1  74 PHE O    O   -5.282   8.142   4.601 1.00 . A A .  74 PHE O    1 1 
        3  4526 1 1  75 SER C    C   -3.656   9.826   6.925 1.00 . A A .  75 SER C    1 1 
        3  4527 1 1  75 SER CA   C   -4.812   8.890   7.318 1.00 . A A .  75 SER CA   1 1 
        3  4528 1 1  75 SER CB   C   -4.807   8.728   8.842 1.00 . A A .  75 SER CB   1 1 
        3  4529 1 1  75 SER H    H   -4.484   6.800   7.312 1.00 . A A .  75 SER H    1 1 
        3  4530 1 1  75 SER HA   H   -5.743   9.379   7.032 1.00 . A A .  75 SER HA   1 1 
        3  4531 1 1  75 SER HB2  H   -4.658   9.706   9.307 1.00 . A A .  75 SER HB2  1 1 
        3  4532 1 1  75 SER HB3  H   -5.770   8.329   9.161 1.00 . A A .  75 SER HB3  1 1 
        3  4533 1 1  75 SER HG   H   -3.790   7.778  10.226 1.00 . A A .  75 SER HG   1 1 
        3  4534 1 1  75 SER N    N   -4.763   7.555   6.702 1.00 . A A .  75 SER N    1 1 
        3  4535 1 1  75 SER O    O   -3.787  11.044   7.063 1.00 . A A .  75 SER O    1 1 
        3  4536 1 1  75 SER OG   O   -3.773   7.840   9.251 1.00 . A A .  75 SER OG   1 1 
        3  4537 1 1  76 GLU C    C   -1.532  10.634   4.559 1.00 . A A .  76 GLU C    1 1 
        3  4538 1 1  76 GLU CA   C   -1.369  10.088   5.994 1.00 . A A .  76 GLU CA   1 1 
        3  4539 1 1  76 GLU CB   C   -0.076   9.251   6.090 1.00 . A A .  76 GLU CB   1 1 
        3  4540 1 1  76 GLU CD   C    1.449   7.789   7.536 1.00 . A A .  76 GLU CD   1 1 
        3  4541 1 1  76 GLU CG   C    0.226   8.725   7.503 1.00 . A A .  76 GLU CG   1 1 
        3  4542 1 1  76 GLU H    H   -2.479   8.290   6.324 1.00 . A A .  76 GLU H    1 1 
        3  4543 1 1  76 GLU HA   H   -1.265  10.945   6.661 1.00 . A A .  76 GLU HA   1 1 
        3  4544 1 1  76 GLU HB2  H   -0.140   8.411   5.399 1.00 . A A .  76 GLU HB2  1 1 
        3  4545 1 1  76 GLU HB3  H    0.759   9.876   5.771 1.00 . A A .  76 GLU HB3  1 1 
        3  4546 1 1  76 GLU HG2  H    0.404   9.576   8.166 1.00 . A A .  76 GLU HG2  1 1 
        3  4547 1 1  76 GLU HG3  H   -0.642   8.182   7.880 1.00 . A A .  76 GLU HG3  1 1 
        3  4548 1 1  76 GLU N    N   -2.533   9.297   6.427 1.00 . A A .  76 GLU N    1 1 
        3  4549 1 1  76 GLU O    O   -0.835  11.572   4.164 1.00 . A A .  76 GLU O    1 1 
        3  4550 1 1  76 GLU OE1  O    2.436   8.008   6.793 1.00 . A A .  76 GLU OE1  1 1 
        3  4551 1 1  76 GLU OE2  O    1.449   6.806   8.316 1.00 . A A .  76 GLU OE2  1 1 
        3  4552 1 1  77 LEU C    C   -3.652  11.746   2.382 1.00 . A A .  77 LEU C    1 1 
        3  4553 1 1  77 LEU CA   C   -2.793  10.470   2.416 1.00 . A A .  77 LEU CA   1 1 
        3  4554 1 1  77 LEU CB   C   -3.544   9.328   1.708 1.00 . A A .  77 LEU CB   1 1 
        3  4555 1 1  77 LEU CD1  C   -3.724   6.993   0.868 1.00 . A A .  77 LEU CD1  1 1 
        3  4556 1 1  77 LEU CD2  C   -1.480   8.061   0.906 1.00 . A A .  77 LEU CD2  1 1 
        3  4557 1 1  77 LEU CG   C   -2.824   7.972   1.624 1.00 . A A .  77 LEU CG   1 1 
        3  4558 1 1  77 LEU H    H   -3.012   9.322   4.196 1.00 . A A .  77 LEU H    1 1 
        3  4559 1 1  77 LEU HA   H   -1.872  10.675   1.873 1.00 . A A .  77 LEU HA   1 1 
        3  4560 1 1  77 LEU HB2  H   -4.481   9.166   2.238 1.00 . A A .  77 LEU HB2  1 1 
        3  4561 1 1  77 LEU HB3  H   -3.788   9.655   0.697 1.00 . A A .  77 LEU HB3  1 1 
        3  4562 1 1  77 LEU HD11 H   -3.929   7.367  -0.135 1.00 . A A .  77 LEU HD11 1 1 
        3  4563 1 1  77 LEU HD12 H   -3.236   6.026   0.788 1.00 . A A .  77 LEU HD12 1 1 
        3  4564 1 1  77 LEU HD13 H   -4.665   6.871   1.403 1.00 . A A .  77 LEU HD13 1 1 
        3  4565 1 1  77 LEU HD21 H   -0.806   8.726   1.446 1.00 . A A .  77 LEU HD21 1 1 
        3  4566 1 1  77 LEU HD22 H   -1.022   7.075   0.864 1.00 . A A .  77 LEU HD22 1 1 
        3  4567 1 1  77 LEU HD23 H   -1.626   8.438  -0.106 1.00 . A A .  77 LEU HD23 1 1 
        3  4568 1 1  77 LEU HG   H   -2.655   7.587   2.628 1.00 . A A .  77 LEU HG   1 1 
        3  4569 1 1  77 LEU N    N   -2.460  10.060   3.783 1.00 . A A .  77 LEU N    1 1 
        3  4570 1 1  77 LEU O    O   -4.424  12.018   3.309 1.00 . A A .  77 LEU O    1 1 
        3  4571 1 1  78 ARG C    C   -5.843  12.967   0.344 1.00 . A A .  78 ARG C    1 1 
        3  4572 1 1  78 ARG CA   C   -4.561  13.548   0.936 1.00 . A A .  78 ARG CA   1 1 
        3  4573 1 1  78 ARG CB   C   -3.929  14.603   0.003 1.00 . A A .  78 ARG CB   1 1 
        3  4574 1 1  78 ARG CD   C   -3.783  16.513   1.671 1.00 . A A .  78 ARG CD   1 1 
        3  4575 1 1  78 ARG CG   C   -2.995  15.573   0.742 1.00 . A A .  78 ARG CG   1 1 
        3  4576 1 1  78 ARG CZ   C   -2.499  18.664   1.880 1.00 . A A .  78 ARG CZ   1 1 
        3  4577 1 1  78 ARG H    H   -2.940  12.201   0.545 1.00 . A A .  78 ARG H    1 1 
        3  4578 1 1  78 ARG HA   H   -4.874  14.030   1.863 1.00 . A A .  78 ARG HA   1 1 
        3  4579 1 1  78 ARG HB2  H   -3.372  14.101  -0.789 1.00 . A A .  78 ARG HB2  1 1 
        3  4580 1 1  78 ARG HB3  H   -4.710  15.191  -0.484 1.00 . A A .  78 ARG HB3  1 1 
        3  4581 1 1  78 ARG HD2  H   -4.559  17.025   1.097 1.00 . A A .  78 ARG HD2  1 1 
        3  4582 1 1  78 ARG HD3  H   -4.291  15.923   2.435 1.00 . A A .  78 ARG HD3  1 1 
        3  4583 1 1  78 ARG HE   H   -2.556  17.233   3.253 1.00 . A A .  78 ARG HE   1 1 
        3  4584 1 1  78 ARG HG2  H   -2.261  15.012   1.322 1.00 . A A .  78 ARG HG2  1 1 
        3  4585 1 1  78 ARG HG3  H   -2.463  16.171   0.001 1.00 . A A .  78 ARG HG3  1 1 
        3  4586 1 1  78 ARG HH11 H   -3.467  18.563   0.134 1.00 . A A .  78 ARG HH11 1 1 
        3  4587 1 1  78 ARG HH12 H   -2.545  20.019   0.393 1.00 . A A .  78 ARG HH12 1 1 
        3  4588 1 1  78 ARG HH21 H   -1.408  19.108   3.504 1.00 . A A .  78 ARG HH21 1 1 
        3  4589 1 1  78 ARG HH22 H   -1.412  20.310   2.249 1.00 . A A .  78 ARG HH22 1 1 
        3  4590 1 1  78 ARG N    N   -3.588  12.492   1.271 1.00 . A A .  78 ARG N    1 1 
        3  4591 1 1  78 ARG NE   N   -2.896  17.488   2.338 1.00 . A A .  78 ARG NE   1 1 
        3  4592 1 1  78 ARG NH1  N   -2.863  19.120   0.714 1.00 . A A .  78 ARG NH1  1 1 
        3  4593 1 1  78 ARG NH2  N   -1.715  19.416   2.596 1.00 . A A .  78 ARG NH2  1 1 
        3  4594 1 1  78 ARG O    O   -5.875  11.820  -0.108 1.00 . A A .  78 ARG O    1 1 
        3  4595 1 1  79 TRP C    C   -8.282  12.724  -1.486 1.00 . A A .  79 TRP C    1 1 
        3  4596 1 1  79 TRP CA   C   -8.246  13.395  -0.098 1.00 . A A .  79 TRP CA   1 1 
        3  4597 1 1  79 TRP CB   C   -9.188  14.612  -0.006 1.00 . A A .  79 TRP CB   1 1 
        3  4598 1 1  79 TRP CD1  C  -11.411  14.235  -1.197 1.00 . A A .  79 TRP CD1  1 1 
        3  4599 1 1  79 TRP CD2  C   -9.975  15.484  -2.384 1.00 . A A .  79 TRP CD2  1 1 
        3  4600 1 1  79 TRP CE2  C  -11.146  15.337  -3.183 1.00 . A A .  79 TRP CE2  1 1 
        3  4601 1 1  79 TRP CE3  C   -8.904  16.222  -2.929 1.00 . A A .  79 TRP CE3  1 1 
        3  4602 1 1  79 TRP CG   C  -10.172  14.773  -1.126 1.00 . A A .  79 TRP CG   1 1 
        3  4603 1 1  79 TRP CH2  C  -10.168  16.637  -4.979 1.00 . A A .  79 TRP CH2  1 1 
        3  4604 1 1  79 TRP CZ2  C  -11.254  15.907  -4.462 1.00 . A A .  79 TRP CZ2  1 1 
        3  4605 1 1  79 TRP CZ3  C   -8.997  16.792  -4.213 1.00 . A A .  79 TRP CZ3  1 1 
        3  4606 1 1  79 TRP H    H   -6.778  14.711   0.712 1.00 . A A .  79 TRP H    1 1 
        3  4607 1 1  79 TRP HA   H   -8.602  12.665   0.620 1.00 . A A .  79 TRP HA   1 1 
        3  4608 1 1  79 TRP HB2  H   -9.733  14.559   0.938 1.00 . A A .  79 TRP HB2  1 1 
        3  4609 1 1  79 TRP HB3  H   -8.594  15.527   0.024 1.00 . A A .  79 TRP HB3  1 1 
        3  4610 1 1  79 TRP HD1  H  -11.868  13.618  -0.429 1.00 . A A .  79 TRP HD1  1 1 
        3  4611 1 1  79 TRP HE1  H  -12.908  14.243  -2.697 1.00 . A A .  79 TRP HE1  1 1 
        3  4612 1 1  79 TRP HE3  H   -8.001  16.334  -2.346 1.00 . A A .  79 TRP HE3  1 1 
        3  4613 1 1  79 TRP HH2  H  -10.232  17.081  -5.966 1.00 . A A .  79 TRP HH2  1 1 
        3  4614 1 1  79 TRP HZ2  H  -12.160  15.782  -5.039 1.00 . A A .  79 TRP HZ2  1 1 
        3  4615 1 1  79 TRP HZ3  H   -8.156  17.346  -4.613 1.00 . A A .  79 TRP HZ3  1 1 
        3  4616 1 1  79 TRP N    N   -6.896  13.785   0.326 1.00 . A A .  79 TRP N    1 1 
        3  4617 1 1  79 TRP NE1  N  -11.990  14.569  -2.409 1.00 . A A .  79 TRP NE1  1 1 
        3  4618 1 1  79 TRP O    O   -9.019  11.758  -1.683 1.00 . A A .  79 TRP O    1 1 
        3  4619 1 1  80 ASP C    C   -6.848  11.224  -3.901 1.00 . A A .  80 ASP C    1 1 
        3  4620 1 1  80 ASP CA   C   -7.434  12.645  -3.798 1.00 . A A .  80 ASP CA   1 1 
        3  4621 1 1  80 ASP CB   C   -6.699  13.612  -4.733 1.00 . A A .  80 ASP CB   1 1 
        3  4622 1 1  80 ASP CG   C   -6.889  13.220  -6.210 1.00 . A A .  80 ASP CG   1 1 
        3  4623 1 1  80 ASP H    H   -6.864  13.970  -2.217 1.00 . A A .  80 ASP H    1 1 
        3  4624 1 1  80 ASP HA   H   -8.466  12.597  -4.136 1.00 . A A .  80 ASP HA   1 1 
        3  4625 1 1  80 ASP HB2  H   -7.089  14.620  -4.588 1.00 . A A .  80 ASP HB2  1 1 
        3  4626 1 1  80 ASP HB3  H   -5.637  13.619  -4.474 1.00 . A A .  80 ASP HB3  1 1 
        3  4627 1 1  80 ASP N    N   -7.449  13.177  -2.431 1.00 . A A .  80 ASP N    1 1 
        3  4628 1 1  80 ASP O    O   -7.276  10.439  -4.748 1.00 . A A .  80 ASP O    1 1 
        3  4629 1 1  80 ASP OD1  O   -8.049  12.987  -6.631 1.00 . A A .  80 ASP OD1  1 1 
        3  4630 1 1  80 ASP OD2  O   -5.882  13.173  -6.958 1.00 . A A .  80 ASP OD2  1 1 
        3  4631 1 1  81 ASP C    C   -6.276   8.630  -2.001 1.00 . A A .  81 ASP C    1 1 
        3  4632 1 1  81 ASP CA   C   -5.413   9.482  -2.931 1.00 . A A .  81 ASP CA   1 1 
        3  4633 1 1  81 ASP CB   C   -3.933   9.420  -2.561 1.00 . A A .  81 ASP CB   1 1 
        3  4634 1 1  81 ASP CG   C   -3.046   9.973  -3.682 1.00 . A A .  81 ASP CG   1 1 
        3  4635 1 1  81 ASP H    H   -5.678  11.474  -2.269 1.00 . A A .  81 ASP H    1 1 
        3  4636 1 1  81 ASP HA   H   -5.487   9.040  -3.918 1.00 . A A .  81 ASP HA   1 1 
        3  4637 1 1  81 ASP HB2  H   -3.767   9.958  -1.629 1.00 . A A .  81 ASP HB2  1 1 
        3  4638 1 1  81 ASP HB3  H   -3.676   8.369  -2.417 1.00 . A A .  81 ASP HB3  1 1 
        3  4639 1 1  81 ASP N    N   -5.905  10.853  -3.027 1.00 . A A .  81 ASP N    1 1 
        3  4640 1 1  81 ASP O    O   -6.457   7.447  -2.267 1.00 . A A .  81 ASP O    1 1 
        3  4641 1 1  81 ASP OD1  O   -2.993   9.344  -4.767 1.00 . A A .  81 ASP OD1  1 1 
        3  4642 1 1  81 ASP OD2  O   -2.384  11.014  -3.461 1.00 . A A .  81 ASP OD2  1 1 
        3  4643 1 1  82 GLN C    C   -9.064   8.026  -1.105 1.00 . A A .  82 GLN C    1 1 
        3  4644 1 1  82 GLN CA   C   -7.927   8.510  -0.196 1.00 . A A .  82 GLN CA   1 1 
        3  4645 1 1  82 GLN CB   C   -8.459   9.404   0.933 1.00 . A A .  82 GLN CB   1 1 
        3  4646 1 1  82 GLN CD   C   -7.911  10.334   3.259 1.00 . A A .  82 GLN CD   1 1 
        3  4647 1 1  82 GLN CG   C   -7.449   9.474   2.084 1.00 . A A .  82 GLN CG   1 1 
        3  4648 1 1  82 GLN H    H   -6.695  10.177  -0.749 1.00 . A A .  82 GLN H    1 1 
        3  4649 1 1  82 GLN HA   H   -7.473   7.624   0.246 1.00 . A A .  82 GLN HA   1 1 
        3  4650 1 1  82 GLN HB2  H   -8.661  10.403   0.551 1.00 . A A .  82 GLN HB2  1 1 
        3  4651 1 1  82 GLN HB3  H   -9.391   8.988   1.316 1.00 . A A .  82 GLN HB3  1 1 
        3  4652 1 1  82 GLN HE21 H   -6.550   9.496   4.489 1.00 . A A .  82 GLN HE21 1 1 
        3  4653 1 1  82 GLN HE22 H   -7.578  10.756   5.187 1.00 . A A .  82 GLN HE22 1 1 
        3  4654 1 1  82 GLN HG2  H   -7.265   8.459   2.440 1.00 . A A .  82 GLN HG2  1 1 
        3  4655 1 1  82 GLN HG3  H   -6.515   9.886   1.712 1.00 . A A .  82 GLN HG3  1 1 
        3  4656 1 1  82 GLN N    N   -6.899   9.209  -0.970 1.00 . A A .  82 GLN N    1 1 
        3  4657 1 1  82 GLN NE2  N   -7.300  10.179   4.412 1.00 . A A .  82 GLN NE2  1 1 
        3  4658 1 1  82 GLN O    O   -9.392   6.838  -1.089 1.00 . A A .  82 GLN O    1 1 
        3  4659 1 1  82 GLN OE1  O   -8.808  11.164   3.168 1.00 . A A .  82 GLN OE1  1 1 
        3  4660 1 1  83 GLN C    C  -10.200   7.486  -3.963 1.00 . A A .  83 GLN C    1 1 
        3  4661 1 1  83 GLN CA   C  -10.672   8.482  -2.889 1.00 . A A .  83 GLN CA   1 1 
        3  4662 1 1  83 GLN CB   C  -11.418   9.699  -3.468 1.00 . A A .  83 GLN CB   1 1 
        3  4663 1 1  83 GLN CD   C  -11.355  11.812  -4.927 1.00 . A A .  83 GLN CD   1 1 
        3  4664 1 1  83 GLN CG   C  -10.623  10.540  -4.479 1.00 . A A .  83 GLN CG   1 1 
        3  4665 1 1  83 GLN H    H   -9.321   9.864  -1.943 1.00 . A A .  83 GLN H    1 1 
        3  4666 1 1  83 GLN HA   H  -11.410   7.941  -2.293 1.00 . A A .  83 GLN HA   1 1 
        3  4667 1 1  83 GLN HB2  H  -12.325   9.341  -3.959 1.00 . A A .  83 GLN HB2  1 1 
        3  4668 1 1  83 GLN HB3  H  -11.720  10.339  -2.636 1.00 . A A .  83 GLN HB3  1 1 
        3  4669 1 1  83 GLN HE21 H   -9.751  12.548  -5.975 1.00 . A A .  83 GLN HE21 1 1 
        3  4670 1 1  83 GLN HE22 H  -11.208  13.522  -5.943 1.00 . A A .  83 GLN HE22 1 1 
        3  4671 1 1  83 GLN HG2  H   -9.689  10.831  -4.016 1.00 . A A .  83 GLN HG2  1 1 
        3  4672 1 1  83 GLN HG3  H  -10.396   9.942  -5.361 1.00 . A A .  83 GLN HG3  1 1 
        3  4673 1 1  83 GLN N    N   -9.607   8.889  -1.970 1.00 . A A .  83 GLN N    1 1 
        3  4674 1 1  83 GLN NE2  N  -10.724  12.678  -5.690 1.00 . A A .  83 GLN NE2  1 1 
        3  4675 1 1  83 GLN O    O  -10.979   6.606  -4.321 1.00 . A A .  83 GLN O    1 1 
        3  4676 1 1  83 GLN OE1  O  -12.516  12.055  -4.617 1.00 . A A .  83 GLN OE1  1 1 
        3  4677 1 1  84 LYS C    C   -8.072   5.252  -4.843 1.00 . A A .  84 LYS C    1 1 
        3  4678 1 1  84 LYS CA   C   -8.426   6.597  -5.444 1.00 . A A .  84 LYS CA   1 1 
        3  4679 1 1  84 LYS CB   C   -7.284   7.234  -6.253 1.00 . A A .  84 LYS CB   1 1 
        3  4680 1 1  84 LYS CD   C   -5.081   5.955  -6.230 1.00 . A A .  84 LYS CD   1 1 
        3  4681 1 1  84 LYS CE   C   -3.589   6.016  -5.880 1.00 . A A .  84 LYS CE   1 1 
        3  4682 1 1  84 LYS CG   C   -5.857   7.164  -5.705 1.00 . A A .  84 LYS CG   1 1 
        3  4683 1 1  84 LYS H    H   -8.280   8.184  -4.055 1.00 . A A .  84 LYS H    1 1 
        3  4684 1 1  84 LYS HA   H   -9.230   6.403  -6.154 1.00 . A A .  84 LYS HA   1 1 
        3  4685 1 1  84 LYS HB2  H   -7.277   6.759  -7.230 1.00 . A A .  84 LYS HB2  1 1 
        3  4686 1 1  84 LYS HB3  H   -7.514   8.288  -6.385 1.00 . A A .  84 LYS HB3  1 1 
        3  4687 1 1  84 LYS HD2  H   -5.513   5.060  -5.785 1.00 . A A .  84 LYS HD2  1 1 
        3  4688 1 1  84 LYS HD3  H   -5.189   5.889  -7.313 1.00 . A A .  84 LYS HD3  1 1 
        3  4689 1 1  84 LYS HE2  H   -3.479   6.049  -4.793 1.00 . A A .  84 LYS HE2  1 1 
        3  4690 1 1  84 LYS HE3  H   -3.119   5.093  -6.231 1.00 . A A .  84 LYS HE3  1 1 
        3  4691 1 1  84 LYS HG2  H   -5.347   8.076  -6.015 1.00 . A A .  84 LYS HG2  1 1 
        3  4692 1 1  84 LYS HG3  H   -5.876   7.119  -4.625 1.00 . A A .  84 LYS HG3  1 1 
        3  4693 1 1  84 LYS HZ1  H   -3.106   8.042  -5.977 1.00 . A A .  84 LYS HZ1  1 1 
        3  4694 1 1  84 LYS HZ2  H   -1.898   7.076  -6.468 1.00 . A A .  84 LYS HZ2  1 1 
        3  4695 1 1  84 LYS HZ3  H   -3.172   7.314  -7.461 1.00 . A A .  84 LYS HZ3  1 1 
        3  4696 1 1  84 LYS N    N   -8.939   7.527  -4.432 1.00 . A A .  84 LYS N    1 1 
        3  4697 1 1  84 LYS NZ   N   -2.902   7.184  -6.497 1.00 . A A .  84 LYS NZ   1 1 
        3  4698 1 1  84 LYS O    O   -8.300   4.235  -5.484 1.00 . A A .  84 LYS O    1 1 
        3  4699 1 1  85 VAL C    C   -8.623   3.275  -2.514 1.00 . A A .  85 VAL C    1 1 
        3  4700 1 1  85 VAL CA   C   -7.308   3.966  -2.885 1.00 . A A .  85 VAL CA   1 1 
        3  4701 1 1  85 VAL CB   C   -6.398   4.229  -1.666 1.00 . A A .  85 VAL CB   1 1 
        3  4702 1 1  85 VAL CG1  C   -6.255   3.036  -0.705 1.00 . A A .  85 VAL CG1  1 1 
        3  4703 1 1  85 VAL CG2  C   -4.995   4.619  -2.158 1.00 . A A .  85 VAL CG2  1 1 
        3  4704 1 1  85 VAL H    H   -7.384   6.114  -3.145 1.00 . A A .  85 VAL H    1 1 
        3  4705 1 1  85 VAL HA   H   -6.780   3.300  -3.575 1.00 . A A .  85 VAL HA   1 1 
        3  4706 1 1  85 VAL HB   H   -6.810   5.062  -1.099 1.00 . A A .  85 VAL HB   1 1 
        3  4707 1 1  85 VAL HG11 H   -7.211   2.817  -0.225 1.00 . A A .  85 VAL HG11 1 1 
        3  4708 1 1  85 VAL HG12 H   -5.900   2.152  -1.238 1.00 . A A .  85 VAL HG12 1 1 
        3  4709 1 1  85 VAL HG13 H   -5.541   3.280   0.083 1.00 . A A .  85 VAL HG13 1 1 
        3  4710 1 1  85 VAL HG21 H   -4.411   5.002  -1.323 1.00 . A A .  85 VAL HG21 1 1 
        3  4711 1 1  85 VAL HG22 H   -4.490   3.752  -2.576 1.00 . A A .  85 VAL HG22 1 1 
        3  4712 1 1  85 VAL HG23 H   -5.058   5.394  -2.926 1.00 . A A .  85 VAL HG23 1 1 
        3  4713 1 1  85 VAL N    N   -7.585   5.221  -3.603 1.00 . A A .  85 VAL N    1 1 
        3  4714 1 1  85 VAL O    O   -8.753   2.070  -2.732 1.00 . A A .  85 VAL O    1 1 
        3  4715 1 1  86 LYS C    C  -11.629   3.008  -3.203 1.00 . A A .  86 LYS C    1 1 
        3  4716 1 1  86 LYS CA   C  -11.013   3.506  -1.890 1.00 . A A .  86 LYS CA   1 1 
        3  4717 1 1  86 LYS CB   C  -11.917   4.554  -1.215 1.00 . A A .  86 LYS CB   1 1 
        3  4718 1 1  86 LYS CD   C  -12.455   5.806   0.958 1.00 . A A .  86 LYS CD   1 1 
        3  4719 1 1  86 LYS CE   C  -13.862   5.249   1.201 1.00 . A A .  86 LYS CE   1 1 
        3  4720 1 1  86 LYS CG   C  -11.546   4.778   0.262 1.00 . A A .  86 LYS CG   1 1 
        3  4721 1 1  86 LYS H    H   -9.475   5.014  -1.891 1.00 . A A .  86 LYS H    1 1 
        3  4722 1 1  86 LYS HA   H  -10.961   2.633  -1.238 1.00 . A A .  86 LYS HA   1 1 
        3  4723 1 1  86 LYS HB2  H  -11.854   5.498  -1.758 1.00 . A A .  86 LYS HB2  1 1 
        3  4724 1 1  86 LYS HB3  H  -12.948   4.200  -1.265 1.00 . A A .  86 LYS HB3  1 1 
        3  4725 1 1  86 LYS HD2  H  -12.023   6.054   1.927 1.00 . A A .  86 LYS HD2  1 1 
        3  4726 1 1  86 LYS HD3  H  -12.504   6.714   0.355 1.00 . A A .  86 LYS HD3  1 1 
        3  4727 1 1  86 LYS HE2  H  -14.296   4.943   0.246 1.00 . A A .  86 LYS HE2  1 1 
        3  4728 1 1  86 LYS HE3  H  -13.767   4.362   1.834 1.00 . A A .  86 LYS HE3  1 1 
        3  4729 1 1  86 LYS HG2  H  -11.606   3.834   0.799 1.00 . A A .  86 LYS HG2  1 1 
        3  4730 1 1  86 LYS HG3  H  -10.516   5.125   0.326 1.00 . A A .  86 LYS HG3  1 1 
        3  4731 1 1  86 LYS HZ1  H  -15.667   5.869   2.026 1.00 . A A .  86 LYS HZ1  1 1 
        3  4732 1 1  86 LYS HZ2  H  -14.371   6.535   2.758 1.00 . A A .  86 LYS HZ2  1 1 
        3  4733 1 1  86 LYS HZ3  H  -14.854   7.079   1.293 1.00 . A A .  86 LYS HZ3  1 1 
        3  4734 1 1  86 LYS N    N   -9.647   4.030  -2.081 1.00 . A A .  86 LYS N    1 1 
        3  4735 1 1  86 LYS NZ   N  -14.744   6.249   1.862 1.00 . A A .  86 LYS NZ   1 1 
        3  4736 1 1  86 LYS O    O  -12.112   1.877  -3.244 1.00 . A A .  86 LYS O    1 1 
        3  4737 1 1  87 LYS C    C  -11.317   2.128  -6.148 1.00 . A A .  87 LYS C    1 1 
        3  4738 1 1  87 LYS CA   C  -12.065   3.350  -5.617 1.00 . A A .  87 LYS CA   1 1 
        3  4739 1 1  87 LYS CB   C  -12.048   4.497  -6.650 1.00 . A A .  87 LYS CB   1 1 
        3  4740 1 1  87 LYS CD   C  -13.966   5.893  -5.603 1.00 . A A .  87 LYS CD   1 1 
        3  4741 1 1  87 LYS CE   C  -15.358   6.457  -5.917 1.00 . A A .  87 LYS CE   1 1 
        3  4742 1 1  87 LYS CG   C  -13.418   5.170  -6.841 1.00 . A A .  87 LYS CG   1 1 
        3  4743 1 1  87 LYS H    H  -11.152   4.711  -4.200 1.00 . A A .  87 LYS H    1 1 
        3  4744 1 1  87 LYS HA   H  -13.097   3.016  -5.497 1.00 . A A .  87 LYS HA   1 1 
        3  4745 1 1  87 LYS HB2  H  -11.294   5.239  -6.395 1.00 . A A .  87 LYS HB2  1 1 
        3  4746 1 1  87 LYS HB3  H  -11.766   4.088  -7.622 1.00 . A A .  87 LYS HB3  1 1 
        3  4747 1 1  87 LYS HD2  H  -14.035   5.199  -4.765 1.00 . A A .  87 LYS HD2  1 1 
        3  4748 1 1  87 LYS HD3  H  -13.298   6.713  -5.341 1.00 . A A .  87 LYS HD3  1 1 
        3  4749 1 1  87 LYS HE2  H  -15.277   7.134  -6.773 1.00 . A A .  87 LYS HE2  1 1 
        3  4750 1 1  87 LYS HE3  H  -16.014   5.631  -6.207 1.00 . A A .  87 LYS HE3  1 1 
        3  4751 1 1  87 LYS HG2  H  -13.329   5.894  -7.654 1.00 . A A .  87 LYS HG2  1 1 
        3  4752 1 1  87 LYS HG3  H  -14.134   4.408  -7.153 1.00 . A A .  87 LYS HG3  1 1 
        3  4753 1 1  87 LYS HZ1  H  -16.854   7.548  -4.979 1.00 . A A .  87 LYS HZ1  1 1 
        3  4754 1 1  87 LYS HZ2  H  -16.043   6.570  -3.955 1.00 . A A .  87 LYS HZ2  1 1 
        3  4755 1 1  87 LYS HZ3  H  -15.358   7.962  -4.480 1.00 . A A .  87 LYS HZ3  1 1 
        3  4756 1 1  87 LYS N    N  -11.556   3.782  -4.296 1.00 . A A .  87 LYS N    1 1 
        3  4757 1 1  87 LYS NZ   N  -15.937   7.181  -4.755 1.00 . A A .  87 LYS NZ   1 1 
        3  4758 1 1  87 LYS O    O  -11.958   1.211  -6.646 1.00 . A A .  87 LYS O    1 1 
        3  4759 1 1  88 THR C    C   -9.473  -0.352  -5.621 1.00 . A A .  88 THR C    1 1 
        3  4760 1 1  88 THR CA   C   -9.181   0.916  -6.431 1.00 . A A .  88 THR CA   1 1 
        3  4761 1 1  88 THR CB   C   -7.683   1.255  -6.411 1.00 . A A .  88 THR CB   1 1 
        3  4762 1 1  88 THR CG2  C   -6.851   0.133  -7.014 1.00 . A A .  88 THR CG2  1 1 
        3  4763 1 1  88 THR H    H   -9.514   2.870  -5.626 1.00 . A A .  88 THR H    1 1 
        3  4764 1 1  88 THR HA   H   -9.433   0.709  -7.466 1.00 . A A .  88 THR HA   1 1 
        3  4765 1 1  88 THR HB   H   -7.351   1.454  -5.392 1.00 . A A .  88 THR HB   1 1 
        3  4766 1 1  88 THR HG1  H   -7.748   3.157  -6.726 1.00 . A A .  88 THR HG1  1 1 
        3  4767 1 1  88 THR HG21 H   -7.246  -0.118  -7.994 1.00 . A A .  88 THR HG21 1 1 
        3  4768 1 1  88 THR HG22 H   -5.815   0.452  -7.109 1.00 . A A .  88 THR HG22 1 1 
        3  4769 1 1  88 THR HG23 H   -6.896  -0.739  -6.368 1.00 . A A .  88 THR HG23 1 1 
        3  4770 1 1  88 THR N    N   -9.996   2.058  -5.989 1.00 . A A .  88 THR N    1 1 
        3  4771 1 1  88 THR O    O   -9.517  -1.443  -6.190 1.00 . A A .  88 THR O    1 1 
        3  4772 1 1  88 THR OG1  O   -7.437   2.378  -7.226 1.00 . A A .  88 THR OG1  1 1 
        3  4773 1 1  89 ALA C    C  -11.574  -1.843  -3.850 1.00 . A A .  89 ALA C    1 1 
        3  4774 1 1  89 ALA CA   C  -10.169  -1.342  -3.476 1.00 . A A .  89 ALA CA   1 1 
        3  4775 1 1  89 ALA CB   C  -10.108  -0.866  -2.025 1.00 . A A .  89 ALA CB   1 1 
        3  4776 1 1  89 ALA H    H   -9.767   0.692  -3.902 1.00 . A A .  89 ALA H    1 1 
        3  4777 1 1  89 ALA HA   H   -9.463  -2.165  -3.599 1.00 . A A .  89 ALA HA   1 1 
        3  4778 1 1  89 ALA HB1  H  -10.763  -0.009  -1.879 1.00 . A A .  89 ALA HB1  1 1 
        3  4779 1 1  89 ALA HB2  H  -10.432  -1.671  -1.374 1.00 . A A .  89 ALA HB2  1 1 
        3  4780 1 1  89 ALA HB3  H   -9.086  -0.589  -1.771 1.00 . A A .  89 ALA HB3  1 1 
        3  4781 1 1  89 ALA N    N   -9.764  -0.225  -4.324 1.00 . A A .  89 ALA N    1 1 
        3  4782 1 1  89 ALA O    O  -11.796  -3.051  -3.949 1.00 . A A .  89 ALA O    1 1 
        3  4783 1 1  90 GLU C    C  -13.822  -1.871  -6.061 1.00 . A A .  90 GLU C    1 1 
        3  4784 1 1  90 GLU CA   C  -13.841  -1.257  -4.649 1.00 . A A .  90 GLU CA   1 1 
        3  4785 1 1  90 GLU CB   C  -14.734  -0.003  -4.632 1.00 . A A .  90 GLU CB   1 1 
        3  4786 1 1  90 GLU CD   C  -16.268  -0.466  -2.654 1.00 . A A .  90 GLU CD   1 1 
        3  4787 1 1  90 GLU CG   C  -15.154   0.437  -3.224 1.00 . A A .  90 GLU CG   1 1 
        3  4788 1 1  90 GLU H    H  -12.260   0.057  -4.030 1.00 . A A .  90 GLU H    1 1 
        3  4789 1 1  90 GLU HA   H  -14.257  -2.002  -3.979 1.00 . A A .  90 GLU HA   1 1 
        3  4790 1 1  90 GLU HB2  H  -14.200   0.817  -5.112 1.00 . A A .  90 GLU HB2  1 1 
        3  4791 1 1  90 GLU HB3  H  -15.635  -0.194  -5.216 1.00 . A A .  90 GLU HB3  1 1 
        3  4792 1 1  90 GLU HG2  H  -14.288   0.437  -2.560 1.00 . A A .  90 GLU HG2  1 1 
        3  4793 1 1  90 GLU HG3  H  -15.518   1.466  -3.286 1.00 . A A .  90 GLU HG3  1 1 
        3  4794 1 1  90 GLU N    N  -12.495  -0.923  -4.161 1.00 . A A .  90 GLU N    1 1 
        3  4795 1 1  90 GLU O    O  -14.637  -2.737  -6.383 1.00 . A A .  90 GLU O    1 1 
        3  4796 1 1  90 GLU OE1  O  -17.467  -0.166  -2.873 1.00 . A A .  90 GLU OE1  1 1 
        3  4797 1 1  90 GLU OE2  O  -15.956  -1.478  -1.981 1.00 . A A .  90 GLU OE2  1 1 
        3  4798 1 1  91 ALA C    C  -11.888  -3.337  -8.262 1.00 . A A .  91 ALA C    1 1 
        3  4799 1 1  91 ALA CA   C  -12.597  -1.963  -8.232 1.00 . A A .  91 ALA CA   1 1 
        3  4800 1 1  91 ALA CB   C  -11.786  -0.881  -8.963 1.00 . A A .  91 ALA CB   1 1 
        3  4801 1 1  91 ALA H    H  -12.287  -0.681  -6.575 1.00 . A A .  91 ALA H    1 1 
        3  4802 1 1  91 ALA HA   H  -13.553  -2.080  -8.745 1.00 . A A .  91 ALA HA   1 1 
        3  4803 1 1  91 ALA HB1  H  -10.848  -0.693  -8.438 1.00 . A A .  91 ALA HB1  1 1 
        3  4804 1 1  91 ALA HB2  H  -11.573  -1.195  -9.984 1.00 . A A .  91 ALA HB2  1 1 
        3  4805 1 1  91 ALA HB3  H  -12.353   0.052  -8.990 1.00 . A A .  91 ALA HB3  1 1 
        3  4806 1 1  91 ALA N    N  -12.856  -1.460  -6.885 1.00 . A A .  91 ALA N    1 1 
        3  4807 1 1  91 ALA O    O  -11.715  -3.916  -9.338 1.00 . A A .  91 ALA O    1 1 
        3  4808 1 1  92 GLY C    C   -9.283  -5.060  -7.512 1.00 . A A .  92 GLY C    1 1 
        3  4809 1 1  92 GLY CA   C  -10.729  -5.135  -7.000 1.00 . A A .  92 GLY CA   1 1 
        3  4810 1 1  92 GLY H    H  -11.650  -3.357  -6.252 1.00 . A A .  92 GLY H    1 1 
        3  4811 1 1  92 GLY HA2  H  -10.685  -5.421  -5.949 1.00 . A A .  92 GLY HA2  1 1 
        3  4812 1 1  92 GLY HA3  H  -11.256  -5.917  -7.548 1.00 . A A .  92 GLY HA3  1 1 
        3  4813 1 1  92 GLY N    N  -11.469  -3.871  -7.105 1.00 . A A .  92 GLY N    1 1 
        3  4814 1 1  92 GLY O    O   -8.725  -6.075  -7.939 1.00 . A A .  92 GLY O    1 1 
        3  4815 1 1  93 GLY C    C   -7.073  -3.085  -9.265 1.00 . A A .  93 GLY C    1 1 
        3  4816 1 1  93 GLY CA   C   -7.291  -3.615  -7.845 1.00 . A A .  93 GLY CA   1 1 
        3  4817 1 1  93 GLY H    H   -9.198  -3.080  -7.111 1.00 . A A .  93 GLY H    1 1 
        3  4818 1 1  93 GLY HA2  H   -6.899  -2.879  -7.148 1.00 . A A .  93 GLY HA2  1 1 
        3  4819 1 1  93 GLY HA3  H   -6.713  -4.529  -7.729 1.00 . A A .  93 GLY HA3  1 1 
        3  4820 1 1  93 GLY N    N   -8.680  -3.869  -7.482 1.00 . A A .  93 GLY N    1 1 
        3  4821 1 1  93 GLY O    O   -7.766  -3.463 -10.212 1.00 . A A .  93 GLY O    1 1 
        3  4822 1 1  94 VAL C    C   -4.032  -1.796 -10.713 1.00 . A A .  94 VAL C    1 1 
        3  4823 1 1  94 VAL CA   C   -5.553  -1.669 -10.668 1.00 . A A .  94 VAL CA   1 1 
        3  4824 1 1  94 VAL CB   C   -5.974  -0.201 -10.888 1.00 . A A .  94 VAL CB   1 1 
        3  4825 1 1  94 VAL CG1  C   -5.307   0.402 -12.137 1.00 . A A .  94 VAL CG1  1 1 
        3  4826 1 1  94 VAL CG2  C   -7.493  -0.093 -11.075 1.00 . A A .  94 VAL CG2  1 1 
        3  4827 1 1  94 VAL H    H   -5.572  -1.955  -8.555 1.00 . A A .  94 VAL H    1 1 
        3  4828 1 1  94 VAL HA   H   -5.957  -2.255 -11.495 1.00 . A A .  94 VAL HA   1 1 
        3  4829 1 1  94 VAL HB   H   -5.684   0.393 -10.021 1.00 . A A .  94 VAL HB   1 1 
        3  4830 1 1  94 VAL HG11 H   -4.227   0.480 -11.997 1.00 . A A .  94 VAL HG11 1 1 
        3  4831 1 1  94 VAL HG12 H   -5.504  -0.226 -13.007 1.00 . A A .  94 VAL HG12 1 1 
        3  4832 1 1  94 VAL HG13 H   -5.694   1.405 -12.320 1.00 . A A .  94 VAL HG13 1 1 
        3  4833 1 1  94 VAL HG21 H   -7.803  -0.677 -11.943 1.00 . A A .  94 VAL HG21 1 1 
        3  4834 1 1  94 VAL HG22 H   -8.010  -0.468 -10.194 1.00 . A A .  94 VAL HG22 1 1 
        3  4835 1 1  94 VAL HG23 H   -7.774   0.949 -11.221 1.00 . A A .  94 VAL HG23 1 1 
        3  4836 1 1  94 VAL N    N   -6.067  -2.215  -9.398 1.00 . A A .  94 VAL N    1 1 
        3  4837 1 1  94 VAL O    O   -3.338  -1.479  -9.746 1.00 . A A .  94 VAL O    1 1 
        3  4838 1 1  95 THR C    C   -1.479  -1.682 -13.171 1.00 . A A .  95 THR C    1 1 
        3  4839 1 1  95 THR CA   C   -2.097  -2.564 -12.078 1.00 . A A .  95 THR CA   1 1 
        3  4840 1 1  95 THR CB   C   -1.940  -4.063 -12.391 1.00 . A A .  95 THR CB   1 1 
        3  4841 1 1  95 THR CG2  C   -2.552  -4.921 -11.280 1.00 . A A .  95 THR CG2  1 1 
        3  4842 1 1  95 THR H    H   -4.143  -2.449 -12.619 1.00 . A A .  95 THR H    1 1 
        3  4843 1 1  95 THR HA   H   -1.541  -2.375 -11.160 1.00 . A A .  95 THR HA   1 1 
        3  4844 1 1  95 THR HB   H   -0.880  -4.300 -12.483 1.00 . A A .  95 THR HB   1 1 
        3  4845 1 1  95 THR HG1  H   -2.442  -5.335 -13.775 1.00 . A A .  95 THR HG1  1 1 
        3  4846 1 1  95 THR HG21 H   -3.636  -4.791 -11.254 1.00 . A A .  95 THR HG21 1 1 
        3  4847 1 1  95 THR HG22 H   -2.323  -5.973 -11.454 1.00 . A A .  95 THR HG22 1 1 
        3  4848 1 1  95 THR HG23 H   -2.139  -4.620 -10.317 1.00 . A A .  95 THR HG23 1 1 
        3  4849 1 1  95 THR N    N   -3.514  -2.241 -11.857 1.00 . A A .  95 THR N    1 1 
        3  4850 1 1  95 THR O    O   -2.186  -1.064 -13.973 1.00 . A A .  95 THR O    1 1 
        3  4851 1 1  95 THR OG1  O   -2.601  -4.391 -13.595 1.00 . A A .  95 THR OG1  1 1 
        3  4852 1 1  96 GLY C    C    2.105  -1.018 -14.125 1.00 . A A .  96 GLY C    1 1 
        3  4853 1 1  96 GLY CA   C    0.602  -0.708 -14.099 1.00 . A A .  96 GLY CA   1 1 
        3  4854 1 1  96 GLY H    H    0.394  -2.115 -12.524 1.00 . A A .  96 GLY H    1 1 
        3  4855 1 1  96 GLY HA2  H    0.205  -0.820 -15.109 1.00 . A A .  96 GLY HA2  1 1 
        3  4856 1 1  96 GLY HA3  H    0.456   0.329 -13.794 1.00 . A A .  96 GLY HA3  1 1 
        3  4857 1 1  96 GLY N    N   -0.146  -1.585 -13.190 1.00 . A A .  96 GLY N    1 1 
        3  4858 1 1  96 GLY O    O    2.617  -1.720 -13.246 1.00 . A A .  96 GLY O    1 1 
        3  4859 1 1  97 LYS C    C    5.199  -0.088 -14.464 1.00 . A A .  97 LYS C    1 1 
        3  4860 1 1  97 LYS CA   C    4.233  -0.819 -15.417 1.00 . A A .  97 LYS CA   1 1 
        3  4861 1 1  97 LYS CB   C    4.561  -0.506 -16.891 1.00 . A A .  97 LYS CB   1 1 
        3  4862 1 1  97 LYS CD   C    4.177  -1.113 -19.324 1.00 . A A .  97 LYS CD   1 1 
        3  4863 1 1  97 LYS CE   C    3.389  -2.023 -20.275 1.00 . A A .  97 LYS CE   1 1 
        3  4864 1 1  97 LYS CG   C    3.788  -1.408 -17.869 1.00 . A A .  97 LYS CG   1 1 
        3  4865 1 1  97 LYS H    H    2.322   0.071 -15.804 1.00 . A A .  97 LYS H    1 1 
        3  4866 1 1  97 LYS HA   H    4.396  -1.886 -15.257 1.00 . A A .  97 LYS HA   1 1 
        3  4867 1 1  97 LYS HB2  H    4.332   0.540 -17.100 1.00 . A A .  97 LYS HB2  1 1 
        3  4868 1 1  97 LYS HB3  H    5.630  -0.658 -17.059 1.00 . A A .  97 LYS HB3  1 1 
        3  4869 1 1  97 LYS HD2  H    3.956  -0.068 -19.552 1.00 . A A .  97 LYS HD2  1 1 
        3  4870 1 1  97 LYS HD3  H    5.247  -1.288 -19.454 1.00 . A A .  97 LYS HD3  1 1 
        3  4871 1 1  97 LYS HE2  H    3.603  -3.066 -20.021 1.00 . A A .  97 LYS HE2  1 1 
        3  4872 1 1  97 LYS HE3  H    2.320  -1.855 -20.117 1.00 . A A .  97 LYS HE3  1 1 
        3  4873 1 1  97 LYS HG2  H    4.009  -2.452 -17.644 1.00 . A A .  97 LYS HG2  1 1 
        3  4874 1 1  97 LYS HG3  H    2.716  -1.243 -17.751 1.00 . A A .  97 LYS HG3  1 1 
        3  4875 1 1  97 LYS HZ1  H    3.214  -2.371 -22.314 1.00 . A A .  97 LYS HZ1  1 1 
        3  4876 1 1  97 LYS HZ2  H    3.533  -0.811 -21.959 1.00 . A A .  97 LYS HZ2  1 1 
        3  4877 1 1  97 LYS HZ3  H    4.720  -1.932 -21.870 1.00 . A A .  97 LYS HZ3  1 1 
        3  4878 1 1  97 LYS N    N    2.810  -0.523 -15.148 1.00 . A A .  97 LYS N    1 1 
        3  4879 1 1  97 LYS NZ   N    3.739  -1.766 -21.696 1.00 . A A .  97 LYS NZ   1 1 
        3  4880 1 1  97 LYS O    O    4.841   0.917 -13.844 1.00 . A A .  97 LYS O    1 1 
        3  4881 1 1  98 GLY C    C    8.052   1.333 -14.193 1.00 . A A .  98 GLY C    1 1 
        3  4882 1 1  98 GLY CA   C    7.536   0.008 -13.607 1.00 . A A .  98 GLY CA   1 1 
        3  4883 1 1  98 GLY H    H    6.639  -1.417 -14.918 1.00 . A A .  98 GLY H    1 1 
        3  4884 1 1  98 GLY HA2  H    7.208   0.191 -12.583 1.00 . A A .  98 GLY HA2  1 1 
        3  4885 1 1  98 GLY HA3  H    8.370  -0.693 -13.566 1.00 . A A .  98 GLY HA3  1 1 
        3  4886 1 1  98 GLY N    N    6.432  -0.596 -14.369 1.00 . A A .  98 GLY N    1 1 
        3  4887 1 1  98 GLY O    O    7.626   1.767 -15.268 1.00 . A A .  98 GLY O    1 1 
        3  4888 1 1  99 GLN C    C   11.007   3.442 -13.498 1.00 . A A .  99 GLN C    1 1 
        3  4889 1 1  99 GLN CA   C    9.497   3.322 -13.800 1.00 . A A .  99 GLN CA   1 1 
        3  4890 1 1  99 GLN CB   C    8.650   4.364 -13.034 1.00 . A A .  99 GLN CB   1 1 
        3  4891 1 1  99 GLN CD   C    8.789   6.140 -14.869 1.00 . A A .  99 GLN CD   1 1 
        3  4892 1 1  99 GLN CG   C    8.924   5.838 -13.378 1.00 . A A .  99 GLN CG   1 1 
        3  4893 1 1  99 GLN H    H    9.326   1.542 -12.637 1.00 . A A .  99 GLN H    1 1 
        3  4894 1 1  99 GLN HA   H    9.372   3.493 -14.869 1.00 . A A .  99 GLN HA   1 1 
        3  4895 1 1  99 GLN HB2  H    7.596   4.168 -13.241 1.00 . A A .  99 GLN HB2  1 1 
        3  4896 1 1  99 GLN HB3  H    8.806   4.225 -11.963 1.00 . A A .  99 GLN HB3  1 1 
        3  4897 1 1  99 GLN HE21 H    6.795   6.479 -14.760 1.00 . A A .  99 GLN HE21 1 1 
        3  4898 1 1  99 GLN HE22 H    7.531   6.625 -16.350 1.00 . A A .  99 GLN HE22 1 1 
        3  4899 1 1  99 GLN HG2  H    8.218   6.459 -12.825 1.00 . A A .  99 GLN HG2  1 1 
        3  4900 1 1  99 GLN HG3  H    9.924   6.116 -13.046 1.00 . A A .  99 GLN HG3  1 1 
        3  4901 1 1  99 GLN N    N    8.975   1.985 -13.478 1.00 . A A .  99 GLN N    1 1 
        3  4902 1 1  99 GLN NE2  N    7.605   6.436 -15.361 1.00 . A A .  99 GLN NE2  1 1 
        3  4903 1 1  99 GLN O    O   11.547   2.732 -12.649 1.00 . A A .  99 GLN O    1 1 
        3  4904 1 1  99 GLN OE1  O    9.753   6.084 -15.622 1.00 . A A .  99 GLN OE1  1 1 
        3  4905 1 1 100 ASP C    C   13.609   5.086 -12.693 1.00 . A A . 100 ASP C    1 1 
        3  4906 1 1 100 ASP CA   C   13.148   4.579 -14.080 1.00 . A A . 100 ASP CA   1 1 
        3  4907 1 1 100 ASP CB   C   13.557   5.560 -15.189 1.00 . A A . 100 ASP CB   1 1 
        3  4908 1 1 100 ASP CG   C   15.082   5.742 -15.289 1.00 . A A . 100 ASP CG   1 1 
        3  4909 1 1 100 ASP H    H   11.191   4.917 -14.870 1.00 . A A . 100 ASP H    1 1 
        3  4910 1 1 100 ASP HA   H   13.653   3.629 -14.263 1.00 . A A . 100 ASP HA   1 1 
        3  4911 1 1 100 ASP HB2  H   13.186   5.185 -16.146 1.00 . A A . 100 ASP HB2  1 1 
        3  4912 1 1 100 ASP HB3  H   13.078   6.524 -15.004 1.00 . A A . 100 ASP HB3  1 1 
        3  4913 1 1 100 ASP N    N   11.694   4.360 -14.186 1.00 . A A . 100 ASP N    1 1 
        3  4914 1 1 100 ASP O    O   14.761   4.877 -12.304 1.00 . A A . 100 ASP O    1 1 
        3  4915 1 1 100 ASP OD1  O   15.780   4.788 -15.710 1.00 . A A . 100 ASP OD1  1 1 
        3  4916 1 1 100 ASP OD2  O   15.583   6.852 -14.986 1.00 . A A . 100 ASP OD2  1 1 
        3  4917 1 1 101 GLY C    C   12.944   4.902  -9.583 1.00 . A A . 101 GLY C    1 1 
        3  4918 1 1 101 GLY CA   C   12.939   6.109 -10.527 1.00 . A A . 101 GLY CA   1 1 
        3  4919 1 1 101 GLY H    H   11.788   5.851 -12.304 1.00 . A A . 101 GLY H    1 1 
        3  4920 1 1 101 GLY HA2  H   13.896   6.625 -10.444 1.00 . A A . 101 GLY HA2  1 1 
        3  4921 1 1 101 GLY HA3  H   12.153   6.793 -10.209 1.00 . A A . 101 GLY HA3  1 1 
        3  4922 1 1 101 GLY N    N   12.711   5.714 -11.921 1.00 . A A . 101 GLY N    1 1 
        3  4923 1 1 101 GLY O    O   11.908   4.535  -9.027 1.00 . A A . 101 GLY O    1 1 
        3  4924 1 1 102 ILE C    C   14.968   3.259  -7.261 1.00 . A A . 102 ILE C    1 1 
        3  4925 1 1 102 ILE CA   C   14.349   3.046  -8.656 1.00 . A A . 102 ILE CA   1 1 
        3  4926 1 1 102 ILE CB   C   15.120   2.060  -9.570 1.00 . A A . 102 ILE CB   1 1 
        3  4927 1 1 102 ILE CD1  C   15.408  -0.437 -10.130 1.00 . A A . 102 ILE CD1  1 1 
        3  4928 1 1 102 ILE CG1  C   15.052   0.603  -9.061 1.00 . A A . 102 ILE CG1  1 1 
        3  4929 1 1 102 ILE CG2  C   16.574   2.521  -9.794 1.00 . A A . 102 ILE CG2  1 1 
        3  4930 1 1 102 ILE H    H   14.890   4.641  -9.966 1.00 . A A . 102 ILE H    1 1 
        3  4931 1 1 102 ILE HA   H   13.375   2.606  -8.450 1.00 . A A . 102 ILE HA   1 1 
        3  4932 1 1 102 ILE HB   H   14.619   2.076 -10.539 1.00 . A A . 102 ILE HB   1 1 
        3  4933 1 1 102 ILE HD11 H   16.445  -0.322 -10.443 1.00 . A A . 102 ILE HD11 1 1 
        3  4934 1 1 102 ILE HD12 H   15.280  -1.437  -9.714 1.00 . A A . 102 ILE HD12 1 1 
        3  4935 1 1 102 ILE HD13 H   14.751  -0.325 -10.992 1.00 . A A . 102 ILE HD13 1 1 
        3  4936 1 1 102 ILE HG12 H   15.725   0.467  -8.215 1.00 . A A . 102 ILE HG12 1 1 
        3  4937 1 1 102 ILE HG13 H   14.035   0.403  -8.728 1.00 . A A . 102 ILE HG13 1 1 
        3  4938 1 1 102 ILE HG21 H   17.056   1.889 -10.539 1.00 . A A . 102 ILE HG21 1 1 
        3  4939 1 1 102 ILE HG22 H   16.594   3.546 -10.164 1.00 . A A . 102 ILE HG22 1 1 
        3  4940 1 1 102 ILE HG23 H   17.139   2.463  -8.864 1.00 . A A . 102 ILE HG23 1 1 
        3  4941 1 1 102 ILE N    N   14.121   4.296  -9.406 1.00 . A A . 102 ILE N    1 1 
        3  4942 1 1 102 ILE O    O   15.271   2.305  -6.545 1.00 . A A . 102 ILE O    1 1 
        3  4943 1 1 103 GLY C    C   15.854   6.360  -5.308 1.00 . A A . 103 GLY C    1 1 
        3  4944 1 1 103 GLY CA   C   15.624   4.859  -5.505 1.00 . A A . 103 GLY CA   1 1 
        3  4945 1 1 103 GLY H    H   14.904   5.268  -7.468 1.00 . A A . 103 GLY H    1 1 
        3  4946 1 1 103 GLY HA2  H   14.883   4.519  -4.781 1.00 . A A . 103 GLY HA2  1 1 
        3  4947 1 1 103 GLY HA3  H   16.559   4.335  -5.309 1.00 . A A . 103 GLY HA3  1 1 
        3  4948 1 1 103 GLY N    N   15.145   4.513  -6.843 1.00 . A A . 103 GLY N    1 1 
        3  4949 1 1 103 GLY O    O   15.743   7.150  -6.250 1.00 . A A . 103 GLY O    1 1 
        3  4950 1 1 104 SER C    C   17.283   8.287  -2.447 1.00 . A A . 104 SER C    1 1 
        3  4951 1 1 104 SER CA   C   16.349   8.155  -3.660 1.00 . A A . 104 SER CA   1 1 
        3  4952 1 1 104 SER CB   C   14.988   8.794  -3.344 1.00 . A A . 104 SER CB   1 1 
        3  4953 1 1 104 SER H    H   16.233   6.054  -3.348 1.00 . A A . 104 SER H    1 1 
        3  4954 1 1 104 SER HA   H   16.798   8.710  -4.486 1.00 . A A . 104 SER HA   1 1 
        3  4955 1 1 104 SER HB2  H   15.129   9.828  -3.027 1.00 . A A . 104 SER HB2  1 1 
        3  4956 1 1 104 SER HB3  H   14.375   8.793  -4.245 1.00 . A A . 104 SER HB3  1 1 
        3  4957 1 1 104 SER HG   H   14.830   8.132  -1.507 1.00 . A A . 104 SER HG   1 1 
        3  4958 1 1 104 SER N    N   16.157   6.756  -4.071 1.00 . A A . 104 SER N    1 1 
        3  4959 1 1 104 SER O    O   17.399   7.361  -1.638 1.00 . A A . 104 SER O    1 1 
        3  4960 1 1 104 SER OG   O   14.310   8.070  -2.329 1.00 . A A . 104 SER OG   1 1 
        3  4961 1 1 105 LYS C    C   18.472  11.305  -0.740 1.00 . A A . 105 LYS C    1 1 
        3  4962 1 1 105 LYS CA   C   18.738   9.845  -1.132 1.00 . A A . 105 LYS CA   1 1 
        3  4963 1 1 105 LYS CB   C   20.221   9.589  -1.460 1.00 . A A . 105 LYS CB   1 1 
        3  4964 1 1 105 LYS CD   C   22.605   9.429  -0.521 1.00 . A A . 105 LYS CD   1 1 
        3  4965 1 1 105 LYS CE   C   23.254  10.324  -1.587 1.00 . A A . 105 LYS CE   1 1 
        3  4966 1 1 105 LYS CG   C   21.142   9.814  -0.247 1.00 . A A . 105 LYS CG   1 1 
        3  4967 1 1 105 LYS H    H   17.766  10.165  -3.004 1.00 . A A . 105 LYS H    1 1 
        3  4968 1 1 105 LYS HA   H   18.463   9.217  -0.280 1.00 . A A . 105 LYS HA   1 1 
        3  4969 1 1 105 LYS HB2  H   20.332   8.554  -1.790 1.00 . A A . 105 LYS HB2  1 1 
        3  4970 1 1 105 LYS HB3  H   20.523  10.244  -2.279 1.00 . A A . 105 LYS HB3  1 1 
        3  4971 1 1 105 LYS HD2  H   23.163   9.525   0.412 1.00 . A A . 105 LYS HD2  1 1 
        3  4972 1 1 105 LYS HD3  H   22.648   8.386  -0.840 1.00 . A A . 105 LYS HD3  1 1 
        3  4973 1 1 105 LYS HE2  H   22.708  10.211  -2.528 1.00 . A A . 105 LYS HE2  1 1 
        3  4974 1 1 105 LYS HE3  H   23.164  11.369  -1.270 1.00 . A A . 105 LYS HE3  1 1 
        3  4975 1 1 105 LYS HG2  H   21.106  10.862   0.053 1.00 . A A . 105 LYS HG2  1 1 
        3  4976 1 1 105 LYS HG3  H   20.780   9.207   0.584 1.00 . A A . 105 LYS HG3  1 1 
        3  4977 1 1 105 LYS HZ1  H   25.106  10.575  -2.493 1.00 . A A . 105 LYS HZ1  1 1 
        3  4978 1 1 105 LYS HZ2  H   25.217  10.096  -0.939 1.00 . A A . 105 LYS HZ2  1 1 
        3  4979 1 1 105 LYS HZ3  H   24.795   9.023  -2.098 1.00 . A A . 105 LYS HZ3  1 1 
        3  4980 1 1 105 LYS N    N   17.911   9.461  -2.291 1.00 . A A . 105 LYS N    1 1 
        3  4981 1 1 105 LYS NZ   N   24.686   9.980  -1.791 1.00 . A A . 105 LYS NZ   1 1 
        3  4982 1 1 105 LYS O    O   18.409  12.177  -1.608 1.00 . A A . 105 LYS O    1 1 
        3  4983 1 1 106 ALA C    C   18.472  12.823   2.647 1.00 . A A . 106 ALA C    1 1 
        3  4984 1 1 106 ALA CA   C   18.077  12.864   1.159 1.00 . A A . 106 ALA CA   1 1 
        3  4985 1 1 106 ALA CB   C   16.593  13.228   1.001 1.00 . A A . 106 ALA CB   1 1 
        3  4986 1 1 106 ALA H    H   18.439  10.815   1.223 1.00 . A A . 106 ALA H    1 1 
        3  4987 1 1 106 ALA HA   H   18.686  13.616   0.654 1.00 . A A . 106 ALA HA   1 1 
        3  4988 1 1 106 ALA HB1  H   15.970  12.482   1.497 1.00 . A A . 106 ALA HB1  1 1 
        3  4989 1 1 106 ALA HB2  H   16.402  14.205   1.448 1.00 . A A . 106 ALA HB2  1 1 
        3  4990 1 1 106 ALA HB3  H   16.327  13.274  -0.056 1.00 . A A . 106 ALA HB3  1 1 
        3  4991 1 1 106 ALA N    N   18.317  11.561   0.559 1.00 . A A . 106 ALA N    1 1 
        3  4992 1 1 106 ALA O    O   18.399  11.783   3.306 1.00 . A A . 106 ALA O    1 1 
        3  4993 1 1 107 GLU C    C   18.024  14.166   5.556 1.00 . A A . 107 GLU C    1 1 
        3  4994 1 1 107 GLU CA   C   19.236  14.159   4.599 1.00 . A A . 107 GLU CA   1 1 
        3  4995 1 1 107 GLU CB   C   20.034  15.467   4.758 1.00 . A A . 107 GLU CB   1 1 
        3  4996 1 1 107 GLU CD   C   22.356  14.429   4.496 1.00 . A A . 107 GLU CD   1 1 
        3  4997 1 1 107 GLU CG   C   21.366  15.497   3.990 1.00 . A A . 107 GLU CG   1 1 
        3  4998 1 1 107 GLU H    H   18.941  14.754   2.550 1.00 . A A . 107 GLU H    1 1 
        3  4999 1 1 107 GLU HA   H   19.871  13.327   4.908 1.00 . A A . 107 GLU HA   1 1 
        3  5000 1 1 107 GLU HB2  H   19.417  16.298   4.415 1.00 . A A . 107 GLU HB2  1 1 
        3  5001 1 1 107 GLU HB3  H   20.246  15.627   5.815 1.00 . A A . 107 GLU HB3  1 1 
        3  5002 1 1 107 GLU HG2  H   21.175  15.366   2.921 1.00 . A A . 107 GLU HG2  1 1 
        3  5003 1 1 107 GLU HG3  H   21.809  16.488   4.115 1.00 . A A . 107 GLU HG3  1 1 
        3  5004 1 1 107 GLU N    N   18.864  13.976   3.182 1.00 . A A . 107 GLU N    1 1 
        3  5005 1 1 107 GLU O    O   18.193  13.974   6.764 1.00 . A A . 107 GLU O    1 1 
        3  5006 1 1 107 GLU OE1  O   22.989  14.636   5.561 1.00 . A A . 107 GLU OE1  1 1 
        3  5007 1 1 107 GLU OE2  O   22.520  13.379   3.828 1.00 . A A . 107 GLU OE2  1 1 
        3  5008 1 1 108 LYS C    C   14.449  13.628   4.937 1.00 . A A . 108 LYS C    1 1 
        3  5009 1 1 108 LYS CA   C   15.515  14.393   5.727 1.00 . A A . 108 LYS CA   1 1 
        3  5010 1 1 108 LYS CB   C   15.061  15.847   5.971 1.00 . A A . 108 LYS CB   1 1 
        3  5011 1 1 108 LYS CD   C   15.959  16.152   8.359 1.00 . A A . 108 LYS CD   1 1 
        3  5012 1 1 108 LYS CE   C   16.842  17.047   9.236 1.00 . A A . 108 LYS CE   1 1 
        3  5013 1 1 108 LYS CG   C   15.955  16.675   6.913 1.00 . A A . 108 LYS CG   1 1 
        3  5014 1 1 108 LYS H    H   16.771  14.480   4.019 1.00 . A A . 108 LYS H    1 1 
        3  5015 1 1 108 LYS HA   H   15.609  13.879   6.683 1.00 . A A . 108 LYS HA   1 1 
        3  5016 1 1 108 LYS HB2  H   15.009  16.361   5.011 1.00 . A A . 108 LYS HB2  1 1 
        3  5017 1 1 108 LYS HB3  H   14.052  15.833   6.387 1.00 . A A . 108 LYS HB3  1 1 
        3  5018 1 1 108 LYS HD2  H   14.938  16.153   8.744 1.00 . A A . 108 LYS HD2  1 1 
        3  5019 1 1 108 LYS HD3  H   16.347  15.134   8.384 1.00 . A A . 108 LYS HD3  1 1 
        3  5020 1 1 108 LYS HE2  H   17.853  17.058   8.820 1.00 . A A . 108 LYS HE2  1 1 
        3  5021 1 1 108 LYS HE3  H   16.453  18.069   9.202 1.00 . A A . 108 LYS HE3  1 1 
        3  5022 1 1 108 LYS HG2  H   16.975  16.696   6.528 1.00 . A A . 108 LYS HG2  1 1 
        3  5023 1 1 108 LYS HG3  H   15.581  17.699   6.919 1.00 . A A . 108 LYS HG3  1 1 
        3  5024 1 1 108 LYS HZ1  H   17.254  15.630  10.700 1.00 . A A . 108 LYS HZ1  1 1 
        3  5025 1 1 108 LYS HZ2  H   17.465  17.163  11.214 1.00 . A A . 108 LYS HZ2  1 1 
        3  5026 1 1 108 LYS HZ3  H   15.958  16.561  11.055 1.00 . A A . 108 LYS HZ3  1 1 
        3  5027 1 1 108 LYS N    N   16.811  14.372   5.023 1.00 . A A . 108 LYS N    1 1 
        3  5028 1 1 108 LYS NZ   N   16.881  16.568  10.643 1.00 . A A . 108 LYS NZ   1 1 
        3  5029 1 1 108 LYS O    O   14.436  13.719   3.688 1.00 . A A . 108 LYS O    1 1 
        3  5030 1 1 108 LYS OXT  O   13.620  12.933   5.566 1.00 . A A . 108 LYS OXT  1 1 
        3  5031 2 2   1 ZN  ZN   ZN   6.939  -2.635  -8.002 1.00 . B A . 109 ZN  ZN   1 1 
        4  5032 1 1   1 MET C    C   -4.689  -7.036  18.698 1.00 . A A .   1 MET C    1 1 
        4  5033 1 1   1 MET CA   C   -6.153  -6.613  18.572 1.00 . A A .   1 MET CA   1 1 
        4  5034 1 1   1 MET CB   C   -6.937  -6.879  19.873 1.00 . A A .   1 MET CB   1 1 
        4  5035 1 1   1 MET CE   C   -5.384  -3.951  22.478 1.00 . A A .   1 MET CE   1 1 
        4  5036 1 1   1 MET CG   C   -6.340  -6.151  21.086 1.00 . A A .   1 MET CG   1 1 
        4  5037 1 1   1 MET H1   H   -7.746  -7.002  17.316 1.00 . A A .   1 MET H1   1 1 
        4  5038 1 1   1 MET H2   H   -6.733  -8.283  17.501 1.00 . A A .   1 MET H2   1 1 
        4  5039 1 1   1 MET H3   H   -6.291  -7.005  16.561 1.00 . A A .   1 MET H3   1 1 
        4  5040 1 1   1 MET HA   H   -6.170  -5.538  18.393 1.00 . A A .   1 MET HA   1 1 
        4  5041 1 1   1 MET HB2  H   -7.965  -6.537  19.743 1.00 . A A .   1 MET HB2  1 1 
        4  5042 1 1   1 MET HB3  H   -6.959  -7.950  20.083 1.00 . A A .   1 MET HB3  1 1 
        4  5043 1 1   1 MET HE1  H   -4.433  -4.479  22.567 1.00 . A A .   1 MET HE1  1 1 
        4  5044 1 1   1 MET HE2  H   -5.205  -2.877  22.533 1.00 . A A .   1 MET HE2  1 1 
        4  5045 1 1   1 MET HE3  H   -6.041  -4.248  23.296 1.00 . A A .   1 MET HE3  1 1 
        4  5046 1 1   1 MET HG2  H   -6.981  -6.342  21.948 1.00 . A A .   1 MET HG2  1 1 
        4  5047 1 1   1 MET HG3  H   -5.358  -6.574  21.307 1.00 . A A .   1 MET HG3  1 1 
        4  5048 1 1   1 MET N    N   -6.781  -7.280  17.407 1.00 . A A .   1 MET N    1 1 
        4  5049 1 1   1 MET O    O   -4.399  -8.219  18.885 1.00 . A A .   1 MET O    1 1 
        4  5050 1 1   1 MET SD   S   -6.163  -4.354  20.890 1.00 . A A .   1 MET SD   1 1 
        4  5051 1 1   2 ALA C    C   -1.671  -4.907  19.235 1.00 . A A .   2 ALA C    1 1 
        4  5052 1 1   2 ALA CA   C   -2.322  -6.244  18.814 1.00 . A A .   2 ALA CA   1 1 
        4  5053 1 1   2 ALA CB   C   -1.680  -6.800  17.529 1.00 . A A .   2 ALA CB   1 1 
        4  5054 1 1   2 ALA H    H   -4.079  -5.123  18.465 1.00 . A A .   2 ALA H    1 1 
        4  5055 1 1   2 ALA HA   H   -2.159  -6.960  19.622 1.00 . A A .   2 ALA HA   1 1 
        4  5056 1 1   2 ALA HB1  H   -0.619  -6.988  17.694 1.00 . A A .   2 ALA HB1  1 1 
        4  5057 1 1   2 ALA HB2  H   -2.156  -7.742  17.252 1.00 . A A .   2 ALA HB2  1 1 
        4  5058 1 1   2 ALA HB3  H   -1.789  -6.093  16.710 1.00 . A A .   2 ALA HB3  1 1 
        4  5059 1 1   2 ALA N    N   -3.765  -6.075  18.603 1.00 . A A .   2 ALA N    1 1 
        4  5060 1 1   2 ALA O    O   -2.293  -3.846  19.141 1.00 . A A .   2 ALA O    1 1 
        4  5061 1 1   3 GLU C    C    0.600  -2.728  19.043 1.00 . A A .   3 GLU C    1 1 
        4  5062 1 1   3 GLU CA   C    0.329  -3.757  20.153 1.00 . A A .   3 GLU CA   1 1 
        4  5063 1 1   3 GLU CB   C    1.632  -4.233  20.822 1.00 . A A .   3 GLU CB   1 1 
        4  5064 1 1   3 GLU CD   C    3.591  -3.663  22.326 1.00 . A A .   3 GLU CD   1 1 
        4  5065 1 1   3 GLU CG   C    2.396  -3.106  21.530 1.00 . A A .   3 GLU CG   1 1 
        4  5066 1 1   3 GLU H    H    0.042  -5.843  19.752 1.00 . A A .   3 GLU H    1 1 
        4  5067 1 1   3 GLU HA   H   -0.259  -3.232  20.900 1.00 . A A .   3 GLU HA   1 1 
        4  5068 1 1   3 GLU HB2  H    1.379  -4.992  21.565 1.00 . A A .   3 GLU HB2  1 1 
        4  5069 1 1   3 GLU HB3  H    2.277  -4.691  20.072 1.00 . A A .   3 GLU HB3  1 1 
        4  5070 1 1   3 GLU HG2  H    2.752  -2.387  20.788 1.00 . A A .   3 GLU HG2  1 1 
        4  5071 1 1   3 GLU HG3  H    1.713  -2.582  22.203 1.00 . A A .   3 GLU HG3  1 1 
        4  5072 1 1   3 GLU N    N   -0.412  -4.944  19.684 1.00 . A A .   3 GLU N    1 1 
        4  5073 1 1   3 GLU O    O    0.581  -1.521  19.303 1.00 . A A .   3 GLU O    1 1 
        4  5074 1 1   3 GLU OE1  O    4.703  -3.790  21.758 1.00 . A A .   3 GLU OE1  1 1 
        4  5075 1 1   3 GLU OE2  O    3.431  -3.973  23.534 1.00 . A A .   3 GLU OE2  1 1 
        4  5076 1 1   4 SER C    C    0.972  -2.912  15.299 1.00 . A A .   4 SER C    1 1 
        4  5077 1 1   4 SER CA   C    1.238  -2.320  16.691 1.00 . A A .   4 SER CA   1 1 
        4  5078 1 1   4 SER CB   C    2.725  -1.987  16.862 1.00 . A A .   4 SER CB   1 1 
        4  5079 1 1   4 SER H    H    0.835  -4.187  17.678 1.00 . A A .   4 SER H    1 1 
        4  5080 1 1   4 SER HA   H    0.677  -1.386  16.750 1.00 . A A .   4 SER HA   1 1 
        4  5081 1 1   4 SER HB2  H    3.017  -1.234  16.131 1.00 . A A .   4 SER HB2  1 1 
        4  5082 1 1   4 SER HB3  H    2.859  -1.583  17.870 1.00 . A A .   4 SER HB3  1 1 
        4  5083 1 1   4 SER HG   H    4.464  -2.894  16.881 1.00 . A A .   4 SER HG   1 1 
        4  5084 1 1   4 SER N    N    0.839  -3.189  17.811 1.00 . A A .   4 SER N    1 1 
        4  5085 1 1   4 SER O    O    0.587  -2.183  14.382 1.00 . A A .   4 SER O    1 1 
        4  5086 1 1   4 SER OG   O    3.534  -3.147  16.717 1.00 . A A .   4 SER OG   1 1 
        4  5087 1 1   5 SER C    C   -0.620  -5.338  13.650 1.00 . A A .   5 SER C    1 1 
        4  5088 1 1   5 SER CA   C    0.850  -4.965  13.878 1.00 . A A .   5 SER CA   1 1 
        4  5089 1 1   5 SER CB   C    1.822  -6.146  13.743 1.00 . A A .   5 SER CB   1 1 
        4  5090 1 1   5 SER H    H    1.465  -4.763  15.910 1.00 . A A .   5 SER H    1 1 
        4  5091 1 1   5 SER HA   H    1.068  -4.290  13.059 1.00 . A A .   5 SER HA   1 1 
        4  5092 1 1   5 SER HB2  H    1.684  -6.603  12.763 1.00 . A A .   5 SER HB2  1 1 
        4  5093 1 1   5 SER HB3  H    2.848  -5.779  13.802 1.00 . A A .   5 SER HB3  1 1 
        4  5094 1 1   5 SER HG   H    2.198  -6.949  15.499 1.00 . A A .   5 SER HG   1 1 
        4  5095 1 1   5 SER N    N    1.094  -4.234  15.135 1.00 . A A .   5 SER N    1 1 
        4  5096 1 1   5 SER O    O   -0.939  -6.395  13.101 1.00 . A A .   5 SER O    1 1 
        4  5097 1 1   5 SER OG   O    1.611  -7.135  14.741 1.00 . A A .   5 SER OG   1 1 
        4  5098 1 1   6 ASP C    C   -3.751  -4.441  12.831 1.00 . A A .   6 ASP C    1 1 
        4  5099 1 1   6 ASP CA   C   -2.977  -4.739  14.135 1.00 . A A .   6 ASP CA   1 1 
        4  5100 1 1   6 ASP CB   C   -3.576  -4.061  15.379 1.00 . A A .   6 ASP CB   1 1 
        4  5101 1 1   6 ASP CG   C   -4.925  -4.666  15.802 1.00 . A A .   6 ASP CG   1 1 
        4  5102 1 1   6 ASP H    H   -1.209  -3.592  14.461 1.00 . A A .   6 ASP H    1 1 
        4  5103 1 1   6 ASP HA   H   -3.034  -5.814  14.275 1.00 . A A .   6 ASP HA   1 1 
        4  5104 1 1   6 ASP HB2  H   -2.883  -4.164  16.215 1.00 . A A .   6 ASP HB2  1 1 
        4  5105 1 1   6 ASP HB3  H   -3.688  -2.992  15.183 1.00 . A A .   6 ASP HB3  1 1 
        4  5106 1 1   6 ASP N    N   -1.538  -4.463  14.069 1.00 . A A .   6 ASP N    1 1 
        4  5107 1 1   6 ASP O    O   -4.848  -3.874  12.839 1.00 . A A .   6 ASP O    1 1 
        4  5108 1 1   6 ASP OD1  O   -5.147  -5.884  15.601 1.00 . A A .   6 ASP OD1  1 1 
        4  5109 1 1   6 ASP OD2  O   -5.739  -3.957  16.434 1.00 . A A .   6 ASP OD2  1 1 
        4  5110 1 1   7 LYS C    C   -3.172  -5.816   9.483 1.00 . A A .   7 LYS C    1 1 
        4  5111 1 1   7 LYS CA   C   -3.641  -4.632  10.324 1.00 . A A .   7 LYS CA   1 1 
        4  5112 1 1   7 LYS CB   C   -3.191  -3.282   9.734 1.00 . A A .   7 LYS CB   1 1 
        4  5113 1 1   7 LYS CD   C   -1.183  -2.313  10.946 1.00 . A A .   7 LYS CD   1 1 
        4  5114 1 1   7 LYS CE   C    0.338  -2.159  10.915 1.00 . A A .   7 LYS CE   1 1 
        4  5115 1 1   7 LYS CG   C   -1.668  -3.100   9.724 1.00 . A A .   7 LYS CG   1 1 
        4  5116 1 1   7 LYS H    H   -2.271  -5.295  11.755 1.00 . A A .   7 LYS H    1 1 
        4  5117 1 1   7 LYS HA   H   -4.721  -4.639  10.311 1.00 . A A .   7 LYS HA   1 1 
        4  5118 1 1   7 LYS HB2  H   -3.552  -3.210   8.708 1.00 . A A .   7 LYS HB2  1 1 
        4  5119 1 1   7 LYS HB3  H   -3.663  -2.469  10.288 1.00 . A A .   7 LYS HB3  1 1 
        4  5120 1 1   7 LYS HD2  H   -1.660  -1.338  10.934 1.00 . A A .   7 LYS HD2  1 1 
        4  5121 1 1   7 LYS HD3  H   -1.482  -2.822  11.857 1.00 . A A .   7 LYS HD3  1 1 
        4  5122 1 1   7 LYS HE2  H    0.782  -3.097  11.261 1.00 . A A .   7 LYS HE2  1 1 
        4  5123 1 1   7 LYS HE3  H    0.655  -1.989   9.882 1.00 . A A .   7 LYS HE3  1 1 
        4  5124 1 1   7 LYS HG2  H   -1.185  -4.075   9.691 1.00 . A A .   7 LYS HG2  1 1 
        4  5125 1 1   7 LYS HG3  H   -1.391  -2.549   8.828 1.00 . A A .   7 LYS HG3  1 1 
        4  5126 1 1   7 LYS HZ1  H    0.401  -0.151  11.413 1.00 . A A .   7 LYS HZ1  1 1 
        4  5127 1 1   7 LYS HZ2  H    0.517  -1.163  12.732 1.00 . A A .   7 LYS HZ2  1 1 
        4  5128 1 1   7 LYS HZ3  H    1.797  -0.936  11.742 1.00 . A A .   7 LYS HZ3  1 1 
        4  5129 1 1   7 LYS N    N   -3.147  -4.791  11.691 1.00 . A A .   7 LYS N    1 1 
        4  5130 1 1   7 LYS NZ   N    0.791  -1.028  11.762 1.00 . A A .   7 LYS NZ   1 1 
        4  5131 1 1   7 LYS O    O   -2.329  -6.603   9.912 1.00 . A A .   7 LYS O    1 1 
        4  5132 1 1   8 LEU C    C   -2.574  -5.995   6.039 1.00 . A A .   8 LEU C    1 1 
        4  5133 1 1   8 LEU CA   C   -3.194  -6.776   7.208 1.00 . A A .   8 LEU CA   1 1 
        4  5134 1 1   8 LEU CB   C   -4.302  -7.756   6.783 1.00 . A A .   8 LEU CB   1 1 
        4  5135 1 1   8 LEU CD1  C   -6.367  -8.208   5.463 1.00 . A A .   8 LEU CD1  1 1 
        4  5136 1 1   8 LEU CD2  C   -6.561  -6.613   7.318 1.00 . A A .   8 LEU CD2  1 1 
        4  5137 1 1   8 LEU CG   C   -5.605  -7.136   6.238 1.00 . A A .   8 LEU CG   1 1 
        4  5138 1 1   8 LEU H    H   -4.415  -5.237   8.031 1.00 . A A .   8 LEU H    1 1 
        4  5139 1 1   8 LEU HA   H   -2.383  -7.388   7.599 1.00 . A A .   8 LEU HA   1 1 
        4  5140 1 1   8 LEU HB2  H   -3.872  -8.395   6.010 1.00 . A A .   8 LEU HB2  1 1 
        4  5141 1 1   8 LEU HB3  H   -4.545  -8.401   7.628 1.00 . A A .   8 LEU HB3  1 1 
        4  5142 1 1   8 LEU HD11 H   -6.669  -9.014   6.132 1.00 . A A .   8 LEU HD11 1 1 
        4  5143 1 1   8 LEU HD12 H   -7.245  -7.757   5.009 1.00 . A A .   8 LEU HD12 1 1 
        4  5144 1 1   8 LEU HD13 H   -5.737  -8.612   4.672 1.00 . A A .   8 LEU HD13 1 1 
        4  5145 1 1   8 LEU HD21 H   -6.691  -7.365   8.097 1.00 . A A .   8 LEU HD21 1 1 
        4  5146 1 1   8 LEU HD22 H   -6.185  -5.693   7.754 1.00 . A A .   8 LEU HD22 1 1 
        4  5147 1 1   8 LEU HD23 H   -7.531  -6.389   6.875 1.00 . A A .   8 LEU HD23 1 1 
        4  5148 1 1   8 LEU HG   H   -5.361  -6.314   5.571 1.00 . A A .   8 LEU HG   1 1 
        4  5149 1 1   8 LEU N    N   -3.687  -5.895   8.265 1.00 . A A .   8 LEU N    1 1 
        4  5150 1 1   8 LEU O    O   -1.782  -6.564   5.290 1.00 . A A .   8 LEU O    1 1 
        4  5151 1 1   9 TYR C    C   -1.951  -2.465   5.399 1.00 . A A .   9 TYR C    1 1 
        4  5152 1 1   9 TYR CA   C   -2.432  -3.814   4.841 1.00 . A A .   9 TYR CA   1 1 
        4  5153 1 1   9 TYR CB   C   -3.588  -3.581   3.849 1.00 . A A .   9 TYR CB   1 1 
        4  5154 1 1   9 TYR CD1  C   -3.646  -5.933   2.876 1.00 . A A .   9 TYR CD1  1 1 
        4  5155 1 1   9 TYR CD2  C   -5.748  -4.777   3.267 1.00 . A A .   9 TYR CD2  1 1 
        4  5156 1 1   9 TYR CE1  C   -4.343  -7.046   2.370 1.00 . A A .   9 TYR CE1  1 1 
        4  5157 1 1   9 TYR CE2  C   -6.455  -5.886   2.761 1.00 . A A .   9 TYR CE2  1 1 
        4  5158 1 1   9 TYR CG   C   -4.341  -4.798   3.330 1.00 . A A .   9 TYR CG   1 1 
        4  5159 1 1   9 TYR CZ   C   -5.751  -7.020   2.298 1.00 . A A .   9 TYR CZ   1 1 
        4  5160 1 1   9 TYR H    H   -3.381  -4.238   6.666 1.00 . A A .   9 TYR H    1 1 
        4  5161 1 1   9 TYR HA   H   -1.605  -4.279   4.307 1.00 . A A .   9 TYR HA   1 1 
        4  5162 1 1   9 TYR HB2  H   -4.311  -2.934   4.340 1.00 . A A .   9 TYR HB2  1 1 
        4  5163 1 1   9 TYR HB3  H   -3.197  -3.038   2.988 1.00 . A A .   9 TYR HB3  1 1 
        4  5164 1 1   9 TYR HD1  H   -2.568  -5.944   2.910 1.00 . A A .   9 TYR HD1  1 1 
        4  5165 1 1   9 TYR HD2  H   -6.289  -3.903   3.600 1.00 . A A .   9 TYR HD2  1 1 
        4  5166 1 1   9 TYR HE1  H   -3.808  -7.916   2.018 1.00 . A A .   9 TYR HE1  1 1 
        4  5167 1 1   9 TYR HE2  H   -7.534  -5.871   2.716 1.00 . A A .   9 TYR HE2  1 1 
        4  5168 1 1   9 TYR HH   H   -7.361  -7.872   1.623 1.00 . A A .   9 TYR HH   1 1 
        4  5169 1 1   9 TYR N    N   -2.859  -4.691   5.930 1.00 . A A .   9 TYR N    1 1 
        4  5170 1 1   9 TYR O    O   -2.377  -2.021   6.468 1.00 . A A .   9 TYR O    1 1 
        4  5171 1 1   9 TYR OH   O   -6.422  -8.079   1.771 1.00 . A A .   9 TYR OH   1 1 
        4  5172 1 1  10 ARG C    C   -0.460   0.361   3.653 1.00 . A A .  10 ARG C    1 1 
        4  5173 1 1  10 ARG CA   C   -0.564  -0.440   4.952 1.00 . A A .  10 ARG CA   1 1 
        4  5174 1 1  10 ARG CB   C    0.751  -0.594   5.761 1.00 . A A .  10 ARG CB   1 1 
        4  5175 1 1  10 ARG CD   C    1.619   1.854   6.004 1.00 . A A .  10 ARG CD   1 1 
        4  5176 1 1  10 ARG CG   C    1.888   0.422   5.529 1.00 . A A .  10 ARG CG   1 1 
        4  5177 1 1  10 ARG CZ   C    1.554   3.191   8.089 1.00 . A A .  10 ARG CZ   1 1 
        4  5178 1 1  10 ARG H    H   -0.749  -2.222   3.803 1.00 . A A .  10 ARG H    1 1 
        4  5179 1 1  10 ARG HA   H   -1.288   0.071   5.583 1.00 . A A .  10 ARG HA   1 1 
        4  5180 1 1  10 ARG HB2  H    0.497  -0.603   6.822 1.00 . A A .  10 ARG HB2  1 1 
        4  5181 1 1  10 ARG HB3  H    1.166  -1.579   5.548 1.00 . A A .  10 ARG HB3  1 1 
        4  5182 1 1  10 ARG HD2  H    2.420   2.484   5.617 1.00 . A A .  10 ARG HD2  1 1 
        4  5183 1 1  10 ARG HD3  H    0.687   2.193   5.576 1.00 . A A .  10 ARG HD3  1 1 
        4  5184 1 1  10 ARG HE   H    1.246   1.227   8.026 1.00 . A A .  10 ARG HE   1 1 
        4  5185 1 1  10 ARG HG2  H    2.788   0.059   6.027 1.00 . A A .  10 ARG HG2  1 1 
        4  5186 1 1  10 ARG HG3  H    2.110   0.457   4.459 1.00 . A A .  10 ARG HG3  1 1 
        4  5187 1 1  10 ARG HH11 H    2.094   4.265   6.498 1.00 . A A .  10 ARG HH11 1 1 
        4  5188 1 1  10 ARG HH12 H    1.795   5.194   7.944 1.00 . A A .  10 ARG HH12 1 1 
        4  5189 1 1  10 ARG HH21 H    0.827   2.481   9.815 1.00 . A A .  10 ARG HH21 1 1 
        4  5190 1 1  10 ARG HH22 H    1.250   4.186   9.791 1.00 . A A .  10 ARG HH22 1 1 
        4  5191 1 1  10 ARG N    N   -1.091  -1.778   4.651 1.00 . A A .  10 ARG N    1 1 
        4  5192 1 1  10 ARG NE   N    1.513   2.023   7.467 1.00 . A A .  10 ARG NE   1 1 
        4  5193 1 1  10 ARG NH1  N    1.887   4.291   7.477 1.00 . A A .  10 ARG NH1  1 1 
        4  5194 1 1  10 ARG NH2  N    1.234   3.288   9.342 1.00 . A A .  10 ARG NH2  1 1 
        4  5195 1 1  10 ARG O    O   -0.201  -0.219   2.604 1.00 . A A .  10 ARG O    1 1 
        4  5196 1 1  11 VAL C    C    0.291   3.896   3.213 1.00 . A A .  11 VAL C    1 1 
        4  5197 1 1  11 VAL CA   C   -0.365   2.637   2.637 1.00 . A A .  11 VAL CA   1 1 
        4  5198 1 1  11 VAL CB   C   -1.640   2.958   1.842 1.00 . A A .  11 VAL CB   1 1 
        4  5199 1 1  11 VAL CG1  C   -2.607   3.901   2.568 1.00 . A A .  11 VAL CG1  1 1 
        4  5200 1 1  11 VAL CG2  C   -1.336   3.601   0.483 1.00 . A A .  11 VAL CG2  1 1 
        4  5201 1 1  11 VAL H    H   -0.976   2.055   4.597 1.00 . A A .  11 VAL H    1 1 
        4  5202 1 1  11 VAL HA   H    0.347   2.178   1.951 1.00 . A A .  11 VAL HA   1 1 
        4  5203 1 1  11 VAL HB   H   -2.144   1.998   1.690 1.00 . A A .  11 VAL HB   1 1 
        4  5204 1 1  11 VAL HG11 H   -2.203   4.908   2.600 1.00 . A A .  11 VAL HG11 1 1 
        4  5205 1 1  11 VAL HG12 H   -3.565   3.918   2.049 1.00 . A A .  11 VAL HG12 1 1 
        4  5206 1 1  11 VAL HG13 H   -2.756   3.573   3.592 1.00 . A A .  11 VAL HG13 1 1 
        4  5207 1 1  11 VAL HG21 H   -0.597   3.020  -0.061 1.00 . A A .  11 VAL HG21 1 1 
        4  5208 1 1  11 VAL HG22 H   -2.249   3.655  -0.112 1.00 . A A .  11 VAL HG22 1 1 
        4  5209 1 1  11 VAL HG23 H   -0.937   4.604   0.619 1.00 . A A .  11 VAL HG23 1 1 
        4  5210 1 1  11 VAL N    N   -0.674   1.672   3.705 1.00 . A A .  11 VAL N    1 1 
        4  5211 1 1  11 VAL O    O   -0.017   4.298   4.334 1.00 . A A .  11 VAL O    1 1 
        4  5212 1 1  12 GLU C    C    2.259   6.646   1.651 1.00 . A A .  12 GLU C    1 1 
        4  5213 1 1  12 GLU CA   C    1.761   5.829   2.846 1.00 . A A .  12 GLU CA   1 1 
        4  5214 1 1  12 GLU CB   C    2.898   5.673   3.882 1.00 . A A .  12 GLU CB   1 1 
        4  5215 1 1  12 GLU CD   C    5.402   5.183   4.279 1.00 . A A .  12 GLU CD   1 1 
        4  5216 1 1  12 GLU CG   C    4.196   5.054   3.330 1.00 . A A .  12 GLU CG   1 1 
        4  5217 1 1  12 GLU H    H    1.474   4.125   1.580 1.00 . A A .  12 GLU H    1 1 
        4  5218 1 1  12 GLU HA   H    0.970   6.427   3.301 1.00 . A A .  12 GLU HA   1 1 
        4  5219 1 1  12 GLU HB2  H    3.122   6.664   4.271 1.00 . A A .  12 GLU HB2  1 1 
        4  5220 1 1  12 GLU HB3  H    2.549   5.058   4.714 1.00 . A A .  12 GLU HB3  1 1 
        4  5221 1 1  12 GLU HG2  H    4.012   4.004   3.115 1.00 . A A .  12 GLU HG2  1 1 
        4  5222 1 1  12 GLU HG3  H    4.467   5.537   2.391 1.00 . A A .  12 GLU HG3  1 1 
        4  5223 1 1  12 GLU N    N    1.202   4.525   2.475 1.00 . A A .  12 GLU N    1 1 
        4  5224 1 1  12 GLU O    O    2.577   6.115   0.583 1.00 . A A .  12 GLU O    1 1 
        4  5225 1 1  12 GLU OE1  O    5.240   5.588   5.454 1.00 . A A .  12 GLU OE1  1 1 
        4  5226 1 1  12 GLU OE2  O    6.537   4.919   3.815 1.00 . A A .  12 GLU OE2  1 1 
        4  5227 1 1  13 TYR C    C    4.822   8.386   1.704 1.00 . A A .  13 TYR C    1 1 
        4  5228 1 1  13 TYR CA   C    3.418   8.759   1.201 1.00 . A A .  13 TYR CA   1 1 
        4  5229 1 1  13 TYR CB   C    3.096  10.246   1.410 1.00 . A A .  13 TYR CB   1 1 
        4  5230 1 1  13 TYR CD1  C    1.044  10.026  -0.123 1.00 . A A .  13 TYR CD1  1 1 
        4  5231 1 1  13 TYR CD2  C    1.288  12.004   1.275 1.00 . A A .  13 TYR CD2  1 1 
        4  5232 1 1  13 TYR CE1  C   -0.103  10.584  -0.714 1.00 . A A .  13 TYR CE1  1 1 
        4  5233 1 1  13 TYR CE2  C    0.120  12.552   0.709 1.00 . A A .  13 TYR CE2  1 1 
        4  5234 1 1  13 TYR CG   C    1.770  10.751   0.848 1.00 . A A .  13 TYR CG   1 1 
        4  5235 1 1  13 TYR CZ   C   -0.560  11.857  -0.312 1.00 . A A .  13 TYR CZ   1 1 
        4  5236 1 1  13 TYR H    H    2.081   8.314   2.772 1.00 . A A .  13 TYR H    1 1 
        4  5237 1 1  13 TYR HA   H    3.375   8.546   0.135 1.00 . A A .  13 TYR HA   1 1 
        4  5238 1 1  13 TYR HB2  H    3.122  10.460   2.480 1.00 . A A .  13 TYR HB2  1 1 
        4  5239 1 1  13 TYR HB3  H    3.890  10.829   0.944 1.00 . A A .  13 TYR HB3  1 1 
        4  5240 1 1  13 TYR HD1  H    1.365   9.039  -0.432 1.00 . A A .  13 TYR HD1  1 1 
        4  5241 1 1  13 TYR HD2  H    1.829  12.560   2.031 1.00 . A A .  13 TYR HD2  1 1 
        4  5242 1 1  13 TYR HE1  H   -0.635  10.044  -1.483 1.00 . A A .  13 TYR HE1  1 1 
        4  5243 1 1  13 TYR HE2  H   -0.239  13.521   1.024 1.00 . A A .  13 TYR HE2  1 1 
        4  5244 1 1  13 TYR HH   H   -1.875  11.962  -1.740 1.00 . A A .  13 TYR HH   1 1 
        4  5245 1 1  13 TYR N    N    2.428   7.946   1.899 1.00 . A A .  13 TYR N    1 1 
        4  5246 1 1  13 TYR O    O    5.082   8.394   2.912 1.00 . A A .  13 TYR O    1 1 
        4  5247 1 1  13 TYR OH   O   -1.650  12.414  -0.899 1.00 . A A .  13 TYR OH   1 1 
        4  5248 1 1  14 ALA C    C    7.997   8.297   1.759 1.00 . A A .  14 ALA C    1 1 
        4  5249 1 1  14 ALA CA   C    6.985   7.361   1.068 1.00 . A A .  14 ALA CA   1 1 
        4  5250 1 1  14 ALA CB   C    7.529   6.815  -0.256 1.00 . A A .  14 ALA CB   1 1 
        4  5251 1 1  14 ALA H    H    5.395   8.004  -0.182 1.00 . A A .  14 ALA H    1 1 
        4  5252 1 1  14 ALA HA   H    6.798   6.515   1.729 1.00 . A A .  14 ALA HA   1 1 
        4  5253 1 1  14 ALA HB1  H    7.685   7.629  -0.959 1.00 . A A .  14 ALA HB1  1 1 
        4  5254 1 1  14 ALA HB2  H    8.479   6.308  -0.092 1.00 . A A .  14 ALA HB2  1 1 
        4  5255 1 1  14 ALA HB3  H    6.818   6.113  -0.691 1.00 . A A .  14 ALA HB3  1 1 
        4  5256 1 1  14 ALA N    N    5.707   8.006   0.783 1.00 . A A .  14 ALA N    1 1 
        4  5257 1 1  14 ALA O    O    8.325   9.364   1.234 1.00 . A A .  14 ALA O    1 1 
        4  5258 1 1  15 LYS C    C   10.883   8.689   3.319 1.00 . A A .  15 LYS C    1 1 
        4  5259 1 1  15 LYS CA   C    9.418   8.684   3.772 1.00 . A A .  15 LYS CA   1 1 
        4  5260 1 1  15 LYS CB   C    9.337   8.186   5.231 1.00 . A A .  15 LYS CB   1 1 
        4  5261 1 1  15 LYS CD   C    7.131   9.400   5.715 1.00 . A A .  15 LYS CD   1 1 
        4  5262 1 1  15 LYS CE   C    5.775   9.300   6.418 1.00 . A A .  15 LYS CE   1 1 
        4  5263 1 1  15 LYS CG   C    7.920   8.086   5.814 1.00 . A A .  15 LYS CG   1 1 
        4  5264 1 1  15 LYS H    H    8.182   6.993   3.286 1.00 . A A .  15 LYS H    1 1 
        4  5265 1 1  15 LYS HA   H    9.079   9.723   3.753 1.00 . A A .  15 LYS HA   1 1 
        4  5266 1 1  15 LYS HB2  H    9.798   7.198   5.298 1.00 . A A .  15 LYS HB2  1 1 
        4  5267 1 1  15 LYS HB3  H    9.920   8.862   5.860 1.00 . A A .  15 LYS HB3  1 1 
        4  5268 1 1  15 LYS HD2  H    7.708  10.196   6.188 1.00 . A A .  15 LYS HD2  1 1 
        4  5269 1 1  15 LYS HD3  H    6.968   9.665   4.669 1.00 . A A .  15 LYS HD3  1 1 
        4  5270 1 1  15 LYS HE2  H    5.937   9.026   7.464 1.00 . A A .  15 LYS HE2  1 1 
        4  5271 1 1  15 LYS HE3  H    5.311  10.289   6.395 1.00 . A A .  15 LYS HE3  1 1 
        4  5272 1 1  15 LYS HG2  H    7.380   7.298   5.294 1.00 . A A .  15 LYS HG2  1 1 
        4  5273 1 1  15 LYS HG3  H    8.002   7.801   6.864 1.00 . A A .  15 LYS HG3  1 1 
        4  5274 1 1  15 LYS HZ1  H    3.952   8.324   6.205 1.00 . A A .  15 LYS HZ1  1 1 
        4  5275 1 1  15 LYS HZ2  H    4.775   8.511   4.778 1.00 . A A .  15 LYS HZ2  1 1 
        4  5276 1 1  15 LYS HZ3  H    5.220   7.360   5.849 1.00 . A A .  15 LYS HZ3  1 1 
        4  5277 1 1  15 LYS N    N    8.524   7.872   2.917 1.00 . A A .  15 LYS N    1 1 
        4  5278 1 1  15 LYS NZ   N    4.876   8.318   5.768 1.00 . A A .  15 LYS NZ   1 1 
        4  5279 1 1  15 LYS O    O   11.563   9.709   3.423 1.00 . A A .  15 LYS O    1 1 
        4  5280 1 1  16 SER C    C   12.901   6.022   1.631 1.00 . A A .  16 SER C    1 1 
        4  5281 1 1  16 SER CA   C   12.783   7.258   2.535 1.00 . A A .  16 SER CA   1 1 
        4  5282 1 1  16 SER CB   C   13.574   7.039   3.831 1.00 . A A .  16 SER CB   1 1 
        4  5283 1 1  16 SER H    H   10.719   6.779   2.743 1.00 . A A .  16 SER H    1 1 
        4  5284 1 1  16 SER HA   H   13.214   8.115   2.019 1.00 . A A .  16 SER HA   1 1 
        4  5285 1 1  16 SER HB2  H   13.396   7.876   4.507 1.00 . A A .  16 SER HB2  1 1 
        4  5286 1 1  16 SER HB3  H   13.247   6.118   4.317 1.00 . A A .  16 SER HB3  1 1 
        4  5287 1 1  16 SER HG   H   15.453   7.028   4.386 1.00 . A A .  16 SER HG   1 1 
        4  5288 1 1  16 SER N    N   11.373   7.537   2.857 1.00 . A A .  16 SER N    1 1 
        4  5289 1 1  16 SER O    O   12.022   5.154   1.645 1.00 . A A .  16 SER O    1 1 
        4  5290 1 1  16 SER OG   O   14.961   6.972   3.543 1.00 . A A .  16 SER OG   1 1 
        4  5291 1 1  17 GLY C    C   14.647   3.463   0.502 1.00 . A A .  17 GLY C    1 1 
        4  5292 1 1  17 GLY CA   C   14.260   4.828  -0.097 1.00 . A A .  17 GLY CA   1 1 
        4  5293 1 1  17 GLY H    H   14.705   6.615   0.984 1.00 . A A .  17 GLY H    1 1 
        4  5294 1 1  17 GLY HA2  H   13.367   4.680  -0.703 1.00 . A A .  17 GLY HA2  1 1 
        4  5295 1 1  17 GLY HA3  H   15.064   5.145  -0.762 1.00 . A A .  17 GLY HA3  1 1 
        4  5296 1 1  17 GLY N    N   13.993   5.906   0.871 1.00 . A A .  17 GLY N    1 1 
        4  5297 1 1  17 GLY O    O   15.334   2.679  -0.155 1.00 . A A .  17 GLY O    1 1 
        4  5298 1 1  18 ARG C    C   13.756   0.723   2.109 1.00 . A A .  18 ARG C    1 1 
        4  5299 1 1  18 ARG CA   C   14.607   1.944   2.493 1.00 . A A .  18 ARG CA   1 1 
        4  5300 1 1  18 ARG CB   C   14.508   2.205   4.010 1.00 . A A .  18 ARG CB   1 1 
        4  5301 1 1  18 ARG CD   C   16.930   2.975   4.351 1.00 . A A .  18 ARG CD   1 1 
        4  5302 1 1  18 ARG CG   C   15.444   3.302   4.547 1.00 . A A .  18 ARG CG   1 1 
        4  5303 1 1  18 ARG CZ   C   19.111   3.966   5.072 1.00 . A A .  18 ARG CZ   1 1 
        4  5304 1 1  18 ARG H    H   13.683   3.868   2.218 1.00 . A A .  18 ARG H    1 1 
        4  5305 1 1  18 ARG HA   H   15.633   1.665   2.252 1.00 . A A .  18 ARG HA   1 1 
        4  5306 1 1  18 ARG HB2  H   13.480   2.482   4.254 1.00 . A A .  18 ARG HB2  1 1 
        4  5307 1 1  18 ARG HB3  H   14.732   1.279   4.543 1.00 . A A .  18 ARG HB3  1 1 
        4  5308 1 1  18 ARG HD2  H   17.133   1.996   4.790 1.00 . A A .  18 ARG HD2  1 1 
        4  5309 1 1  18 ARG HD3  H   17.150   2.937   3.281 1.00 . A A .  18 ARG HD3  1 1 
        4  5310 1 1  18 ARG HE   H   17.334   4.784   5.404 1.00 . A A .  18 ARG HE   1 1 
        4  5311 1 1  18 ARG HG2  H   15.218   4.249   4.059 1.00 . A A .  18 ARG HG2  1 1 
        4  5312 1 1  18 ARG HG3  H   15.251   3.418   5.615 1.00 . A A .  18 ARG HG3  1 1 
        4  5313 1 1  18 ARG HH11 H   19.357   2.239   4.099 1.00 . A A .  18 ARG HH11 1 1 
        4  5314 1 1  18 ARG HH12 H   20.825   2.999   4.649 1.00 . A A .  18 ARG HH12 1 1 
        4  5315 1 1  18 ARG HH21 H   19.243   5.698   6.079 1.00 . A A .  18 ARG HH21 1 1 
        4  5316 1 1  18 ARG HH22 H   20.755   4.907   5.738 1.00 . A A .  18 ARG HH22 1 1 
        4  5317 1 1  18 ARG N    N   14.258   3.177   1.754 1.00 . A A .  18 ARG N    1 1 
        4  5318 1 1  18 ARG NE   N   17.792   3.989   4.987 1.00 . A A .  18 ARG NE   1 1 
        4  5319 1 1  18 ARG NH1  N   19.822   2.996   4.569 1.00 . A A .  18 ARG NH1  1 1 
        4  5320 1 1  18 ARG NH2  N   19.750   4.929   5.673 1.00 . A A .  18 ARG NH2  1 1 
        4  5321 1 1  18 ARG O    O   14.184  -0.409   2.330 1.00 . A A .  18 ARG O    1 1 
        4  5322 1 1  19 ALA C    C   11.945  -0.621  -0.289 1.00 . A A .  19 ALA C    1 1 
        4  5323 1 1  19 ALA CA   C   11.637  -0.108   1.130 1.00 . A A .  19 ALA CA   1 1 
        4  5324 1 1  19 ALA CB   C   10.212   0.440   1.233 1.00 . A A .  19 ALA CB   1 1 
        4  5325 1 1  19 ALA H    H   12.304   1.893   1.362 1.00 . A A .  19 ALA H    1 1 
        4  5326 1 1  19 ALA HA   H   11.720  -0.950   1.820 1.00 . A A .  19 ALA HA   1 1 
        4  5327 1 1  19 ALA HB1  H    9.507  -0.343   0.967 1.00 . A A .  19 ALA HB1  1 1 
        4  5328 1 1  19 ALA HB2  H   10.005   0.773   2.252 1.00 . A A .  19 ALA HB2  1 1 
        4  5329 1 1  19 ALA HB3  H   10.082   1.270   0.540 1.00 . A A .  19 ALA HB3  1 1 
        4  5330 1 1  19 ALA N    N   12.565   0.941   1.549 1.00 . A A .  19 ALA N    1 1 
        4  5331 1 1  19 ALA O    O   12.271   0.164  -1.185 1.00 . A A .  19 ALA O    1 1 
        4  5332 1 1  20 SER C    C   10.588  -3.218  -2.220 1.00 . A A .  20 SER C    1 1 
        4  5333 1 1  20 SER CA   C   11.907  -2.564  -1.831 1.00 . A A .  20 SER CA   1 1 
        4  5334 1 1  20 SER CB   C   13.081  -3.552  -1.863 1.00 . A A .  20 SER CB   1 1 
        4  5335 1 1  20 SER H    H   11.378  -2.513   0.211 1.00 . A A .  20 SER H    1 1 
        4  5336 1 1  20 SER HA   H   12.116  -1.805  -2.578 1.00 . A A .  20 SER HA   1 1 
        4  5337 1 1  20 SER HB2  H   13.157  -3.983  -2.862 1.00 . A A .  20 SER HB2  1 1 
        4  5338 1 1  20 SER HB3  H   14.000  -3.001  -1.659 1.00 . A A .  20 SER HB3  1 1 
        4  5339 1 1  20 SER HG   H   13.832  -5.001  -0.800 1.00 . A A .  20 SER HG   1 1 
        4  5340 1 1  20 SER N    N   11.774  -1.926  -0.516 1.00 . A A .  20 SER N    1 1 
        4  5341 1 1  20 SER O    O    9.807  -3.583  -1.343 1.00 . A A .  20 SER O    1 1 
        4  5342 1 1  20 SER OG   O   12.946  -4.600  -0.909 1.00 . A A .  20 SER OG   1 1 
        4  5343 1 1  21 CYS C    C    9.176  -5.414  -4.139 1.00 . A A .  21 CYS C    1 1 
        4  5344 1 1  21 CYS CA   C    9.079  -3.887  -4.046 1.00 . A A .  21 CYS CA   1 1 
        4  5345 1 1  21 CYS CB   C    8.804  -3.219  -5.390 1.00 . A A .  21 CYS CB   1 1 
        4  5346 1 1  21 CYS H    H   11.038  -3.063  -4.191 1.00 . A A .  21 CYS H    1 1 
        4  5347 1 1  21 CYS HA   H    8.266  -3.627  -3.374 1.00 . A A .  21 CYS HA   1 1 
        4  5348 1 1  21 CYS HB2  H    8.865  -2.134  -5.264 1.00 . A A .  21 CYS HB2  1 1 
        4  5349 1 1  21 CYS HB3  H    9.572  -3.530  -6.103 1.00 . A A .  21 CYS HB3  1 1 
        4  5350 1 1  21 CYS N    N   10.322  -3.334  -3.522 1.00 . A A .  21 CYS N    1 1 
        4  5351 1 1  21 CYS O    O    9.922  -5.952  -4.964 1.00 . A A .  21 CYS O    1 1 
        4  5352 1 1  21 CYS SG   S    7.145  -3.664  -6.019 1.00 . A A .  21 CYS SG   1 1 
        4  5353 1 1  22 LYS C    C    7.859  -8.347  -4.374 1.00 . A A .  22 LYS C    1 1 
        4  5354 1 1  22 LYS CA   C    8.539  -7.609  -3.202 1.00 . A A .  22 LYS CA   1 1 
        4  5355 1 1  22 LYS CB   C    8.089  -8.163  -1.825 1.00 . A A .  22 LYS CB   1 1 
        4  5356 1 1  22 LYS CD   C    9.512  -6.615  -0.263 1.00 . A A .  22 LYS CD   1 1 
        4  5357 1 1  22 LYS CE   C   10.541  -7.660   0.171 1.00 . A A .  22 LYS CE   1 1 
        4  5358 1 1  22 LYS CG   C    8.144  -7.211  -0.619 1.00 . A A .  22 LYS CG   1 1 
        4  5359 1 1  22 LYS H    H    7.857  -5.631  -2.622 1.00 . A A .  22 LYS H    1 1 
        4  5360 1 1  22 LYS HA   H    9.599  -7.849  -3.295 1.00 . A A .  22 LYS HA   1 1 
        4  5361 1 1  22 LYS HB2  H    7.059  -8.503  -1.906 1.00 . A A .  22 LYS HB2  1 1 
        4  5362 1 1  22 LYS HB3  H    8.685  -9.049  -1.602 1.00 . A A .  22 LYS HB3  1 1 
        4  5363 1 1  22 LYS HD2  H    9.909  -6.081  -1.123 1.00 . A A .  22 LYS HD2  1 1 
        4  5364 1 1  22 LYS HD3  H    9.365  -5.902   0.550 1.00 . A A .  22 LYS HD3  1 1 
        4  5365 1 1  22 LYS HE2  H   10.139  -8.232   1.014 1.00 . A A .  22 LYS HE2  1 1 
        4  5366 1 1  22 LYS HE3  H   10.710  -8.352  -0.660 1.00 . A A .  22 LYS HE3  1 1 
        4  5367 1 1  22 LYS HG2  H    7.448  -6.401  -0.818 1.00 . A A .  22 LYS HG2  1 1 
        4  5368 1 1  22 LYS HG3  H    7.770  -7.734   0.257 1.00 . A A .  22 LYS HG3  1 1 
        4  5369 1 1  22 LYS HZ1  H   11.710  -6.459   1.400 1.00 . A A .  22 LYS HZ1  1 1 
        4  5370 1 1  22 LYS HZ2  H   12.548  -7.683   0.718 1.00 . A A .  22 LYS HZ2  1 1 
        4  5371 1 1  22 LYS HZ3  H   12.134  -6.363  -0.168 1.00 . A A .  22 LYS HZ3  1 1 
        4  5372 1 1  22 LYS N    N    8.427  -6.136  -3.296 1.00 . A A .  22 LYS N    1 1 
        4  5373 1 1  22 LYS NZ   N   11.818  -7.003   0.555 1.00 . A A .  22 LYS NZ   1 1 
        4  5374 1 1  22 LYS O    O    7.882  -9.579  -4.407 1.00 . A A .  22 LYS O    1 1 
        4  5375 1 1  23 LYS C    C    7.212  -7.926  -7.811 1.00 . A A .  23 LYS C    1 1 
        4  5376 1 1  23 LYS CA   C    6.496  -8.139  -6.473 1.00 . A A .  23 LYS CA   1 1 
        4  5377 1 1  23 LYS CB   C    5.069  -7.559  -6.449 1.00 . A A .  23 LYS CB   1 1 
        4  5378 1 1  23 LYS CD   C    3.974  -9.573  -7.621 1.00 . A A .  23 LYS CD   1 1 
        4  5379 1 1  23 LYS CE   C    2.915  -9.947  -8.663 1.00 . A A .  23 LYS CE   1 1 
        4  5380 1 1  23 LYS CG   C    4.143  -8.046  -7.574 1.00 . A A .  23 LYS CG   1 1 
        4  5381 1 1  23 LYS H    H    7.308  -6.608  -5.212 1.00 . A A .  23 LYS H    1 1 
        4  5382 1 1  23 LYS HA   H    6.408  -9.219  -6.354 1.00 . A A .  23 LYS HA   1 1 
        4  5383 1 1  23 LYS HB2  H    4.605  -7.823  -5.499 1.00 . A A .  23 LYS HB2  1 1 
        4  5384 1 1  23 LYS HB3  H    5.128  -6.471  -6.502 1.00 . A A .  23 LYS HB3  1 1 
        4  5385 1 1  23 LYS HD2  H    4.922 -10.041  -7.893 1.00 . A A .  23 LYS HD2  1 1 
        4  5386 1 1  23 LYS HD3  H    3.666  -9.937  -6.639 1.00 . A A .  23 LYS HD3  1 1 
        4  5387 1 1  23 LYS HE2  H    1.966  -9.489  -8.370 1.00 . A A .  23 LYS HE2  1 1 
        4  5388 1 1  23 LYS HE3  H    3.210  -9.526  -9.629 1.00 . A A .  23 LYS HE3  1 1 
        4  5389 1 1  23 LYS HG2  H    3.166  -7.591  -7.412 1.00 . A A .  23 LYS HG2  1 1 
        4  5390 1 1  23 LYS HG3  H    4.525  -7.695  -8.534 1.00 . A A .  23 LYS HG3  1 1 
        4  5391 1 1  23 LYS HZ1  H    2.484 -11.838  -7.901 1.00 . A A .  23 LYS HZ1  1 1 
        4  5392 1 1  23 LYS HZ2  H    2.028 -11.650  -9.454 1.00 . A A .  23 LYS HZ2  1 1 
        4  5393 1 1  23 LYS HZ3  H    3.603 -11.863  -9.092 1.00 . A A .  23 LYS HZ3  1 1 
        4  5394 1 1  23 LYS N    N    7.254  -7.612  -5.322 1.00 . A A .  23 LYS N    1 1 
        4  5395 1 1  23 LYS NZ   N    2.749 -11.420  -8.782 1.00 . A A .  23 LYS NZ   1 1 
        4  5396 1 1  23 LYS O    O    7.429  -8.913  -8.516 1.00 . A A .  23 LYS O    1 1 
        4  5397 1 1  24 CYS C    C    9.912  -6.382  -9.197 1.00 . A A .  24 CYS C    1 1 
        4  5398 1 1  24 CYS CA   C    8.371  -6.407  -9.384 1.00 . A A .  24 CYS CA   1 1 
        4  5399 1 1  24 CYS CB   C    7.765  -5.207 -10.135 1.00 . A A .  24 CYS CB   1 1 
        4  5400 1 1  24 CYS H    H    7.397  -5.921  -7.529 1.00 . A A .  24 CYS H    1 1 
        4  5401 1 1  24 CYS HA   H    8.200  -7.249 -10.055 1.00 . A A .  24 CYS HA   1 1 
        4  5402 1 1  24 CYS HB2  H    8.103  -5.273 -11.172 1.00 . A A .  24 CYS HB2  1 1 
        4  5403 1 1  24 CYS HB3  H    6.675  -5.294 -10.145 1.00 . A A .  24 CYS HB3  1 1 
        4  5404 1 1  24 CYS N    N    7.614  -6.692  -8.149 1.00 . A A .  24 CYS N    1 1 
        4  5405 1 1  24 CYS O    O   10.662  -6.269 -10.171 1.00 . A A .  24 CYS O    1 1 
        4  5406 1 1  24 CYS SG   S    8.279  -3.579  -9.474 1.00 . A A .  24 CYS SG   1 1 
        4  5407 1 1  25 SER C    C   12.669  -5.451  -7.803 1.00 . A A .  25 SER C    1 1 
        4  5408 1 1  25 SER CA   C   11.805  -6.703  -7.562 1.00 . A A .  25 SER CA   1 1 
        4  5409 1 1  25 SER CB   C   12.450  -7.987  -8.111 1.00 . A A .  25 SER CB   1 1 
        4  5410 1 1  25 SER H    H    9.710  -6.644  -7.213 1.00 . A A .  25 SER H    1 1 
        4  5411 1 1  25 SER HA   H   11.798  -6.815  -6.479 1.00 . A A .  25 SER HA   1 1 
        4  5412 1 1  25 SER HB2  H   12.516  -7.933  -9.198 1.00 . A A .  25 SER HB2  1 1 
        4  5413 1 1  25 SER HB3  H   13.461  -8.078  -7.710 1.00 . A A .  25 SER HB3  1 1 
        4  5414 1 1  25 SER HG   H   10.851  -9.118  -8.190 1.00 . A A .  25 SER HG   1 1 
        4  5415 1 1  25 SER N    N   10.387  -6.587  -7.960 1.00 . A A .  25 SER N    1 1 
        4  5416 1 1  25 SER O    O   13.899  -5.535  -7.845 1.00 . A A .  25 SER O    1 1 
        4  5417 1 1  25 SER OG   O   11.712  -9.142  -7.731 1.00 . A A .  25 SER OG   1 1 
        4  5418 1 1  26 GLU C    C   12.680  -2.321  -6.520 1.00 . A A .  26 GLU C    1 1 
        4  5419 1 1  26 GLU CA   C   12.707  -2.966  -7.927 1.00 . A A .  26 GLU CA   1 1 
        4  5420 1 1  26 GLU CB   C   12.089  -2.074  -9.024 1.00 . A A .  26 GLU CB   1 1 
        4  5421 1 1  26 GLU CD   C   11.883  -1.695 -11.559 1.00 . A A .  26 GLU CD   1 1 
        4  5422 1 1  26 GLU CG   C   12.280  -2.672 -10.430 1.00 . A A .  26 GLU CG   1 1 
        4  5423 1 1  26 GLU H    H   11.033  -4.293  -7.903 1.00 . A A .  26 GLU H    1 1 
        4  5424 1 1  26 GLU HA   H   13.761  -3.090  -8.180 1.00 . A A .  26 GLU HA   1 1 
        4  5425 1 1  26 GLU HB2  H   11.027  -1.936  -8.831 1.00 . A A .  26 GLU HB2  1 1 
        4  5426 1 1  26 GLU HB3  H   12.577  -1.099  -8.993 1.00 . A A .  26 GLU HB3  1 1 
        4  5427 1 1  26 GLU HG2  H   13.330  -2.947 -10.556 1.00 . A A .  26 GLU HG2  1 1 
        4  5428 1 1  26 GLU HG3  H   11.683  -3.585 -10.505 1.00 . A A .  26 GLU HG3  1 1 
        4  5429 1 1  26 GLU N    N   12.043  -4.279  -7.925 1.00 . A A .  26 GLU N    1 1 
        4  5430 1 1  26 GLU O    O   12.315  -2.962  -5.532 1.00 . A A .  26 GLU O    1 1 
        4  5431 1 1  26 GLU OE1  O   12.358  -0.533 -11.566 1.00 . A A .  26 GLU OE1  1 1 
        4  5432 1 1  26 GLU OE2  O   11.140  -2.096 -12.489 1.00 . A A .  26 GLU OE2  1 1 
        4  5433 1 1  27 SER C    C   12.273   0.952  -5.173 1.00 . A A .  27 SER C    1 1 
        4  5434 1 1  27 SER CA   C   13.137  -0.302  -5.133 1.00 . A A .  27 SER CA   1 1 
        4  5435 1 1  27 SER CB   C   14.572   0.041  -4.770 1.00 . A A .  27 SER CB   1 1 
        4  5436 1 1  27 SER H    H   13.344  -0.557  -7.240 1.00 . A A .  27 SER H    1 1 
        4  5437 1 1  27 SER HA   H   12.752  -0.928  -4.332 1.00 . A A .  27 SER HA   1 1 
        4  5438 1 1  27 SER HB2  H   15.148  -0.882  -4.768 1.00 . A A .  27 SER HB2  1 1 
        4  5439 1 1  27 SER HB3  H   14.950   0.738  -5.511 1.00 . A A .  27 SER HB3  1 1 
        4  5440 1 1  27 SER HG   H   15.592   0.777  -3.286 1.00 . A A .  27 SER HG   1 1 
        4  5441 1 1  27 SER N    N   13.090  -1.054  -6.398 1.00 . A A .  27 SER N    1 1 
        4  5442 1 1  27 SER O    O   12.089   1.556  -6.233 1.00 . A A .  27 SER O    1 1 
        4  5443 1 1  27 SER OG   O   14.645   0.640  -3.495 1.00 . A A .  27 SER OG   1 1 
        4  5444 1 1  28 ILE C    C   11.143   3.673  -3.432 1.00 . A A .  28 ILE C    1 1 
        4  5445 1 1  28 ILE CA   C   10.626   2.308  -3.935 1.00 . A A .  28 ILE CA   1 1 
        4  5446 1 1  28 ILE CB   C    9.468   1.766  -3.064 1.00 . A A .  28 ILE CB   1 1 
        4  5447 1 1  28 ILE CD1  C    8.172  -0.334  -2.332 1.00 . A A .  28 ILE CD1  1 1 
        4  5448 1 1  28 ILE CG1  C    9.055   0.311  -3.407 1.00 . A A .  28 ILE CG1  1 1 
        4  5449 1 1  28 ILE CG2  C    8.256   2.702  -3.240 1.00 . A A .  28 ILE CG2  1 1 
        4  5450 1 1  28 ILE H    H   12.063   0.896  -3.173 1.00 . A A .  28 ILE H    1 1 
        4  5451 1 1  28 ILE HA   H   10.232   2.418  -4.942 1.00 . A A .  28 ILE HA   1 1 
        4  5452 1 1  28 ILE HB   H    9.784   1.788  -2.020 1.00 . A A .  28 ILE HB   1 1 
        4  5453 1 1  28 ILE HD11 H    8.684  -0.308  -1.372 1.00 . A A .  28 ILE HD11 1 1 
        4  5454 1 1  28 ILE HD12 H    7.215   0.179  -2.250 1.00 . A A .  28 ILE HD12 1 1 
        4  5455 1 1  28 ILE HD13 H    7.988  -1.374  -2.599 1.00 . A A .  28 ILE HD13 1 1 
        4  5456 1 1  28 ILE HG12 H    8.536   0.291  -4.366 1.00 . A A .  28 ILE HG12 1 1 
        4  5457 1 1  28 ILE HG13 H    9.937  -0.321  -3.491 1.00 . A A .  28 ILE HG13 1 1 
        4  5458 1 1  28 ILE HG21 H    7.948   2.735  -4.286 1.00 . A A .  28 ILE HG21 1 1 
        4  5459 1 1  28 ILE HG22 H    7.416   2.344  -2.653 1.00 . A A .  28 ILE HG22 1 1 
        4  5460 1 1  28 ILE HG23 H    8.491   3.716  -2.916 1.00 . A A .  28 ILE HG23 1 1 
        4  5461 1 1  28 ILE N    N   11.726   1.340  -4.023 1.00 . A A .  28 ILE N    1 1 
        4  5462 1 1  28 ILE O    O   11.565   3.765  -2.274 1.00 . A A .  28 ILE O    1 1 
        4  5463 1 1  29 PRO C    C   10.765   6.815  -2.898 1.00 . A A .  29 PRO C    1 1 
        4  5464 1 1  29 PRO CA   C   11.659   6.054  -3.890 1.00 . A A .  29 PRO CA   1 1 
        4  5465 1 1  29 PRO CB   C   11.811   6.809  -5.215 1.00 . A A .  29 PRO CB   1 1 
        4  5466 1 1  29 PRO CD   C   10.624   4.774  -5.627 1.00 . A A .  29 PRO CD   1 1 
        4  5467 1 1  29 PRO CG   C   10.682   6.235  -6.070 1.00 . A A .  29 PRO CG   1 1 
        4  5468 1 1  29 PRO HA   H   12.644   5.936  -3.435 1.00 . A A .  29 PRO HA   1 1 
        4  5469 1 1  29 PRO HB2  H   11.719   7.890  -5.096 1.00 . A A .  29 PRO HB2  1 1 
        4  5470 1 1  29 PRO HB3  H   12.771   6.562  -5.671 1.00 . A A .  29 PRO HB3  1 1 
        4  5471 1 1  29 PRO HD2  H    9.597   4.413  -5.684 1.00 . A A .  29 PRO HD2  1 1 
        4  5472 1 1  29 PRO HD3  H   11.272   4.173  -6.267 1.00 . A A .  29 PRO HD3  1 1 
        4  5473 1 1  29 PRO HG2  H    9.743   6.731  -5.820 1.00 . A A .  29 PRO HG2  1 1 
        4  5474 1 1  29 PRO HG3  H   10.893   6.327  -7.135 1.00 . A A .  29 PRO HG3  1 1 
        4  5475 1 1  29 PRO N    N   11.123   4.741  -4.257 1.00 . A A .  29 PRO N    1 1 
        4  5476 1 1  29 PRO O    O    9.556   6.583  -2.821 1.00 . A A .  29 PRO O    1 1 
        4  5477 1 1  30 LYS C    C    9.736   9.683  -2.160 1.00 . A A .  30 LYS C    1 1 
        4  5478 1 1  30 LYS CA   C   10.612   8.734  -1.329 1.00 . A A .  30 LYS CA   1 1 
        4  5479 1 1  30 LYS CB   C   11.542   9.468  -0.361 1.00 . A A .  30 LYS CB   1 1 
        4  5480 1 1  30 LYS CD   C   13.538  10.957  -0.056 1.00 . A A .  30 LYS CD   1 1 
        4  5481 1 1  30 LYS CE   C   14.778  11.439  -0.802 1.00 . A A .  30 LYS CE   1 1 
        4  5482 1 1  30 LYS CG   C   12.568  10.347  -1.072 1.00 . A A .  30 LYS CG   1 1 
        4  5483 1 1  30 LYS H    H   12.347   7.909  -2.287 1.00 . A A .  30 LYS H    1 1 
        4  5484 1 1  30 LYS HA   H    9.955   8.165  -0.690 1.00 . A A .  30 LYS HA   1 1 
        4  5485 1 1  30 LYS HB2  H   10.951  10.085   0.318 1.00 . A A .  30 LYS HB2  1 1 
        4  5486 1 1  30 LYS HB3  H   12.066   8.719   0.229 1.00 . A A .  30 LYS HB3  1 1 
        4  5487 1 1  30 LYS HD2  H   13.064  11.771   0.498 1.00 . A A .  30 LYS HD2  1 1 
        4  5488 1 1  30 LYS HD3  H   13.853  10.188   0.651 1.00 . A A .  30 LYS HD3  1 1 
        4  5489 1 1  30 LYS HE2  H   15.592  11.538  -0.082 1.00 . A A .  30 LYS HE2  1 1 
        4  5490 1 1  30 LYS HE3  H   15.034  10.648  -1.513 1.00 . A A .  30 LYS HE3  1 1 
        4  5491 1 1  30 LYS HG2  H   13.127   9.728  -1.773 1.00 . A A .  30 LYS HG2  1 1 
        4  5492 1 1  30 LYS HG3  H   12.059  11.142  -1.619 1.00 . A A .  30 LYS HG3  1 1 
        4  5493 1 1  30 LYS HZ1  H   13.822  12.660  -2.198 1.00 . A A .  30 LYS HZ1  1 1 
        4  5494 1 1  30 LYS HZ2  H   14.314  13.467  -0.862 1.00 . A A .  30 LYS HZ2  1 1 
        4  5495 1 1  30 LYS HZ3  H   15.399  13.023  -1.994 1.00 . A A .  30 LYS HZ3  1 1 
        4  5496 1 1  30 LYS N    N   11.353   7.768  -2.164 1.00 . A A .  30 LYS N    1 1 
        4  5497 1 1  30 LYS NZ   N   14.560  12.730  -1.510 1.00 . A A .  30 LYS NZ   1 1 
        4  5498 1 1  30 LYS O    O    9.958   9.856  -3.360 1.00 . A A .  30 LYS O    1 1 
        4  5499 1 1  31 ASP C    C    6.957  10.474  -3.294 1.00 . A A .  31 ASP C    1 1 
        4  5500 1 1  31 ASP CA   C    7.733  11.168  -2.145 1.00 . A A .  31 ASP CA   1 1 
        4  5501 1 1  31 ASP CB   C    8.345  12.539  -2.498 1.00 . A A .  31 ASP CB   1 1 
        4  5502 1 1  31 ASP CG   C    7.288  13.603  -2.853 1.00 . A A .  31 ASP CG   1 1 
        4  5503 1 1  31 ASP H    H    8.658  10.127  -0.518 1.00 . A A .  31 ASP H    1 1 
        4  5504 1 1  31 ASP HA   H    6.987  11.354  -1.372 1.00 . A A .  31 ASP HA   1 1 
        4  5505 1 1  31 ASP HB2  H    8.914  12.899  -1.639 1.00 . A A .  31 ASP HB2  1 1 
        4  5506 1 1  31 ASP HB3  H    9.041  12.418  -3.330 1.00 . A A .  31 ASP HB3  1 1 
        4  5507 1 1  31 ASP N    N    8.747  10.304  -1.514 1.00 . A A .  31 ASP N    1 1 
        4  5508 1 1  31 ASP O    O    6.643  11.070  -4.328 1.00 . A A .  31 ASP O    1 1 
        4  5509 1 1  31 ASP OD1  O    6.265  13.713  -2.134 1.00 . A A .  31 ASP OD1  1 1 
        4  5510 1 1  31 ASP OD2  O    7.504  14.376  -3.819 1.00 . A A .  31 ASP OD2  1 1 
        4  5511 1 1  32 SER C    C    4.625   7.788  -3.080 1.00 . A A .  32 SER C    1 1 
        4  5512 1 1  32 SER CA   C    5.775   8.349  -3.928 1.00 . A A .  32 SER CA   1 1 
        4  5513 1 1  32 SER CB   C    6.585   7.214  -4.577 1.00 . A A .  32 SER CB   1 1 
        4  5514 1 1  32 SER H    H    6.921   8.777  -2.218 1.00 . A A .  32 SER H    1 1 
        4  5515 1 1  32 SER HA   H    5.338   8.949  -4.726 1.00 . A A .  32 SER HA   1 1 
        4  5516 1 1  32 SER HB2  H    5.962   6.722  -5.326 1.00 . A A .  32 SER HB2  1 1 
        4  5517 1 1  32 SER HB3  H    7.462   7.627  -5.078 1.00 . A A .  32 SER HB3  1 1 
        4  5518 1 1  32 SER HG   H    7.909   6.437  -3.354 1.00 . A A .  32 SER HG   1 1 
        4  5519 1 1  32 SER N    N    6.649   9.188  -3.097 1.00 . A A .  32 SER N    1 1 
        4  5520 1 1  32 SER O    O    4.642   7.913  -1.852 1.00 . A A .  32 SER O    1 1 
        4  5521 1 1  32 SER OG   O    6.984   6.250  -3.619 1.00 . A A .  32 SER OG   1 1 
        4  5522 1 1  33 LEU C    C    2.947   4.924  -2.992 1.00 . A A .  33 LEU C    1 1 
        4  5523 1 1  33 LEU CA   C    2.578   6.413  -3.005 1.00 . A A .  33 LEU CA   1 1 
        4  5524 1 1  33 LEU CB   C    1.222   6.685  -3.685 1.00 . A A .  33 LEU CB   1 1 
        4  5525 1 1  33 LEU CD1  C   -0.304   6.628  -1.640 1.00 . A A .  33 LEU CD1  1 1 
        4  5526 1 1  33 LEU CD2  C   -1.219   6.114  -3.868 1.00 . A A .  33 LEU CD2  1 1 
        4  5527 1 1  33 LEU CG   C    0.027   6.002  -2.993 1.00 . A A .  33 LEU CG   1 1 
        4  5528 1 1  33 LEU H    H    3.693   7.041  -4.704 1.00 . A A .  33 LEU H    1 1 
        4  5529 1 1  33 LEU HA   H    2.525   6.764  -1.973 1.00 . A A .  33 LEU HA   1 1 
        4  5530 1 1  33 LEU HB2  H    1.045   7.762  -3.711 1.00 . A A .  33 LEU HB2  1 1 
        4  5531 1 1  33 LEU HB3  H    1.279   6.330  -4.714 1.00 . A A .  33 LEU HB3  1 1 
        4  5532 1 1  33 LEU HD11 H   -0.503   7.692  -1.759 1.00 . A A .  33 LEU HD11 1 1 
        4  5533 1 1  33 LEU HD12 H   -1.188   6.146  -1.226 1.00 . A A .  33 LEU HD12 1 1 
        4  5534 1 1  33 LEU HD13 H    0.521   6.487  -0.947 1.00 . A A .  33 LEU HD13 1 1 
        4  5535 1 1  33 LEU HD21 H   -1.484   7.163  -4.000 1.00 . A A .  33 LEU HD21 1 1 
        4  5536 1 1  33 LEU HD22 H   -1.024   5.665  -4.842 1.00 . A A .  33 LEU HD22 1 1 
        4  5537 1 1  33 LEU HD23 H   -2.048   5.584  -3.398 1.00 . A A .  33 LEU HD23 1 1 
        4  5538 1 1  33 LEU HG   H    0.248   4.947  -2.846 1.00 . A A .  33 LEU HG   1 1 
        4  5539 1 1  33 LEU N    N    3.627   7.160  -3.706 1.00 . A A .  33 LEU N    1 1 
        4  5540 1 1  33 LEU O    O    3.171   4.337  -4.055 1.00 . A A .  33 LEU O    1 1 
        4  5541 1 1  34 ARG C    C    2.531   2.170  -0.611 1.00 . A A .  34 ARG C    1 1 
        4  5542 1 1  34 ARG CA   C    3.389   2.893  -1.641 1.00 . A A .  34 ARG CA   1 1 
        4  5543 1 1  34 ARG CB   C    4.897   2.802  -1.352 1.00 . A A .  34 ARG CB   1 1 
        4  5544 1 1  34 ARG CD   C    6.894   3.243   0.084 1.00 . A A .  34 ARG CD   1 1 
        4  5545 1 1  34 ARG CG   C    5.373   3.425  -0.027 1.00 . A A .  34 ARG CG   1 1 
        4  5546 1 1  34 ARG CZ   C    8.704   4.016   1.622 1.00 . A A .  34 ARG CZ   1 1 
        4  5547 1 1  34 ARG H    H    2.746   4.827  -0.977 1.00 . A A .  34 ARG H    1 1 
        4  5548 1 1  34 ARG HA   H    3.221   2.371  -2.584 1.00 . A A .  34 ARG HA   1 1 
        4  5549 1 1  34 ARG HB2  H    5.187   1.751  -1.360 1.00 . A A .  34 ARG HB2  1 1 
        4  5550 1 1  34 ARG HB3  H    5.417   3.299  -2.172 1.00 . A A .  34 ARG HB3  1 1 
        4  5551 1 1  34 ARG HD2  H    7.132   2.180   0.004 1.00 . A A .  34 ARG HD2  1 1 
        4  5552 1 1  34 ARG HD3  H    7.359   3.770  -0.749 1.00 . A A .  34 ARG HD3  1 1 
        4  5553 1 1  34 ARG HE   H    6.804   3.908   2.129 1.00 . A A .  34 ARG HE   1 1 
        4  5554 1 1  34 ARG HG2  H    5.127   4.487  -0.005 1.00 . A A .  34 ARG HG2  1 1 
        4  5555 1 1  34 ARG HG3  H    4.885   2.928   0.808 1.00 . A A .  34 ARG HG3  1 1 
        4  5556 1 1  34 ARG HH11 H    9.444   3.661  -0.206 1.00 . A A .  34 ARG HH11 1 1 
        4  5557 1 1  34 ARG HH12 H   10.589   4.248   0.975 1.00 . A A .  34 ARG HH12 1 1 
        4  5558 1 1  34 ARG HH21 H    8.257   4.513   3.481 1.00 . A A .  34 ARG HH21 1 1 
        4  5559 1 1  34 ARG HH22 H    9.988   4.466   3.095 1.00 . A A .  34 ARG HH22 1 1 
        4  5560 1 1  34 ARG N    N    2.989   4.300  -1.812 1.00 . A A .  34 ARG N    1 1 
        4  5561 1 1  34 ARG NE   N    7.440   3.758   1.352 1.00 . A A .  34 ARG NE   1 1 
        4  5562 1 1  34 ARG NH1  N    9.658   3.921   0.739 1.00 . A A .  34 ARG NH1  1 1 
        4  5563 1 1  34 ARG NH2  N    9.026   4.411   2.813 1.00 . A A .  34 ARG NH2  1 1 
        4  5564 1 1  34 ARG O    O    2.006   2.791   0.311 1.00 . A A .  34 ARG O    1 1 
        4  5565 1 1  35 MET C    C    2.418  -1.159   0.632 1.00 . A A .  35 MET C    1 1 
        4  5566 1 1  35 MET CA   C    1.575  -0.035   0.041 1.00 . A A .  35 MET CA   1 1 
        4  5567 1 1  35 MET CB   C    0.385  -0.593  -0.760 1.00 . A A .  35 MET CB   1 1 
        4  5568 1 1  35 MET CE   C   -3.054  -0.948  -0.459 1.00 . A A .  35 MET CE   1 1 
        4  5569 1 1  35 MET CG   C   -0.700   0.462  -0.984 1.00 . A A .  35 MET CG   1 1 
        4  5570 1 1  35 MET H    H    2.961   0.419  -1.492 1.00 . A A .  35 MET H    1 1 
        4  5571 1 1  35 MET HA   H    1.201   0.517   0.897 1.00 . A A .  35 MET HA   1 1 
        4  5572 1 1  35 MET HB2  H    0.739  -0.956  -1.725 1.00 . A A .  35 MET HB2  1 1 
        4  5573 1 1  35 MET HB3  H   -0.060  -1.423  -0.212 1.00 . A A .  35 MET HB3  1 1 
        4  5574 1 1  35 MET HE1  H   -3.186  -0.263   0.380 1.00 . A A .  35 MET HE1  1 1 
        4  5575 1 1  35 MET HE2  H   -4.035  -1.295  -0.792 1.00 . A A .  35 MET HE2  1 1 
        4  5576 1 1  35 MET HE3  H   -2.454  -1.801  -0.141 1.00 . A A .  35 MET HE3  1 1 
        4  5577 1 1  35 MET HG2  H   -0.989   0.854  -0.011 1.00 . A A .  35 MET HG2  1 1 
        4  5578 1 1  35 MET HG3  H   -0.269   1.272  -1.571 1.00 . A A .  35 MET HG3  1 1 
        4  5579 1 1  35 MET N    N    2.390   0.861  -0.783 1.00 . A A .  35 MET N    1 1 
        4  5580 1 1  35 MET O    O    3.507  -1.446   0.146 1.00 . A A .  35 MET O    1 1 
        4  5581 1 1  35 MET SD   S   -2.210  -0.099  -1.822 1.00 . A A .  35 MET SD   1 1 
        4  5582 1 1  36 ALA C    C    1.596  -3.931   2.888 1.00 . A A .  36 ALA C    1 1 
        4  5583 1 1  36 ALA CA   C    2.594  -2.899   2.354 1.00 . A A .  36 ALA CA   1 1 
        4  5584 1 1  36 ALA CB   C    3.499  -2.360   3.460 1.00 . A A .  36 ALA CB   1 1 
        4  5585 1 1  36 ALA H    H    1.026  -1.493   2.051 1.00 . A A .  36 ALA H    1 1 
        4  5586 1 1  36 ALA HA   H    3.219  -3.389   1.617 1.00 . A A .  36 ALA HA   1 1 
        4  5587 1 1  36 ALA HB1  H    4.090  -3.167   3.891 1.00 . A A .  36 ALA HB1  1 1 
        4  5588 1 1  36 ALA HB2  H    4.164  -1.619   3.033 1.00 . A A .  36 ALA HB2  1 1 
        4  5589 1 1  36 ALA HB3  H    2.903  -1.885   4.231 1.00 . A A .  36 ALA HB3  1 1 
        4  5590 1 1  36 ALA N    N    1.935  -1.779   1.701 1.00 . A A .  36 ALA N    1 1 
        4  5591 1 1  36 ALA O    O    0.403  -3.644   3.014 1.00 . A A .  36 ALA O    1 1 
        4  5592 1 1  37 ILE C    C    1.899  -6.670   5.129 1.00 . A A .  37 ILE C    1 1 
        4  5593 1 1  37 ILE CA   C    1.305  -6.217   3.804 1.00 . A A .  37 ILE CA   1 1 
        4  5594 1 1  37 ILE CB   C    1.183  -7.355   2.767 1.00 . A A .  37 ILE CB   1 1 
        4  5595 1 1  37 ILE CD1  C   -0.258  -7.963   0.725 1.00 . A A .  37 ILE CD1  1 1 
        4  5596 1 1  37 ILE CG1  C   -0.144  -7.151   2.016 1.00 . A A .  37 ILE CG1  1 1 
        4  5597 1 1  37 ILE CG2  C    1.275  -8.767   3.361 1.00 . A A .  37 ILE CG2  1 1 
        4  5598 1 1  37 ILE H    H    3.084  -5.298   3.074 1.00 . A A .  37 ILE H    1 1 
        4  5599 1 1  37 ILE HA   H    0.303  -5.853   4.033 1.00 . A A .  37 ILE HA   1 1 
        4  5600 1 1  37 ILE HB   H    2.006  -7.263   2.058 1.00 . A A .  37 ILE HB   1 1 
        4  5601 1 1  37 ILE HD11 H   -0.297  -9.027   0.951 1.00 . A A .  37 ILE HD11 1 1 
        4  5602 1 1  37 ILE HD12 H   -1.171  -7.675   0.202 1.00 . A A .  37 ILE HD12 1 1 
        4  5603 1 1  37 ILE HD13 H    0.599  -7.759   0.085 1.00 . A A .  37 ILE HD13 1 1 
        4  5604 1 1  37 ILE HG12 H   -0.972  -7.406   2.682 1.00 . A A .  37 ILE HG12 1 1 
        4  5605 1 1  37 ILE HG13 H   -0.235  -6.099   1.755 1.00 . A A .  37 ILE HG13 1 1 
        4  5606 1 1  37 ILE HG21 H    0.473  -8.926   4.086 1.00 . A A .  37 ILE HG21 1 1 
        4  5607 1 1  37 ILE HG22 H    1.215  -9.500   2.560 1.00 . A A .  37 ILE HG22 1 1 
        4  5608 1 1  37 ILE HG23 H    2.241  -8.899   3.851 1.00 . A A .  37 ILE HG23 1 1 
        4  5609 1 1  37 ILE N    N    2.094  -5.121   3.234 1.00 . A A .  37 ILE N    1 1 
        4  5610 1 1  37 ILE O    O    3.113  -6.806   5.250 1.00 . A A .  37 ILE O    1 1 
        4  5611 1 1  38 MET C    C    1.498  -8.992   7.402 1.00 . A A .  38 MET C    1 1 
        4  5612 1 1  38 MET CA   C    1.444  -7.462   7.410 1.00 . A A .  38 MET CA   1 1 
        4  5613 1 1  38 MET CB   C    0.491  -6.907   8.483 1.00 . A A .  38 MET CB   1 1 
        4  5614 1 1  38 MET CE   C    3.272  -5.230   9.041 1.00 . A A .  38 MET CE   1 1 
        4  5615 1 1  38 MET CG   C    1.118  -6.801   9.876 1.00 . A A .  38 MET CG   1 1 
        4  5616 1 1  38 MET H    H    0.054  -6.836   5.918 1.00 . A A .  38 MET H    1 1 
        4  5617 1 1  38 MET HA   H    2.451  -7.118   7.615 1.00 . A A .  38 MET HA   1 1 
        4  5618 1 1  38 MET HB2  H    0.135  -5.916   8.196 1.00 . A A .  38 MET HB2  1 1 
        4  5619 1 1  38 MET HB3  H   -0.373  -7.565   8.544 1.00 . A A .  38 MET HB3  1 1 
        4  5620 1 1  38 MET HE1  H    3.954  -4.404   9.236 1.00 . A A .  38 MET HE1  1 1 
        4  5621 1 1  38 MET HE2  H    3.807  -6.175   9.122 1.00 . A A .  38 MET HE2  1 1 
        4  5622 1 1  38 MET HE3  H    2.859  -5.130   8.032 1.00 . A A .  38 MET HE3  1 1 
        4  5623 1 1  38 MET HG2  H    0.318  -6.925  10.604 1.00 . A A .  38 MET HG2  1 1 
        4  5624 1 1  38 MET HG3  H    1.830  -7.615  10.015 1.00 . A A .  38 MET HG3  1 1 
        4  5625 1 1  38 MET N    N    1.042  -6.943   6.109 1.00 . A A .  38 MET N    1 1 
        4  5626 1 1  38 MET O    O    0.474  -9.655   7.219 1.00 . A A .  38 MET O    1 1 
        4  5627 1 1  38 MET SD   S    1.932  -5.222  10.253 1.00 . A A .  38 MET SD   1 1 
        4  5628 1 1  39 VAL C    C    3.791 -11.390   8.899 1.00 . A A .  39 VAL C    1 1 
        4  5629 1 1  39 VAL CA   C    2.899 -11.013   7.717 1.00 . A A .  39 VAL CA   1 1 
        4  5630 1 1  39 VAL CB   C    3.414 -11.587   6.381 1.00 . A A .  39 VAL CB   1 1 
        4  5631 1 1  39 VAL CG1  C    4.787 -11.046   5.977 1.00 . A A .  39 VAL CG1  1 1 
        4  5632 1 1  39 VAL CG2  C    3.460 -13.120   6.370 1.00 . A A .  39 VAL CG2  1 1 
        4  5633 1 1  39 VAL H    H    3.507  -8.950   7.681 1.00 . A A .  39 VAL H    1 1 
        4  5634 1 1  39 VAL HA   H    1.931 -11.482   7.904 1.00 . A A .  39 VAL HA   1 1 
        4  5635 1 1  39 VAL HB   H    2.706 -11.299   5.608 1.00 . A A .  39 VAL HB   1 1 
        4  5636 1 1  39 VAL HG11 H    5.047 -11.440   4.996 1.00 . A A .  39 VAL HG11 1 1 
        4  5637 1 1  39 VAL HG12 H    4.762  -9.958   5.917 1.00 . A A .  39 VAL HG12 1 1 
        4  5638 1 1  39 VAL HG13 H    5.549 -11.347   6.695 1.00 . A A .  39 VAL HG13 1 1 
        4  5639 1 1  39 VAL HG21 H    3.685 -13.468   5.362 1.00 . A A .  39 VAL HG21 1 1 
        4  5640 1 1  39 VAL HG22 H    4.234 -13.488   7.044 1.00 . A A .  39 VAL HG22 1 1 
        4  5641 1 1  39 VAL HG23 H    2.492 -13.523   6.666 1.00 . A A .  39 VAL HG23 1 1 
        4  5642 1 1  39 VAL N    N    2.689  -9.555   7.623 1.00 . A A .  39 VAL N    1 1 
        4  5643 1 1  39 VAL O    O    4.747 -10.690   9.224 1.00 . A A .  39 VAL O    1 1 
        4  5644 1 1  40 GLN C    C    5.577 -13.678  10.132 1.00 . A A .  40 GLN C    1 1 
        4  5645 1 1  40 GLN CA   C    4.254 -13.086  10.648 1.00 . A A .  40 GLN CA   1 1 
        4  5646 1 1  40 GLN CB   C    3.412 -14.107  11.438 1.00 . A A .  40 GLN CB   1 1 
        4  5647 1 1  40 GLN CD   C    1.821 -16.088  11.372 1.00 . A A .  40 GLN CD   1 1 
        4  5648 1 1  40 GLN CG   C    2.452 -14.948  10.575 1.00 . A A .  40 GLN CG   1 1 
        4  5649 1 1  40 GLN H    H    2.681 -13.032   9.215 1.00 . A A .  40 GLN H    1 1 
        4  5650 1 1  40 GLN HA   H    4.516 -12.290  11.341 1.00 . A A .  40 GLN HA   1 1 
        4  5651 1 1  40 GLN HB2  H    4.086 -14.766  11.988 1.00 . A A .  40 GLN HB2  1 1 
        4  5652 1 1  40 GLN HB3  H    2.813 -13.566  12.171 1.00 . A A .  40 GLN HB3  1 1 
        4  5653 1 1  40 GLN HE21 H    3.410 -17.316  11.106 1.00 . A A .  40 GLN HE21 1 1 
        4  5654 1 1  40 GLN HE22 H    2.075 -17.958  12.051 1.00 . A A .  40 GLN HE22 1 1 
        4  5655 1 1  40 GLN HG2  H    1.654 -14.302  10.196 1.00 . A A .  40 GLN HG2  1 1 
        4  5656 1 1  40 GLN HG3  H    2.991 -15.361   9.720 1.00 . A A .  40 GLN HG3  1 1 
        4  5657 1 1  40 GLN N    N    3.470 -12.504   9.553 1.00 . A A .  40 GLN N    1 1 
        4  5658 1 1  40 GLN NE2  N    2.496 -17.210  11.521 1.00 . A A .  40 GLN NE2  1 1 
        4  5659 1 1  40 GLN O    O    5.597 -14.466   9.183 1.00 . A A .  40 GLN O    1 1 
        4  5660 1 1  40 GLN OE1  O    0.713 -15.989  11.885 1.00 . A A .  40 GLN OE1  1 1 
        4  5661 1 1  41 SER C    C    8.702 -14.789  10.834 1.00 . A A .  41 SER C    1 1 
        4  5662 1 1  41 SER CA   C    8.054 -13.523  10.268 1.00 . A A .  41 SER CA   1 1 
        4  5663 1 1  41 SER CB   C    8.940 -12.305  10.562 1.00 . A A .  41 SER CB   1 1 
        4  5664 1 1  41 SER H    H    6.616 -12.663  11.546 1.00 . A A .  41 SER H    1 1 
        4  5665 1 1  41 SER HA   H    8.009 -13.634   9.191 1.00 . A A .  41 SER HA   1 1 
        4  5666 1 1  41 SER HB2  H    9.996 -12.572  10.494 1.00 . A A .  41 SER HB2  1 1 
        4  5667 1 1  41 SER HB3  H    8.737 -11.534   9.822 1.00 . A A .  41 SER HB3  1 1 
        4  5668 1 1  41 SER HG   H    8.891 -12.447  12.516 1.00 . A A .  41 SER HG   1 1 
        4  5669 1 1  41 SER N    N    6.691 -13.280  10.748 1.00 . A A .  41 SER N    1 1 
        4  5670 1 1  41 SER O    O    8.584 -15.061  12.032 1.00 . A A .  41 SER O    1 1 
        4  5671 1 1  41 SER OG   O    8.672 -11.773  11.845 1.00 . A A .  41 SER OG   1 1 
        4  5672 1 1  42 PRO C    C   11.696 -16.111  10.991 1.00 . A A .  42 PRO C    1 1 
        4  5673 1 1  42 PRO CA   C   10.328 -16.610  10.475 1.00 . A A .  42 PRO CA   1 1 
        4  5674 1 1  42 PRO CB   C   10.465 -17.543   9.268 1.00 . A A .  42 PRO CB   1 1 
        4  5675 1 1  42 PRO CD   C    9.439 -15.499   8.550 1.00 . A A .  42 PRO CD   1 1 
        4  5676 1 1  42 PRO CG   C   10.401 -16.589   8.076 1.00 . A A .  42 PRO CG   1 1 
        4  5677 1 1  42 PRO HA   H    9.814 -17.131  11.276 1.00 . A A .  42 PRO HA   1 1 
        4  5678 1 1  42 PRO HB2  H   11.398 -18.111   9.284 1.00 . A A .  42 PRO HB2  1 1 
        4  5679 1 1  42 PRO HB3  H    9.610 -18.221   9.235 1.00 . A A .  42 PRO HB3  1 1 
        4  5680 1 1  42 PRO HD2  H    9.743 -14.524   8.170 1.00 . A A .  42 PRO HD2  1 1 
        4  5681 1 1  42 PRO HD3  H    8.424 -15.724   8.218 1.00 . A A .  42 PRO HD3  1 1 
        4  5682 1 1  42 PRO HG2  H   11.389 -16.161   7.899 1.00 . A A .  42 PRO HG2  1 1 
        4  5683 1 1  42 PRO HG3  H   10.036 -17.087   7.178 1.00 . A A .  42 PRO HG3  1 1 
        4  5684 1 1  42 PRO N    N    9.470 -15.528  10.007 1.00 . A A .  42 PRO N    1 1 
        4  5685 1 1  42 PRO O    O   12.339 -16.796  11.788 1.00 . A A .  42 PRO O    1 1 
        4  5686 1 1  43 MET C    C   13.384 -13.263  12.032 1.00 . A A .  43 MET C    1 1 
        4  5687 1 1  43 MET CA   C   13.441 -14.312  10.904 1.00 . A A .  43 MET CA   1 1 
        4  5688 1 1  43 MET CB   C   14.096 -13.725   9.648 1.00 . A A .  43 MET CB   1 1 
        4  5689 1 1  43 MET CE   C   12.555 -13.649   6.749 1.00 . A A .  43 MET CE   1 1 
        4  5690 1 1  43 MET CG   C   13.359 -12.492   9.098 1.00 . A A .  43 MET CG   1 1 
        4  5691 1 1  43 MET H    H   11.565 -14.441   9.878 1.00 . A A .  43 MET H    1 1 
        4  5692 1 1  43 MET HA   H   14.104 -15.111  11.228 1.00 . A A .  43 MET HA   1 1 
        4  5693 1 1  43 MET HB2  H   15.125 -13.440   9.874 1.00 . A A .  43 MET HB2  1 1 
        4  5694 1 1  43 MET HB3  H   14.143 -14.510   8.896 1.00 . A A .  43 MET HB3  1 1 
        4  5695 1 1  43 MET HE1  H   12.975 -14.578   7.136 1.00 . A A .  43 MET HE1  1 1 
        4  5696 1 1  43 MET HE2  H   11.538 -13.541   7.123 1.00 . A A .  43 MET HE2  1 1 
        4  5697 1 1  43 MET HE3  H   12.544 -13.681   5.659 1.00 . A A .  43 MET HE3  1 1 
        4  5698 1 1  43 MET HG2  H   12.293 -12.575   9.304 1.00 . A A .  43 MET HG2  1 1 
        4  5699 1 1  43 MET HG3  H   13.728 -11.607   9.618 1.00 . A A .  43 MET HG3  1 1 
        4  5700 1 1  43 MET N    N   12.140 -14.920  10.555 1.00 . A A .  43 MET N    1 1 
        4  5701 1 1  43 MET O    O   14.427 -12.835  12.531 1.00 . A A .  43 MET O    1 1 
        4  5702 1 1  43 MET SD   S   13.552 -12.243   7.314 1.00 . A A .  43 MET SD   1 1 
        4  5703 1 1  44 PHE C    C   10.794 -12.181  14.384 1.00 . A A .  44 PHE C    1 1 
        4  5704 1 1  44 PHE CA   C   11.922 -11.780  13.411 1.00 . A A .  44 PHE CA   1 1 
        4  5705 1 1  44 PHE CB   C   11.672 -10.442  12.689 1.00 . A A .  44 PHE CB   1 1 
        4  5706 1 1  44 PHE CD1  C   12.172  -8.624  14.385 1.00 . A A .  44 PHE CD1  1 1 
        4  5707 1 1  44 PHE CD2  C    9.867  -8.951  13.671 1.00 . A A .  44 PHE CD2  1 1 
        4  5708 1 1  44 PHE CE1  C   11.756  -7.601  15.256 1.00 . A A .  44 PHE CE1  1 1 
        4  5709 1 1  44 PHE CE2  C    9.451  -7.926  14.539 1.00 . A A .  44 PHE CE2  1 1 
        4  5710 1 1  44 PHE CG   C   11.229  -9.302  13.590 1.00 . A A .  44 PHE CG   1 1 
        4  5711 1 1  44 PHE CZ   C   10.396  -7.252  15.334 1.00 . A A .  44 PHE CZ   1 1 
        4  5712 1 1  44 PHE H    H   11.374 -13.273  12.002 1.00 . A A .  44 PHE H    1 1 
        4  5713 1 1  44 PHE HA   H   12.814 -11.651  14.019 1.00 . A A .  44 PHE HA   1 1 
        4  5714 1 1  44 PHE HB2  H   12.595 -10.144  12.187 1.00 . A A .  44 PHE HB2  1 1 
        4  5715 1 1  44 PHE HB3  H   10.927 -10.580  11.909 1.00 . A A .  44 PHE HB3  1 1 
        4  5716 1 1  44 PHE HD1  H   13.220  -8.892  14.332 1.00 . A A .  44 PHE HD1  1 1 
        4  5717 1 1  44 PHE HD2  H    9.134  -9.474  13.073 1.00 . A A .  44 PHE HD2  1 1 
        4  5718 1 1  44 PHE HE1  H   12.483  -7.082  15.868 1.00 . A A .  44 PHE HE1  1 1 
        4  5719 1 1  44 PHE HE2  H    8.405  -7.657  14.596 1.00 . A A .  44 PHE HE2  1 1 
        4  5720 1 1  44 PHE HZ   H   10.077  -6.464  16.003 1.00 . A A .  44 PHE HZ   1 1 
        4  5721 1 1  44 PHE N    N   12.179 -12.829  12.416 1.00 . A A .  44 PHE N    1 1 
        4  5722 1 1  44 PHE O    O    9.955 -13.029  14.076 1.00 . A A .  44 PHE O    1 1 
        4  5723 1 1  45 ASP C    C    8.586 -11.292  16.767 1.00 . A A .  45 ASP C    1 1 
        4  5724 1 1  45 ASP CA   C    9.959 -12.001  16.728 1.00 . A A .  45 ASP CA   1 1 
        4  5725 1 1  45 ASP CB   C   10.787 -11.842  18.017 1.00 . A A .  45 ASP CB   1 1 
        4  5726 1 1  45 ASP CG   C   10.097 -12.442  19.258 1.00 . A A .  45 ASP CG   1 1 
        4  5727 1 1  45 ASP H    H   11.413 -10.810  15.712 1.00 . A A .  45 ASP H    1 1 
        4  5728 1 1  45 ASP HA   H    9.747 -13.065  16.617 1.00 . A A .  45 ASP HA   1 1 
        4  5729 1 1  45 ASP HB2  H   11.746 -12.349  17.880 1.00 . A A .  45 ASP HB2  1 1 
        4  5730 1 1  45 ASP HB3  H   10.994 -10.782  18.177 1.00 . A A .  45 ASP HB3  1 1 
        4  5731 1 1  45 ASP N    N   10.782 -11.589  15.579 1.00 . A A .  45 ASP N    1 1 
        4  5732 1 1  45 ASP O    O    8.218 -10.638  17.748 1.00 . A A .  45 ASP O    1 1 
        4  5733 1 1  45 ASP OD1  O    9.492 -13.537  19.157 1.00 . A A .  45 ASP OD1  1 1 
        4  5734 1 1  45 ASP OD2  O   10.204 -11.846  20.357 1.00 . A A .  45 ASP OD2  1 1 
        4  5735 1 1  46 GLY C    C    6.074 -10.747  14.037 1.00 . A A .  46 GLY C    1 1 
        4  5736 1 1  46 GLY CA   C    6.529 -10.741  15.492 1.00 . A A .  46 GLY CA   1 1 
        4  5737 1 1  46 GLY H    H    8.201 -11.930  14.893 1.00 . A A .  46 GLY H    1 1 
        4  5738 1 1  46 GLY HA2  H    5.771 -11.267  16.074 1.00 . A A .  46 GLY HA2  1 1 
        4  5739 1 1  46 GLY HA3  H    6.578  -9.711  15.845 1.00 . A A .  46 GLY HA3  1 1 
        4  5740 1 1  46 GLY N    N    7.836 -11.384  15.667 1.00 . A A .  46 GLY N    1 1 
        4  5741 1 1  46 GLY O    O    6.084 -11.795  13.384 1.00 . A A .  46 GLY O    1 1 
        4  5742 1 1  47 LYS C    C    5.922  -8.228  11.468 1.00 . A A .  47 LYS C    1 1 
        4  5743 1 1  47 LYS CA   C    5.186  -9.379  12.155 1.00 . A A .  47 LYS CA   1 1 
        4  5744 1 1  47 LYS CB   C    3.658  -9.200  12.101 1.00 . A A .  47 LYS CB   1 1 
        4  5745 1 1  47 LYS CD   C    1.594 -10.734  12.311 1.00 . A A .  47 LYS CD   1 1 
        4  5746 1 1  47 LYS CE   C    0.555  -9.631  12.085 1.00 . A A .  47 LYS CE   1 1 
        4  5747 1 1  47 LYS CG   C    2.910 -10.265  12.930 1.00 . A A .  47 LYS CG   1 1 
        4  5748 1 1  47 LYS H    H    5.655  -8.771  14.145 1.00 . A A .  47 LYS H    1 1 
        4  5749 1 1  47 LYS HA   H    5.436 -10.272  11.583 1.00 . A A .  47 LYS HA   1 1 
        4  5750 1 1  47 LYS HB2  H    3.396  -8.210  12.473 1.00 . A A .  47 LYS HB2  1 1 
        4  5751 1 1  47 LYS HB3  H    3.348  -9.253  11.056 1.00 . A A .  47 LYS HB3  1 1 
        4  5752 1 1  47 LYS HD2  H    1.834 -11.180  11.345 1.00 . A A .  47 LYS HD2  1 1 
        4  5753 1 1  47 LYS HD3  H    1.175 -11.514  12.946 1.00 . A A .  47 LYS HD3  1 1 
        4  5754 1 1  47 LYS HE2  H    1.024  -8.837  11.502 1.00 . A A .  47 LYS HE2  1 1 
        4  5755 1 1  47 LYS HE3  H   -0.255 -10.057  11.484 1.00 . A A .  47 LYS HE3  1 1 
        4  5756 1 1  47 LYS HG2  H    3.526 -11.157  13.025 1.00 . A A .  47 LYS HG2  1 1 
        4  5757 1 1  47 LYS HG3  H    2.733  -9.881  13.936 1.00 . A A .  47 LYS HG3  1 1 
        4  5758 1 1  47 LYS HZ1  H    0.737  -8.666  13.934 1.00 . A A .  47 LYS HZ1  1 1 
        4  5759 1 1  47 LYS HZ2  H   -0.641  -8.316  13.169 1.00 . A A .  47 LYS HZ2  1 1 
        4  5760 1 1  47 LYS HZ3  H   -0.473  -9.782  13.896 1.00 . A A .  47 LYS HZ3  1 1 
        4  5761 1 1  47 LYS N    N    5.647  -9.579  13.538 1.00 . A A .  47 LYS N    1 1 
        4  5762 1 1  47 LYS NZ   N    0.009  -9.078  13.354 1.00 . A A .  47 LYS NZ   1 1 
        4  5763 1 1  47 LYS O    O    6.372  -7.286  12.121 1.00 . A A .  47 LYS O    1 1 
        4  5764 1 1  48 VAL C    C    6.119  -6.955   8.061 1.00 . A A .  48 VAL C    1 1 
        4  5765 1 1  48 VAL CA   C    6.885  -7.470   9.293 1.00 . A A .  48 VAL CA   1 1 
        4  5766 1 1  48 VAL CB   C    8.163  -8.219   8.859 1.00 . A A .  48 VAL CB   1 1 
        4  5767 1 1  48 VAL CG1  C    9.050  -8.541  10.072 1.00 . A A .  48 VAL CG1  1 1 
        4  5768 1 1  48 VAL CG2  C    7.875  -9.526   8.105 1.00 . A A .  48 VAL CG2  1 1 
        4  5769 1 1  48 VAL H    H    5.610  -9.130   9.702 1.00 . A A .  48 VAL H    1 1 
        4  5770 1 1  48 VAL HA   H    7.202  -6.611   9.881 1.00 . A A .  48 VAL HA   1 1 
        4  5771 1 1  48 VAL HB   H    8.727  -7.566   8.195 1.00 . A A .  48 VAL HB   1 1 
        4  5772 1 1  48 VAL HG11 H    8.548  -9.243  10.738 1.00 . A A .  48 VAL HG11 1 1 
        4  5773 1 1  48 VAL HG12 H    9.988  -8.985   9.741 1.00 . A A .  48 VAL HG12 1 1 
        4  5774 1 1  48 VAL HG13 H    9.272  -7.629  10.627 1.00 . A A .  48 VAL HG13 1 1 
        4  5775 1 1  48 VAL HG21 H    7.311  -9.320   7.196 1.00 . A A .  48 VAL HG21 1 1 
        4  5776 1 1  48 VAL HG22 H    8.813 -10.006   7.829 1.00 . A A .  48 VAL HG22 1 1 
        4  5777 1 1  48 VAL HG23 H    7.293 -10.207   8.727 1.00 . A A .  48 VAL HG23 1 1 
        4  5778 1 1  48 VAL N    N    6.041  -8.323  10.145 1.00 . A A .  48 VAL N    1 1 
        4  5779 1 1  48 VAL O    O    5.265  -7.680   7.540 1.00 . A A .  48 VAL O    1 1 
        4  5780 1 1  49 PRO C    C    6.389  -5.563   5.104 1.00 . A A .  49 PRO C    1 1 
        4  5781 1 1  49 PRO CA   C    5.710  -5.150   6.422 1.00 . A A .  49 PRO CA   1 1 
        4  5782 1 1  49 PRO CB   C    5.756  -3.633   6.634 1.00 . A A .  49 PRO CB   1 1 
        4  5783 1 1  49 PRO CD   C    7.190  -4.696   8.246 1.00 . A A .  49 PRO CD   1 1 
        4  5784 1 1  49 PRO CG   C    7.061  -3.426   7.402 1.00 . A A .  49 PRO CG   1 1 
        4  5785 1 1  49 PRO HA   H    4.669  -5.474   6.413 1.00 . A A .  49 PRO HA   1 1 
        4  5786 1 1  49 PRO HB2  H    5.751  -3.081   5.693 1.00 . A A .  49 PRO HB2  1 1 
        4  5787 1 1  49 PRO HB3  H    4.914  -3.325   7.255 1.00 . A A .  49 PRO HB3  1 1 
        4  5788 1 1  49 PRO HD2  H    8.235  -5.000   8.313 1.00 . A A .  49 PRO HD2  1 1 
        4  5789 1 1  49 PRO HD3  H    6.790  -4.503   9.244 1.00 . A A .  49 PRO HD3  1 1 
        4  5790 1 1  49 PRO HG2  H    7.897  -3.365   6.705 1.00 . A A .  49 PRO HG2  1 1 
        4  5791 1 1  49 PRO HG3  H    7.022  -2.532   8.025 1.00 . A A .  49 PRO HG3  1 1 
        4  5792 1 1  49 PRO N    N    6.381  -5.719   7.589 1.00 . A A .  49 PRO N    1 1 
        4  5793 1 1  49 PRO O    O    7.591  -5.359   4.916 1.00 . A A .  49 PRO O    1 1 
        4  5794 1 1  50 HIS C    C    5.662  -5.272   1.873 1.00 . A A .  50 HIS C    1 1 
        4  5795 1 1  50 HIS CA   C    6.067  -6.412   2.792 1.00 . A A .  50 HIS CA   1 1 
        4  5796 1 1  50 HIS CB   C    5.494  -7.763   2.324 1.00 . A A .  50 HIS CB   1 1 
        4  5797 1 1  50 HIS CD2  C    6.937  -8.995   4.035 1.00 . A A .  50 HIS CD2  1 1 
        4  5798 1 1  50 HIS CE1  C    7.049 -10.979   3.084 1.00 . A A .  50 HIS CE1  1 1 
        4  5799 1 1  50 HIS CG   C    6.222  -8.965   2.876 1.00 . A A .  50 HIS CG   1 1 
        4  5800 1 1  50 HIS H    H    4.658  -6.337   4.400 1.00 . A A .  50 HIS H    1 1 
        4  5801 1 1  50 HIS HA   H    7.150  -6.470   2.747 1.00 . A A .  50 HIS HA   1 1 
        4  5802 1 1  50 HIS HB2  H    4.440  -7.831   2.597 1.00 . A A .  50 HIS HB2  1 1 
        4  5803 1 1  50 HIS HB3  H    5.558  -7.811   1.237 1.00 . A A .  50 HIS HB3  1 1 
        4  5804 1 1  50 HIS HD2  H    7.048  -8.168   4.722 1.00 . A A .  50 HIS HD2  1 1 
        4  5805 1 1  50 HIS HE1  H    7.270 -12.029   2.924 1.00 . A A .  50 HIS HE1  1 1 
        4  5806 1 1  50 HIS HE2  H    8.034 -10.619   4.904 1.00 . A A .  50 HIS HE2  1 1 
        4  5807 1 1  50 HIS N    N    5.621  -6.113   4.160 1.00 . A A .  50 HIS N    1 1 
        4  5808 1 1  50 HIS ND1  N    6.292 -10.222   2.271 1.00 . A A .  50 HIS ND1  1 1 
        4  5809 1 1  50 HIS NE2  N    7.461 -10.264   4.145 1.00 . A A .  50 HIS NE2  1 1 
        4  5810 1 1  50 HIS O    O    4.502  -5.201   1.493 1.00 . A A .  50 HIS O    1 1 
        4  5811 1 1  51 TRP C    C    6.266  -3.413  -0.721 1.00 . A A .  51 TRP C    1 1 
        4  5812 1 1  51 TRP CA   C    6.341  -3.151   0.789 1.00 . A A .  51 TRP CA   1 1 
        4  5813 1 1  51 TRP CB   C    7.439  -2.119   1.064 1.00 . A A .  51 TRP CB   1 1 
        4  5814 1 1  51 TRP CD1  C    8.230  -1.883   3.465 1.00 . A A .  51 TRP CD1  1 1 
        4  5815 1 1  51 TRP CD2  C    6.611  -0.422   2.931 1.00 . A A .  51 TRP CD2  1 1 
        4  5816 1 1  51 TRP CE2  C    6.936  -0.199   4.302 1.00 . A A .  51 TRP CE2  1 1 
        4  5817 1 1  51 TRP CE3  C    5.592   0.378   2.369 1.00 . A A .  51 TRP CE3  1 1 
        4  5818 1 1  51 TRP CG   C    7.438  -1.517   2.433 1.00 . A A .  51 TRP CG   1 1 
        4  5819 1 1  51 TRP CH2  C    5.245   1.521   4.503 1.00 . A A .  51 TRP CH2  1 1 
        4  5820 1 1  51 TRP CZ2  C    6.277   0.764   5.081 1.00 . A A .  51 TRP CZ2  1 1 
        4  5821 1 1  51 TRP CZ3  C    4.895   1.315   3.155 1.00 . A A .  51 TRP CZ3  1 1 
        4  5822 1 1  51 TRP H    H    7.522  -4.495   1.931 1.00 . A A .  51 TRP H    1 1 
        4  5823 1 1  51 TRP HA   H    5.394  -2.715   1.111 1.00 . A A .  51 TRP HA   1 1 
        4  5824 1 1  51 TRP HB2  H    8.412  -2.572   0.869 1.00 . A A .  51 TRP HB2  1 1 
        4  5825 1 1  51 TRP HB3  H    7.312  -1.299   0.358 1.00 . A A .  51 TRP HB3  1 1 
        4  5826 1 1  51 TRP HD1  H    8.974  -2.672   3.428 1.00 . A A .  51 TRP HD1  1 1 
        4  5827 1 1  51 TRP HE1  H    8.425  -1.193   5.456 1.00 . A A .  51 TRP HE1  1 1 
        4  5828 1 1  51 TRP HE3  H    5.310   0.223   1.338 1.00 . A A .  51 TRP HE3  1 1 
        4  5829 1 1  51 TRP HH2  H    4.721   2.259   5.095 1.00 . A A .  51 TRP HH2  1 1 
        4  5830 1 1  51 TRP HZ2  H    6.554   0.910   6.116 1.00 . A A .  51 TRP HZ2  1 1 
        4  5831 1 1  51 TRP HZ3  H    4.076   1.869   2.719 1.00 . A A .  51 TRP HZ3  1 1 
        4  5832 1 1  51 TRP N    N    6.592  -4.365   1.570 1.00 . A A .  51 TRP N    1 1 
        4  5833 1 1  51 TRP NE1  N    7.946  -1.099   4.567 1.00 . A A .  51 TRP NE1  1 1 
        4  5834 1 1  51 TRP O    O    7.009  -4.215  -1.275 1.00 . A A .  51 TRP O    1 1 
        4  5835 1 1  52 TYR C    C    4.941  -1.260  -3.358 1.00 . A A .  52 TYR C    1 1 
        4  5836 1 1  52 TYR CA   C    5.313  -2.673  -2.869 1.00 . A A .  52 TYR CA   1 1 
        4  5837 1 1  52 TYR CB   C    4.296  -3.728  -3.350 1.00 . A A .  52 TYR CB   1 1 
        4  5838 1 1  52 TYR CD1  C    3.372  -5.196  -1.470 1.00 . A A .  52 TYR CD1  1 1 
        4  5839 1 1  52 TYR CD2  C    4.829  -6.187  -3.149 1.00 . A A .  52 TYR CD2  1 1 
        4  5840 1 1  52 TYR CE1  C    3.202  -6.463  -0.868 1.00 . A A .  52 TYR CE1  1 1 
        4  5841 1 1  52 TYR CE2  C    4.647  -7.454  -2.564 1.00 . A A .  52 TYR CE2  1 1 
        4  5842 1 1  52 TYR CG   C    4.187  -5.057  -2.614 1.00 . A A .  52 TYR CG   1 1 
        4  5843 1 1  52 TYR CZ   C    3.844  -7.593  -1.415 1.00 . A A .  52 TYR CZ   1 1 
        4  5844 1 1  52 TYR H    H    4.811  -2.033  -0.915 1.00 . A A .  52 TYR H    1 1 
        4  5845 1 1  52 TYR HA   H    6.282  -2.924  -3.296 1.00 . A A .  52 TYR HA   1 1 
        4  5846 1 1  52 TYR HB2  H    3.305  -3.282  -3.356 1.00 . A A .  52 TYR HB2  1 1 
        4  5847 1 1  52 TYR HB3  H    4.577  -3.973  -4.372 1.00 . A A .  52 TYR HB3  1 1 
        4  5848 1 1  52 TYR HD1  H    2.891  -4.327  -1.043 1.00 . A A .  52 TYR HD1  1 1 
        4  5849 1 1  52 TYR HD2  H    5.443  -6.076  -4.028 1.00 . A A .  52 TYR HD2  1 1 
        4  5850 1 1  52 TYR HE1  H    2.598  -6.573   0.023 1.00 . A A .  52 TYR HE1  1 1 
        4  5851 1 1  52 TYR HE2  H    5.105  -8.331  -2.997 1.00 . A A .  52 TYR HE2  1 1 
        4  5852 1 1  52 TYR HH   H    3.105  -8.807  -0.076 1.00 . A A .  52 TYR HH   1 1 
        4  5853 1 1  52 TYR N    N    5.414  -2.675  -1.416 1.00 . A A .  52 TYR N    1 1 
        4  5854 1 1  52 TYR O    O    4.383  -0.455  -2.601 1.00 . A A .  52 TYR O    1 1 
        4  5855 1 1  52 TYR OH   O    3.681  -8.824  -0.855 1.00 . A A .  52 TYR OH   1 1 
        4  5856 1 1  53 HIS C    C    3.066   0.180  -5.154 1.00 . A A .  53 HIS C    1 1 
        4  5857 1 1  53 HIS CA   C    4.603   0.237  -5.279 1.00 . A A .  53 HIS CA   1 1 
        4  5858 1 1  53 HIS CB   C    4.983   0.322  -6.769 1.00 . A A .  53 HIS CB   1 1 
        4  5859 1 1  53 HIS CD2  C    7.237   1.498  -6.928 1.00 . A A .  53 HIS CD2  1 1 
        4  5860 1 1  53 HIS CE1  C    8.478  -0.103  -7.794 1.00 . A A .  53 HIS CE1  1 1 
        4  5861 1 1  53 HIS CG   C    6.461   0.385  -7.082 1.00 . A A .  53 HIS CG   1 1 
        4  5862 1 1  53 HIS H    H    5.695  -1.630  -5.190 1.00 . A A .  53 HIS H    1 1 
        4  5863 1 1  53 HIS HA   H    4.953   1.139  -4.772 1.00 . A A .  53 HIS HA   1 1 
        4  5864 1 1  53 HIS HB2  H    4.540  -0.517  -7.293 1.00 . A A .  53 HIS HB2  1 1 
        4  5865 1 1  53 HIS HB3  H    4.528   1.222  -7.185 1.00 . A A .  53 HIS HB3  1 1 
        4  5866 1 1  53 HIS HD2  H    6.911   2.457  -6.547 1.00 . A A .  53 HIS HD2  1 1 
        4  5867 1 1  53 HIS HE1  H    9.337  -0.630  -8.189 1.00 . A A .  53 HIS HE1  1 1 
        4  5868 1 1  53 HIS HE2  H    9.307   1.785  -7.411 1.00 . A A .  53 HIS HE2  1 1 
        4  5869 1 1  53 HIS N    N    5.207  -0.945  -4.630 1.00 . A A .  53 HIS N    1 1 
        4  5870 1 1  53 HIS ND1  N    7.252  -0.628  -7.636 1.00 . A A .  53 HIS ND1  1 1 
        4  5871 1 1  53 HIS NE2  N    8.498   1.173  -7.377 1.00 . A A .  53 HIS NE2  1 1 
        4  5872 1 1  53 HIS O    O    2.503  -0.914  -5.055 1.00 . A A .  53 HIS O    1 1 
        4  5873 1 1  54 PHE C    C    0.191   0.365  -5.997 1.00 . A A .  54 PHE C    1 1 
        4  5874 1 1  54 PHE CA   C    0.905   1.363  -5.065 1.00 . A A .  54 PHE CA   1 1 
        4  5875 1 1  54 PHE CB   C    0.368   2.778  -5.331 1.00 . A A .  54 PHE CB   1 1 
        4  5876 1 1  54 PHE CD1  C   -1.951   2.457  -4.355 1.00 . A A .  54 PHE CD1  1 1 
        4  5877 1 1  54 PHE CD2  C   -1.756   3.105  -6.693 1.00 . A A .  54 PHE CD2  1 1 
        4  5878 1 1  54 PHE CE1  C   -3.344   2.343  -4.503 1.00 . A A .  54 PHE CE1  1 1 
        4  5879 1 1  54 PHE CE2  C   -3.155   3.021  -6.829 1.00 . A A .  54 PHE CE2  1 1 
        4  5880 1 1  54 PHE CG   C   -1.148   2.819  -5.453 1.00 . A A .  54 PHE CG   1 1 
        4  5881 1 1  54 PHE CZ   C   -3.946   2.630  -5.737 1.00 . A A .  54 PHE CZ   1 1 
        4  5882 1 1  54 PHE H    H    2.869   2.206  -5.268 1.00 . A A .  54 PHE H    1 1 
        4  5883 1 1  54 PHE HA   H    0.653   1.097  -4.036 1.00 . A A .  54 PHE HA   1 1 
        4  5884 1 1  54 PHE HB2  H    0.677   3.433  -4.520 1.00 . A A .  54 PHE HB2  1 1 
        4  5885 1 1  54 PHE HB3  H    0.804   3.155  -6.256 1.00 . A A .  54 PHE HB3  1 1 
        4  5886 1 1  54 PHE HD1  H   -1.493   2.230  -3.404 1.00 . A A .  54 PHE HD1  1 1 
        4  5887 1 1  54 PHE HD2  H   -1.152   3.364  -7.551 1.00 . A A .  54 PHE HD2  1 1 
        4  5888 1 1  54 PHE HE1  H   -3.953   2.022  -3.671 1.00 . A A .  54 PHE HE1  1 1 
        4  5889 1 1  54 PHE HE2  H   -3.627   3.246  -7.776 1.00 . A A .  54 PHE HE2  1 1 
        4  5890 1 1  54 PHE HZ   H   -5.017   2.547  -5.848 1.00 . A A .  54 PHE HZ   1 1 
        4  5891 1 1  54 PHE N    N    2.372   1.327  -5.203 1.00 . A A .  54 PHE N    1 1 
        4  5892 1 1  54 PHE O    O   -0.683  -0.375  -5.552 1.00 . A A .  54 PHE O    1 1 
        4  5893 1 1  55 SER C    C    0.334  -2.030  -8.086 1.00 . A A .  55 SER C    1 1 
        4  5894 1 1  55 SER CA   C   -0.041  -0.559  -8.279 1.00 . A A .  55 SER CA   1 1 
        4  5895 1 1  55 SER CB   C    0.355  -0.103  -9.689 1.00 . A A .  55 SER CB   1 1 
        4  5896 1 1  55 SER H    H    1.341   0.895  -7.583 1.00 . A A .  55 SER H    1 1 
        4  5897 1 1  55 SER HA   H   -1.123  -0.468  -8.195 1.00 . A A .  55 SER HA   1 1 
        4  5898 1 1  55 SER HB2  H    1.418  -0.289  -9.844 1.00 . A A .  55 SER HB2  1 1 
        4  5899 1 1  55 SER HB3  H   -0.216  -0.671 -10.425 1.00 . A A .  55 SER HB3  1 1 
        4  5900 1 1  55 SER HG   H    0.330   1.552 -10.754 1.00 . A A .  55 SER HG   1 1 
        4  5901 1 1  55 SER N    N    0.589   0.303  -7.273 1.00 . A A .  55 SER N    1 1 
        4  5902 1 1  55 SER O    O   -0.474  -2.917  -8.360 1.00 . A A .  55 SER O    1 1 
        4  5903 1 1  55 SER OG   O    0.093   1.284  -9.847 1.00 . A A .  55 SER OG   1 1 
        4  5904 1 1  56 CYS C    C    1.374  -4.460  -6.333 1.00 . A A .  56 CYS C    1 1 
        4  5905 1 1  56 CYS CA   C    2.091  -3.635  -7.419 1.00 . A A .  56 CYS CA   1 1 
        4  5906 1 1  56 CYS CB   C    3.593  -3.532  -7.151 1.00 . A A .  56 CYS CB   1 1 
        4  5907 1 1  56 CYS H    H    2.150  -1.529  -7.344 1.00 . A A .  56 CYS H    1 1 
        4  5908 1 1  56 CYS HA   H    1.952  -4.142  -8.364 1.00 . A A .  56 CYS HA   1 1 
        4  5909 1 1  56 CYS HB2  H    3.755  -2.886  -6.285 1.00 . A A .  56 CYS HB2  1 1 
        4  5910 1 1  56 CYS HB3  H    3.968  -4.526  -6.895 1.00 . A A .  56 CYS HB3  1 1 
        4  5911 1 1  56 CYS N    N    1.546  -2.297  -7.587 1.00 . A A .  56 CYS N    1 1 
        4  5912 1 1  56 CYS O    O    1.181  -5.659  -6.516 1.00 . A A .  56 CYS O    1 1 
        4  5913 1 1  56 CYS SG   S    4.519  -2.900  -8.601 1.00 . A A .  56 CYS SG   1 1 
        4  5914 1 1  57 PHE C    C   -1.117  -5.204  -4.824 1.00 . A A .  57 PHE C    1 1 
        4  5915 1 1  57 PHE CA   C    0.070  -4.442  -4.207 1.00 . A A .  57 PHE CA   1 1 
        4  5916 1 1  57 PHE CB   C   -0.427  -3.334  -3.268 1.00 . A A .  57 PHE CB   1 1 
        4  5917 1 1  57 PHE CD1  C   -2.801  -3.923  -2.613 1.00 . A A .  57 PHE CD1  1 1 
        4  5918 1 1  57 PHE CD2  C   -1.062  -4.093  -0.921 1.00 . A A .  57 PHE CD2  1 1 
        4  5919 1 1  57 PHE CE1  C   -3.753  -4.387  -1.693 1.00 . A A .  57 PHE CE1  1 1 
        4  5920 1 1  57 PHE CE2  C   -2.028  -4.505   0.016 1.00 . A A .  57 PHE CE2  1 1 
        4  5921 1 1  57 PHE CG   C   -1.449  -3.792  -2.241 1.00 . A A .  57 PHE CG   1 1 
        4  5922 1 1  57 PHE CZ   C   -3.369  -4.668  -0.374 1.00 . A A .  57 PHE CZ   1 1 
        4  5923 1 1  57 PHE H    H    1.127  -2.850  -5.167 1.00 . A A .  57 PHE H    1 1 
        4  5924 1 1  57 PHE HA   H    0.645  -5.142  -3.604 1.00 . A A .  57 PHE HA   1 1 
        4  5925 1 1  57 PHE HB2  H    0.437  -2.921  -2.752 1.00 . A A .  57 PHE HB2  1 1 
        4  5926 1 1  57 PHE HB3  H   -0.876  -2.536  -3.859 1.00 . A A .  57 PHE HB3  1 1 
        4  5927 1 1  57 PHE HD1  H   -3.111  -3.681  -3.617 1.00 . A A .  57 PHE HD1  1 1 
        4  5928 1 1  57 PHE HD2  H   -0.029  -3.991  -0.620 1.00 . A A .  57 PHE HD2  1 1 
        4  5929 1 1  57 PHE HE1  H   -4.784  -4.507  -2.000 1.00 . A A .  57 PHE HE1  1 1 
        4  5930 1 1  57 PHE HE2  H   -1.742  -4.691   1.040 1.00 . A A .  57 PHE HE2  1 1 
        4  5931 1 1  57 PHE HZ   H   -4.110  -4.995   0.342 1.00 . A A .  57 PHE HZ   1 1 
        4  5932 1 1  57 PHE N    N    0.921  -3.832  -5.242 1.00 . A A .  57 PHE N    1 1 
        4  5933 1 1  57 PHE O    O   -1.405  -6.345  -4.459 1.00 . A A .  57 PHE O    1 1 
        4  5934 1 1  58 TRP C    C   -2.558  -6.278  -7.484 1.00 . A A .  58 TRP C    1 1 
        4  5935 1 1  58 TRP CA   C   -2.941  -5.169  -6.488 1.00 . A A .  58 TRP CA   1 1 
        4  5936 1 1  58 TRP CB   C   -3.729  -4.034  -7.148 1.00 . A A .  58 TRP CB   1 1 
        4  5937 1 1  58 TRP CD1  C   -3.338  -1.735  -6.203 1.00 . A A .  58 TRP CD1  1 1 
        4  5938 1 1  58 TRP CD2  C   -5.088  -2.727  -5.214 1.00 . A A .  58 TRP CD2  1 1 
        4  5939 1 1  58 TRP CE2  C   -4.898  -1.461  -4.572 1.00 . A A .  58 TRP CE2  1 1 
        4  5940 1 1  58 TRP CE3  C   -6.160  -3.523  -4.743 1.00 . A A .  58 TRP CE3  1 1 
        4  5941 1 1  58 TRP CG   C   -4.054  -2.877  -6.246 1.00 . A A .  58 TRP CG   1 1 
        4  5942 1 1  58 TRP CH2  C   -6.762  -1.834  -3.087 1.00 . A A .  58 TRP CH2  1 1 
        4  5943 1 1  58 TRP CZ2  C   -5.712  -1.017  -3.522 1.00 . A A .  58 TRP CZ2  1 1 
        4  5944 1 1  58 TRP CZ3  C   -6.990  -3.078  -3.699 1.00 . A A .  58 TRP CZ3  1 1 
        4  5945 1 1  58 TRP H    H   -1.492  -3.662  -6.074 1.00 . A A .  58 TRP H    1 1 
        4  5946 1 1  58 TRP HA   H   -3.588  -5.623  -5.735 1.00 . A A .  58 TRP HA   1 1 
        4  5947 1 1  58 TRP HB2  H   -3.140  -3.654  -7.981 1.00 . A A .  58 TRP HB2  1 1 
        4  5948 1 1  58 TRP HB3  H   -4.648  -4.447  -7.554 1.00 . A A .  58 TRP HB3  1 1 
        4  5949 1 1  58 TRP HD1  H   -2.477  -1.528  -6.825 1.00 . A A .  58 TRP HD1  1 1 
        4  5950 1 1  58 TRP HE1  H   -3.381  -0.017  -4.984 1.00 . A A .  58 TRP HE1  1 1 
        4  5951 1 1  58 TRP HE3  H   -6.359  -4.485  -5.190 1.00 . A A .  58 TRP HE3  1 1 
        4  5952 1 1  58 TRP HH2  H   -7.381  -1.504  -2.271 1.00 . A A .  58 TRP HH2  1 1 
        4  5953 1 1  58 TRP HZ2  H   -5.538  -0.065  -3.041 1.00 . A A .  58 TRP HZ2  1 1 
        4  5954 1 1  58 TRP HZ3  H   -7.804  -3.705  -3.362 1.00 . A A .  58 TRP HZ3  1 1 
        4  5955 1 1  58 TRP N    N   -1.776  -4.596  -5.813 1.00 . A A .  58 TRP N    1 1 
        4  5956 1 1  58 TRP NE1  N   -3.819  -0.902  -5.218 1.00 . A A .  58 TRP NE1  1 1 
        4  5957 1 1  58 TRP O    O   -3.355  -7.187  -7.716 1.00 . A A .  58 TRP O    1 1 
        4  5958 1 1  59 LYS C    C   -0.499  -8.645  -7.866 1.00 . A A .  59 LYS C    1 1 
        4  5959 1 1  59 LYS CA   C   -0.731  -7.414  -8.751 1.00 . A A .  59 LYS CA   1 1 
        4  5960 1 1  59 LYS CB   C    0.592  -7.037  -9.432 1.00 . A A .  59 LYS CB   1 1 
        4  5961 1 1  59 LYS CD   C    1.849  -5.361 -10.824 1.00 . A A .  59 LYS CD   1 1 
        4  5962 1 1  59 LYS CE   C    1.699  -3.910 -11.271 1.00 . A A .  59 LYS CE   1 1 
        4  5963 1 1  59 LYS CG   C    0.466  -5.827 -10.357 1.00 . A A .  59 LYS CG   1 1 
        4  5964 1 1  59 LYS H    H   -0.703  -5.514  -7.747 1.00 . A A .  59 LYS H    1 1 
        4  5965 1 1  59 LYS HA   H   -1.427  -7.683  -9.546 1.00 . A A .  59 LYS HA   1 1 
        4  5966 1 1  59 LYS HB2  H    1.343  -6.835  -8.672 1.00 . A A .  59 LYS HB2  1 1 
        4  5967 1 1  59 LYS HB3  H    0.942  -7.884 -10.025 1.00 . A A .  59 LYS HB3  1 1 
        4  5968 1 1  59 LYS HD2  H    2.564  -5.418 -10.002 1.00 . A A .  59 LYS HD2  1 1 
        4  5969 1 1  59 LYS HD3  H    2.204  -5.985 -11.646 1.00 . A A .  59 LYS HD3  1 1 
        4  5970 1 1  59 LYS HE2  H    1.221  -3.897 -12.254 1.00 . A A .  59 LYS HE2  1 1 
        4  5971 1 1  59 LYS HE3  H    1.023  -3.412 -10.569 1.00 . A A .  59 LYS HE3  1 1 
        4  5972 1 1  59 LYS HG2  H   -0.155  -6.077 -11.218 1.00 . A A .  59 LYS HG2  1 1 
        4  5973 1 1  59 LYS HG3  H   -0.013  -5.017  -9.810 1.00 . A A .  59 LYS HG3  1 1 
        4  5974 1 1  59 LYS HZ1  H    2.861  -2.258 -11.652 1.00 . A A .  59 LYS HZ1  1 1 
        4  5975 1 1  59 LYS HZ2  H    3.413  -3.135 -10.366 1.00 . A A .  59 LYS HZ2  1 1 
        4  5976 1 1  59 LYS HZ3  H    3.663  -3.664 -11.903 1.00 . A A .  59 LYS HZ3  1 1 
        4  5977 1 1  59 LYS N    N   -1.311  -6.286  -7.989 1.00 . A A .  59 LYS N    1 1 
        4  5978 1 1  59 LYS NZ   N    3.001  -3.199 -11.299 1.00 . A A .  59 LYS NZ   1 1 
        4  5979 1 1  59 LYS O    O   -0.511  -9.764  -8.377 1.00 . A A .  59 LYS O    1 1 
        4  5980 1 1  60 VAL C    C   -1.651 -10.249  -5.406 1.00 . A A .  60 VAL C    1 1 
        4  5981 1 1  60 VAL CA   C   -0.264  -9.592  -5.583 1.00 . A A .  60 VAL CA   1 1 
        4  5982 1 1  60 VAL CB   C    0.336  -9.176  -4.215 1.00 . A A .  60 VAL CB   1 1 
        4  5983 1 1  60 VAL CG1  C    0.788 -10.386  -3.382 1.00 . A A .  60 VAL CG1  1 1 
        4  5984 1 1  60 VAL CG2  C    1.578  -8.290  -4.347 1.00 . A A .  60 VAL CG2  1 1 
        4  5985 1 1  60 VAL H    H   -0.211  -7.510  -6.203 1.00 . A A .  60 VAL H    1 1 
        4  5986 1 1  60 VAL HA   H    0.393 -10.355  -5.999 1.00 . A A .  60 VAL HA   1 1 
        4  5987 1 1  60 VAL HB   H   -0.412  -8.626  -3.651 1.00 . A A .  60 VAL HB   1 1 
        4  5988 1 1  60 VAL HG11 H    1.542 -10.957  -3.925 1.00 . A A .  60 VAL HG11 1 1 
        4  5989 1 1  60 VAL HG12 H    1.211 -10.049  -2.435 1.00 . A A .  60 VAL HG12 1 1 
        4  5990 1 1  60 VAL HG13 H   -0.053 -11.037  -3.153 1.00 . A A .  60 VAL HG13 1 1 
        4  5991 1 1  60 VAL HG21 H    1.997  -8.094  -3.362 1.00 . A A .  60 VAL HG21 1 1 
        4  5992 1 1  60 VAL HG22 H    2.328  -8.774  -4.971 1.00 . A A .  60 VAL HG22 1 1 
        4  5993 1 1  60 VAL HG23 H    1.308  -7.331  -4.771 1.00 . A A .  60 VAL HG23 1 1 
        4  5994 1 1  60 VAL N    N   -0.308  -8.465  -6.550 1.00 . A A .  60 VAL N    1 1 
        4  5995 1 1  60 VAL O    O   -1.748 -11.385  -4.941 1.00 . A A .  60 VAL O    1 1 
        4  5996 1 1  61 GLY C    C   -4.891 -10.039  -4.575 1.00 . A A .  61 GLY C    1 1 
        4  5997 1 1  61 GLY CA   C   -4.091 -10.141  -5.881 1.00 . A A .  61 GLY CA   1 1 
        4  5998 1 1  61 GLY H    H   -2.598  -8.664  -6.234 1.00 . A A .  61 GLY H    1 1 
        4  5999 1 1  61 GLY HA2  H   -4.650  -9.607  -6.650 1.00 . A A .  61 GLY HA2  1 1 
        4  6000 1 1  61 GLY HA3  H   -4.043 -11.190  -6.172 1.00 . A A .  61 GLY HA3  1 1 
        4  6001 1 1  61 GLY N    N   -2.733  -9.582  -5.831 1.00 . A A .  61 GLY N    1 1 
        4  6002 1 1  61 GLY O    O   -5.908 -10.723  -4.428 1.00 . A A .  61 GLY O    1 1 
        4  6003 1 1  62 HIS C    C   -6.351  -7.937  -2.616 1.00 . A A .  62 HIS C    1 1 
        4  6004 1 1  62 HIS CA   C   -5.192  -8.919  -2.384 1.00 . A A .  62 HIS CA   1 1 
        4  6005 1 1  62 HIS CB   C   -4.229  -8.432  -1.292 1.00 . A A .  62 HIS CB   1 1 
        4  6006 1 1  62 HIS CD2  C   -2.225 -10.020  -1.239 1.00 . A A .  62 HIS CD2  1 1 
        4  6007 1 1  62 HIS CE1  C   -2.752 -11.241   0.520 1.00 . A A .  62 HIS CE1  1 1 
        4  6008 1 1  62 HIS CG   C   -3.397  -9.556  -0.721 1.00 . A A .  62 HIS CG   1 1 
        4  6009 1 1  62 HIS H    H   -3.628  -8.661  -3.819 1.00 . A A .  62 HIS H    1 1 
        4  6010 1 1  62 HIS HA   H   -5.638  -9.849  -2.024 1.00 . A A .  62 HIS HA   1 1 
        4  6011 1 1  62 HIS HB2  H   -3.575  -7.654  -1.691 1.00 . A A .  62 HIS HB2  1 1 
        4  6012 1 1  62 HIS HB3  H   -4.807  -7.993  -0.480 1.00 . A A .  62 HIS HB3  1 1 
        4  6013 1 1  62 HIS HD2  H   -1.719  -9.632  -2.109 1.00 . A A .  62 HIS HD2  1 1 
        4  6014 1 1  62 HIS HE1  H   -2.709 -12.004   1.291 1.00 . A A .  62 HIS HE1  1 1 
        4  6015 1 1  62 HIS HE2  H   -1.001 -11.646  -0.565 1.00 . A A .  62 HIS HE2  1 1 
        4  6016 1 1  62 HIS N    N   -4.454  -9.206  -3.623 1.00 . A A .  62 HIS N    1 1 
        4  6017 1 1  62 HIS ND1  N   -3.737 -10.335   0.390 1.00 . A A .  62 HIS ND1  1 1 
        4  6018 1 1  62 HIS NE2  N   -1.833 -11.077  -0.446 1.00 . A A .  62 HIS NE2  1 1 
        4  6019 1 1  62 HIS O    O   -6.278  -7.062  -3.484 1.00 . A A .  62 HIS O    1 1 
        4  6020 1 1  63 SER C    C   -9.086  -6.728  -0.585 1.00 . A A .  63 SER C    1 1 
        4  6021 1 1  63 SER CA   C   -8.673  -7.327  -1.929 1.00 . A A .  63 SER CA   1 1 
        4  6022 1 1  63 SER CB   C   -9.803  -8.216  -2.470 1.00 . A A .  63 SER CB   1 1 
        4  6023 1 1  63 SER H    H   -7.366  -8.783  -1.094 1.00 . A A .  63 SER H    1 1 
        4  6024 1 1  63 SER HA   H   -8.541  -6.493  -2.620 1.00 . A A .  63 SER HA   1 1 
        4  6025 1 1  63 SER HB2  H   -9.931  -9.078  -1.812 1.00 . A A .  63 SER HB2  1 1 
        4  6026 1 1  63 SER HB3  H  -10.733  -7.645  -2.483 1.00 . A A .  63 SER HB3  1 1 
        4  6027 1 1  63 SER HG   H  -10.241  -9.234  -4.087 1.00 . A A .  63 SER HG   1 1 
        4  6028 1 1  63 SER N    N   -7.415  -8.084  -1.819 1.00 . A A .  63 SER N    1 1 
        4  6029 1 1  63 SER O    O   -8.796  -7.283   0.477 1.00 . A A .  63 SER O    1 1 
        4  6030 1 1  63 SER OG   O   -9.512  -8.657  -3.787 1.00 . A A .  63 SER OG   1 1 
        4  6031 1 1  64 ILE C    C  -11.454  -4.230   0.490 1.00 . A A .  64 ILE C    1 1 
        4  6032 1 1  64 ILE CA   C   -9.992  -4.698   0.518 1.00 . A A .  64 ILE CA   1 1 
        4  6033 1 1  64 ILE CB   C   -8.996  -3.509   0.508 1.00 . A A .  64 ILE CB   1 1 
        4  6034 1 1  64 ILE CD1  C   -6.532  -2.764   0.156 1.00 . A A .  64 ILE CD1  1 1 
        4  6035 1 1  64 ILE CG1  C   -7.579  -3.872  -0.003 1.00 . A A .  64 ILE CG1  1 1 
        4  6036 1 1  64 ILE CG2  C   -8.930  -2.899   1.913 1.00 . A A .  64 ILE CG2  1 1 
        4  6037 1 1  64 ILE H    H  -10.046  -5.224  -1.536 1.00 . A A .  64 ILE H    1 1 
        4  6038 1 1  64 ILE HA   H   -9.838  -5.266   1.438 1.00 . A A .  64 ILE HA   1 1 
        4  6039 1 1  64 ILE HB   H   -9.380  -2.753  -0.174 1.00 . A A .  64 ILE HB   1 1 
        4  6040 1 1  64 ILE HD11 H   -5.697  -2.952  -0.510 1.00 . A A .  64 ILE HD11 1 1 
        4  6041 1 1  64 ILE HD12 H   -6.966  -1.795  -0.090 1.00 . A A .  64 ILE HD12 1 1 
        4  6042 1 1  64 ILE HD13 H   -6.161  -2.753   1.179 1.00 . A A .  64 ILE HD13 1 1 
        4  6043 1 1  64 ILE HG12 H   -7.216  -4.763   0.504 1.00 . A A .  64 ILE HG12 1 1 
        4  6044 1 1  64 ILE HG13 H   -7.643  -4.103  -1.065 1.00 . A A .  64 ILE HG13 1 1 
        4  6045 1 1  64 ILE HG21 H   -8.534  -3.627   2.618 1.00 . A A .  64 ILE HG21 1 1 
        4  6046 1 1  64 ILE HG22 H   -8.275  -2.029   1.908 1.00 . A A .  64 ILE HG22 1 1 
        4  6047 1 1  64 ILE HG23 H   -9.921  -2.583   2.238 1.00 . A A .  64 ILE HG23 1 1 
        4  6048 1 1  64 ILE N    N   -9.756  -5.576  -0.634 1.00 . A A .  64 ILE N    1 1 
        4  6049 1 1  64 ILE O    O  -11.970  -3.876  -0.573 1.00 . A A .  64 ILE O    1 1 
        4  6050 1 1  65 ARG C    C  -13.981  -2.970   2.779 1.00 . A A .  65 ARG C    1 1 
        4  6051 1 1  65 ARG CA   C  -13.595  -4.064   1.777 1.00 . A A .  65 ARG CA   1 1 
        4  6052 1 1  65 ARG CB   C  -14.317  -5.401   2.073 1.00 . A A .  65 ARG CB   1 1 
        4  6053 1 1  65 ARG CD   C  -12.623  -7.298   2.312 1.00 . A A .  65 ARG CD   1 1 
        4  6054 1 1  65 ARG CG   C  -13.596  -6.358   3.044 1.00 . A A .  65 ARG CG   1 1 
        4  6055 1 1  65 ARG CZ   C  -10.519  -8.488   2.959 1.00 . A A .  65 ARG CZ   1 1 
        4  6056 1 1  65 ARG H    H  -11.603  -4.500   2.482 1.00 . A A .  65 ARG H    1 1 
        4  6057 1 1  65 ARG HA   H  -13.983  -3.705   0.821 1.00 . A A .  65 ARG HA   1 1 
        4  6058 1 1  65 ARG HB2  H  -15.303  -5.176   2.485 1.00 . A A .  65 ARG HB2  1 1 
        4  6059 1 1  65 ARG HB3  H  -14.488  -5.924   1.131 1.00 . A A .  65 ARG HB3  1 1 
        4  6060 1 1  65 ARG HD2  H  -13.127  -8.254   2.156 1.00 . A A .  65 ARG HD2  1 1 
        4  6061 1 1  65 ARG HD3  H  -12.372  -6.889   1.333 1.00 . A A .  65 ARG HD3  1 1 
        4  6062 1 1  65 ARG HE   H  -11.086  -6.761   3.718 1.00 . A A .  65 ARG HE   1 1 
        4  6063 1 1  65 ARG HG2  H  -13.069  -5.784   3.801 1.00 . A A .  65 ARG HG2  1 1 
        4  6064 1 1  65 ARG HG3  H  -14.336  -6.967   3.566 1.00 . A A .  65 ARG HG3  1 1 
        4  6065 1 1  65 ARG HH11 H  -11.517  -9.530   1.575 1.00 . A A .  65 ARG HH11 1 1 
        4  6066 1 1  65 ARG HH12 H  -10.010 -10.231   2.099 1.00 . A A .  65 ARG HH12 1 1 
        4  6067 1 1  65 ARG HH21 H   -9.345  -7.656   4.310 1.00 . A A .  65 ARG HH21 1 1 
        4  6068 1 1  65 ARG HH22 H   -8.761  -9.188   3.644 1.00 . A A .  65 ARG HH22 1 1 
        4  6069 1 1  65 ARG N    N  -12.133  -4.263   1.642 1.00 . A A .  65 ARG N    1 1 
        4  6070 1 1  65 ARG NE   N  -11.374  -7.492   3.068 1.00 . A A .  65 ARG NE   1 1 
        4  6071 1 1  65 ARG NH1  N  -10.697  -9.500   2.156 1.00 . A A .  65 ARG NH1  1 1 
        4  6072 1 1  65 ARG NH2  N   -9.454  -8.466   3.695 1.00 . A A .  65 ARG NH2  1 1 
        4  6073 1 1  65 ARG O    O  -15.057  -2.385   2.657 1.00 . A A .  65 ARG O    1 1 
        4  6074 1 1  66 HIS C    C  -11.773  -0.805   4.671 1.00 . A A .  66 HIS C    1 1 
        4  6075 1 1  66 HIS CA   C  -13.162  -1.456   4.579 1.00 . A A .  66 HIS CA   1 1 
        4  6076 1 1  66 HIS CB   C  -13.869  -1.743   5.927 1.00 . A A .  66 HIS CB   1 1 
        4  6077 1 1  66 HIS CD2  C  -13.050  -4.143   6.406 1.00 . A A .  66 HIS CD2  1 1 
        4  6078 1 1  66 HIS CE1  C  -13.075  -4.117   8.599 1.00 . A A .  66 HIS CE1  1 1 
        4  6079 1 1  66 HIS CG   C  -13.400  -2.887   6.809 1.00 . A A .  66 HIS CG   1 1 
        4  6080 1 1  66 HIS H    H  -12.249  -3.209   3.777 1.00 . A A .  66 HIS H    1 1 
        4  6081 1 1  66 HIS HA   H  -13.783  -0.713   4.085 1.00 . A A .  66 HIS HA   1 1 
        4  6082 1 1  66 HIS HB2  H  -13.833  -0.829   6.520 1.00 . A A .  66 HIS HB2  1 1 
        4  6083 1 1  66 HIS HB3  H  -14.921  -1.931   5.708 1.00 . A A .  66 HIS HB3  1 1 
        4  6084 1 1  66 HIS HD2  H  -12.985  -4.491   5.394 1.00 . A A .  66 HIS HD2  1 1 
        4  6085 1 1  66 HIS HE1  H  -13.015  -4.459   9.622 1.00 . A A .  66 HIS HE1  1 1 
        4  6086 1 1  66 HIS HE2  H  -12.559  -5.872   7.571 1.00 . A A .  66 HIS HE2  1 1 
        4  6087 1 1  66 HIS N    N  -13.093  -2.644   3.718 1.00 . A A .  66 HIS N    1 1 
        4  6088 1 1  66 HIS ND1  N  -13.444  -2.885   8.208 1.00 . A A .  66 HIS ND1  1 1 
        4  6089 1 1  66 HIS NE2  N  -12.827  -4.893   7.535 1.00 . A A .  66 HIS NE2  1 1 
        4  6090 1 1  66 HIS O    O  -11.116  -0.863   5.709 1.00 . A A .  66 HIS O    1 1 
        4  6091 1 1  67 PRO C    C   -9.378   1.211   4.419 1.00 . A A .  67 PRO C    1 1 
        4  6092 1 1  67 PRO CA   C   -9.865   0.160   3.420 1.00 . A A .  67 PRO CA   1 1 
        4  6093 1 1  67 PRO CB   C   -9.704   0.650   1.971 1.00 . A A .  67 PRO CB   1 1 
        4  6094 1 1  67 PRO CD   C  -11.976   0.035   2.313 1.00 . A A .  67 PRO CD   1 1 
        4  6095 1 1  67 PRO CG   C  -11.120   1.059   1.583 1.00 . A A .  67 PRO CG   1 1 
        4  6096 1 1  67 PRO HA   H   -9.266  -0.730   3.584 1.00 . A A .  67 PRO HA   1 1 
        4  6097 1 1  67 PRO HB2  H   -9.007   1.485   1.888 1.00 . A A .  67 PRO HB2  1 1 
        4  6098 1 1  67 PRO HB3  H   -9.384  -0.166   1.327 1.00 . A A .  67 PRO HB3  1 1 
        4  6099 1 1  67 PRO HD2  H  -12.974   0.441   2.477 1.00 . A A .  67 PRO HD2  1 1 
        4  6100 1 1  67 PRO HD3  H  -12.029  -0.885   1.729 1.00 . A A .  67 PRO HD3  1 1 
        4  6101 1 1  67 PRO HG2  H  -11.331   2.049   1.987 1.00 . A A .  67 PRO HG2  1 1 
        4  6102 1 1  67 PRO HG3  H  -11.276   1.028   0.503 1.00 . A A .  67 PRO HG3  1 1 
        4  6103 1 1  67 PRO N    N  -11.272  -0.216   3.563 1.00 . A A .  67 PRO N    1 1 
        4  6104 1 1  67 PRO O    O   -8.237   1.133   4.855 1.00 . A A .  67 PRO O    1 1 
        4  6105 1 1  68 ASP C    C   -9.710   2.482   7.304 1.00 . A A .  68 ASP C    1 1 
        4  6106 1 1  68 ASP CA   C   -9.867   3.111   5.903 1.00 . A A .  68 ASP CA   1 1 
        4  6107 1 1  68 ASP CB   C  -10.837   4.300   5.865 1.00 . A A .  68 ASP CB   1 1 
        4  6108 1 1  68 ASP CG   C  -12.308   3.878   5.964 1.00 . A A .  68 ASP CG   1 1 
        4  6109 1 1  68 ASP H    H  -11.181   2.129   4.538 1.00 . A A .  68 ASP H    1 1 
        4  6110 1 1  68 ASP HA   H   -8.878   3.493   5.652 1.00 . A A .  68 ASP HA   1 1 
        4  6111 1 1  68 ASP HB2  H  -10.591   4.996   6.669 1.00 . A A .  68 ASP HB2  1 1 
        4  6112 1 1  68 ASP HB3  H  -10.691   4.829   4.923 1.00 . A A .  68 ASP HB3  1 1 
        4  6113 1 1  68 ASP N    N  -10.227   2.136   4.865 1.00 . A A .  68 ASP N    1 1 
        4  6114 1 1  68 ASP O    O   -9.209   3.132   8.226 1.00 . A A .  68 ASP O    1 1 
        4  6115 1 1  68 ASP OD1  O  -12.908   3.598   4.897 1.00 . A A .  68 ASP OD1  1 1 
        4  6116 1 1  68 ASP OD2  O  -12.862   3.836   7.087 1.00 . A A .  68 ASP OD2  1 1 
        4  6117 1 1  69 VAL C    C   -8.685  -0.618   8.394 1.00 . A A .  69 VAL C    1 1 
        4  6118 1 1  69 VAL CA   C   -9.844   0.365   8.633 1.00 . A A .  69 VAL CA   1 1 
        4  6119 1 1  69 VAL CB   C  -11.117  -0.413   9.030 1.00 . A A .  69 VAL CB   1 1 
        4  6120 1 1  69 VAL CG1  C  -10.956  -1.089  10.397 1.00 . A A .  69 VAL CG1  1 1 
        4  6121 1 1  69 VAL CG2  C  -12.362   0.483   9.087 1.00 . A A .  69 VAL CG2  1 1 
        4  6122 1 1  69 VAL H    H  -10.515   0.752   6.654 1.00 . A A .  69 VAL H    1 1 
        4  6123 1 1  69 VAL HA   H   -9.573   1.014   9.461 1.00 . A A .  69 VAL HA   1 1 
        4  6124 1 1  69 VAL HB   H  -11.295  -1.190   8.290 1.00 . A A .  69 VAL HB   1 1 
        4  6125 1 1  69 VAL HG11 H  -11.870  -1.625  10.651 1.00 . A A .  69 VAL HG11 1 1 
        4  6126 1 1  69 VAL HG12 H  -10.141  -1.811  10.364 1.00 . A A .  69 VAL HG12 1 1 
        4  6127 1 1  69 VAL HG13 H  -10.749  -0.342  11.164 1.00 . A A .  69 VAL HG13 1 1 
        4  6128 1 1  69 VAL HG21 H  -12.192   1.319   9.766 1.00 . A A .  69 VAL HG21 1 1 
        4  6129 1 1  69 VAL HG22 H  -12.592   0.861   8.091 1.00 . A A .  69 VAL HG22 1 1 
        4  6130 1 1  69 VAL HG23 H  -13.219  -0.096   9.430 1.00 . A A .  69 VAL HG23 1 1 
        4  6131 1 1  69 VAL N    N  -10.091   1.206   7.454 1.00 . A A .  69 VAL N    1 1 
        4  6132 1 1  69 VAL O    O   -7.827  -0.788   9.260 1.00 . A A .  69 VAL O    1 1 
        4  6133 1 1  70 GLU C    C   -6.320  -1.881   6.449 1.00 . A A .  70 GLU C    1 1 
        4  6134 1 1  70 GLU CA   C   -7.698  -2.360   6.917 1.00 . A A .  70 GLU CA   1 1 
        4  6135 1 1  70 GLU CB   C   -8.285  -3.277   5.825 1.00 . A A .  70 GLU CB   1 1 
        4  6136 1 1  70 GLU CD   C  -10.087  -4.868   5.035 1.00 . A A .  70 GLU CD   1 1 
        4  6137 1 1  70 GLU CG   C   -9.590  -3.988   6.197 1.00 . A A .  70 GLU CG   1 1 
        4  6138 1 1  70 GLU H    H   -9.384  -1.066   6.559 1.00 . A A .  70 GLU H    1 1 
        4  6139 1 1  70 GLU HA   H   -7.503  -2.935   7.825 1.00 . A A .  70 GLU HA   1 1 
        4  6140 1 1  70 GLU HB2  H   -8.455  -2.683   4.926 1.00 . A A .  70 GLU HB2  1 1 
        4  6141 1 1  70 GLU HB3  H   -7.547  -4.043   5.588 1.00 . A A .  70 GLU HB3  1 1 
        4  6142 1 1  70 GLU HG2  H   -9.418  -4.603   7.084 1.00 . A A .  70 GLU HG2  1 1 
        4  6143 1 1  70 GLU HG3  H  -10.349  -3.250   6.449 1.00 . A A .  70 GLU HG3  1 1 
        4  6144 1 1  70 GLU N    N   -8.643  -1.266   7.224 1.00 . A A .  70 GLU N    1 1 
        4  6145 1 1  70 GLU O    O   -5.319  -2.548   6.714 1.00 . A A .  70 GLU O    1 1 
        4  6146 1 1  70 GLU OE1  O  -10.803  -4.368   4.134 1.00 . A A .  70 GLU OE1  1 1 
        4  6147 1 1  70 GLU OE2  O   -9.783  -6.083   5.018 1.00 . A A .  70 GLU OE2  1 1 
        4  6148 1 1  71 VAL C    C   -4.636   0.982   6.262 1.00 . A A .  71 VAL C    1 1 
        4  6149 1 1  71 VAL CA   C   -5.070  -0.069   5.254 1.00 . A A .  71 VAL CA   1 1 
        4  6150 1 1  71 VAL CB   C   -5.297   0.506   3.855 1.00 . A A .  71 VAL CB   1 1 
        4  6151 1 1  71 VAL CG1  C   -3.942   0.925   3.314 1.00 . A A .  71 VAL CG1  1 1 
        4  6152 1 1  71 VAL CG2  C   -5.862  -0.546   2.897 1.00 . A A .  71 VAL CG2  1 1 
        4  6153 1 1  71 VAL H    H   -7.149  -0.251   5.606 1.00 . A A .  71 VAL H    1 1 
        4  6154 1 1  71 VAL HA   H   -4.228  -0.752   5.129 1.00 . A A .  71 VAL HA   1 1 
        4  6155 1 1  71 VAL HB   H   -5.953   1.374   3.878 1.00 . A A .  71 VAL HB   1 1 
        4  6156 1 1  71 VAL HG11 H   -3.302   0.053   3.181 1.00 . A A .  71 VAL HG11 1 1 
        4  6157 1 1  71 VAL HG12 H   -4.103   1.424   2.361 1.00 . A A .  71 VAL HG12 1 1 
        4  6158 1 1  71 VAL HG13 H   -3.474   1.609   4.023 1.00 . A A .  71 VAL HG13 1 1 
        4  6159 1 1  71 VAL HG21 H   -6.861  -0.829   3.215 1.00 . A A .  71 VAL HG21 1 1 
        4  6160 1 1  71 VAL HG22 H   -5.916  -0.142   1.887 1.00 . A A .  71 VAL HG22 1 1 
        4  6161 1 1  71 VAL HG23 H   -5.224  -1.431   2.908 1.00 . A A .  71 VAL HG23 1 1 
        4  6162 1 1  71 VAL N    N   -6.272  -0.739   5.761 1.00 . A A .  71 VAL N    1 1 
        4  6163 1 1  71 VAL O    O   -5.092   2.126   6.274 1.00 . A A .  71 VAL O    1 1 
        4  6164 1 1  72 ASP C    C   -2.236   2.525   7.352 1.00 . A A .  72 ASP C    1 1 
        4  6165 1 1  72 ASP CA   C   -3.068   1.453   8.082 1.00 . A A .  72 ASP CA   1 1 
        4  6166 1 1  72 ASP CB   C   -2.250   0.564   9.018 1.00 . A A .  72 ASP CB   1 1 
        4  6167 1 1  72 ASP CG   C   -1.442   1.360  10.051 1.00 . A A .  72 ASP CG   1 1 
        4  6168 1 1  72 ASP H    H   -3.387  -0.388   7.056 1.00 . A A .  72 ASP H    1 1 
        4  6169 1 1  72 ASP HA   H   -3.835   1.956   8.673 1.00 . A A .  72 ASP HA   1 1 
        4  6170 1 1  72 ASP HB2  H   -2.953  -0.109   9.523 1.00 . A A .  72 ASP HB2  1 1 
        4  6171 1 1  72 ASP HB3  H   -1.572  -0.050   8.422 1.00 . A A .  72 ASP HB3  1 1 
        4  6172 1 1  72 ASP N    N   -3.719   0.571   7.126 1.00 . A A .  72 ASP N    1 1 
        4  6173 1 1  72 ASP O    O   -1.589   2.248   6.346 1.00 . A A .  72 ASP O    1 1 
        4  6174 1 1  72 ASP OD1  O   -2.012   2.257  10.709 1.00 . A A .  72 ASP OD1  1 1 
        4  6175 1 1  72 ASP OD2  O   -0.227   1.082  10.201 1.00 . A A .  72 ASP OD2  1 1 
        4  6176 1 1  73 GLY C    C   -2.329   5.632   6.102 1.00 . A A .  73 GLY C    1 1 
        4  6177 1 1  73 GLY CA   C   -1.574   4.909   7.224 1.00 . A A .  73 GLY CA   1 1 
        4  6178 1 1  73 GLY H    H   -2.876   3.937   8.616 1.00 . A A .  73 GLY H    1 1 
        4  6179 1 1  73 GLY HA2  H   -1.358   5.637   8.006 1.00 . A A .  73 GLY HA2  1 1 
        4  6180 1 1  73 GLY HA3  H   -0.629   4.567   6.811 1.00 . A A .  73 GLY HA3  1 1 
        4  6181 1 1  73 GLY N    N   -2.282   3.768   7.823 1.00 . A A .  73 GLY N    1 1 
        4  6182 1 1  73 GLY O    O   -1.878   6.676   5.642 1.00 . A A .  73 GLY O    1 1 
        4  6183 1 1  74 PHE C    C   -4.818   7.274   5.306 1.00 . A A .  74 PHE C    1 1 
        4  6184 1 1  74 PHE CA   C   -4.452   5.858   4.813 1.00 . A A .  74 PHE CA   1 1 
        4  6185 1 1  74 PHE CB   C   -5.693   4.958   4.687 1.00 . A A .  74 PHE CB   1 1 
        4  6186 1 1  74 PHE CD1  C   -6.891   5.194   2.467 1.00 . A A .  74 PHE CD1  1 1 
        4  6187 1 1  74 PHE CD2  C   -7.869   6.232   4.442 1.00 . A A .  74 PHE CD2  1 1 
        4  6188 1 1  74 PHE CE1  C   -7.987   5.628   1.702 1.00 . A A .  74 PHE CE1  1 1 
        4  6189 1 1  74 PHE CE2  C   -8.960   6.673   3.672 1.00 . A A .  74 PHE CE2  1 1 
        4  6190 1 1  74 PHE CG   C   -6.832   5.491   3.841 1.00 . A A .  74 PHE CG   1 1 
        4  6191 1 1  74 PHE CZ   C   -9.020   6.366   2.304 1.00 . A A .  74 PHE CZ   1 1 
        4  6192 1 1  74 PHE H    H   -3.825   4.279   6.110 1.00 . A A .  74 PHE H    1 1 
        4  6193 1 1  74 PHE HA   H   -3.986   5.982   3.828 1.00 . A A .  74 PHE HA   1 1 
        4  6194 1 1  74 PHE HB2  H   -5.381   4.001   4.268 1.00 . A A .  74 PHE HB2  1 1 
        4  6195 1 1  74 PHE HB3  H   -6.081   4.758   5.687 1.00 . A A .  74 PHE HB3  1 1 
        4  6196 1 1  74 PHE HD1  H   -6.104   4.618   2.002 1.00 . A A .  74 PHE HD1  1 1 
        4  6197 1 1  74 PHE HD2  H   -7.837   6.454   5.500 1.00 . A A .  74 PHE HD2  1 1 
        4  6198 1 1  74 PHE HE1  H   -8.042   5.395   0.649 1.00 . A A .  74 PHE HE1  1 1 
        4  6199 1 1  74 PHE HE2  H   -9.763   7.233   4.132 1.00 . A A .  74 PHE HE2  1 1 
        4  6200 1 1  74 PHE HZ   H   -9.865   6.695   1.715 1.00 . A A .  74 PHE HZ   1 1 
        4  6201 1 1  74 PHE N    N   -3.521   5.160   5.718 1.00 . A A .  74 PHE N    1 1 
        4  6202 1 1  74 PHE O    O   -5.104   8.160   4.503 1.00 . A A .  74 PHE O    1 1 
        4  6203 1 1  75 SER C    C   -3.747   9.832   6.861 1.00 . A A .  75 SER C    1 1 
        4  6204 1 1  75 SER CA   C   -4.870   8.850   7.237 1.00 . A A .  75 SER CA   1 1 
        4  6205 1 1  75 SER CB   C   -4.897   8.686   8.761 1.00 . A A .  75 SER CB   1 1 
        4  6206 1 1  75 SER H    H   -4.499   6.757   7.229 1.00 . A A .  75 SER H    1 1 
        4  6207 1 1  75 SER HA   H   -5.815   9.299   6.928 1.00 . A A .  75 SER HA   1 1 
        4  6208 1 1  75 SER HB2  H   -4.812   9.669   9.231 1.00 . A A .  75 SER HB2  1 1 
        4  6209 1 1  75 SER HB3  H   -5.847   8.237   9.053 1.00 . A A .  75 SER HB3  1 1 
        4  6210 1 1  75 SER HG   H   -3.872   7.784  10.172 1.00 . A A .  75 SER HG   1 1 
        4  6211 1 1  75 SER N    N   -4.751   7.521   6.616 1.00 . A A .  75 SER N    1 1 
        4  6212 1 1  75 SER O    O   -3.958  11.046   6.899 1.00 . A A .  75 SER O    1 1 
        4  6213 1 1  75 SER OG   O   -3.832   7.849   9.197 1.00 . A A .  75 SER OG   1 1 
        4  6214 1 1  76 GLU C    C   -1.525  10.720   4.657 1.00 . A A .  76 GLU C    1 1 
        4  6215 1 1  76 GLU CA   C   -1.406  10.167   6.092 1.00 . A A .  76 GLU CA   1 1 
        4  6216 1 1  76 GLU CB   C   -0.103   9.355   6.219 1.00 . A A .  76 GLU CB   1 1 
        4  6217 1 1  76 GLU CD   C    1.401   7.883   7.671 1.00 . A A .  76 GLU CD   1 1 
        4  6218 1 1  76 GLU CG   C    0.147   8.777   7.624 1.00 . A A .  76 GLU CG   1 1 
        4  6219 1 1  76 GLU H    H   -2.447   8.336   6.452 1.00 . A A .  76 GLU H    1 1 
        4  6220 1 1  76 GLU HA   H   -1.344  11.019   6.771 1.00 . A A .  76 GLU HA   1 1 
        4  6221 1 1  76 GLU HB2  H   -0.114   8.543   5.493 1.00 . A A .  76 GLU HB2  1 1 
        4  6222 1 1  76 GLU HB3  H    0.730  10.012   5.963 1.00 . A A .  76 GLU HB3  1 1 
        4  6223 1 1  76 GLU HG2  H    0.261   9.602   8.330 1.00 . A A .  76 GLU HG2  1 1 
        4  6224 1 1  76 GLU HG3  H   -0.719   8.187   7.933 1.00 . A A .  76 GLU HG3  1 1 
        4  6225 1 1  76 GLU N    N   -2.564   9.343   6.475 1.00 . A A .  76 GLU N    1 1 
        4  6226 1 1  76 GLU O    O   -0.920  11.743   4.329 1.00 . A A .  76 GLU O    1 1 
        4  6227 1 1  76 GLU OE1  O    2.418   8.210   7.014 1.00 . A A .  76 GLU OE1  1 1 
        4  6228 1 1  76 GLU OE2  O    1.383   6.847   8.381 1.00 . A A .  76 GLU OE2  1 1 
        4  6229 1 1  77 LEU C    C   -3.556  11.732   2.468 1.00 . A A .  77 LEU C    1 1 
        4  6230 1 1  77 LEU CA   C   -2.655  10.484   2.446 1.00 . A A .  77 LEU CA   1 1 
        4  6231 1 1  77 LEU CB   C   -3.371   9.332   1.709 1.00 . A A .  77 LEU CB   1 1 
        4  6232 1 1  77 LEU CD1  C   -1.512   7.583   2.192 1.00 . A A .  77 LEU CD1  1 1 
        4  6233 1 1  77 LEU CD2  C   -3.477   7.031   0.765 1.00 . A A .  77 LEU CD2  1 1 
        4  6234 1 1  77 LEU CG   C   -2.527   8.148   1.203 1.00 . A A .  77 LEU CG   1 1 
        4  6235 1 1  77 LEU H    H   -2.803   9.248   4.173 1.00 . A A .  77 LEU H    1 1 
        4  6236 1 1  77 LEU HA   H   -1.738  10.734   1.912 1.00 . A A .  77 LEU HA   1 1 
        4  6237 1 1  77 LEU HB2  H   -4.157   8.952   2.358 1.00 . A A .  77 LEU HB2  1 1 
        4  6238 1 1  77 LEU HB3  H   -3.866   9.747   0.830 1.00 . A A .  77 LEU HB3  1 1 
        4  6239 1 1  77 LEU HD11 H   -2.015   7.262   3.102 1.00 . A A .  77 LEU HD11 1 1 
        4  6240 1 1  77 LEU HD12 H   -0.994   6.739   1.739 1.00 . A A .  77 LEU HD12 1 1 
        4  6241 1 1  77 LEU HD13 H   -0.769   8.343   2.430 1.00 . A A .  77 LEU HD13 1 1 
        4  6242 1 1  77 LEU HD21 H   -4.145   7.400  -0.014 1.00 . A A .  77 LEU HD21 1 1 
        4  6243 1 1  77 LEU HD22 H   -2.907   6.194   0.367 1.00 . A A .  77 LEU HD22 1 1 
        4  6244 1 1  77 LEU HD23 H   -4.071   6.687   1.610 1.00 . A A .  77 LEU HD23 1 1 
        4  6245 1 1  77 LEU HG   H   -1.975   8.470   0.330 1.00 . A A .  77 LEU HG   1 1 
        4  6246 1 1  77 LEU N    N   -2.324  10.059   3.811 1.00 . A A .  77 LEU N    1 1 
        4  6247 1 1  77 LEU O    O   -4.185  12.051   3.483 1.00 . A A .  77 LEU O    1 1 
        4  6248 1 1  78 ARG C    C   -5.814  12.907   0.157 1.00 . A A .  78 ARG C    1 1 
        4  6249 1 1  78 ARG CA   C   -4.701  13.439   1.053 1.00 . A A .  78 ARG CA   1 1 
        4  6250 1 1  78 ARG CB   C   -4.065  14.741   0.524 1.00 . A A .  78 ARG CB   1 1 
        4  6251 1 1  78 ARG CD   C   -4.179  15.913   2.812 1.00 . A A .  78 ARG CD   1 1 
        4  6252 1 1  78 ARG CG   C   -3.304  15.536   1.601 1.00 . A A .  78 ARG CG   1 1 
        4  6253 1 1  78 ARG CZ   C   -4.428  14.988   5.142 1.00 . A A .  78 ARG CZ   1 1 
        4  6254 1 1  78 ARG H    H   -3.078  12.146   0.551 1.00 . A A .  78 ARG H    1 1 
        4  6255 1 1  78 ARG HA   H   -5.234  13.664   1.974 1.00 . A A .  78 ARG HA   1 1 
        4  6256 1 1  78 ARG HB2  H   -3.386  14.508  -0.297 1.00 . A A .  78 ARG HB2  1 1 
        4  6257 1 1  78 ARG HB3  H   -4.841  15.394   0.119 1.00 . A A .  78 ARG HB3  1 1 
        4  6258 1 1  78 ARG HD2  H   -3.809  16.855   3.219 1.00 . A A .  78 ARG HD2  1 1 
        4  6259 1 1  78 ARG HD3  H   -5.213  16.051   2.473 1.00 . A A .  78 ARG HD3  1 1 
        4  6260 1 1  78 ARG HE   H   -3.938  13.929   3.564 1.00 . A A .  78 ARG HE   1 1 
        4  6261 1 1  78 ARG HG2  H   -2.431  14.974   1.934 1.00 . A A .  78 ARG HG2  1 1 
        4  6262 1 1  78 ARG HG3  H   -2.948  16.458   1.138 1.00 . A A .  78 ARG HG3  1 1 
        4  6263 1 1  78 ARG HH11 H   -4.748  16.959   5.133 1.00 . A A .  78 ARG HH11 1 1 
        4  6264 1 1  78 ARG HH12 H   -4.941  16.180   6.680 1.00 . A A .  78 ARG HH12 1 1 
        4  6265 1 1  78 ARG HH21 H   -4.235  13.019   5.471 1.00 . A A .  78 ARG HH21 1 1 
        4  6266 1 1  78 ARG HH22 H   -4.624  13.979   6.871 1.00 . A A .  78 ARG HH22 1 1 
        4  6267 1 1  78 ARG N    N   -3.666  12.425   1.330 1.00 . A A .  78 ARG N    1 1 
        4  6268 1 1  78 ARG NE   N   -4.145  14.873   3.861 1.00 . A A .  78 ARG NE   1 1 
        4  6269 1 1  78 ARG NH1  N   -4.728  16.129   5.699 1.00 . A A .  78 ARG NH1  1 1 
        4  6270 1 1  78 ARG NH2  N   -4.419  13.923   5.890 1.00 . A A .  78 ARG NH2  1 1 
        4  6271 1 1  78 ARG O    O   -5.719  11.812  -0.406 1.00 . A A .  78 ARG O    1 1 
        4  6272 1 1  79 TRP C    C   -8.155  12.598  -1.808 1.00 . A A .  79 TRP C    1 1 
        4  6273 1 1  79 TRP CA   C   -8.206  13.247  -0.413 1.00 . A A .  79 TRP CA   1 1 
        4  6274 1 1  79 TRP CB   C   -9.198  14.428  -0.346 1.00 . A A .  79 TRP CB   1 1 
        4  6275 1 1  79 TRP CD1  C  -11.276  14.171  -1.796 1.00 . A A .  79 TRP CD1  1 1 
        4  6276 1 1  79 TRP CD2  C   -9.695  15.443  -2.752 1.00 . A A .  79 TRP CD2  1 1 
        4  6277 1 1  79 TRP CE2  C  -10.782  15.379  -3.673 1.00 . A A .  79 TRP CE2  1 1 
        4  6278 1 1  79 TRP CE3  C   -8.555  16.175  -3.146 1.00 . A A .  79 TRP CE3  1 1 
        4  6279 1 1  79 TRP CG   C  -10.041  14.669  -1.564 1.00 . A A .  79 TRP CG   1 1 
        4  6280 1 1  79 TRP CH2  C   -9.600  16.757  -5.277 1.00 . A A .  79 TRP CH2  1 1 
        4  6281 1 1  79 TRP CZ2  C  -10.747  16.025  -4.918 1.00 . A A .  79 TRP CZ2  1 1 
        4  6282 1 1  79 TRP CZ3  C   -8.507  16.829  -4.393 1.00 . A A .  79 TRP CZ3  1 1 
        4  6283 1 1  79 TRP H    H   -6.865  14.565   0.570 1.00 . A A .  79 TRP H    1 1 
        4  6284 1 1  79 TRP HA   H   -8.564  12.497   0.286 1.00 . A A .  79 TRP HA   1 1 
        4  6285 1 1  79 TRP HB2  H   -9.859  14.271   0.507 1.00 . A A .  79 TRP HB2  1 1 
        4  6286 1 1  79 TRP HB3  H   -8.654  15.354  -0.150 1.00 . A A .  79 TRP HB3  1 1 
        4  6287 1 1  79 TRP HD1  H  -11.826  13.527  -1.116 1.00 . A A .  79 TRP HD1  1 1 
        4  6288 1 1  79 TRP HE1  H  -12.602  14.295  -3.442 1.00 . A A .  79 TRP HE1  1 1 
        4  6289 1 1  79 TRP HE3  H   -7.704  16.215  -2.483 1.00 . A A .  79 TRP HE3  1 1 
        4  6290 1 1  79 TRP HH2  H   -9.554  17.261  -6.236 1.00 . A A .  79 TRP HH2  1 1 
        4  6291 1 1  79 TRP HZ2  H  -11.592  15.962  -5.590 1.00 . A A .  79 TRP HZ2  1 1 
        4  6292 1 1  79 TRP HZ3  H   -7.616  17.378  -4.669 1.00 . A A .  79 TRP HZ3  1 1 
        4  6293 1 1  79 TRP N    N   -6.899  13.680   0.087 1.00 . A A .  79 TRP N    1 1 
        4  6294 1 1  79 TRP NE1  N  -11.717  14.588  -3.038 1.00 . A A .  79 TRP NE1  1 1 
        4  6295 1 1  79 TRP O    O   -8.864  11.623  -2.049 1.00 . A A .  79 TRP O    1 1 
        4  6296 1 1  80 ASP C    C   -6.556  11.169  -4.181 1.00 . A A .  80 ASP C    1 1 
        4  6297 1 1  80 ASP CA   C   -7.199  12.566  -4.081 1.00 . A A .  80 ASP CA   1 1 
        4  6298 1 1  80 ASP CB   C   -6.474  13.569  -4.985 1.00 . A A .  80 ASP CB   1 1 
        4  6299 1 1  80 ASP CG   C   -6.618  13.187  -6.469 1.00 . A A .  80 ASP CG   1 1 
        4  6300 1 1  80 ASP H    H   -6.727  13.877  -2.455 1.00 . A A .  80 ASP H    1 1 
        4  6301 1 1  80 ASP HA   H   -8.218  12.484  -4.448 1.00 . A A .  80 ASP HA   1 1 
        4  6302 1 1  80 ASP HB2  H   -6.901  14.561  -4.839 1.00 . A A .  80 ASP HB2  1 1 
        4  6303 1 1  80 ASP HB3  H   -5.420  13.608  -4.701 1.00 . A A .  80 ASP HB3  1 1 
        4  6304 1 1  80 ASP N    N   -7.289  13.079  -2.708 1.00 . A A .  80 ASP N    1 1 
        4  6305 1 1  80 ASP O    O   -6.899  10.388  -5.067 1.00 . A A .  80 ASP O    1 1 
        4  6306 1 1  80 ASP OD1  O   -7.762  12.927  -6.919 1.00 . A A .  80 ASP OD1  1 1 
        4  6307 1 1  80 ASP OD2  O   -5.594  13.170  -7.193 1.00 . A A .  80 ASP OD2  1 1 
        4  6308 1 1  81 ASP C    C   -5.962   8.579  -2.345 1.00 . A A .  81 ASP C    1 1 
        4  6309 1 1  81 ASP CA   C   -5.060   9.491  -3.170 1.00 . A A .  81 ASP CA   1 1 
        4  6310 1 1  81 ASP CB   C   -3.639   9.560  -2.602 1.00 . A A .  81 ASP CB   1 1 
        4  6311 1 1  81 ASP CG   C   -2.681  10.205  -3.610 1.00 . A A .  81 ASP CG   1 1 
        4  6312 1 1  81 ASP H    H   -5.505  11.441  -2.481 1.00 . A A .  81 ASP H    1 1 
        4  6313 1 1  81 ASP HA   H   -4.993   9.057  -4.167 1.00 . A A .  81 ASP HA   1 1 
        4  6314 1 1  81 ASP HB2  H   -3.643  10.115  -1.662 1.00 . A A .  81 ASP HB2  1 1 
        4  6315 1 1  81 ASP HB3  H   -3.291   8.546  -2.391 1.00 . A A .  81 ASP HB3  1 1 
        4  6316 1 1  81 ASP N    N   -5.645  10.826  -3.267 1.00 . A A .  81 ASP N    1 1 
        4  6317 1 1  81 ASP O    O   -6.172   7.440  -2.741 1.00 . A A .  81 ASP O    1 1 
        4  6318 1 1  81 ASP OD1  O   -2.463   9.610  -4.693 1.00 . A A .  81 ASP OD1  1 1 
        4  6319 1 1  81 ASP OD2  O   -2.147  11.297  -3.309 1.00 . A A .  81 ASP OD2  1 1 
        4  6320 1 1  82 GLN C    C   -8.759   7.897  -1.427 1.00 . A A .  82 GLN C    1 1 
        4  6321 1 1  82 GLN CA   C   -7.612   8.367  -0.520 1.00 . A A .  82 GLN CA   1 1 
        4  6322 1 1  82 GLN CB   C   -8.142   9.263   0.610 1.00 . A A .  82 GLN CB   1 1 
        4  6323 1 1  82 GLN CD   C   -7.584  10.336   2.868 1.00 . A A .  82 GLN CD   1 1 
        4  6324 1 1  82 GLN CG   C   -7.130   9.390   1.757 1.00 . A A .  82 GLN CG   1 1 
        4  6325 1 1  82 GLN H    H   -6.364  10.034  -0.993 1.00 . A A .  82 GLN H    1 1 
        4  6326 1 1  82 GLN HA   H   -7.160   7.478  -0.084 1.00 . A A .  82 GLN HA   1 1 
        4  6327 1 1  82 GLN HB2  H   -8.371  10.248   0.209 1.00 . A A .  82 GLN HB2  1 1 
        4  6328 1 1  82 GLN HB3  H   -9.063   8.839   1.008 1.00 . A A .  82 GLN HB3  1 1 
        4  6329 1 1  82 GLN HE21 H   -6.296   9.523   4.195 1.00 . A A .  82 GLN HE21 1 1 
        4  6330 1 1  82 GLN HE22 H   -7.282  10.870   4.772 1.00 . A A .  82 GLN HE22 1 1 
        4  6331 1 1  82 GLN HG2  H   -6.957   8.400   2.179 1.00 . A A .  82 GLN HG2  1 1 
        4  6332 1 1  82 GLN HG3  H   -6.187   9.763   1.366 1.00 . A A .  82 GLN HG3  1 1 
        4  6333 1 1  82 GLN N    N   -6.586   9.087  -1.277 1.00 . A A .  82 GLN N    1 1 
        4  6334 1 1  82 GLN NE2  N   -7.012  10.229   4.046 1.00 . A A .  82 GLN NE2  1 1 
        4  6335 1 1  82 GLN O    O   -9.054   6.704  -1.467 1.00 . A A .  82 GLN O    1 1 
        4  6336 1 1  82 GLN OE1  O   -8.435  11.201   2.703 1.00 . A A .  82 GLN OE1  1 1 
        4  6337 1 1  83 GLN C    C  -10.043   7.447  -4.233 1.00 . A A .  83 GLN C    1 1 
        4  6338 1 1  83 GLN CA   C  -10.463   8.421  -3.122 1.00 . A A .  83 GLN CA   1 1 
        4  6339 1 1  83 GLN CB   C  -11.173   9.673  -3.674 1.00 . A A .  83 GLN CB   1 1 
        4  6340 1 1  83 GLN CD   C  -11.097  11.735  -5.205 1.00 . A A .  83 GLN CD   1 1 
        4  6341 1 1  83 GLN CG   C  -10.407  10.436  -4.771 1.00 . A A .  83 GLN CG   1 1 
        4  6342 1 1  83 GLN H    H   -9.088   9.766  -2.165 1.00 . A A .  83 GLN H    1 1 
        4  6343 1 1  83 GLN HA   H  -11.200   7.892  -2.515 1.00 . A A .  83 GLN HA   1 1 
        4  6344 1 1  83 GLN HB2  H  -12.134   9.361  -4.087 1.00 . A A .  83 GLN HB2  1 1 
        4  6345 1 1  83 GLN HB3  H  -11.375  10.351  -2.843 1.00 . A A .  83 GLN HB3  1 1 
        4  6346 1 1  83 GLN HE21 H   -9.478  12.435  -6.257 1.00 . A A .  83 GLN HE21 1 1 
        4  6347 1 1  83 GLN HE22 H  -10.911  13.443  -6.220 1.00 . A A .  83 GLN HE22 1 1 
        4  6348 1 1  83 GLN HG2  H   -9.416  10.670  -4.403 1.00 . A A .  83 GLN HG2  1 1 
        4  6349 1 1  83 GLN HG3  H  -10.296   9.803  -5.652 1.00 . A A .  83 GLN HG3  1 1 
        4  6350 1 1  83 GLN N    N   -9.357   8.789  -2.228 1.00 . A A .  83 GLN N    1 1 
        4  6351 1 1  83 GLN NE2  N  -10.446  12.587  -5.969 1.00 . A A .  83 GLN NE2  1 1 
        4  6352 1 1  83 GLN O    O  -10.866   6.651  -4.676 1.00 . A A .  83 GLN O    1 1 
        4  6353 1 1  83 GLN OE1  O  -12.250  12.010  -4.890 1.00 . A A .  83 GLN OE1  1 1 
        4  6354 1 1  84 LYS C    C   -7.817   5.224  -5.110 1.00 . A A .  84 LYS C    1 1 
        4  6355 1 1  84 LYS CA   C   -8.204   6.584  -5.689 1.00 . A A .  84 LYS CA   1 1 
        4  6356 1 1  84 LYS CB   C   -7.046   7.372  -6.327 1.00 . A A .  84 LYS CB   1 1 
        4  6357 1 1  84 LYS CD   C   -4.990   5.884  -6.680 1.00 . A A .  84 LYS CD   1 1 
        4  6358 1 1  84 LYS CE   C   -4.018   6.733  -5.843 1.00 . A A .  84 LYS CE   1 1 
        4  6359 1 1  84 LYS CG   C   -6.167   6.624  -7.335 1.00 . A A .  84 LYS CG   1 1 
        4  6360 1 1  84 LYS H    H   -8.110   8.056  -4.197 1.00 . A A .  84 LYS H    1 1 
        4  6361 1 1  84 LYS HA   H   -8.958   6.399  -6.459 1.00 . A A .  84 LYS HA   1 1 
        4  6362 1 1  84 LYS HB2  H   -7.482   8.224  -6.849 1.00 . A A .  84 LYS HB2  1 1 
        4  6363 1 1  84 LYS HB3  H   -6.411   7.767  -5.538 1.00 . A A .  84 LYS HB3  1 1 
        4  6364 1 1  84 LYS HD2  H   -5.399   5.127  -6.015 1.00 . A A .  84 LYS HD2  1 1 
        4  6365 1 1  84 LYS HD3  H   -4.431   5.388  -7.469 1.00 . A A .  84 LYS HD3  1 1 
        4  6366 1 1  84 LYS HE2  H   -4.551   7.124  -4.973 1.00 . A A .  84 LYS HE2  1 1 
        4  6367 1 1  84 LYS HE3  H   -3.232   6.073  -5.465 1.00 . A A .  84 LYS HE3  1 1 
        4  6368 1 1  84 LYS HG2  H   -6.780   5.914  -7.893 1.00 . A A .  84 LYS HG2  1 1 
        4  6369 1 1  84 LYS HG3  H   -5.767   7.344  -8.050 1.00 . A A .  84 LYS HG3  1 1 
        4  6370 1 1  84 LYS HZ1  H   -4.104   8.440  -7.040 1.00 . A A .  84 LYS HZ1  1 1 
        4  6371 1 1  84 LYS HZ2  H   -2.871   8.459  -5.980 1.00 . A A .  84 LYS HZ2  1 1 
        4  6372 1 1  84 LYS HZ3  H   -2.780   7.517  -7.328 1.00 . A A .  84 LYS HZ3  1 1 
        4  6373 1 1  84 LYS N    N   -8.770   7.450  -4.654 1.00 . A A .  84 LYS N    1 1 
        4  6374 1 1  84 LYS NZ   N   -3.405   7.852  -6.607 1.00 . A A .  84 LYS NZ   1 1 
        4  6375 1 1  84 LYS O    O   -8.050   4.212  -5.763 1.00 . A A .  84 LYS O    1 1 
        4  6376 1 1  85 VAL C    C   -8.454   3.218  -2.879 1.00 . A A .  85 VAL C    1 1 
        4  6377 1 1  85 VAL CA   C   -7.105   3.893  -3.144 1.00 . A A .  85 VAL CA   1 1 
        4  6378 1 1  85 VAL CB   C   -6.327   4.120  -1.825 1.00 . A A .  85 VAL CB   1 1 
        4  6379 1 1  85 VAL CG1  C   -6.249   2.867  -0.936 1.00 . A A .  85 VAL CG1  1 1 
        4  6380 1 1  85 VAL CG2  C   -4.881   4.573  -2.062 1.00 . A A .  85 VAL CG2  1 1 
        4  6381 1 1  85 VAL H    H   -7.097   6.047  -3.407 1.00 . A A .  85 VAL H    1 1 
        4  6382 1 1  85 VAL HA   H   -6.541   3.206  -3.781 1.00 . A A .  85 VAL HA   1 1 
        4  6383 1 1  85 VAL HB   H   -6.836   4.902  -1.263 1.00 . A A .  85 VAL HB   1 1 
        4  6384 1 1  85 VAL HG11 H   -5.634   3.071  -0.059 1.00 . A A .  85 VAL HG11 1 1 
        4  6385 1 1  85 VAL HG12 H   -7.242   2.580  -0.588 1.00 . A A .  85 VAL HG12 1 1 
        4  6386 1 1  85 VAL HG13 H   -5.806   2.034  -1.486 1.00 . A A .  85 VAL HG13 1 1 
        4  6387 1 1  85 VAL HG21 H   -4.258   3.734  -2.355 1.00 . A A .  85 VAL HG21 1 1 
        4  6388 1 1  85 VAL HG22 H   -4.829   5.333  -2.838 1.00 . A A .  85 VAL HG22 1 1 
        4  6389 1 1  85 VAL HG23 H   -4.480   4.989  -1.138 1.00 . A A .  85 VAL HG23 1 1 
        4  6390 1 1  85 VAL N    N   -7.314   5.164  -3.875 1.00 . A A .  85 VAL N    1 1 
        4  6391 1 1  85 VAL O    O   -8.606   2.032  -3.173 1.00 . A A .  85 VAL O    1 1 
        4  6392 1 1  86 LYS C    C  -11.500   3.047  -3.552 1.00 . A A .  86 LYS C    1 1 
        4  6393 1 1  86 LYS CA   C  -10.830   3.430  -2.227 1.00 . A A .  86 LYS CA   1 1 
        4  6394 1 1  86 LYS CB   C  -11.691   4.386  -1.377 1.00 . A A .  86 LYS CB   1 1 
        4  6395 1 1  86 LYS CD   C  -12.069   5.113   1.104 1.00 . A A .  86 LYS CD   1 1 
        4  6396 1 1  86 LYS CE   C  -13.313   4.248   1.309 1.00 . A A .  86 LYS CE   1 1 
        4  6397 1 1  86 LYS CG   C  -11.121   4.514   0.051 1.00 . A A .  86 LYS CG   1 1 
        4  6398 1 1  86 LYS H    H   -9.286   4.936  -2.177 1.00 . A A .  86 LYS H    1 1 
        4  6399 1 1  86 LYS HA   H  -10.746   2.493  -1.674 1.00 . A A .  86 LYS HA   1 1 
        4  6400 1 1  86 LYS HB2  H  -11.740   5.371  -1.845 1.00 . A A .  86 LYS HB2  1 1 
        4  6401 1 1  86 LYS HB3  H  -12.700   3.976  -1.329 1.00 . A A .  86 LYS HB3  1 1 
        4  6402 1 1  86 LYS HD2  H  -11.531   5.165   2.053 1.00 . A A .  86 LYS HD2  1 1 
        4  6403 1 1  86 LYS HD3  H  -12.360   6.122   0.807 1.00 . A A .  86 LYS HD3  1 1 
        4  6404 1 1  86 LYS HE2  H  -13.958   4.370   0.437 1.00 . A A .  86 LYS HE2  1 1 
        4  6405 1 1  86 LYS HE3  H  -12.990   3.208   1.360 1.00 . A A .  86 LYS HE3  1 1 
        4  6406 1 1  86 LYS HG2  H  -10.805   3.532   0.394 1.00 . A A .  86 LYS HG2  1 1 
        4  6407 1 1  86 LYS HG3  H  -10.229   5.131   0.014 1.00 . A A .  86 LYS HG3  1 1 
        4  6408 1 1  86 LYS HZ1  H  -14.244   5.592   2.605 1.00 . A A .  86 LYS HZ1  1 1 
        4  6409 1 1  86 LYS HZ2  H  -14.933   4.112   2.601 1.00 . A A .  86 LYS HZ2  1 1 
        4  6410 1 1  86 LYS HZ3  H  -13.528   4.328   3.387 1.00 . A A .  86 LYS HZ3  1 1 
        4  6411 1 1  86 LYS N    N   -9.470   3.967  -2.423 1.00 . A A .  86 LYS N    1 1 
        4  6412 1 1  86 LYS NZ   N  -14.050   4.602   2.552 1.00 . A A .  86 LYS NZ   1 1 
        4  6413 1 1  86 LYS O    O  -12.099   1.975  -3.627 1.00 . A A .  86 LYS O    1 1 
        4  6414 1 1  87 LYS C    C  -11.080   2.160  -6.456 1.00 . A A .  87 LYS C    1 1 
        4  6415 1 1  87 LYS CA   C  -11.742   3.457  -5.993 1.00 . A A .  87 LYS CA   1 1 
        4  6416 1 1  87 LYS CB   C  -11.447   4.611  -6.972 1.00 . A A .  87 LYS CB   1 1 
        4  6417 1 1  87 LYS CD   C  -13.374   4.237  -8.598 1.00 . A A .  87 LYS CD   1 1 
        4  6418 1 1  87 LYS CE   C  -13.734   4.077 -10.081 1.00 . A A .  87 LYS CE   1 1 
        4  6419 1 1  87 LYS CG   C  -11.855   4.359  -8.433 1.00 . A A .  87 LYS CG   1 1 
        4  6420 1 1  87 LYS H    H  -10.862   4.724  -4.488 1.00 . A A .  87 LYS H    1 1 
        4  6421 1 1  87 LYS HA   H  -12.817   3.275  -5.975 1.00 . A A .  87 LYS HA   1 1 
        4  6422 1 1  87 LYS HB2  H  -11.966   5.506  -6.631 1.00 . A A .  87 LYS HB2  1 1 
        4  6423 1 1  87 LYS HB3  H  -10.378   4.812  -6.961 1.00 . A A .  87 LYS HB3  1 1 
        4  6424 1 1  87 LYS HD2  H  -13.734   3.371  -8.043 1.00 . A A .  87 LYS HD2  1 1 
        4  6425 1 1  87 LYS HD3  H  -13.839   5.141  -8.200 1.00 . A A .  87 LYS HD3  1 1 
        4  6426 1 1  87 LYS HE2  H  -13.343   4.937 -10.633 1.00 . A A .  87 LYS HE2  1 1 
        4  6427 1 1  87 LYS HE3  H  -13.242   3.179 -10.466 1.00 . A A .  87 LYS HE3  1 1 
        4  6428 1 1  87 LYS HG2  H  -11.507   5.202  -9.031 1.00 . A A .  87 LYS HG2  1 1 
        4  6429 1 1  87 LYS HG3  H  -11.369   3.459  -8.810 1.00 . A A .  87 LYS HG3  1 1 
        4  6430 1 1  87 LYS HZ1  H  -15.679   4.802  -9.943 1.00 . A A .  87 LYS HZ1  1 1 
        4  6431 1 1  87 LYS HZ2  H  -15.432   3.872 -11.259 1.00 . A A .  87 LYS HZ2  1 1 
        4  6432 1 1  87 LYS HZ3  H  -15.588   3.176  -9.792 1.00 . A A .  87 LYS HZ3  1 1 
        4  6433 1 1  87 LYS N    N  -11.312   3.826  -4.627 1.00 . A A .  87 LYS N    1 1 
        4  6434 1 1  87 LYS NZ   N  -15.205   3.975 -10.279 1.00 . A A .  87 LYS NZ   1 1 
        4  6435 1 1  87 LYS O    O  -11.768   1.280  -6.958 1.00 . A A .  87 LYS O    1 1 
        4  6436 1 1  88 THR C    C   -9.417  -0.427  -5.815 1.00 . A A .  88 THR C    1 1 
        4  6437 1 1  88 THR CA   C   -9.014   0.808  -6.630 1.00 . A A .  88 THR CA   1 1 
        4  6438 1 1  88 THR CB   C   -7.499   1.058  -6.575 1.00 . A A .  88 THR CB   1 1 
        4  6439 1 1  88 THR CG2  C   -6.716  -0.086  -7.212 1.00 . A A .  88 THR CG2  1 1 
        4  6440 1 1  88 THR H    H   -9.261   2.792  -5.875 1.00 . A A .  88 THR H    1 1 
        4  6441 1 1  88 THR HA   H   -9.243   0.604  -7.669 1.00 . A A .  88 THR HA   1 1 
        4  6442 1 1  88 THR HB   H   -7.175   1.203  -5.544 1.00 . A A .  88 THR HB   1 1 
        4  6443 1 1  88 THR HG1  H   -7.480   2.981  -6.855 1.00 . A A .  88 THR HG1  1 1 
        4  6444 1 1  88 THR HG21 H   -7.081  -0.265  -8.223 1.00 . A A .  88 THR HG21 1 1 
        4  6445 1 1  88 THR HG22 H   -5.658   0.171  -7.249 1.00 . A A .  88 THR HG22 1 1 
        4  6446 1 1  88 THR HG23 H   -6.839  -0.984  -6.616 1.00 . A A .  88 THR HG23 1 1 
        4  6447 1 1  88 THR N    N   -9.775   2.004  -6.239 1.00 . A A .  88 THR N    1 1 
        4  6448 1 1  88 THR O    O   -9.478  -1.525  -6.368 1.00 . A A .  88 THR O    1 1 
        4  6449 1 1  88 THR OG1  O   -7.169   2.196  -7.345 1.00 . A A .  88 THR OG1  1 1 
        4  6450 1 1  89 ALA C    C  -11.734  -1.754  -4.170 1.00 . A A .  89 ALA C    1 1 
        4  6451 1 1  89 ALA CA   C  -10.327  -1.336  -3.710 1.00 . A A .  89 ALA CA   1 1 
        4  6452 1 1  89 ALA CB   C  -10.335  -0.852  -2.256 1.00 . A A .  89 ALA CB   1 1 
        4  6453 1 1  89 ALA H    H   -9.766   0.663  -4.138 1.00 . A A .  89 ALA H    1 1 
        4  6454 1 1  89 ALA HA   H   -9.671  -2.205  -3.778 1.00 . A A .  89 ALA HA   1 1 
        4  6455 1 1  89 ALA HB1  H  -10.703  -1.652  -1.617 1.00 . A A .  89 ALA HB1  1 1 
        4  6456 1 1  89 ALA HB2  H   -9.326  -0.576  -1.950 1.00 . A A .  89 ALA HB2  1 1 
        4  6457 1 1  89 ALA HB3  H  -10.990   0.012  -2.148 1.00 . A A .  89 ALA HB3  1 1 
        4  6458 1 1  89 ALA N    N   -9.795  -0.262  -4.543 1.00 . A A .  89 ALA N    1 1 
        4  6459 1 1  89 ALA O    O  -12.028  -2.947  -4.268 1.00 . A A .  89 ALA O    1 1 
        4  6460 1 1  90 GLU C    C  -13.843  -1.674  -6.517 1.00 . A A .  90 GLU C    1 1 
        4  6461 1 1  90 GLU CA   C  -13.908  -1.046  -5.112 1.00 . A A .  90 GLU CA   1 1 
        4  6462 1 1  90 GLU CB   C  -14.730   0.254  -5.150 1.00 . A A .  90 GLU CB   1 1 
        4  6463 1 1  90 GLU CD   C  -16.385  -0.141  -3.255 1.00 . A A .  90 GLU CD   1 1 
        4  6464 1 1  90 GLU CG   C  -15.212   0.718  -3.769 1.00 . A A .  90 GLU CG   1 1 
        4  6465 1 1  90 GLU H    H  -12.286   0.183  -4.426 1.00 . A A .  90 GLU H    1 1 
        4  6466 1 1  90 GLU HA   H  -14.399  -1.762  -4.462 1.00 . A A .  90 GLU HA   1 1 
        4  6467 1 1  90 GLU HB2  H  -14.126   1.043  -5.599 1.00 . A A .  90 GLU HB2  1 1 
        4  6468 1 1  90 GLU HB3  H  -15.604   0.108  -5.786 1.00 . A A .  90 GLU HB3  1 1 
        4  6469 1 1  90 GLU HG2  H  -14.383   0.692  -3.060 1.00 . A A .  90 GLU HG2  1 1 
        4  6470 1 1  90 GLU HG3  H  -15.534   1.758  -3.856 1.00 . A A .  90 GLU HG3  1 1 
        4  6471 1 1  90 GLU N    N  -12.574  -0.785  -4.553 1.00 . A A .  90 GLU N    1 1 
        4  6472 1 1  90 GLU O    O  -14.687  -2.495  -6.882 1.00 . A A .  90 GLU O    1 1 
        4  6473 1 1  90 GLU OE1  O  -17.558   0.174  -3.575 1.00 . A A .  90 GLU OE1  1 1 
        4  6474 1 1  90 GLU OE2  O  -16.147  -1.132  -2.524 1.00 . A A .  90 GLU OE2  1 1 
        4  6475 1 1  91 ALA C    C  -11.849  -3.267  -8.576 1.00 . A A .  91 ALA C    1 1 
        4  6476 1 1  91 ALA CA   C  -12.493  -1.859  -8.606 1.00 . A A .  91 ALA CA   1 1 
        4  6477 1 1  91 ALA CB   C  -11.590  -0.826  -9.295 1.00 . A A .  91 ALA CB   1 1 
        4  6478 1 1  91 ALA H    H  -12.215  -0.579  -6.941 1.00 . A A .  91 ALA H    1 1 
        4  6479 1 1  91 ALA HA   H  -13.421  -1.940  -9.174 1.00 . A A .  91 ALA HA   1 1 
        4  6480 1 1  91 ALA HB1  H  -10.669  -0.695  -8.725 1.00 . A A .  91 ALA HB1  1 1 
        4  6481 1 1  91 ALA HB2  H  -11.346  -1.154 -10.305 1.00 . A A .  91 ALA HB2  1 1 
        4  6482 1 1  91 ALA HB3  H  -12.100   0.138  -9.346 1.00 . A A .  91 ALA HB3  1 1 
        4  6483 1 1  91 ALA N    N  -12.808  -1.327  -7.283 1.00 . A A .  91 ALA N    1 1 
        4  6484 1 1  91 ALA O    O  -11.647  -3.872  -9.632 1.00 . A A .  91 ALA O    1 1 
        4  6485 1 1  92 GLY C    C   -9.395  -5.135  -7.663 1.00 . A A .  92 GLY C    1 1 
        4  6486 1 1  92 GLY CA   C  -10.865  -5.104  -7.220 1.00 . A A .  92 GLY CA   1 1 
        4  6487 1 1  92 GLY H    H  -11.720  -3.261  -6.557 1.00 . A A .  92 GLY H    1 1 
        4  6488 1 1  92 GLY HA2  H  -10.885  -5.362  -6.161 1.00 . A A .  92 GLY HA2  1 1 
        4  6489 1 1  92 GLY HA3  H  -11.415  -5.865  -7.773 1.00 . A A .  92 GLY HA3  1 1 
        4  6490 1 1  92 GLY N    N  -11.519  -3.799  -7.390 1.00 . A A .  92 GLY N    1 1 
        4  6491 1 1  92 GLY O    O   -8.886  -6.196  -8.035 1.00 . A A .  92 GLY O    1 1 
        4  6492 1 1  93 GLY C    C   -7.002  -3.363  -9.369 1.00 . A A .  93 GLY C    1 1 
        4  6493 1 1  93 GLY CA   C   -7.300  -3.826  -7.941 1.00 . A A .  93 GLY CA   1 1 
        4  6494 1 1  93 GLY H    H   -9.202  -3.161  -7.288 1.00 . A A .  93 GLY H    1 1 
        4  6495 1 1  93 GLY HA2  H   -6.883  -3.097  -7.253 1.00 . A A .  93 GLY HA2  1 1 
        4  6496 1 1  93 GLY HA3  H   -6.783  -4.771  -7.777 1.00 . A A .  93 GLY HA3  1 1 
        4  6497 1 1  93 GLY N    N   -8.717  -3.985  -7.626 1.00 . A A .  93 GLY N    1 1 
        4  6498 1 1  93 GLY O    O   -7.631  -3.805 -10.334 1.00 . A A .  93 GLY O    1 1 
        4  6499 1 1  94 VAL C    C   -4.430  -3.226 -11.257 1.00 . A A .  94 VAL C    1 1 
        4  6500 1 1  94 VAL CA   C   -5.390  -2.129 -10.796 1.00 . A A .  94 VAL CA   1 1 
        4  6501 1 1  94 VAL CB   C   -4.701  -0.745 -10.765 1.00 . A A .  94 VAL CB   1 1 
        4  6502 1 1  94 VAL CG1  C   -3.541  -0.652  -9.767 1.00 . A A .  94 VAL CG1  1 1 
        4  6503 1 1  94 VAL CG2  C   -4.171  -0.330 -12.149 1.00 . A A .  94 VAL CG2  1 1 
        4  6504 1 1  94 VAL H    H   -5.539  -2.170  -8.661 1.00 . A A .  94 VAL H    1 1 
        4  6505 1 1  94 VAL HA   H   -6.190  -2.062 -11.534 1.00 . A A .  94 VAL HA   1 1 
        4  6506 1 1  94 VAL HB   H   -5.452  -0.011 -10.470 1.00 . A A .  94 VAL HB   1 1 
        4  6507 1 1  94 VAL HG11 H   -2.749  -1.352 -10.033 1.00 . A A .  94 VAL HG11 1 1 
        4  6508 1 1  94 VAL HG12 H   -3.134   0.360  -9.770 1.00 . A A .  94 VAL HG12 1 1 
        4  6509 1 1  94 VAL HG13 H   -3.897  -0.873  -8.764 1.00 . A A .  94 VAL HG13 1 1 
        4  6510 1 1  94 VAL HG21 H   -4.966  -0.395 -12.893 1.00 . A A .  94 VAL HG21 1 1 
        4  6511 1 1  94 VAL HG22 H   -3.823   0.701 -12.101 1.00 . A A .  94 VAL HG22 1 1 
        4  6512 1 1  94 VAL HG23 H   -3.337  -0.961 -12.470 1.00 . A A .  94 VAL HG23 1 1 
        4  6513 1 1  94 VAL N    N   -6.000  -2.486  -9.503 1.00 . A A .  94 VAL N    1 1 
        4  6514 1 1  94 VAL O    O   -3.729  -3.845 -10.455 1.00 . A A .  94 VAL O    1 1 
        4  6515 1 1  95 THR C    C   -2.828  -3.577 -14.466 1.00 . A A .  95 THR C    1 1 
        4  6516 1 1  95 THR CA   C   -3.376  -4.296 -13.228 1.00 . A A .  95 THR CA   1 1 
        4  6517 1 1  95 THR CB   C   -3.961  -5.679 -13.573 1.00 . A A .  95 THR CB   1 1 
        4  6518 1 1  95 THR CG2  C   -4.458  -6.411 -12.319 1.00 . A A .  95 THR CG2  1 1 
        4  6519 1 1  95 THR H    H   -4.990  -2.922 -13.170 1.00 . A A .  95 THR H    1 1 
        4  6520 1 1  95 THR HA   H   -2.536  -4.458 -12.554 1.00 . A A .  95 THR HA   1 1 
        4  6521 1 1  95 THR HB   H   -3.182  -6.282 -14.041 1.00 . A A .  95 THR HB   1 1 
        4  6522 1 1  95 THR HG1  H   -5.342  -6.468 -14.691 1.00 . A A .  95 THR HG1  1 1 
        4  6523 1 1  95 THR HG21 H   -3.657  -6.463 -11.582 1.00 . A A .  95 THR HG21 1 1 
        4  6524 1 1  95 THR HG22 H   -5.303  -5.880 -11.873 1.00 . A A .  95 THR HG22 1 1 
        4  6525 1 1  95 THR HG23 H   -4.766  -7.424 -12.577 1.00 . A A .  95 THR HG23 1 1 
        4  6526 1 1  95 THR N    N   -4.369  -3.442 -12.566 1.00 . A A .  95 THR N    1 1 
        4  6527 1 1  95 THR O    O   -3.497  -2.715 -15.045 1.00 . A A .  95 THR O    1 1 
        4  6528 1 1  95 THR OG1  O   -5.055  -5.565 -14.463 1.00 . A A .  95 THR OG1  1 1 
        4  6529 1 1  96 GLY C    C   -0.310  -1.915 -15.893 1.00 . A A .  96 GLY C    1 1 
        4  6530 1 1  96 GLY CA   C   -0.966  -3.295 -16.055 1.00 . A A .  96 GLY CA   1 1 
        4  6531 1 1  96 GLY H    H   -1.079  -4.602 -14.365 1.00 . A A .  96 GLY H    1 1 
        4  6532 1 1  96 GLY HA2  H   -0.212  -3.985 -16.430 1.00 . A A .  96 GLY HA2  1 1 
        4  6533 1 1  96 GLY HA3  H   -1.743  -3.182 -16.810 1.00 . A A .  96 GLY HA3  1 1 
        4  6534 1 1  96 GLY N    N   -1.588  -3.882 -14.859 1.00 . A A .  96 GLY N    1 1 
        4  6535 1 1  96 GLY O    O    0.101  -1.328 -16.898 1.00 . A A .  96 GLY O    1 1 
        4  6536 1 1  97 LYS C    C    1.446  -0.069 -13.304 1.00 . A A .  97 LYS C    1 1 
        4  6537 1 1  97 LYS CA   C    0.333  -0.039 -14.361 1.00 . A A .  97 LYS CA   1 1 
        4  6538 1 1  97 LYS CB   C   -0.811   0.923 -13.977 1.00 . A A .  97 LYS CB   1 1 
        4  6539 1 1  97 LYS CD   C   -2.804   2.251 -14.849 1.00 . A A .  97 LYS CD   1 1 
        4  6540 1 1  97 LYS CE   C   -3.809   2.360 -16.003 1.00 . A A .  97 LYS CE   1 1 
        4  6541 1 1  97 LYS CG   C   -1.823   1.103 -15.122 1.00 . A A .  97 LYS CG   1 1 
        4  6542 1 1  97 LYS H    H   -0.544  -1.939 -13.890 1.00 . A A .  97 LYS H    1 1 
        4  6543 1 1  97 LYS HA   H    0.804   0.362 -15.261 1.00 . A A .  97 LYS HA   1 1 
        4  6544 1 1  97 LYS HB2  H   -1.326   0.548 -13.090 1.00 . A A .  97 LYS HB2  1 1 
        4  6545 1 1  97 LYS HB3  H   -0.387   1.900 -13.737 1.00 . A A .  97 LYS HB3  1 1 
        4  6546 1 1  97 LYS HD2  H   -3.338   2.064 -13.917 1.00 . A A .  97 LYS HD2  1 1 
        4  6547 1 1  97 LYS HD3  H   -2.248   3.187 -14.759 1.00 . A A .  97 LYS HD3  1 1 
        4  6548 1 1  97 LYS HE2  H   -3.257   2.515 -16.935 1.00 . A A .  97 LYS HE2  1 1 
        4  6549 1 1  97 LYS HE3  H   -4.350   1.413 -16.089 1.00 . A A .  97 LYS HE3  1 1 
        4  6550 1 1  97 LYS HG2  H   -1.284   1.320 -16.045 1.00 . A A .  97 LYS HG2  1 1 
        4  6551 1 1  97 LYS HG3  H   -2.388   0.179 -15.255 1.00 . A A .  97 LYS HG3  1 1 
        4  6552 1 1  97 LYS HZ1  H   -5.425   3.538 -16.561 1.00 . A A .  97 LYS HZ1  1 1 
        4  6553 1 1  97 LYS HZ2  H   -5.305   3.347 -14.946 1.00 . A A .  97 LYS HZ2  1 1 
        4  6554 1 1  97 LYS HZ3  H   -4.293   4.364 -15.730 1.00 . A A .  97 LYS HZ3  1 1 
        4  6555 1 1  97 LYS N    N   -0.210  -1.382 -14.664 1.00 . A A .  97 LYS N    1 1 
        4  6556 1 1  97 LYS NZ   N   -4.770   3.475 -15.794 1.00 . A A .  97 LYS NZ   1 1 
        4  6557 1 1  97 LYS O    O    1.613  -1.054 -12.582 1.00 . A A .  97 LYS O    1 1 
        4  6558 1 1  98 GLY C    C    3.790   2.627 -12.115 1.00 . A A .  98 GLY C    1 1 
        4  6559 1 1  98 GLY CA   C    3.361   1.167 -12.310 1.00 . A A .  98 GLY CA   1 1 
        4  6560 1 1  98 GLY H    H    1.991   1.799 -13.813 1.00 . A A .  98 GLY H    1 1 
        4  6561 1 1  98 GLY HA2  H    3.125   0.752 -11.330 1.00 . A A .  98 GLY HA2  1 1 
        4  6562 1 1  98 GLY HA3  H    4.204   0.610 -12.720 1.00 . A A .  98 GLY HA3  1 1 
        4  6563 1 1  98 GLY N    N    2.209   1.018 -13.210 1.00 . A A .  98 GLY N    1 1 
        4  6564 1 1  98 GLY O    O    3.043   3.554 -12.438 1.00 . A A .  98 GLY O    1 1 
        4  6565 1 1  99 GLN C    C    6.950   4.354 -11.883 1.00 . A A .  99 GLN C    1 1 
        4  6566 1 1  99 GLN CA   C    5.569   4.140 -11.235 1.00 . A A .  99 GLN CA   1 1 
        4  6567 1 1  99 GLN CB   C    5.656   4.287  -9.705 1.00 . A A .  99 GLN CB   1 1 
        4  6568 1 1  99 GLN CD   C    4.319   4.459  -7.520 1.00 . A A .  99 GLN CD   1 1 
        4  6569 1 1  99 GLN CG   C    4.267   4.346  -9.042 1.00 . A A .  99 GLN CG   1 1 
        4  6570 1 1  99 GLN H    H    5.568   2.017 -11.379 1.00 . A A .  99 GLN H    1 1 
        4  6571 1 1  99 GLN HA   H    4.917   4.931 -11.610 1.00 . A A .  99 GLN HA   1 1 
        4  6572 1 1  99 GLN HB2  H    6.221   3.447  -9.297 1.00 . A A .  99 GLN HB2  1 1 
        4  6573 1 1  99 GLN HB3  H    6.190   5.209  -9.468 1.00 . A A .  99 GLN HB3  1 1 
        4  6574 1 1  99 GLN HE21 H    2.310   4.644  -7.378 1.00 . A A .  99 GLN HE21 1 1 
        4  6575 1 1  99 GLN HE22 H    3.220   4.605  -5.859 1.00 . A A .  99 GLN HE22 1 1 
        4  6576 1 1  99 GLN HG2  H    3.722   5.206  -9.437 1.00 . A A .  99 GLN HG2  1 1 
        4  6577 1 1  99 GLN HG3  H    3.703   3.447  -9.288 1.00 . A A .  99 GLN HG3  1 1 
        4  6578 1 1  99 GLN N    N    4.996   2.827 -11.574 1.00 . A A .  99 GLN N    1 1 
        4  6579 1 1  99 GLN NE2  N    3.181   4.581  -6.875 1.00 . A A .  99 GLN NE2  1 1 
        4  6580 1 1  99 GLN O    O    7.690   3.399 -12.133 1.00 . A A .  99 GLN O    1 1 
        4  6581 1 1  99 GLN OE1  O    5.359   4.421  -6.879 1.00 . A A .  99 GLN OE1  1 1 
        4  6582 1 1 100 ASP C    C    9.676   6.233 -11.624 1.00 . A A . 100 ASP C    1 1 
        4  6583 1 1 100 ASP CA   C    8.596   6.025 -12.710 1.00 . A A . 100 ASP CA   1 1 
        4  6584 1 1 100 ASP CB   C    8.387   7.285 -13.566 1.00 . A A . 100 ASP CB   1 1 
        4  6585 1 1 100 ASP CG   C    9.668   7.725 -14.298 1.00 . A A . 100 ASP CG   1 1 
        4  6586 1 1 100 ASP H    H    6.657   6.350 -11.890 1.00 . A A . 100 ASP H    1 1 
        4  6587 1 1 100 ASP HA   H    8.947   5.234 -13.374 1.00 . A A . 100 ASP HA   1 1 
        4  6588 1 1 100 ASP HB2  H    7.613   7.083 -14.311 1.00 . A A . 100 ASP HB2  1 1 
        4  6589 1 1 100 ASP HB3  H    8.030   8.094 -12.924 1.00 . A A . 100 ASP HB3  1 1 
        4  6590 1 1 100 ASP N    N    7.302   5.615 -12.144 1.00 . A A . 100 ASP N    1 1 
        4  6591 1 1 100 ASP O    O    9.372   6.605 -10.486 1.00 . A A . 100 ASP O    1 1 
        4  6592 1 1 100 ASP OD1  O   10.285   6.885 -14.994 1.00 . A A . 100 ASP OD1  1 1 
        4  6593 1 1 100 ASP OD2  O   10.059   8.911 -14.178 1.00 . A A . 100 ASP OD2  1 1 
        4  6594 1 1 101 GLY C    C   12.278   4.880 -10.159 1.00 . A A . 101 GLY C    1 1 
        4  6595 1 1 101 GLY CA   C   12.096   6.105 -11.071 1.00 . A A . 101 GLY CA   1 1 
        4  6596 1 1 101 GLY H    H   11.127   5.737 -12.937 1.00 . A A . 101 GLY H    1 1 
        4  6597 1 1 101 GLY HA2  H   13.005   6.223 -11.662 1.00 . A A . 101 GLY HA2  1 1 
        4  6598 1 1 101 GLY HA3  H   11.996   6.990 -10.442 1.00 . A A . 101 GLY HA3  1 1 
        4  6599 1 1 101 GLY N    N   10.946   6.015 -11.982 1.00 . A A . 101 GLY N    1 1 
        4  6600 1 1 101 GLY O    O   11.493   3.929 -10.187 1.00 . A A . 101 GLY O    1 1 
        4  6601 1 1 102 ILE C    C   14.395   4.336  -7.172 1.00 . A A . 102 ILE C    1 1 
        4  6602 1 1 102 ILE CA   C   13.760   3.799  -8.468 1.00 . A A . 102 ILE CA   1 1 
        4  6603 1 1 102 ILE CB   C   14.682   2.815  -9.236 1.00 . A A . 102 ILE CB   1 1 
        4  6604 1 1 102 ILE CD1  C   15.601   0.394  -9.195 1.00 . A A . 102 ILE CD1  1 1 
        4  6605 1 1 102 ILE CG1  C   14.923   1.528  -8.416 1.00 . A A . 102 ILE CG1  1 1 
        4  6606 1 1 102 ILE CG2  C   16.006   3.467  -9.678 1.00 . A A . 102 ILE CG2  1 1 
        4  6607 1 1 102 ILE H    H   13.941   5.718  -9.377 1.00 . A A . 102 ILE H    1 1 
        4  6608 1 1 102 ILE HA   H   12.863   3.249  -8.179 1.00 . A A . 102 ILE HA   1 1 
        4  6609 1 1 102 ILE HB   H   14.148   2.519 -10.142 1.00 . A A . 102 ILE HB   1 1 
        4  6610 1 1 102 ILE HD11 H   15.630  -0.501  -8.573 1.00 . A A . 102 ILE HD11 1 1 
        4  6611 1 1 102 ILE HD12 H   15.040   0.178 -10.103 1.00 . A A . 102 ILE HD12 1 1 
        4  6612 1 1 102 ILE HD13 H   16.624   0.668  -9.453 1.00 . A A . 102 ILE HD13 1 1 
        4  6613 1 1 102 ILE HG12 H   15.536   1.757  -7.546 1.00 . A A . 102 ILE HG12 1 1 
        4  6614 1 1 102 ILE HG13 H   13.958   1.157  -8.073 1.00 . A A . 102 ILE HG13 1 1 
        4  6615 1 1 102 ILE HG21 H   16.621   3.712  -8.812 1.00 . A A . 102 ILE HG21 1 1 
        4  6616 1 1 102 ILE HG22 H   16.563   2.789 -10.324 1.00 . A A . 102 ILE HG22 1 1 
        4  6617 1 1 102 ILE HG23 H   15.812   4.377 -10.245 1.00 . A A . 102 ILE HG23 1 1 
        4  6618 1 1 102 ILE N    N   13.348   4.899  -9.357 1.00 . A A . 102 ILE N    1 1 
        4  6619 1 1 102 ILE O    O   15.095   5.350  -7.178 1.00 . A A . 102 ILE O    1 1 
        4  6620 1 1 103 GLY C    C   16.084   3.794  -4.384 1.00 . A A . 103 GLY C    1 1 
        4  6621 1 1 103 GLY CA   C   14.605   4.058  -4.709 1.00 . A A . 103 GLY CA   1 1 
        4  6622 1 1 103 GLY H    H   13.516   2.865  -6.113 1.00 . A A . 103 GLY H    1 1 
        4  6623 1 1 103 GLY HA2  H   14.429   5.127  -4.581 1.00 . A A . 103 GLY HA2  1 1 
        4  6624 1 1 103 GLY HA3  H   14.011   3.526  -3.966 1.00 . A A . 103 GLY HA3  1 1 
        4  6625 1 1 103 GLY N    N   14.145   3.657  -6.048 1.00 . A A . 103 GLY N    1 1 
        4  6626 1 1 103 GLY O    O   16.571   4.287  -3.365 1.00 . A A . 103 GLY O    1 1 
        4  6627 1 1 104 SER C    C   19.030   2.609  -6.284 1.00 . A A . 104 SER C    1 1 
        4  6628 1 1 104 SER CA   C   18.192   2.605  -4.998 1.00 . A A . 104 SER CA   1 1 
        4  6629 1 1 104 SER CB   C   18.216   1.185  -4.410 1.00 . A A . 104 SER CB   1 1 
        4  6630 1 1 104 SER H    H   16.353   2.724  -6.073 1.00 . A A . 104 SER H    1 1 
        4  6631 1 1 104 SER HA   H   18.673   3.278  -4.287 1.00 . A A . 104 SER HA   1 1 
        4  6632 1 1 104 SER HB2  H   17.814   0.487  -5.146 1.00 . A A . 104 SER HB2  1 1 
        4  6633 1 1 104 SER HB3  H   19.249   0.899  -4.196 1.00 . A A . 104 SER HB3  1 1 
        4  6634 1 1 104 SER HG   H   17.848   1.671  -2.545 1.00 . A A . 104 SER HG   1 1 
        4  6635 1 1 104 SER N    N   16.804   3.047  -5.231 1.00 . A A . 104 SER N    1 1 
        4  6636 1 1 104 SER O    O   18.511   2.335  -7.370 1.00 . A A . 104 SER O    1 1 
        4  6637 1 1 104 SER OG   O   17.449   1.089  -3.220 1.00 . A A . 104 SER OG   1 1 
        4  6638 1 1 105 LYS C    C   22.705   2.336  -6.687 1.00 . A A . 105 LYS C    1 1 
        4  6639 1 1 105 LYS CA   C   21.345   2.799  -7.235 1.00 . A A . 105 LYS CA   1 1 
        4  6640 1 1 105 LYS CB   C   21.454   4.179  -7.917 1.00 . A A . 105 LYS CB   1 1 
        4  6641 1 1 105 LYS CD   C   22.414   5.524  -9.842 1.00 . A A . 105 LYS CD   1 1 
        4  6642 1 1 105 LYS CE   C   23.098   5.420 -11.211 1.00 . A A . 105 LYS CE   1 1 
        4  6643 1 1 105 LYS CG   C   22.204   4.122  -9.258 1.00 . A A . 105 LYS CG   1 1 
        4  6644 1 1 105 LYS H    H   20.682   3.089  -5.228 1.00 . A A . 105 LYS H    1 1 
        4  6645 1 1 105 LYS HA   H   21.013   2.068  -7.975 1.00 . A A . 105 LYS HA   1 1 
        4  6646 1 1 105 LYS HB2  H   20.450   4.564  -8.110 1.00 . A A . 105 LYS HB2  1 1 
        4  6647 1 1 105 LYS HB3  H   21.959   4.874  -7.244 1.00 . A A . 105 LYS HB3  1 1 
        4  6648 1 1 105 LYS HD2  H   21.453   6.030  -9.952 1.00 . A A . 105 LYS HD2  1 1 
        4  6649 1 1 105 LYS HD3  H   23.043   6.096  -9.158 1.00 . A A . 105 LYS HD3  1 1 
        4  6650 1 1 105 LYS HE2  H   23.916   4.697 -11.142 1.00 . A A . 105 LYS HE2  1 1 
        4  6651 1 1 105 LYS HE3  H   22.376   5.044 -11.942 1.00 . A A . 105 LYS HE3  1 1 
        4  6652 1 1 105 LYS HG2  H   23.184   3.668  -9.117 1.00 . A A . 105 LYS HG2  1 1 
        4  6653 1 1 105 LYS HG3  H   21.632   3.516  -9.962 1.00 . A A . 105 LYS HG3  1 1 
        4  6654 1 1 105 LYS HZ1  H   24.053   6.672 -12.565 1.00 . A A . 105 LYS HZ1  1 1 
        4  6655 1 1 105 LYS HZ2  H   22.931   7.446 -11.659 1.00 . A A . 105 LYS HZ2  1 1 
        4  6656 1 1 105 LYS HZ3  H   24.382   7.024 -11.002 1.00 . A A . 105 LYS HZ3  1 1 
        4  6657 1 1 105 LYS N    N   20.340   2.869  -6.156 1.00 . A A . 105 LYS N    1 1 
        4  6658 1 1 105 LYS NZ   N   23.643   6.730 -11.644 1.00 . A A . 105 LYS NZ   1 1 
        4  6659 1 1 105 LYS O    O   23.067   2.689  -5.562 1.00 . A A . 105 LYS O    1 1 
        4  6660 1 1 106 ALA C    C   25.885   1.860  -7.946 1.00 . A A . 106 ALA C    1 1 
        4  6661 1 1 106 ALA CA   C   24.804   1.093  -7.153 1.00 . A A . 106 ALA CA   1 1 
        4  6662 1 1 106 ALA CB   C   24.839  -0.425  -7.383 1.00 . A A . 106 ALA CB   1 1 
        4  6663 1 1 106 ALA H    H   23.098   1.344  -8.393 1.00 . A A . 106 ALA H    1 1 
        4  6664 1 1 106 ALA HA   H   25.004   1.255  -6.092 1.00 . A A . 106 ALA HA   1 1 
        4  6665 1 1 106 ALA HB1  H   24.628  -0.656  -8.428 1.00 . A A . 106 ALA HB1  1 1 
        4  6666 1 1 106 ALA HB2  H   25.826  -0.811  -7.125 1.00 . A A . 106 ALA HB2  1 1 
        4  6667 1 1 106 ALA HB3  H   24.094  -0.912  -6.751 1.00 . A A . 106 ALA HB3  1 1 
        4  6668 1 1 106 ALA N    N   23.462   1.579  -7.483 1.00 . A A . 106 ALA N    1 1 
        4  6669 1 1 106 ALA O    O   26.226   1.503  -9.076 1.00 . A A . 106 ALA O    1 1 
        4  6670 1 1 107 GLU C    C   28.914   2.941  -7.614 1.00 . A A . 107 GLU C    1 1 
        4  6671 1 1 107 GLU CA   C   27.581   3.671  -7.879 1.00 . A A . 107 GLU CA   1 1 
        4  6672 1 1 107 GLU CB   C   27.618   5.092  -7.282 1.00 . A A . 107 GLU CB   1 1 
        4  6673 1 1 107 GLU CD   C   26.657   6.429  -9.290 1.00 . A A . 107 GLU CD   1 1 
        4  6674 1 1 107 GLU CG   C   26.510   6.023  -7.806 1.00 . A A . 107 GLU CG   1 1 
        4  6675 1 1 107 GLU H    H   26.086   3.176  -6.433 1.00 . A A . 107 GLU H    1 1 
        4  6676 1 1 107 GLU HA   H   27.479   3.757  -8.962 1.00 . A A . 107 GLU HA   1 1 
        4  6677 1 1 107 GLU HB2  H   27.526   5.015  -6.198 1.00 . A A . 107 GLU HB2  1 1 
        4  6678 1 1 107 GLU HB3  H   28.587   5.550  -7.490 1.00 . A A . 107 GLU HB3  1 1 
        4  6679 1 1 107 GLU HG2  H   25.540   5.546  -7.650 1.00 . A A . 107 GLU HG2  1 1 
        4  6680 1 1 107 GLU HG3  H   26.527   6.931  -7.198 1.00 . A A . 107 GLU HG3  1 1 
        4  6681 1 1 107 GLU N    N   26.423   2.928  -7.352 1.00 . A A . 107 GLU N    1 1 
        4  6682 1 1 107 GLU O    O   29.044   2.187  -6.641 1.00 . A A . 107 GLU O    1 1 
        4  6683 1 1 107 GLU OE1  O   27.694   6.135  -9.934 1.00 . A A . 107 GLU OE1  1 1 
        4  6684 1 1 107 GLU OE2  O   25.716   7.060  -9.828 1.00 . A A . 107 GLU OE2  1 1 
        4  6685 1 1 108 LYS C    C   32.341   3.595  -8.866 1.00 . A A . 108 LYS C    1 1 
        4  6686 1 1 108 LYS CA   C   31.270   2.596  -8.404 1.00 . A A . 108 LYS CA   1 1 
        4  6687 1 1 108 LYS CB   C   31.294   1.289  -9.225 1.00 . A A . 108 LYS CB   1 1 
        4  6688 1 1 108 LYS CD   C   32.990   0.020  -7.768 1.00 . A A . 108 LYS CD   1 1 
        4  6689 1 1 108 LYS CE   C   34.261  -0.837  -7.829 1.00 . A A . 108 LYS CE   1 1 
        4  6690 1 1 108 LYS CG   C   32.622   0.514  -9.176 1.00 . A A . 108 LYS CG   1 1 
        4  6691 1 1 108 LYS H    H   29.739   3.832  -9.228 1.00 . A A . 108 LYS H    1 1 
        4  6692 1 1 108 LYS HA   H   31.490   2.360  -7.364 1.00 . A A . 108 LYS HA   1 1 
        4  6693 1 1 108 LYS HB2  H   30.501   0.630  -8.867 1.00 . A A . 108 LYS HB2  1 1 
        4  6694 1 1 108 LYS HB3  H   31.078   1.524 -10.269 1.00 . A A . 108 LYS HB3  1 1 
        4  6695 1 1 108 LYS HD2  H   33.166   0.873  -7.113 1.00 . A A . 108 LYS HD2  1 1 
        4  6696 1 1 108 LYS HD3  H   32.168  -0.577  -7.370 1.00 . A A . 108 LYS HD3  1 1 
        4  6697 1 1 108 LYS HE2  H   34.084  -1.682  -8.501 1.00 . A A . 108 LYS HE2  1 1 
        4  6698 1 1 108 LYS HE3  H   35.070  -0.235  -8.254 1.00 . A A . 108 LYS HE3  1 1 
        4  6699 1 1 108 LYS HG2  H   32.530  -0.351  -9.835 1.00 . A A . 108 LYS HG2  1 1 
        4  6700 1 1 108 LYS HG3  H   33.427   1.142  -9.561 1.00 . A A . 108 LYS HG3  1 1 
        4  6701 1 1 108 LYS HZ1  H   34.840  -0.568  -5.850 1.00 . A A . 108 LYS HZ1  1 1 
        4  6702 1 1 108 LYS HZ2  H   33.926  -1.906  -6.077 1.00 . A A . 108 LYS HZ2  1 1 
        4  6703 1 1 108 LYS HZ3  H   35.492  -1.897  -6.536 1.00 . A A . 108 LYS HZ3  1 1 
        4  6704 1 1 108 LYS N    N   29.916   3.181  -8.473 1.00 . A A . 108 LYS N    1 1 
        4  6705 1 1 108 LYS NZ   N   34.654  -1.334  -6.484 1.00 . A A . 108 LYS NZ   1 1 
        4  6706 1 1 108 LYS O    O   32.212   4.149  -9.983 1.00 . A A . 108 LYS O    1 1 
        4  6707 1 1 108 LYS OXT  O   33.298   3.836  -8.094 1.00 . A A . 108 LYS OXT  1 1 
        4  6708 2 2   1 ZN  ZN   ZN   6.767  -2.534  -8.027 1.00 . B A . 109 ZN  ZN   1 1 
        5  6709 1 1   1 MET C    C   -0.251  -1.688  23.240 1.00 . A A .   1 MET C    1 1 
        5  6710 1 1   1 MET CA   C    0.237  -3.130  23.418 1.00 . A A .   1 MET CA   1 1 
        5  6711 1 1   1 MET CB   C    1.098  -3.338  24.682 1.00 . A A .   1 MET CB   1 1 
        5  6712 1 1   1 MET CE   C   -1.667  -3.284  27.861 1.00 . A A .   1 MET CE   1 1 
        5  6713 1 1   1 MET CG   C    0.349  -2.999  25.978 1.00 . A A .   1 MET CG   1 1 
        5  6714 1 1   1 MET H1   H    0.349  -3.441  21.376 1.00 . A A .   1 MET H1   1 1 
        5  6715 1 1   1 MET H2   H    1.135  -4.586  22.255 1.00 . A A .   1 MET H2   1 1 
        5  6716 1 1   1 MET H3   H    1.794  -3.094  22.054 1.00 . A A .   1 MET H3   1 1 
        5  6717 1 1   1 MET HA   H   -0.662  -3.735  23.541 1.00 . A A .   1 MET HA   1 1 
        5  6718 1 1   1 MET HB2  H    1.404  -4.384  24.733 1.00 . A A .   1 MET HB2  1 1 
        5  6719 1 1   1 MET HB3  H    2.001  -2.727  24.626 1.00 . A A .   1 MET HB3  1 1 
        5  6720 1 1   1 MET HE1  H   -1.831  -2.209  27.773 1.00 . A A .   1 MET HE1  1 1 
        5  6721 1 1   1 MET HE2  H   -2.591  -3.762  28.186 1.00 . A A .   1 MET HE2  1 1 
        5  6722 1 1   1 MET HE3  H   -0.887  -3.473  28.599 1.00 . A A .   1 MET HE3  1 1 
        5  6723 1 1   1 MET HG2  H    1.024  -3.181  26.816 1.00 . A A .   1 MET HG2  1 1 
        5  6724 1 1   1 MET HG3  H    0.096  -1.939  25.981 1.00 . A A .   1 MET HG3  1 1 
        5  6725 1 1   1 MET N    N    0.927  -3.601  22.192 1.00 . A A .   1 MET N    1 1 
        5  6726 1 1   1 MET O    O   -1.442  -1.484  23.007 1.00 . A A .   1 MET O    1 1 
        5  6727 1 1   1 MET SD   S   -1.167  -3.962  26.253 1.00 . A A .   1 MET SD   1 1 
        5  6728 1 1   2 ALA C    C    0.327   0.874  21.378 1.00 . A A .   2 ALA C    1 1 
        5  6729 1 1   2 ALA CA   C    0.329   0.696  22.915 1.00 . A A .   2 ALA CA   1 1 
        5  6730 1 1   2 ALA CB   C    1.345   1.621  23.594 1.00 . A A .   2 ALA CB   1 1 
        5  6731 1 1   2 ALA H    H    1.608  -0.904  23.502 1.00 . A A .   2 ALA H    1 1 
        5  6732 1 1   2 ALA HA   H   -0.665   0.960  23.281 1.00 . A A .   2 ALA HA   1 1 
        5  6733 1 1   2 ALA HB1  H    2.355   1.393  23.247 1.00 . A A .   2 ALA HB1  1 1 
        5  6734 1 1   2 ALA HB2  H    1.113   2.660  23.355 1.00 . A A .   2 ALA HB2  1 1 
        5  6735 1 1   2 ALA HB3  H    1.298   1.492  24.677 1.00 . A A .   2 ALA HB3  1 1 
        5  6736 1 1   2 ALA N    N    0.640  -0.689  23.300 1.00 . A A .   2 ALA N    1 1 
        5  6737 1 1   2 ALA O    O   -0.440   1.667  20.828 1.00 . A A .   2 ALA O    1 1 
        5  6738 1 1   3 GLU C    C    0.270  -1.404  18.903 1.00 . A A .   3 GLU C    1 1 
        5  6739 1 1   3 GLU CA   C    1.133  -0.172  19.247 1.00 . A A .   3 GLU CA   1 1 
        5  6740 1 1   3 GLU CB   C    2.576  -0.308  18.714 1.00 . A A .   3 GLU CB   1 1 
        5  6741 1 1   3 GLU CD   C    3.806  -1.436  20.682 1.00 . A A .   3 GLU CD   1 1 
        5  6742 1 1   3 GLU CG   C    3.378  -1.531  19.204 1.00 . A A .   3 GLU CG   1 1 
        5  6743 1 1   3 GLU H    H    1.752  -0.525  21.237 1.00 . A A .   3 GLU H    1 1 
        5  6744 1 1   3 GLU HA   H    0.683   0.686  18.743 1.00 . A A .   3 GLU HA   1 1 
        5  6745 1 1   3 GLU HB2  H    2.522  -0.364  17.626 1.00 . A A .   3 GLU HB2  1 1 
        5  6746 1 1   3 GLU HB3  H    3.131   0.599  18.961 1.00 . A A .   3 GLU HB3  1 1 
        5  6747 1 1   3 GLU HG2  H    2.796  -2.440  19.040 1.00 . A A .   3 GLU HG2  1 1 
        5  6748 1 1   3 GLU HG3  H    4.272  -1.616  18.580 1.00 . A A .   3 GLU HG3  1 1 
        5  6749 1 1   3 GLU N    N    1.154   0.086  20.690 1.00 . A A .   3 GLU N    1 1 
        5  6750 1 1   3 GLU O    O    0.023  -2.260  19.763 1.00 . A A .   3 GLU O    1 1 
        5  6751 1 1   3 GLU OE1  O    3.013  -1.847  21.566 1.00 . A A .   3 GLU OE1  1 1 
        5  6752 1 1   3 GLU OE2  O    4.926  -0.948  20.969 1.00 . A A .   3 GLU OE2  1 1 
        5  6753 1 1   4 SER C    C   -0.712  -3.055  15.737 1.00 . A A .   4 SER C    1 1 
        5  6754 1 1   4 SER CA   C   -1.037  -2.612  17.170 1.00 . A A .   4 SER CA   1 1 
        5  6755 1 1   4 SER CB   C   -2.515  -2.212  17.289 1.00 . A A .   4 SER CB   1 1 
        5  6756 1 1   4 SER H    H    0.052  -0.790  16.983 1.00 . A A .   4 SER H    1 1 
        5  6757 1 1   4 SER HA   H   -0.885  -3.479  17.815 1.00 . A A .   4 SER HA   1 1 
        5  6758 1 1   4 SER HB2  H   -3.144  -3.059  17.009 1.00 . A A .   4 SER HB2  1 1 
        5  6759 1 1   4 SER HB3  H   -2.729  -1.955  18.329 1.00 . A A .   4 SER HB3  1 1 
        5  6760 1 1   4 SER HG   H   -3.714  -0.778  16.703 1.00 . A A .   4 SER HG   1 1 
        5  6761 1 1   4 SER N    N   -0.176  -1.516  17.648 1.00 . A A .   4 SER N    1 1 
        5  6762 1 1   4 SER O    O   -0.353  -2.244  14.878 1.00 . A A .   4 SER O    1 1 
        5  6763 1 1   4 SER OG   O   -2.824  -1.101  16.457 1.00 . A A .   4 SER OG   1 1 
        5  6764 1 1   5 SER C    C   -1.896  -5.786  13.670 1.00 . A A .   5 SER C    1 1 
        5  6765 1 1   5 SER CA   C   -0.683  -4.982  14.142 1.00 . A A .   5 SER CA   1 1 
        5  6766 1 1   5 SER CB   C    0.632  -5.777  14.115 1.00 . A A .   5 SER CB   1 1 
        5  6767 1 1   5 SER H    H   -1.156  -4.962  16.221 1.00 . A A .   5 SER H    1 1 
        5  6768 1 1   5 SER HA   H   -0.606  -4.201  13.392 1.00 . A A .   5 SER HA   1 1 
        5  6769 1 1   5 SER HB2  H    0.799  -6.157  13.108 1.00 . A A .   5 SER HB2  1 1 
        5  6770 1 1   5 SER HB3  H    1.461  -5.115  14.369 1.00 . A A .   5 SER HB3  1 1 
        5  6771 1 1   5 SER HG   H    0.799  -6.536  15.917 1.00 . A A .   5 SER HG   1 1 
        5  6772 1 1   5 SER N    N   -0.884  -4.353  15.462 1.00 . A A .   5 SER N    1 1 
        5  6773 1 1   5 SER O    O   -1.778  -6.737  12.897 1.00 . A A .   5 SER O    1 1 
        5  6774 1 1   5 SER OG   O    0.603  -6.873  15.020 1.00 . A A .   5 SER OG   1 1 
        5  6775 1 1   6 ASP C    C   -5.011  -5.587  12.484 1.00 . A A .   6 ASP C    1 1 
        5  6776 1 1   6 ASP CA   C   -4.360  -6.061  13.807 1.00 . A A .   6 ASP CA   1 1 
        5  6777 1 1   6 ASP CB   C   -5.282  -5.969  15.035 1.00 . A A .   6 ASP CB   1 1 
        5  6778 1 1   6 ASP CG   C   -6.480  -6.937  14.977 1.00 . A A .   6 ASP CG   1 1 
        5  6779 1 1   6 ASP H    H   -3.124  -4.594  14.737 1.00 . A A .   6 ASP H    1 1 
        5  6780 1 1   6 ASP HA   H   -4.102  -7.107  13.658 1.00 . A A .   6 ASP HA   1 1 
        5  6781 1 1   6 ASP HB2  H   -4.701  -6.206  15.928 1.00 . A A .   6 ASP HB2  1 1 
        5  6782 1 1   6 ASP HB3  H   -5.633  -4.939  15.134 1.00 . A A .   6 ASP HB3  1 1 
        5  6783 1 1   6 ASP N    N   -3.092  -5.388  14.112 1.00 . A A .   6 ASP N    1 1 
        5  6784 1 1   6 ASP O    O   -6.231  -5.643  12.309 1.00 . A A .   6 ASP O    1 1 
        5  6785 1 1   6 ASP OD1  O   -6.283  -8.135  14.660 1.00 . A A .   6 ASP OD1  1 1 
        5  6786 1 1   6 ASP OD2  O   -7.616  -6.519  15.310 1.00 . A A .   6 ASP OD2  1 1 
        5  6787 1 1   7 LYS C    C   -3.510  -5.185   9.226 1.00 . A A .   7 LYS C    1 1 
        5  6788 1 1   7 LYS CA   C   -4.552  -4.647  10.199 1.00 . A A .   7 LYS CA   1 1 
        5  6789 1 1   7 LYS CB   C   -4.735  -3.116  10.062 1.00 . A A .   7 LYS CB   1 1 
        5  6790 1 1   7 LYS CD   C   -3.396  -2.064  11.955 1.00 . A A .   7 LYS CD   1 1 
        5  6791 1 1   7 LYS CE   C   -3.486  -1.094  13.139 1.00 . A A .   7 LYS CE   1 1 
        5  6792 1 1   7 LYS CG   C   -4.788  -2.271  11.346 1.00 . A A .   7 LYS CG   1 1 
        5  6793 1 1   7 LYS H    H   -3.195  -5.144  11.731 1.00 . A A .   7 LYS H    1 1 
        5  6794 1 1   7 LYS HA   H   -5.505  -5.102   9.937 1.00 . A A .   7 LYS HA   1 1 
        5  6795 1 1   7 LYS HB2  H   -3.954  -2.709   9.417 1.00 . A A .   7 LYS HB2  1 1 
        5  6796 1 1   7 LYS HB3  H   -5.676  -2.954   9.534 1.00 . A A .   7 LYS HB3  1 1 
        5  6797 1 1   7 LYS HD2  H   -2.984  -3.015  12.281 1.00 . A A .   7 LYS HD2  1 1 
        5  6798 1 1   7 LYS HD3  H   -2.739  -1.664  11.188 1.00 . A A .   7 LYS HD3  1 1 
        5  6799 1 1   7 LYS HE2  H   -4.171  -0.283  12.873 1.00 . A A .   7 LYS HE2  1 1 
        5  6800 1 1   7 LYS HE3  H   -3.907  -1.618  14.003 1.00 . A A .   7 LYS HE3  1 1 
        5  6801 1 1   7 LYS HG2  H   -5.193  -1.293  11.083 1.00 . A A .   7 LYS HG2  1 1 
        5  6802 1 1   7 LYS HG3  H   -5.457  -2.729  12.075 1.00 . A A .   7 LYS HG3  1 1 
        5  6803 1 1   7 LYS HZ1  H   -1.486  -1.222  13.733 1.00 . A A .   7 LYS HZ1  1 1 
        5  6804 1 1   7 LYS HZ2  H   -1.806   0.033  12.695 1.00 . A A .   7 LYS HZ2  1 1 
        5  6805 1 1   7 LYS HZ3  H   -2.246   0.102  14.281 1.00 . A A .   7 LYS HZ3  1 1 
        5  6806 1 1   7 LYS N    N   -4.188  -5.097  11.546 1.00 . A A .   7 LYS N    1 1 
        5  6807 1 1   7 LYS NZ   N   -2.165  -0.511  13.482 1.00 . A A .   7 LYS NZ   1 1 
        5  6808 1 1   7 LYS O    O   -2.309  -4.988   9.401 1.00 . A A .   7 LYS O    1 1 
        5  6809 1 1   8 LEU C    C   -2.636  -5.862   6.127 1.00 . A A .   8 LEU C    1 1 
        5  6810 1 1   8 LEU CA   C   -3.240  -6.691   7.267 1.00 . A A .   8 LEU CA   1 1 
        5  6811 1 1   8 LEU CB   C   -4.107  -7.861   6.763 1.00 . A A .   8 LEU CB   1 1 
        5  6812 1 1   8 LEU CD1  C   -5.883  -8.760   5.251 1.00 . A A .   8 LEU CD1  1 1 
        5  6813 1 1   8 LEU CD2  C   -6.502  -6.887   6.738 1.00 . A A .   8 LEU CD2  1 1 
        5  6814 1 1   8 LEU CG   C   -5.352  -7.495   5.926 1.00 . A A .   8 LEU CG   1 1 
        5  6815 1 1   8 LEU H    H   -4.994  -5.990   8.192 1.00 . A A .   8 LEU H    1 1 
        5  6816 1 1   8 LEU HA   H   -2.394  -7.144   7.780 1.00 . A A .   8 LEU HA   1 1 
        5  6817 1 1   8 LEU HB2  H   -3.461  -8.490   6.149 1.00 . A A .   8 LEU HB2  1 1 
        5  6818 1 1   8 LEU HB3  H   -4.418  -8.465   7.617 1.00 . A A .   8 LEU HB3  1 1 
        5  6819 1 1   8 LEU HD11 H   -6.181  -9.490   6.004 1.00 . A A .   8 LEU HD11 1 1 
        5  6820 1 1   8 LEU HD12 H   -6.740  -8.512   4.625 1.00 . A A .   8 LEU HD12 1 1 
        5  6821 1 1   8 LEU HD13 H   -5.108  -9.188   4.616 1.00 . A A .   8 LEU HD13 1 1 
        5  6822 1 1   8 LEU HD21 H   -7.405  -6.867   6.129 1.00 . A A .   8 LEU HD21 1 1 
        5  6823 1 1   8 LEU HD22 H   -6.690  -7.481   7.633 1.00 . A A .   8 LEU HD22 1 1 
        5  6824 1 1   8 LEU HD23 H   -6.275  -5.857   7.000 1.00 . A A .   8 LEU HD23 1 1 
        5  6825 1 1   8 LEU HG   H   -5.065  -6.780   5.165 1.00 . A A .   8 LEU HG   1 1 
        5  6826 1 1   8 LEU N    N   -3.999  -5.906   8.230 1.00 . A A .   8 LEU N    1 1 
        5  6827 1 1   8 LEU O    O   -1.772  -6.385   5.429 1.00 . A A .   8 LEU O    1 1 
        5  6828 1 1   9 TYR C    C   -2.021  -2.413   5.416 1.00 . A A .   9 TYR C    1 1 
        5  6829 1 1   9 TYR CA   C   -2.565  -3.736   4.866 1.00 . A A .   9 TYR CA   1 1 
        5  6830 1 1   9 TYR CB   C   -3.699  -3.510   3.849 1.00 . A A .   9 TYR CB   1 1 
        5  6831 1 1   9 TYR CD1  C   -3.565  -5.828   2.816 1.00 . A A .   9 TYR CD1  1 1 
        5  6832 1 1   9 TYR CD2  C   -5.758  -4.853   3.196 1.00 . A A .   9 TYR CD2  1 1 
        5  6833 1 1   9 TYR CE1  C   -4.160  -6.979   2.267 1.00 . A A .   9 TYR CE1  1 1 
        5  6834 1 1   9 TYR CE2  C   -6.364  -6.005   2.655 1.00 . A A .   9 TYR CE2  1 1 
        5  6835 1 1   9 TYR CG   C   -4.354  -4.761   3.279 1.00 . A A .   9 TYR CG   1 1 
        5  6836 1 1   9 TYR CZ   C   -5.565  -7.065   2.170 1.00 . A A .   9 TYR CZ   1 1 
        5  6837 1 1   9 TYR H    H   -3.652  -4.153   6.622 1.00 . A A .   9 TYR H    1 1 
        5  6838 1 1   9 TYR HA   H   -1.743  -4.224   4.344 1.00 . A A .   9 TYR HA   1 1 
        5  6839 1 1   9 TYR HB2  H   -4.470  -2.911   4.329 1.00 . A A .   9 TYR HB2  1 1 
        5  6840 1 1   9 TYR HB3  H   -3.306  -2.928   3.014 1.00 . A A .   9 TYR HB3  1 1 
        5  6841 1 1   9 TYR HD1  H   -2.492  -5.756   2.877 1.00 . A A .   9 TYR HD1  1 1 
        5  6842 1 1   9 TYR HD2  H   -6.370  -4.033   3.536 1.00 . A A .   9 TYR HD2  1 1 
        5  6843 1 1   9 TYR HE1  H   -3.552  -7.791   1.900 1.00 . A A .   9 TYR HE1  1 1 
        5  6844 1 1   9 TYR HE2  H   -7.441  -6.074   2.594 1.00 . A A .   9 TYR HE2  1 1 
        5  6845 1 1   9 TYR HH   H   -7.088  -8.041   1.463 1.00 . A A .   9 TYR HH   1 1 
        5  6846 1 1   9 TYR N    N   -3.029  -4.594   5.954 1.00 . A A .   9 TYR N    1 1 
        5  6847 1 1   9 TYR O    O   -2.377  -1.978   6.512 1.00 . A A .   9 TYR O    1 1 
        5  6848 1 1   9 TYR OH   O   -6.133  -8.157   1.593 1.00 . A A .   9 TYR OH   1 1 
        5  6849 1 1  10 ARG C    C   -0.432   0.362   3.679 1.00 . A A .  10 ARG C    1 1 
        5  6850 1 1  10 ARG CA   C   -0.481  -0.498   4.945 1.00 . A A .  10 ARG CA   1 1 
        5  6851 1 1  10 ARG CB   C    0.921  -0.819   5.510 1.00 . A A .  10 ARG CB   1 1 
        5  6852 1 1  10 ARG CD   C    1.539   1.357   6.675 1.00 . A A .  10 ARG CD   1 1 
        5  6853 1 1  10 ARG CG   C    1.948   0.330   5.612 1.00 . A A .  10 ARG CG   1 1 
        5  6854 1 1  10 ARG CZ   C    2.187   3.606   7.491 1.00 . A A .  10 ARG CZ   1 1 
        5  6855 1 1  10 ARG H    H   -0.878  -2.233   3.781 1.00 . A A .  10 ARG H    1 1 
        5  6856 1 1  10 ARG HA   H   -1.063   0.019   5.704 1.00 . A A .  10 ARG HA   1 1 
        5  6857 1 1  10 ARG HB2  H    0.802  -1.267   6.498 1.00 . A A .  10 ARG HB2  1 1 
        5  6858 1 1  10 ARG HB3  H    1.356  -1.583   4.874 1.00 . A A .  10 ARG HB3  1 1 
        5  6859 1 1  10 ARG HD2  H    0.546   1.715   6.426 1.00 . A A .  10 ARG HD2  1 1 
        5  6860 1 1  10 ARG HD3  H    1.510   0.860   7.643 1.00 . A A .  10 ARG HD3  1 1 
        5  6861 1 1  10 ARG HE   H    3.214   2.595   6.129 1.00 . A A .  10 ARG HE   1 1 
        5  6862 1 1  10 ARG HG2  H    2.913  -0.099   5.886 1.00 . A A .  10 ARG HG2  1 1 
        5  6863 1 1  10 ARG HG3  H    2.066   0.809   4.639 1.00 . A A .  10 ARG HG3  1 1 
        5  6864 1 1  10 ARG HH11 H    0.687   2.882   8.646 1.00 . A A .  10 ARG HH11 1 1 
        5  6865 1 1  10 ARG HH12 H    1.073   4.610   8.781 1.00 . A A .  10 ARG HH12 1 1 
        5  6866 1 1  10 ARG HH21 H    3.698   4.669   6.726 1.00 . A A .  10 ARG HH21 1 1 
        5  6867 1 1  10 ARG HH22 H    2.607   5.511   7.861 1.00 . A A .  10 ARG HH22 1 1 
        5  6868 1 1  10 ARG N    N   -1.156  -1.765   4.639 1.00 . A A .  10 ARG N    1 1 
        5  6869 1 1  10 ARG NE   N    2.428   2.531   6.758 1.00 . A A .  10 ARG NE   1 1 
        5  6870 1 1  10 ARG NH1  N    1.238   3.695   8.371 1.00 . A A .  10 ARG NH1  1 1 
        5  6871 1 1  10 ARG NH2  N    2.909   4.673   7.372 1.00 . A A .  10 ARG NH2  1 1 
        5  6872 1 1  10 ARG O    O   -0.284  -0.190   2.593 1.00 . A A .  10 ARG O    1 1 
        5  6873 1 1  11 VAL C    C    0.388   3.919   3.248 1.00 . A A .  11 VAL C    1 1 
        5  6874 1 1  11 VAL CA   C   -0.310   2.662   2.720 1.00 . A A .  11 VAL CA   1 1 
        5  6875 1 1  11 VAL CB   C   -1.641   3.006   2.025 1.00 . A A .  11 VAL CB   1 1 
        5  6876 1 1  11 VAL CG1  C   -2.526   3.961   2.838 1.00 . A A .  11 VAL CG1  1 1 
        5  6877 1 1  11 VAL CG2  C   -1.423   3.647   0.648 1.00 . A A .  11 VAL CG2  1 1 
        5  6878 1 1  11 VAL H    H   -0.798   2.049   4.710 1.00 . A A .  11 VAL H    1 1 
        5  6879 1 1  11 VAL HA   H    0.350   2.213   1.977 1.00 . A A .  11 VAL HA   1 1 
        5  6880 1 1  11 VAL HB   H   -2.184   2.065   1.895 1.00 . A A .  11 VAL HB   1 1 
        5  6881 1 1  11 VAL HG11 H   -2.092   4.960   2.865 1.00 . A A .  11 VAL HG11 1 1 
        5  6882 1 1  11 VAL HG12 H   -3.519   4.013   2.394 1.00 . A A .  11 VAL HG12 1 1 
        5  6883 1 1  11 VAL HG13 H   -2.607   3.607   3.863 1.00 . A A .  11 VAL HG13 1 1 
        5  6884 1 1  11 VAL HG21 H   -0.998   4.644   0.756 1.00 . A A .  11 VAL HG21 1 1 
        5  6885 1 1  11 VAL HG22 H   -0.740   3.051   0.050 1.00 . A A .  11 VAL HG22 1 1 
        5  6886 1 1  11 VAL HG23 H   -2.375   3.718   0.123 1.00 . A A .  11 VAL HG23 1 1 
        5  6887 1 1  11 VAL N    N   -0.538   1.683   3.799 1.00 . A A .  11 VAL N    1 1 
        5  6888 1 1  11 VAL O    O    0.157   4.325   4.387 1.00 . A A .  11 VAL O    1 1 
        5  6889 1 1  12 GLU C    C    2.512   6.514   1.550 1.00 . A A .  12 GLU C    1 1 
        5  6890 1 1  12 GLU CA   C    1.905   5.812   2.763 1.00 . A A .  12 GLU CA   1 1 
        5  6891 1 1  12 GLU CB   C    3.017   5.592   3.813 1.00 . A A .  12 GLU CB   1 1 
        5  6892 1 1  12 GLU CD   C    5.258   4.516   4.390 1.00 . A A .  12 GLU CD   1 1 
        5  6893 1 1  12 GLU CG   C    4.163   4.688   3.327 1.00 . A A .  12 GLU CG   1 1 
        5  6894 1 1  12 GLU H    H    1.441   4.136   1.526 1.00 . A A .  12 GLU H    1 1 
        5  6895 1 1  12 GLU HA   H    1.165   6.512   3.157 1.00 . A A .  12 GLU HA   1 1 
        5  6896 1 1  12 GLU HB2  H    3.433   6.559   4.097 1.00 . A A .  12 GLU HB2  1 1 
        5  6897 1 1  12 GLU HB3  H    2.576   5.157   4.706 1.00 . A A .  12 GLU HB3  1 1 
        5  6898 1 1  12 GLU HG2  H    3.762   3.709   3.063 1.00 . A A .  12 GLU HG2  1 1 
        5  6899 1 1  12 GLU HG3  H    4.609   5.122   2.431 1.00 . A A .  12 GLU HG3  1 1 
        5  6900 1 1  12 GLU N    N    1.244   4.542   2.436 1.00 . A A .  12 GLU N    1 1 
        5  6901 1 1  12 GLU O    O    2.845   5.902   0.531 1.00 . A A .  12 GLU O    1 1 
        5  6902 1 1  12 GLU OE1  O    4.924   4.265   5.571 1.00 . A A .  12 GLU OE1  1 1 
        5  6903 1 1  12 GLU OE2  O    6.456   4.604   4.029 1.00 . A A .  12 GLU OE2  1 1 
        5  6904 1 1  13 TYR C    C    5.151   8.198   1.432 1.00 . A A .  13 TYR C    1 1 
        5  6905 1 1  13 TYR CA   C    3.733   8.555   0.968 1.00 . A A .  13 TYR CA   1 1 
        5  6906 1 1  13 TYR CB   C    3.463  10.052   1.123 1.00 . A A .  13 TYR CB   1 1 
        5  6907 1 1  13 TYR CD1  C    1.416  10.001  -0.386 1.00 . A A .  13 TYR CD1  1 1 
        5  6908 1 1  13 TYR CD2  C    1.408  11.455   1.569 1.00 . A A .  13 TYR CD2  1 1 
        5  6909 1 1  13 TYR CE1  C    0.180  10.536  -0.794 1.00 . A A .  13 TYR CE1  1 1 
        5  6910 1 1  13 TYR CE2  C    0.159  11.974   1.182 1.00 . A A .  13 TYR CE2  1 1 
        5  6911 1 1  13 TYR CG   C    2.058  10.502   0.763 1.00 . A A .  13 TYR CG   1 1 
        5  6912 1 1  13 TYR CZ   C   -0.443  11.536  -0.016 1.00 . A A .  13 TYR CZ   1 1 
        5  6913 1 1  13 TYR H    H    2.381   8.251   2.566 1.00 . A A .  13 TYR H    1 1 
        5  6914 1 1  13 TYR HA   H    3.641   8.290  -0.083 1.00 . A A .  13 TYR HA   1 1 
        5  6915 1 1  13 TYR HB2  H    3.671  10.335   2.156 1.00 . A A .  13 TYR HB2  1 1 
        5  6916 1 1  13 TYR HB3  H    4.165  10.595   0.488 1.00 . A A .  13 TYR HB3  1 1 
        5  6917 1 1  13 TYR HD1  H    1.867   9.197  -0.950 1.00 . A A .  13 TYR HD1  1 1 
        5  6918 1 1  13 TYR HD2  H    1.874  11.791   2.486 1.00 . A A .  13 TYR HD2  1 1 
        5  6919 1 1  13 TYR HE1  H   -0.298  10.178  -1.693 1.00 . A A .  13 TYR HE1  1 1 
        5  6920 1 1  13 TYR HE2  H   -0.332  12.724   1.785 1.00 . A A .  13 TYR HE2  1 1 
        5  6921 1 1  13 TYR HH   H   -1.869  11.810  -1.317 1.00 . A A .  13 TYR HH   1 1 
        5  6922 1 1  13 TYR N    N    2.743   7.811   1.731 1.00 . A A .  13 TYR N    1 1 
        5  6923 1 1  13 TYR O    O    5.462   8.226   2.625 1.00 . A A .  13 TYR O    1 1 
        5  6924 1 1  13 TYR OH   O   -1.627  12.073  -0.404 1.00 . A A .  13 TYR OH   1 1 
        5  6925 1 1  14 ALA C    C    8.286   8.740   1.000 1.00 . A A .  14 ALA C    1 1 
        5  6926 1 1  14 ALA CA   C    7.410   7.503   0.724 1.00 . A A .  14 ALA CA   1 1 
        5  6927 1 1  14 ALA CB   C    7.881   6.710  -0.501 1.00 . A A .  14 ALA CB   1 1 
        5  6928 1 1  14 ALA H    H    5.692   7.857  -0.477 1.00 . A A .  14 ALA H    1 1 
        5  6929 1 1  14 ALA HA   H    7.452   6.845   1.592 1.00 . A A .  14 ALA HA   1 1 
        5  6930 1 1  14 ALA HB1  H    7.761   7.310  -1.403 1.00 . A A .  14 ALA HB1  1 1 
        5  6931 1 1  14 ALA HB2  H    8.932   6.440  -0.390 1.00 . A A .  14 ALA HB2  1 1 
        5  6932 1 1  14 ALA HB3  H    7.285   5.805  -0.610 1.00 . A A .  14 ALA HB3  1 1 
        5  6933 1 1  14 ALA N    N    6.024   7.876   0.481 1.00 . A A .  14 ALA N    1 1 
        5  6934 1 1  14 ALA O    O    8.515   9.554   0.104 1.00 . A A .  14 ALA O    1 1 
        5  6935 1 1  15 LYS C    C   11.208   9.668   2.188 1.00 . A A .  15 LYS C    1 1 
        5  6936 1 1  15 LYS CA   C    9.756   9.952   2.607 1.00 . A A .  15 LYS CA   1 1 
        5  6937 1 1  15 LYS CB   C    9.615  10.218   4.122 1.00 . A A .  15 LYS CB   1 1 
        5  6938 1 1  15 LYS CD   C   10.335  12.711   4.141 1.00 . A A .  15 LYS CD   1 1 
        5  6939 1 1  15 LYS CE   C   11.636  13.528   4.151 1.00 . A A .  15 LYS CE   1 1 
        5  6940 1 1  15 LYS CG   C   10.569  11.288   4.688 1.00 . A A .  15 LYS CG   1 1 
        5  6941 1 1  15 LYS H    H    8.526   8.214   2.937 1.00 . A A .  15 LYS H    1 1 
        5  6942 1 1  15 LYS HA   H    9.462  10.856   2.072 1.00 . A A .  15 LYS HA   1 1 
        5  6943 1 1  15 LYS HB2  H    8.589  10.519   4.335 1.00 . A A .  15 LYS HB2  1 1 
        5  6944 1 1  15 LYS HB3  H    9.807   9.287   4.659 1.00 . A A .  15 LYS HB3  1 1 
        5  6945 1 1  15 LYS HD2  H    9.934  12.691   3.129 1.00 . A A .  15 LYS HD2  1 1 
        5  6946 1 1  15 LYS HD3  H    9.599  13.206   4.777 1.00 . A A .  15 LYS HD3  1 1 
        5  6947 1 1  15 LYS HE2  H   11.389  14.592   4.171 1.00 . A A .  15 LYS HE2  1 1 
        5  6948 1 1  15 LYS HE3  H   12.188  13.296   5.066 1.00 . A A .  15 LYS HE3  1 1 
        5  6949 1 1  15 LYS HG2  H   10.444  11.320   5.772 1.00 . A A .  15 LYS HG2  1 1 
        5  6950 1 1  15 LYS HG3  H   11.597  10.978   4.507 1.00 . A A .  15 LYS HG3  1 1 
        5  6951 1 1  15 LYS HZ1  H   12.528  12.240   2.771 1.00 . A A .  15 LYS HZ1  1 1 
        5  6952 1 1  15 LYS HZ2  H   12.092  13.671   2.128 1.00 . A A .  15 LYS HZ2  1 1 
        5  6953 1 1  15 LYS HZ3  H   13.428  13.577   3.069 1.00 . A A .  15 LYS HZ3  1 1 
        5  6954 1 1  15 LYS N    N    8.819   8.871   2.224 1.00 . A A .  15 LYS N    1 1 
        5  6955 1 1  15 LYS NZ   N   12.471  13.236   2.956 1.00 . A A .  15 LYS NZ   1 1 
        5  6956 1 1  15 LYS O    O   11.972  10.606   1.958 1.00 . A A .  15 LYS O    1 1 
        5  6957 1 1  16 SER C    C   12.822   6.539   1.004 1.00 . A A .  16 SER C    1 1 
        5  6958 1 1  16 SER CA   C   12.913   7.932   1.643 1.00 . A A .  16 SER CA   1 1 
        5  6959 1 1  16 SER CB   C   13.875   7.925   2.836 1.00 . A A .  16 SER CB   1 1 
        5  6960 1 1  16 SER H    H   10.892   7.689   2.264 1.00 . A A .  16 SER H    1 1 
        5  6961 1 1  16 SER HA   H   13.310   8.626   0.900 1.00 . A A .  16 SER HA   1 1 
        5  6962 1 1  16 SER HB2  H   13.874   8.910   3.303 1.00 . A A .  16 SER HB2  1 1 
        5  6963 1 1  16 SER HB3  H   13.549   7.186   3.570 1.00 . A A .  16 SER HB3  1 1 
        5  6964 1 1  16 SER HG   H   15.802   7.748   3.144 1.00 . A A .  16 SER HG   1 1 
        5  6965 1 1  16 SER N    N   11.586   8.396   2.075 1.00 . A A .  16 SER N    1 1 
        5  6966 1 1  16 SER O    O   11.910   5.761   1.309 1.00 . A A .  16 SER O    1 1 
        5  6967 1 1  16 SER OG   O   15.188   7.625   2.395 1.00 . A A .  16 SER OG   1 1 
        5  6968 1 1  17 GLY C    C   14.281   3.721   0.075 1.00 . A A .  17 GLY C    1 1 
        5  6969 1 1  17 GLY CA   C   13.798   4.972  -0.676 1.00 . A A .  17 GLY CA   1 1 
        5  6970 1 1  17 GLY H    H   14.525   6.863  -0.004 1.00 . A A .  17 GLY H    1 1 
        5  6971 1 1  17 GLY HA2  H   12.789   4.772  -1.031 1.00 . A A .  17 GLY HA2  1 1 
        5  6972 1 1  17 GLY HA3  H   14.435   5.120  -1.548 1.00 . A A .  17 GLY HA3  1 1 
        5  6973 1 1  17 GLY N    N   13.767   6.207   0.122 1.00 . A A .  17 GLY N    1 1 
        5  6974 1 1  17 GLY O    O   15.022   2.913  -0.488 1.00 . A A .  17 GLY O    1 1 
        5  6975 1 1  18 ARG C    C   13.574   1.172   2.051 1.00 . A A .  18 ARG C    1 1 
        5  6976 1 1  18 ARG CA   C   14.350   2.483   2.249 1.00 . A A .  18 ARG CA   1 1 
        5  6977 1 1  18 ARG CB   C   14.262   2.941   3.718 1.00 . A A .  18 ARG CB   1 1 
        5  6978 1 1  18 ARG CD   C   16.579   4.108   3.711 1.00 . A A .  18 ARG CD   1 1 
        5  6979 1 1  18 ARG CG   C   15.086   4.199   4.062 1.00 . A A .  18 ARG CG   1 1 
        5  6980 1 1  18 ARG CZ   C   18.505   2.608   4.263 1.00 . A A .  18 ARG CZ   1 1 
        5  6981 1 1  18 ARG H    H   13.306   4.294   1.736 1.00 . A A .  18 ARG H    1 1 
        5  6982 1 1  18 ARG HA   H   15.389   2.236   2.026 1.00 . A A .  18 ARG HA   1 1 
        5  6983 1 1  18 ARG HB2  H   13.217   3.141   3.964 1.00 . A A .  18 ARG HB2  1 1 
        5  6984 1 1  18 ARG HB3  H   14.595   2.125   4.360 1.00 . A A .  18 ARG HB3  1 1 
        5  6985 1 1  18 ARG HD2  H   16.683   3.967   2.634 1.00 . A A .  18 ARG HD2  1 1 
        5  6986 1 1  18 ARG HD3  H   17.049   5.057   3.974 1.00 . A A .  18 ARG HD3  1 1 
        5  6987 1 1  18 ARG HE   H   16.731   2.539   5.150 1.00 . A A .  18 ARG HE   1 1 
        5  6988 1 1  18 ARG HG2  H   14.663   5.051   3.534 1.00 . A A .  18 ARG HG2  1 1 
        5  6989 1 1  18 ARG HG3  H   14.990   4.396   5.131 1.00 . A A .  18 ARG HG3  1 1 
        5  6990 1 1  18 ARG HH11 H   18.965   3.928   2.836 1.00 . A A .  18 ARG HH11 1 1 
        5  6991 1 1  18 ARG HH12 H   20.247   2.834   3.280 1.00 . A A .  18 ARG HH12 1 1 
        5  6992 1 1  18 ARG HH21 H   18.403   1.169   5.660 1.00 . A A .  18 ARG HH21 1 1 
        5  6993 1 1  18 ARG HH22 H   19.931   1.319   4.842 1.00 . A A .  18 ARG HH22 1 1 
        5  6994 1 1  18 ARG N    N   13.914   3.579   1.357 1.00 . A A .  18 ARG N    1 1 
        5  6995 1 1  18 ARG NE   N   17.259   3.015   4.435 1.00 . A A .  18 ARG NE   1 1 
        5  6996 1 1  18 ARG NH1  N   19.302   3.160   3.391 1.00 . A A .  18 ARG NH1  1 1 
        5  6997 1 1  18 ARG NH2  N   18.982   1.626   4.974 1.00 . A A .  18 ARG NH2  1 1 
        5  6998 1 1  18 ARG O    O   14.080   0.108   2.411 1.00 . A A .  18 ARG O    1 1 
        5  6999 1 1  19 ALA C    C   11.798  -0.462  -0.240 1.00 . A A .  19 ALA C    1 1 
        5  7000 1 1  19 ALA CA   C   11.526   0.083   1.176 1.00 . A A .  19 ALA CA   1 1 
        5  7001 1 1  19 ALA CB   C   10.058   0.478   1.363 1.00 . A A .  19 ALA CB   1 1 
        5  7002 1 1  19 ALA H    H   12.040   2.145   1.198 1.00 . A A .  19 ALA H    1 1 
        5  7003 1 1  19 ALA HA   H   11.743  -0.715   1.889 1.00 . A A .  19 ALA HA   1 1 
        5  7004 1 1  19 ALA HB1  H    9.787   1.264   0.658 1.00 . A A .  19 ALA HB1  1 1 
        5  7005 1 1  19 ALA HB2  H    9.427  -0.388   1.180 1.00 . A A .  19 ALA HB2  1 1 
        5  7006 1 1  19 ALA HB3  H    9.888   0.827   2.383 1.00 . A A .  19 ALA HB3  1 1 
        5  7007 1 1  19 ALA N    N   12.367   1.239   1.487 1.00 . A A .  19 ALA N    1 1 
        5  7008 1 1  19 ALA O    O   12.036   0.306  -1.176 1.00 . A A .  19 ALA O    1 1 
        5  7009 1 1  20 SER C    C   10.739  -3.408  -2.020 1.00 . A A .  20 SER C    1 1 
        5  7010 1 1  20 SER CA   C   11.909  -2.478  -1.692 1.00 . A A .  20 SER CA   1 1 
        5  7011 1 1  20 SER CB   C   13.237  -3.247  -1.703 1.00 . A A .  20 SER CB   1 1 
        5  7012 1 1  20 SER H    H   11.436  -2.354   0.381 1.00 . A A .  20 SER H    1 1 
        5  7013 1 1  20 SER HA   H   11.951  -1.739  -2.486 1.00 . A A .  20 SER HA   1 1 
        5  7014 1 1  20 SER HB2  H   13.188  -4.057  -0.974 1.00 . A A .  20 SER HB2  1 1 
        5  7015 1 1  20 SER HB3  H   13.392  -3.680  -2.693 1.00 . A A .  20 SER HB3  1 1 
        5  7016 1 1  20 SER HG   H   14.345  -1.651  -2.012 1.00 . A A .  20 SER HG   1 1 
        5  7017 1 1  20 SER N    N   11.697  -1.783  -0.411 1.00 . A A .  20 SER N    1 1 
        5  7018 1 1  20 SER O    O   10.081  -3.927  -1.115 1.00 . A A .  20 SER O    1 1 
        5  7019 1 1  20 SER OG   O   14.334  -2.402  -1.385 1.00 . A A .  20 SER OG   1 1 
        5  7020 1 1  21 CYS C    C    9.269  -5.713  -3.825 1.00 . A A .  21 CYS C    1 1 
        5  7021 1 1  21 CYS CA   C    9.218  -4.179  -3.799 1.00 . A A .  21 CYS CA   1 1 
        5  7022 1 1  21 CYS CB   C    8.947  -3.567  -5.169 1.00 . A A .  21 CYS CB   1 1 
        5  7023 1 1  21 CYS H    H   11.125  -3.271  -4.014 1.00 . A A .  21 CYS H    1 1 
        5  7024 1 1  21 CYS HA   H    8.410  -3.873  -3.136 1.00 . A A .  21 CYS HA   1 1 
        5  7025 1 1  21 CYS HB2  H    9.015  -2.479  -5.090 1.00 . A A .  21 CYS HB2  1 1 
        5  7026 1 1  21 CYS HB3  H    9.715  -3.909  -5.868 1.00 . A A .  21 CYS HB3  1 1 
        5  7027 1 1  21 CYS N    N   10.462  -3.594  -3.312 1.00 . A A .  21 CYS N    1 1 
        5  7028 1 1  21 CYS O    O   10.147  -6.319  -4.447 1.00 . A A .  21 CYS O    1 1 
        5  7029 1 1  21 CYS SG   S    7.292  -4.020  -5.794 1.00 . A A .  21 CYS SG   1 1 
        5  7030 1 1  22 LYS C    C    7.615  -8.539  -4.207 1.00 . A A .  22 LYS C    1 1 
        5  7031 1 1  22 LYS CA   C    8.230  -7.817  -3.000 1.00 . A A .  22 LYS CA   1 1 
        5  7032 1 1  22 LYS CB   C    7.462  -8.145  -1.706 1.00 . A A .  22 LYS CB   1 1 
        5  7033 1 1  22 LYS CD   C    9.399  -8.080  -0.003 1.00 . A A .  22 LYS CD   1 1 
        5  7034 1 1  22 LYS CE   C    9.270  -9.533   0.477 1.00 . A A .  22 LYS CE   1 1 
        5  7035 1 1  22 LYS CG   C    8.050  -7.499  -0.443 1.00 . A A .  22 LYS CG   1 1 
        5  7036 1 1  22 LYS H    H    7.657  -5.775  -2.626 1.00 . A A .  22 LYS H    1 1 
        5  7037 1 1  22 LYS HA   H    9.244  -8.209  -2.916 1.00 . A A .  22 LYS HA   1 1 
        5  7038 1 1  22 LYS HB2  H    6.450  -7.773  -1.810 1.00 . A A .  22 LYS HB2  1 1 
        5  7039 1 1  22 LYS HB3  H    7.402  -9.225  -1.571 1.00 . A A .  22 LYS HB3  1 1 
        5  7040 1 1  22 LYS HD2  H   10.097  -8.019  -0.840 1.00 . A A .  22 LYS HD2  1 1 
        5  7041 1 1  22 LYS HD3  H    9.781  -7.467   0.813 1.00 . A A .  22 LYS HD3  1 1 
        5  7042 1 1  22 LYS HE2  H    8.526  -9.573   1.279 1.00 . A A .  22 LYS HE2  1 1 
        5  7043 1 1  22 LYS HE3  H    8.901 -10.150  -0.349 1.00 . A A .  22 LYS HE3  1 1 
        5  7044 1 1  22 LYS HG2  H    8.182  -6.437  -0.626 1.00 . A A .  22 LYS HG2  1 1 
        5  7045 1 1  22 LYS HG3  H    7.326  -7.594   0.363 1.00 . A A .  22 LYS HG3  1 1 
        5  7046 1 1  22 LYS HZ1  H   10.475 -11.026   1.272 1.00 . A A .  22 LYS HZ1  1 1 
        5  7047 1 1  22 LYS HZ2  H   11.269 -10.053   0.231 1.00 . A A .  22 LYS HZ2  1 1 
        5  7048 1 1  22 LYS HZ3  H   10.922  -9.528   1.741 1.00 . A A .  22 LYS HZ3  1 1 
        5  7049 1 1  22 LYS N    N    8.304  -6.352  -3.157 1.00 . A A .  22 LYS N    1 1 
        5  7050 1 1  22 LYS NZ   N   10.569 -10.067   0.961 1.00 . A A .  22 LYS NZ   1 1 
        5  7051 1 1  22 LYS O    O    7.648  -9.770  -4.255 1.00 . A A .  22 LYS O    1 1 
        5  7052 1 1  23 LYS C    C    7.209  -8.228  -7.639 1.00 . A A .  23 LYS C    1 1 
        5  7053 1 1  23 LYS CA   C    6.368  -8.325  -6.363 1.00 . A A .  23 LYS CA   1 1 
        5  7054 1 1  23 LYS CB   C    4.988  -7.657  -6.502 1.00 . A A .  23 LYS CB   1 1 
        5  7055 1 1  23 LYS CD   C    3.882  -9.621  -7.759 1.00 . A A .  23 LYS CD   1 1 
        5  7056 1 1  23 LYS CE   C    2.989  -9.962  -8.958 1.00 . A A .  23 LYS CE   1 1 
        5  7057 1 1  23 LYS CG   C    4.155  -8.107  -7.717 1.00 . A A .  23 LYS CG   1 1 
        5  7058 1 1  23 LYS H    H    7.110  -6.789  -5.033 1.00 . A A .  23 LYS H    1 1 
        5  7059 1 1  23 LYS HA   H    6.195  -9.391  -6.206 1.00 . A A .  23 LYS HA   1 1 
        5  7060 1 1  23 LYS HB2  H    4.412  -7.864  -5.601 1.00 . A A .  23 LYS HB2  1 1 
        5  7061 1 1  23 LYS HB3  H    5.132  -6.580  -6.568 1.00 . A A .  23 LYS HB3  1 1 
        5  7062 1 1  23 LYS HD2  H    4.822 -10.163  -7.857 1.00 . A A .  23 LYS HD2  1 1 
        5  7063 1 1  23 LYS HD3  H    3.390  -9.930  -6.836 1.00 . A A .  23 LYS HD3  1 1 
        5  7064 1 1  23 LYS HE2  H    2.035  -9.440  -8.842 1.00 . A A .  23 LYS HE2  1 1 
        5  7065 1 1  23 LYS HE3  H    3.466  -9.587  -9.869 1.00 . A A .  23 LYS HE3  1 1 
        5  7066 1 1  23 LYS HG2  H    3.202  -7.579  -7.683 1.00 . A A .  23 LYS HG2  1 1 
        5  7067 1 1  23 LYS HG3  H    4.669  -7.809  -8.631 1.00 . A A .  23 LYS HG3  1 1 
        5  7068 1 1  23 LYS HZ1  H    2.323 -11.806  -8.249 1.00 . A A .  23 LYS HZ1  1 1 
        5  7069 1 1  23 LYS HZ2  H    2.143 -11.631  -9.860 1.00 . A A .  23 LYS HZ2  1 1 
        5  7070 1 1  23 LYS HZ3  H    3.621 -11.925  -9.235 1.00 . A A .  23 LYS HZ3  1 1 
        5  7071 1 1  23 LYS N    N    7.059  -7.792  -5.170 1.00 . A A .  23 LYS N    1 1 
        5  7072 1 1  23 LYS NZ   N    2.755 -11.426  -9.080 1.00 . A A .  23 LYS NZ   1 1 
        5  7073 1 1  23 LYS O    O    7.366  -9.242  -8.321 1.00 . A A .  23 LYS O    1 1 
        5  7074 1 1  24 CYS C    C   10.113  -6.851  -8.887 1.00 . A A .  24 CYS C    1 1 
        5  7075 1 1  24 CYS CA   C    8.586  -6.831  -9.152 1.00 . A A .  24 CYS CA   1 1 
        5  7076 1 1  24 CYS CB   C    8.069  -5.614  -9.943 1.00 . A A .  24 CYS CB   1 1 
        5  7077 1 1  24 CYS H    H    7.586  -6.260  -7.344 1.00 . A A .  24 CYS H    1 1 
        5  7078 1 1  24 CYS HA   H    8.415  -7.680  -9.817 1.00 . A A .  24 CYS HA   1 1 
        5  7079 1 1  24 CYS HB2  H    8.496  -5.674 -10.946 1.00 . A A .  24 CYS HB2  1 1 
        5  7080 1 1  24 CYS HB3  H    6.983  -5.682 -10.045 1.00 . A A .  24 CYS HB3  1 1 
        5  7081 1 1  24 CYS N    N    7.759  -7.048  -7.954 1.00 . A A .  24 CYS N    1 1 
        5  7082 1 1  24 CYS O    O   10.911  -6.797  -9.829 1.00 . A A .  24 CYS O    1 1 
        5  7083 1 1  24 CYS SG   S    8.551  -4.005  -9.211 1.00 . A A .  24 CYS SG   1 1 
        5  7084 1 1  25 SER C    C   12.786  -5.856  -7.403 1.00 . A A .  25 SER C    1 1 
        5  7085 1 1  25 SER CA   C   11.917  -7.105  -7.148 1.00 . A A .  25 SER CA   1 1 
        5  7086 1 1  25 SER CB   C   12.593  -8.404  -7.621 1.00 . A A .  25 SER CB   1 1 
        5  7087 1 1  25 SER H    H    9.805  -7.067  -6.913 1.00 . A A .  25 SER H    1 1 
        5  7088 1 1  25 SER HA   H   11.862  -7.184  -6.063 1.00 . A A .  25 SER HA   1 1 
        5  7089 1 1  25 SER HB2  H   12.708  -8.383  -8.706 1.00 . A A .  25 SER HB2  1 1 
        5  7090 1 1  25 SER HB3  H   13.584  -8.478  -7.170 1.00 . A A .  25 SER HB3  1 1 
        5  7091 1 1  25 SER HG   H   12.299 -10.343  -7.552 1.00 . A A .  25 SER HG   1 1 
        5  7092 1 1  25 SER N    N   10.521  -7.011  -7.619 1.00 . A A .  25 SER N    1 1 
        5  7093 1 1  25 SER O    O   14.015  -5.922  -7.322 1.00 . A A .  25 SER O    1 1 
        5  7094 1 1  25 SER OG   O   11.831  -9.544  -7.241 1.00 . A A .  25 SER OG   1 1 
        5  7095 1 1  26 GLU C    C   12.812  -2.694  -6.379 1.00 . A A .  26 GLU C    1 1 
        5  7096 1 1  26 GLU CA   C   12.808  -3.390  -7.762 1.00 . A A .  26 GLU CA   1 1 
        5  7097 1 1  26 GLU CB   C   12.100  -2.537  -8.837 1.00 . A A .  26 GLU CB   1 1 
        5  7098 1 1  26 GLU CD   C   13.386  -3.212 -10.970 1.00 . A A .  26 GLU CD   1 1 
        5  7099 1 1  26 GLU CG   C   12.023  -3.151 -10.248 1.00 . A A .  26 GLU CG   1 1 
        5  7100 1 1  26 GLU H    H   11.151  -4.727  -7.699 1.00 . A A .  26 GLU H    1 1 
        5  7101 1 1  26 GLU HA   H   13.850  -3.509  -8.062 1.00 . A A .  26 GLU HA   1 1 
        5  7102 1 1  26 GLU HB2  H   11.083  -2.350  -8.496 1.00 . A A .  26 GLU HB2  1 1 
        5  7103 1 1  26 GLU HB3  H   12.601  -1.572  -8.921 1.00 . A A .  26 GLU HB3  1 1 
        5  7104 1 1  26 GLU HG2  H   11.585  -4.149 -10.202 1.00 . A A .  26 GLU HG2  1 1 
        5  7105 1 1  26 GLU HG3  H   11.335  -2.536 -10.835 1.00 . A A .  26 GLU HG3  1 1 
        5  7106 1 1  26 GLU N    N   12.160  -4.707  -7.674 1.00 . A A .  26 GLU N    1 1 
        5  7107 1 1  26 GLU O    O   12.455  -3.299  -5.364 1.00 . A A .  26 GLU O    1 1 
        5  7108 1 1  26 GLU OE1  O   14.243  -4.054 -10.612 1.00 . A A .  26 GLU OE1  1 1 
        5  7109 1 1  26 GLU OE2  O   13.600  -2.428 -11.927 1.00 . A A .  26 GLU OE2  1 1 
        5  7110 1 1  27 SER C    C   12.342   0.650  -5.193 1.00 . A A .  27 SER C    1 1 
        5  7111 1 1  27 SER CA   C   13.183  -0.618  -5.073 1.00 . A A .  27 SER CA   1 1 
        5  7112 1 1  27 SER CB   C   14.594  -0.291  -4.613 1.00 . A A .  27 SER CB   1 1 
        5  7113 1 1  27 SER H    H   13.454  -0.945  -7.166 1.00 . A A .  27 SER H    1 1 
        5  7114 1 1  27 SER HA   H   12.733  -1.216  -4.288 1.00 . A A .  27 SER HA   1 1 
        5  7115 1 1  27 SER HB2  H   15.235  -1.148  -4.816 1.00 . A A .  27 SER HB2  1 1 
        5  7116 1 1  27 SER HB3  H   14.939   0.590  -5.152 1.00 . A A .  27 SER HB3  1 1 
        5  7117 1 1  27 SER HG   H   15.484   0.226  -2.948 1.00 . A A .  27 SER HG   1 1 
        5  7118 1 1  27 SER N    N   13.198  -1.415  -6.311 1.00 . A A .  27 SER N    1 1 
        5  7119 1 1  27 SER O    O   12.263   1.264  -6.261 1.00 . A A .  27 SER O    1 1 
        5  7120 1 1  27 SER OG   O   14.586  -0.041  -3.221 1.00 . A A .  27 SER OG   1 1 
        5  7121 1 1  28 ILE C    C   10.977   3.388  -3.920 1.00 . A A .  28 ILE C    1 1 
        5  7122 1 1  28 ILE CA   C   10.520   1.929  -4.134 1.00 . A A .  28 ILE CA   1 1 
        5  7123 1 1  28 ILE CB   C    9.449   1.478  -3.111 1.00 . A A .  28 ILE CB   1 1 
        5  7124 1 1  28 ILE CD1  C    8.195  -0.583  -2.173 1.00 . A A .  28 ILE CD1  1 1 
        5  7125 1 1  28 ILE CG1  C    9.028   0.001  -3.322 1.00 . A A .  28 ILE CG1  1 1 
        5  7126 1 1  28 ILE CG2  C    8.206   2.383  -3.197 1.00 . A A .  28 ILE CG2  1 1 
        5  7127 1 1  28 ILE H    H   11.935   0.600  -3.218 1.00 . A A .  28 ILE H    1 1 
        5  7128 1 1  28 ILE HA   H   10.080   1.830  -5.121 1.00 . A A .  28 ILE HA   1 1 
        5  7129 1 1  28 ILE HB   H    9.871   1.576  -2.109 1.00 . A A .  28 ILE HB   1 1 
        5  7130 1 1  28 ILE HD11 H    8.043  -1.647  -2.345 1.00 . A A .  28 ILE HD11 1 1 
        5  7131 1 1  28 ILE HD12 H    8.724  -0.453  -1.230 1.00 . A A .  28 ILE HD12 1 1 
        5  7132 1 1  28 ILE HD13 H    7.221  -0.100  -2.114 1.00 . A A .  28 ILE HD13 1 1 
        5  7133 1 1  28 ILE HG12 H    8.465  -0.089  -4.253 1.00 . A A .  28 ILE HG12 1 1 
        5  7134 1 1  28 ILE HG13 H    9.911  -0.629  -3.407 1.00 . A A .  28 ILE HG13 1 1 
        5  7135 1 1  28 ILE HG21 H    7.748   2.314  -4.185 1.00 . A A .  28 ILE HG21 1 1 
        5  7136 1 1  28 ILE HG22 H    7.478   2.068  -2.454 1.00 . A A .  28 ILE HG22 1 1 
        5  7137 1 1  28 ILE HG23 H    8.461   3.424  -2.995 1.00 . A A .  28 ILE HG23 1 1 
        5  7138 1 1  28 ILE N    N   11.676   1.026  -4.104 1.00 . A A .  28 ILE N    1 1 
        5  7139 1 1  28 ILE O    O   11.583   3.677  -2.884 1.00 . A A .  28 ILE O    1 1 
        5  7140 1 1  29 PRO C    C   10.445   6.562  -3.765 1.00 . A A .  29 PRO C    1 1 
        5  7141 1 1  29 PRO CA   C   11.203   5.694  -4.782 1.00 . A A .  29 PRO CA   1 1 
        5  7142 1 1  29 PRO CB   C   11.070   6.244  -6.207 1.00 . A A .  29 PRO CB   1 1 
        5  7143 1 1  29 PRO CD   C   10.000   4.114  -6.116 1.00 . A A .  29 PRO CD   1 1 
        5  7144 1 1  29 PRO CG   C    9.855   5.496  -6.752 1.00 . A A .  29 PRO CG   1 1 
        5  7145 1 1  29 PRO HA   H   12.256   5.684  -4.503 1.00 . A A .  29 PRO HA   1 1 
        5  7146 1 1  29 PRO HB2  H   10.923   7.325  -6.226 1.00 . A A .  29 PRO HB2  1 1 
        5  7147 1 1  29 PRO HB3  H   11.949   5.971  -6.792 1.00 . A A .  29 PRO HB3  1 1 
        5  7148 1 1  29 PRO HD2  H    9.014   3.676  -5.951 1.00 . A A .  29 PRO HD2  1 1 
        5  7149 1 1  29 PRO HD3  H   10.598   3.475  -6.768 1.00 . A A .  29 PRO HD3  1 1 
        5  7150 1 1  29 PRO HG2  H    8.938   5.970  -6.400 1.00 . A A .  29 PRO HG2  1 1 
        5  7151 1 1  29 PRO HG3  H    9.865   5.443  -7.842 1.00 . A A .  29 PRO HG3  1 1 
        5  7152 1 1  29 PRO N    N   10.709   4.318  -4.858 1.00 . A A .  29 PRO N    1 1 
        5  7153 1 1  29 PRO O    O    9.263   6.338  -3.490 1.00 . A A .  29 PRO O    1 1 
        5  7154 1 1  30 LYS C    C    9.715   9.673  -3.234 1.00 . A A .  30 LYS C    1 1 
        5  7155 1 1  30 LYS CA   C   10.520   8.657  -2.411 1.00 . A A .  30 LYS CA   1 1 
        5  7156 1 1  30 LYS CB   C   11.591   9.288  -1.512 1.00 . A A .  30 LYS CB   1 1 
        5  7157 1 1  30 LYS CD   C   13.665  10.703  -1.360 1.00 . A A .  30 LYS CD   1 1 
        5  7158 1 1  30 LYS CE   C   14.495  11.683  -2.180 1.00 . A A .  30 LYS CE   1 1 
        5  7159 1 1  30 LYS CG   C   12.481  10.293  -2.240 1.00 . A A .  30 LYS CG   1 1 
        5  7160 1 1  30 LYS H    H   12.101   7.683  -3.472 1.00 . A A .  30 LYS H    1 1 
        5  7161 1 1  30 LYS HA   H    9.819   8.193  -1.735 1.00 . A A .  30 LYS HA   1 1 
        5  7162 1 1  30 LYS HB2  H   11.103   9.802  -0.684 1.00 . A A .  30 LYS HB2  1 1 
        5  7163 1 1  30 LYS HB3  H   12.207   8.488  -1.104 1.00 . A A .  30 LYS HB3  1 1 
        5  7164 1 1  30 LYS HD2  H   13.309  11.185  -0.447 1.00 . A A .  30 LYS HD2  1 1 
        5  7165 1 1  30 LYS HD3  H   14.260   9.826  -1.103 1.00 . A A .  30 LYS HD3  1 1 
        5  7166 1 1  30 LYS HE2  H   14.697  11.219  -3.150 1.00 . A A .  30 LYS HE2  1 1 
        5  7167 1 1  30 LYS HE3  H   13.882  12.571  -2.351 1.00 . A A .  30 LYS HE3  1 1 
        5  7168 1 1  30 LYS HG2  H   12.853   9.851  -3.163 1.00 . A A .  30 LYS HG2  1 1 
        5  7169 1 1  30 LYS HG3  H   11.895  11.179  -2.487 1.00 . A A .  30 LYS HG3  1 1 
        5  7170 1 1  30 LYS HZ1  H   16.383  11.242  -1.404 1.00 . A A .  30 LYS HZ1  1 1 
        5  7171 1 1  30 LYS HZ2  H   16.259  12.763  -2.009 1.00 . A A .  30 LYS HZ2  1 1 
        5  7172 1 1  30 LYS HZ3  H   15.602  12.399  -0.556 1.00 . A A .  30 LYS HZ3  1 1 
        5  7173 1 1  30 LYS N    N   11.117   7.595  -3.239 1.00 . A A .  30 LYS N    1 1 
        5  7174 1 1  30 LYS NZ   N   15.765  12.043  -1.501 1.00 . A A .  30 LYS NZ   1 1 
        5  7175 1 1  30 LYS O    O    9.799   9.699  -4.462 1.00 . A A .  30 LYS O    1 1 
        5  7176 1 1  31 ASP C    C    6.929  10.662  -4.060 1.00 . A A .  31 ASP C    1 1 
        5  7177 1 1  31 ASP CA   C    7.922  11.407  -3.136 1.00 . A A .  31 ASP CA   1 1 
        5  7178 1 1  31 ASP CB   C    8.609  12.639  -3.758 1.00 . A A .  31 ASP CB   1 1 
        5  7179 1 1  31 ASP CG   C    7.618  13.757  -4.135 1.00 . A A .  31 ASP CG   1 1 
        5  7180 1 1  31 ASP H    H    8.919  10.393  -1.538 1.00 . A A .  31 ASP H    1 1 
        5  7181 1 1  31 ASP HA   H    7.322  11.772  -2.301 1.00 . A A .  31 ASP HA   1 1 
        5  7182 1 1  31 ASP HB2  H    9.321  13.043  -3.035 1.00 . A A .  31 ASP HB2  1 1 
        5  7183 1 1  31 ASP HB3  H    9.171  12.330  -4.640 1.00 . A A .  31 ASP HB3  1 1 
        5  7184 1 1  31 ASP N    N    8.924  10.500  -2.547 1.00 . A A .  31 ASP N    1 1 
        5  7185 1 1  31 ASP O    O    6.578  11.115  -5.153 1.00 . A A .  31 ASP O    1 1 
        5  7186 1 1  31 ASP OD1  O    6.699  14.059  -3.334 1.00 . A A .  31 ASP OD1  1 1 
        5  7187 1 1  31 ASP OD2  O    7.786  14.380  -5.212 1.00 . A A .  31 ASP OD2  1 1 
        5  7188 1 1  32 SER C    C    4.775   7.728  -3.370 1.00 . A A .  32 SER C    1 1 
        5  7189 1 1  32 SER CA   C    5.673   8.510  -4.343 1.00 . A A .  32 SER CA   1 1 
        5  7190 1 1  32 SER CB   C    6.572   7.556  -5.138 1.00 . A A .  32 SER CB   1 1 
        5  7191 1 1  32 SER H    H    6.821   9.186  -2.697 1.00 . A A .  32 SER H    1 1 
        5  7192 1 1  32 SER HA   H    5.030   9.051  -5.038 1.00 . A A .  32 SER HA   1 1 
        5  7193 1 1  32 SER HB2  H    7.427   8.101  -5.543 1.00 . A A .  32 SER HB2  1 1 
        5  7194 1 1  32 SER HB3  H    6.939   6.767  -4.482 1.00 . A A .  32 SER HB3  1 1 
        5  7195 1 1  32 SER HG   H    5.742   7.665  -6.905 1.00 . A A .  32 SER HG   1 1 
        5  7196 1 1  32 SER N    N    6.519   9.468  -3.618 1.00 . A A .  32 SER N    1 1 
        5  7197 1 1  32 SER O    O    4.945   7.830  -2.153 1.00 . A A .  32 SER O    1 1 
        5  7198 1 1  32 SER OG   O    5.846   6.985  -6.211 1.00 . A A .  32 SER OG   1 1 
        5  7199 1 1  33 LEU C    C    3.153   4.732  -3.012 1.00 . A A .  33 LEU C    1 1 
        5  7200 1 1  33 LEU CA   C    2.809   6.229  -3.093 1.00 . A A .  33 LEU CA   1 1 
        5  7201 1 1  33 LEU CB   C    1.430   6.496  -3.731 1.00 . A A .  33 LEU CB   1 1 
        5  7202 1 1  33 LEU CD1  C   -0.006   6.578  -1.621 1.00 . A A .  33 LEU CD1  1 1 
        5  7203 1 1  33 LEU CD2  C   -1.044   6.079  -3.790 1.00 . A A .  33 LEU CD2  1 1 
        5  7204 1 1  33 LEU CG   C    0.232   5.901  -2.969 1.00 . A A .  33 LEU CG   1 1 
        5  7205 1 1  33 LEU H    H    3.807   6.819  -4.882 1.00 . A A .  33 LEU H    1 1 
        5  7206 1 1  33 LEU HA   H    2.799   6.628  -2.078 1.00 . A A .  33 LEU HA   1 1 
        5  7207 1 1  33 LEU HB2  H    1.284   7.573  -3.817 1.00 . A A .  33 LEU HB2  1 1 
        5  7208 1 1  33 LEU HB3  H    1.438   6.079  -4.740 1.00 . A A .  33 LEU HB3  1 1 
        5  7209 1 1  33 LEU HD11 H    0.835   6.405  -0.958 1.00 . A A .  33 LEU HD11 1 1 
        5  7210 1 1  33 LEU HD12 H   -0.144   7.651  -1.758 1.00 . A A .  33 LEU HD12 1 1 
        5  7211 1 1  33 LEU HD13 H   -0.901   6.164  -1.158 1.00 . A A .  33 LEU HD13 1 1 
        5  7212 1 1  33 LEU HD21 H   -1.877   5.596  -3.279 1.00 . A A .  33 LEU HD21 1 1 
        5  7213 1 1  33 LEU HD22 H   -1.260   7.141  -3.915 1.00 . A A .  33 LEU HD22 1 1 
        5  7214 1 1  33 LEU HD23 H   -0.918   5.618  -4.769 1.00 . A A .  33 LEU HD23 1 1 
        5  7215 1 1  33 LEU HG   H    0.401   4.839  -2.809 1.00 . A A .  33 LEU HG   1 1 
        5  7216 1 1  33 LEU N    N    3.816   6.952  -3.880 1.00 . A A .  33 LEU N    1 1 
        5  7217 1 1  33 LEU O    O    3.411   4.096  -4.036 1.00 . A A .  33 LEU O    1 1 
        5  7218 1 1  34 ARG C    C    2.567   2.076  -0.570 1.00 . A A .  34 ARG C    1 1 
        5  7219 1 1  34 ARG CA   C    3.498   2.739  -1.573 1.00 . A A .  34 ARG CA   1 1 
        5  7220 1 1  34 ARG CB   C    4.988   2.611  -1.205 1.00 . A A .  34 ARG CB   1 1 
        5  7221 1 1  34 ARG CD   C    6.941   3.025   0.313 1.00 . A A .  34 ARG CD   1 1 
        5  7222 1 1  34 ARG CG   C    5.430   3.243   0.127 1.00 . A A .  34 ARG CG   1 1 
        5  7223 1 1  34 ARG CZ   C    8.681   4.148   1.735 1.00 . A A .  34 ARG CZ   1 1 
        5  7224 1 1  34 ARG H    H    2.858   4.697  -1.007 1.00 . A A .  34 ARG H    1 1 
        5  7225 1 1  34 ARG HA   H    3.363   2.183  -2.501 1.00 . A A .  34 ARG HA   1 1 
        5  7226 1 1  34 ARG HB2  H    5.248   1.551  -1.187 1.00 . A A .  34 ARG HB2  1 1 
        5  7227 1 1  34 ARG HB3  H    5.555   3.080  -2.009 1.00 . A A .  34 ARG HB3  1 1 
        5  7228 1 1  34 ARG HD2  H    7.142   1.953   0.376 1.00 . A A .  34 ARG HD2  1 1 
        5  7229 1 1  34 ARG HD3  H    7.453   3.422  -0.564 1.00 . A A .  34 ARG HD3  1 1 
        5  7230 1 1  34 ARG HE   H    6.834   3.810   2.312 1.00 . A A .  34 ARG HE   1 1 
        5  7231 1 1  34 ARG HG2  H    5.218   4.313   0.111 1.00 . A A .  34 ARG HG2  1 1 
        5  7232 1 1  34 ARG HG3  H    4.893   2.780   0.955 1.00 . A A .  34 ARG HG3  1 1 
        5  7233 1 1  34 ARG HH11 H    9.460   3.688  -0.048 1.00 . A A .  34 ARG HH11 1 1 
        5  7234 1 1  34 ARG HH12 H   10.504   4.594   1.023 1.00 . A A .  34 ARG HH12 1 1 
        5  7235 1 1  34 ARG HH21 H    8.172   4.756   3.546 1.00 . A A .  34 ARG HH21 1 1 
        5  7236 1 1  34 ARG HH22 H    9.870   5.009   3.110 1.00 . A A .  34 ARG HH22 1 1 
        5  7237 1 1  34 ARG N    N    3.142   4.147  -1.812 1.00 . A A .  34 ARG N    1 1 
        5  7238 1 1  34 ARG NE   N    7.463   3.685   1.524 1.00 . A A .  34 ARG NE   1 1 
        5  7239 1 1  34 ARG NH1  N    9.638   4.094   0.853 1.00 . A A .  34 ARG NH1  1 1 
        5  7240 1 1  34 ARG NH2  N    8.940   4.717   2.871 1.00 . A A .  34 ARG NH2  1 1 
        5  7241 1 1  34 ARG O    O    1.956   2.745   0.261 1.00 . A A .  34 ARG O    1 1 
        5  7242 1 1  35 MET C    C    2.462  -1.219   0.797 1.00 . A A .  35 MET C    1 1 
        5  7243 1 1  35 MET CA   C    1.630  -0.102   0.171 1.00 . A A .  35 MET CA   1 1 
        5  7244 1 1  35 MET CB   C    0.426  -0.653  -0.619 1.00 . A A .  35 MET CB   1 1 
        5  7245 1 1  35 MET CE   C   -2.983  -0.931  -0.370 1.00 . A A .  35 MET CE   1 1 
        5  7246 1 1  35 MET CG   C   -0.609   0.444  -0.885 1.00 . A A .  35 MET CG   1 1 
        5  7247 1 1  35 MET H    H    3.064   0.288  -1.333 1.00 . A A .  35 MET H    1 1 
        5  7248 1 1  35 MET HA   H    1.264   0.490   1.003 1.00 . A A .  35 MET HA   1 1 
        5  7249 1 1  35 MET HB2  H    0.770  -1.069  -1.565 1.00 . A A .  35 MET HB2  1 1 
        5  7250 1 1  35 MET HB3  H   -0.052  -1.444  -0.041 1.00 . A A .  35 MET HB3  1 1 
        5  7251 1 1  35 MET HE1  H   -4.005  -1.173  -0.673 1.00 . A A .  35 MET HE1  1 1 
        5  7252 1 1  35 MET HE2  H   -2.440  -1.850  -0.143 1.00 . A A .  35 MET HE2  1 1 
        5  7253 1 1  35 MET HE3  H   -3.015  -0.295   0.518 1.00 . A A .  35 MET HE3  1 1 
        5  7254 1 1  35 MET HG2  H   -0.888   0.877   0.074 1.00 . A A .  35 MET HG2  1 1 
        5  7255 1 1  35 MET HG3  H   -0.140   1.221  -1.488 1.00 . A A .  35 MET HG3  1 1 
        5  7256 1 1  35 MET N    N    2.460   0.757  -0.671 1.00 . A A .  35 MET N    1 1 
        5  7257 1 1  35 MET O    O    3.553  -1.523   0.327 1.00 . A A .  35 MET O    1 1 
        5  7258 1 1  35 MET SD   S   -2.139  -0.062  -1.722 1.00 . A A .  35 MET SD   1 1 
        5  7259 1 1  36 ALA C    C    1.609  -3.919   3.133 1.00 . A A .  36 ALA C    1 1 
        5  7260 1 1  36 ALA CA   C    2.623  -2.907   2.583 1.00 . A A .  36 ALA CA   1 1 
        5  7261 1 1  36 ALA CB   C    3.565  -2.364   3.671 1.00 . A A .  36 ALA CB   1 1 
        5  7262 1 1  36 ALA H    H    1.047  -1.519   2.198 1.00 . A A .  36 ALA H    1 1 
        5  7263 1 1  36 ALA HA   H    3.232  -3.436   1.860 1.00 . A A .  36 ALA HA   1 1 
        5  7264 1 1  36 ALA HB1  H    3.353  -2.821   4.638 1.00 . A A .  36 ALA HB1  1 1 
        5  7265 1 1  36 ALA HB2  H    4.596  -2.590   3.408 1.00 . A A .  36 ALA HB2  1 1 
        5  7266 1 1  36 ALA HB3  H    3.453  -1.284   3.757 1.00 . A A .  36 ALA HB3  1 1 
        5  7267 1 1  36 ALA N    N    1.970  -1.804   1.882 1.00 . A A .  36 ALA N    1 1 
        5  7268 1 1  36 ALA O    O    0.408  -3.639   3.182 1.00 . A A .  36 ALA O    1 1 
        5  7269 1 1  37 ILE C    C    1.813  -6.621   5.474 1.00 . A A .  37 ILE C    1 1 
        5  7270 1 1  37 ILE CA   C    1.271  -6.164   4.126 1.00 . A A .  37 ILE CA   1 1 
        5  7271 1 1  37 ILE CB   C    1.140  -7.306   3.095 1.00 . A A .  37 ILE CB   1 1 
        5  7272 1 1  37 ILE CD1  C   -0.419  -7.961   1.154 1.00 . A A .  37 ILE CD1  1 1 
        5  7273 1 1  37 ILE CG1  C   -0.221  -7.128   2.409 1.00 . A A .  37 ILE CG1  1 1 
        5  7274 1 1  37 ILE CG2  C    1.290  -8.721   3.667 1.00 . A A .  37 ILE CG2  1 1 
        5  7275 1 1  37 ILE H    H    3.081  -5.282   3.421 1.00 . A A .  37 ILE H    1 1 
        5  7276 1 1  37 ILE HA   H    0.279  -5.765   4.329 1.00 . A A .  37 ILE HA   1 1 
        5  7277 1 1  37 ILE HB   H    1.928  -7.194   2.350 1.00 . A A .  37 ILE HB   1 1 
        5  7278 1 1  37 ILE HD11 H   -1.387  -7.709   0.723 1.00 . A A .  37 ILE HD11 1 1 
        5  7279 1 1  37 ILE HD12 H    0.363  -7.726   0.435 1.00 . A A .  37 ILE HD12 1 1 
        5  7280 1 1  37 ILE HD13 H   -0.401  -9.022   1.394 1.00 . A A .  37 ILE HD13 1 1 
        5  7281 1 1  37 ILE HG12 H   -1.007  -7.387   3.116 1.00 . A A .  37 ILE HG12 1 1 
        5  7282 1 1  37 ILE HG13 H   -0.327  -6.084   2.124 1.00 . A A .  37 ILE HG13 1 1 
        5  7283 1 1  37 ILE HG21 H    0.505  -8.915   4.401 1.00 . A A .  37 ILE HG21 1 1 
        5  7284 1 1  37 ILE HG22 H    1.243  -9.437   2.847 1.00 . A A .  37 ILE HG22 1 1 
        5  7285 1 1  37 ILE HG23 H    2.267  -8.824   4.140 1.00 . A A .  37 ILE HG23 1 1 
        5  7286 1 1  37 ILE N    N    2.091  -5.091   3.552 1.00 . A A .  37 ILE N    1 1 
        5  7287 1 1  37 ILE O    O    3.020  -6.801   5.615 1.00 . A A .  37 ILE O    1 1 
        5  7288 1 1  38 MET C    C    1.324  -8.858   7.835 1.00 . A A .  38 MET C    1 1 
        5  7289 1 1  38 MET CA   C    1.317  -7.327   7.774 1.00 . A A .  38 MET CA   1 1 
        5  7290 1 1  38 MET CB   C    0.402  -6.679   8.830 1.00 . A A .  38 MET CB   1 1 
        5  7291 1 1  38 MET CE   C    3.229  -5.129   9.361 1.00 . A A .  38 MET CE   1 1 
        5  7292 1 1  38 MET CG   C    1.023  -6.619  10.228 1.00 . A A .  38 MET CG   1 1 
        5  7293 1 1  38 MET H    H   -0.055  -6.682   6.265 1.00 . A A .  38 MET H    1 1 
        5  7294 1 1  38 MET HA   H    2.338  -7.010   7.961 1.00 . A A .  38 MET HA   1 1 
        5  7295 1 1  38 MET HB2  H    0.153  -5.661   8.526 1.00 . A A .  38 MET HB2  1 1 
        5  7296 1 1  38 MET HB3  H   -0.525  -7.246   8.890 1.00 . A A .  38 MET HB3  1 1 
        5  7297 1 1  38 MET HE1  H    3.736  -6.092   9.407 1.00 . A A .  38 MET HE1  1 1 
        5  7298 1 1  38 MET HE2  H    2.788  -5.004   8.367 1.00 . A A .  38 MET HE2  1 1 
        5  7299 1 1  38 MET HE3  H    3.944  -4.328   9.541 1.00 . A A .  38 MET HE3  1 1 
        5  7300 1 1  38 MET HG2  H    0.208  -6.697  10.947 1.00 . A A .  38 MET HG2  1 1 
        5  7301 1 1  38 MET HG3  H    1.679  -7.476  10.371 1.00 . A A .  38 MET HG3  1 1 
        5  7302 1 1  38 MET N    N    0.931  -6.843   6.450 1.00 . A A .  38 MET N    1 1 
        5  7303 1 1  38 MET O    O    0.270  -9.493   7.761 1.00 . A A .  38 MET O    1 1 
        5  7304 1 1  38 MET SD   S    1.934  -5.096  10.623 1.00 . A A .  38 MET SD   1 1 
        5  7305 1 1  39 VAL C    C    3.602 -11.275   9.300 1.00 . A A .  39 VAL C    1 1 
        5  7306 1 1  39 VAL CA   C    2.704 -10.912   8.117 1.00 . A A .  39 VAL CA   1 1 
        5  7307 1 1  39 VAL CB   C    3.209 -11.521   6.792 1.00 . A A .  39 VAL CB   1 1 
        5  7308 1 1  39 VAL CG1  C    4.589 -11.009   6.375 1.00 . A A .  39 VAL CG1  1 1 
        5  7309 1 1  39 VAL CG2  C    3.232 -13.054   6.811 1.00 . A A .  39 VAL CG2  1 1 
        5  7310 1 1  39 VAL H    H    3.346  -8.864   7.981 1.00 . A A .  39 VAL H    1 1 
        5  7311 1 1  39 VAL HA   H    1.733 -11.365   8.315 1.00 . A A .  39 VAL HA   1 1 
        5  7312 1 1  39 VAL HB   H    2.506 -11.241   6.011 1.00 . A A .  39 VAL HB   1 1 
        5  7313 1 1  39 VAL HG11 H    5.348 -11.305   7.098 1.00 . A A .  39 VAL HG11 1 1 
        5  7314 1 1  39 VAL HG12 H    4.839 -11.429   5.402 1.00 . A A .  39 VAL HG12 1 1 
        5  7315 1 1  39 VAL HG13 H    4.579  -9.922   6.291 1.00 . A A .  39 VAL HG13 1 1 
        5  7316 1 1  39 VAL HG21 H    3.447 -13.426   5.809 1.00 . A A .  39 VAL HG21 1 1 
        5  7317 1 1  39 VAL HG22 H    4.005 -13.420   7.488 1.00 . A A .  39 VAL HG22 1 1 
        5  7318 1 1  39 VAL HG23 H    2.260 -13.438   7.120 1.00 . A A .  39 VAL HG23 1 1 
        5  7319 1 1  39 VAL N    N    2.514  -9.451   7.992 1.00 . A A .  39 VAL N    1 1 
        5  7320 1 1  39 VAL O    O    4.560 -10.572   9.612 1.00 . A A .  39 VAL O    1 1 
        5  7321 1 1  40 GLN C    C    5.406 -13.544  10.561 1.00 . A A .  40 GLN C    1 1 
        5  7322 1 1  40 GLN CA   C    4.084 -12.942  11.072 1.00 . A A .  40 GLN CA   1 1 
        5  7323 1 1  40 GLN CB   C    3.246 -13.958  11.872 1.00 . A A .  40 GLN CB   1 1 
        5  7324 1 1  40 GLN CD   C    1.690 -16.011  11.801 1.00 . A A .  40 GLN CD   1 1 
        5  7325 1 1  40 GLN CG   C    2.383 -14.901  11.005 1.00 . A A .  40 GLN CG   1 1 
        5  7326 1 1  40 GLN H    H    2.503 -12.921   9.645 1.00 . A A .  40 GLN H    1 1 
        5  7327 1 1  40 GLN HA   H    4.345 -12.136  11.756 1.00 . A A .  40 GLN HA   1 1 
        5  7328 1 1  40 GLN HB2  H    3.922 -14.551  12.492 1.00 . A A .  40 GLN HB2  1 1 
        5  7329 1 1  40 GLN HB3  H    2.581 -13.409  12.538 1.00 . A A .  40 GLN HB3  1 1 
        5  7330 1 1  40 GLN HE21 H    0.910 -16.853  10.132 1.00 . A A .  40 GLN HE21 1 1 
        5  7331 1 1  40 GLN HE22 H    0.525 -17.635  11.659 1.00 . A A .  40 GLN HE22 1 1 
        5  7332 1 1  40 GLN HG2  H    1.611 -14.314  10.500 1.00 . A A .  40 GLN HG2  1 1 
        5  7333 1 1  40 GLN HG3  H    3.007 -15.360  10.237 1.00 . A A .  40 GLN HG3  1 1 
        5  7334 1 1  40 GLN N    N    3.291 -12.382   9.971 1.00 . A A .  40 GLN N    1 1 
        5  7335 1 1  40 GLN NE2  N    0.984 -16.903  11.137 1.00 . A A .  40 GLN NE2  1 1 
        5  7336 1 1  40 GLN O    O    5.414 -14.330   9.611 1.00 . A A .  40 GLN O    1 1 
        5  7337 1 1  40 GLN OE1  O    1.756 -16.106  13.021 1.00 . A A .  40 GLN OE1  1 1 
        5  7338 1 1  41 SER C    C    8.369 -14.856  11.465 1.00 . A A .  41 SER C    1 1 
        5  7339 1 1  41 SER CA   C    7.870 -13.592  10.761 1.00 . A A .  41 SER CA   1 1 
        5  7340 1 1  41 SER CB   C    8.862 -12.453  10.972 1.00 . A A .  41 SER CB   1 1 
        5  7341 1 1  41 SER H    H    6.461 -12.559  11.988 1.00 . A A .  41 SER H    1 1 
        5  7342 1 1  41 SER HA   H    7.853 -13.786   9.696 1.00 . A A .  41 SER HA   1 1 
        5  7343 1 1  41 SER HB2  H    8.535 -11.584  10.404 1.00 . A A .  41 SER HB2  1 1 
        5  7344 1 1  41 SER HB3  H    8.892 -12.196  12.032 1.00 . A A .  41 SER HB3  1 1 
        5  7345 1 1  41 SER HG   H   10.609 -12.070  10.169 1.00 . A A .  41 SER HG   1 1 
        5  7346 1 1  41 SER N    N    6.527 -13.180  11.190 1.00 . A A .  41 SER N    1 1 
        5  7347 1 1  41 SER O    O    8.289 -14.945  12.695 1.00 . A A .  41 SER O    1 1 
        5  7348 1 1  41 SER OG   O   10.152 -12.852  10.535 1.00 . A A .  41 SER OG   1 1 
        5  7349 1 1  42 PRO C    C   11.069 -16.479  11.946 1.00 . A A .  42 PRO C    1 1 
        5  7350 1 1  42 PRO CA   C    9.729 -16.903  11.311 1.00 . A A .  42 PRO CA   1 1 
        5  7351 1 1  42 PRO CB   C    9.955 -17.915  10.178 1.00 . A A .  42 PRO CB   1 1 
        5  7352 1 1  42 PRO CD   C    8.750 -16.056   9.304 1.00 . A A .  42 PRO CD   1 1 
        5  7353 1 1  42 PRO CG   C    8.890 -17.566   9.141 1.00 . A A .  42 PRO CG   1 1 
        5  7354 1 1  42 PRO HA   H    9.091 -17.344  12.072 1.00 . A A .  42 PRO HA   1 1 
        5  7355 1 1  42 PRO HB2  H   10.944 -17.772   9.738 1.00 . A A .  42 PRO HB2  1 1 
        5  7356 1 1  42 PRO HB3  H    9.848 -18.941  10.531 1.00 . A A .  42 PRO HB3  1 1 
        5  7357 1 1  42 PRO HD2  H    9.507 -15.535   8.718 1.00 . A A .  42 PRO HD2  1 1 
        5  7358 1 1  42 PRO HD3  H    7.750 -15.750   8.993 1.00 . A A .  42 PRO HD3  1 1 
        5  7359 1 1  42 PRO HG2  H    9.200 -17.838   8.131 1.00 . A A .  42 PRO HG2  1 1 
        5  7360 1 1  42 PRO HG3  H    7.949 -18.052   9.403 1.00 . A A .  42 PRO HG3  1 1 
        5  7361 1 1  42 PRO N    N    8.969 -15.807  10.721 1.00 . A A .  42 PRO N    1 1 
        5  7362 1 1  42 PRO O    O   11.653 -17.253  12.708 1.00 . A A .  42 PRO O    1 1 
        5  7363 1 1  43 MET C    C   12.910 -13.620  12.995 1.00 . A A .  43 MET C    1 1 
        5  7364 1 1  43 MET CA   C   12.920 -14.796  12.001 1.00 . A A .  43 MET CA   1 1 
        5  7365 1 1  43 MET CB   C   13.691 -14.405  10.732 1.00 . A A .  43 MET CB   1 1 
        5  7366 1 1  43 MET CE   C   12.249 -15.297   7.869 1.00 . A A .  43 MET CE   1 1 
        5  7367 1 1  43 MET CG   C   14.070 -15.631   9.887 1.00 . A A .  43 MET CG   1 1 
        5  7368 1 1  43 MET H    H   11.028 -14.689  11.006 1.00 . A A .  43 MET H    1 1 
        5  7369 1 1  43 MET HA   H   13.473 -15.608  12.467 1.00 . A A .  43 MET HA   1 1 
        5  7370 1 1  43 MET HB2  H   13.083 -13.713  10.150 1.00 . A A .  43 MET HB2  1 1 
        5  7371 1 1  43 MET HB3  H   14.610 -13.887  11.005 1.00 . A A .  43 MET HB3  1 1 
        5  7372 1 1  43 MET HE1  H   12.014 -15.112   6.821 1.00 . A A .  43 MET HE1  1 1 
        5  7373 1 1  43 MET HE2  H   11.824 -16.253   8.174 1.00 . A A .  43 MET HE2  1 1 
        5  7374 1 1  43 MET HE3  H   11.818 -14.508   8.485 1.00 . A A .  43 MET HE3  1 1 
        5  7375 1 1  43 MET HG2  H   15.069 -15.954  10.181 1.00 . A A .  43 MET HG2  1 1 
        5  7376 1 1  43 MET HG3  H   13.387 -16.454  10.099 1.00 . A A .  43 MET HG3  1 1 
        5  7377 1 1  43 MET N    N   11.577 -15.279  11.621 1.00 . A A .  43 MET N    1 1 
        5  7378 1 1  43 MET O    O   13.888 -13.425  13.721 1.00 . A A .  43 MET O    1 1 
        5  7379 1 1  43 MET SD   S   14.047 -15.345   8.098 1.00 . A A .  43 MET SD   1 1 
        5  7380 1 1  44 PHE C    C   10.580 -11.991  15.029 1.00 . A A .  44 PHE C    1 1 
        5  7381 1 1  44 PHE CA   C   11.626 -11.693  13.937 1.00 . A A .  44 PHE CA   1 1 
        5  7382 1 1  44 PHE CB   C   11.286 -10.453  13.089 1.00 . A A .  44 PHE CB   1 1 
        5  7383 1 1  44 PHE CD1  C   12.021  -8.491  14.517 1.00 . A A .  44 PHE CD1  1 1 
        5  7384 1 1  44 PHE CD2  C    9.651  -8.756  14.025 1.00 . A A .  44 PHE CD2  1 1 
        5  7385 1 1  44 PHE CE1  C   11.731  -7.350  15.287 1.00 . A A .  44 PHE CE1  1 1 
        5  7386 1 1  44 PHE CE2  C    9.361  -7.615  14.793 1.00 . A A .  44 PHE CE2  1 1 
        5  7387 1 1  44 PHE CG   C   10.981  -9.198  13.885 1.00 . A A .  44 PHE CG   1 1 
        5  7388 1 1  44 PHE CZ   C   10.401  -6.913  15.425 1.00 . A A .  44 PHE CZ   1 1 
        5  7389 1 1  44 PHE H    H   11.055 -13.078  12.427 1.00 . A A .  44 PHE H    1 1 
        5  7390 1 1  44 PHE HA   H   12.562 -11.479  14.454 1.00 . A A .  44 PHE HA   1 1 
        5  7391 1 1  44 PHE HB2  H   12.126 -10.245  12.425 1.00 . A A .  44 PHE HB2  1 1 
        5  7392 1 1  44 PHE HB3  H   10.428 -10.675  12.459 1.00 . A A .  44 PHE HB3  1 1 
        5  7393 1 1  44 PHE HD1  H   13.045  -8.825  14.414 1.00 . A A .  44 PHE HD1  1 1 
        5  7394 1 1  44 PHE HD2  H    8.846  -9.297  13.546 1.00 . A A .  44 PHE HD2  1 1 
        5  7395 1 1  44 PHE HE1  H   12.532  -6.808  15.774 1.00 . A A .  44 PHE HE1  1 1 
        5  7396 1 1  44 PHE HE2  H    8.337  -7.276  14.895 1.00 . A A .  44 PHE HE2  1 1 
        5  7397 1 1  44 PHE HZ   H   10.180  -6.034  16.017 1.00 . A A .  44 PHE HZ   1 1 
        5  7398 1 1  44 PHE N    N   11.822 -12.845  13.046 1.00 . A A .  44 PHE N    1 1 
        5  7399 1 1  44 PHE O    O    9.725 -12.865  14.882 1.00 . A A .  44 PHE O    1 1 
        5  7400 1 1  45 ASP C    C    8.412 -10.853  17.271 1.00 . A A .  45 ASP C    1 1 
        5  7401 1 1  45 ASP CA   C    9.838 -11.453  17.357 1.00 . A A .  45 ASP CA   1 1 
        5  7402 1 1  45 ASP CB   C   10.636 -10.946  18.574 1.00 . A A .  45 ASP CB   1 1 
        5  7403 1 1  45 ASP CG   C   11.954 -11.715  18.766 1.00 . A A .  45 ASP CG   1 1 
        5  7404 1 1  45 ASP H    H   11.309 -10.495  16.141 1.00 . A A .  45 ASP H    1 1 
        5  7405 1 1  45 ASP HA   H    9.702 -12.527  17.492 1.00 . A A .  45 ASP HA   1 1 
        5  7406 1 1  45 ASP HB2  H   10.838  -9.879  18.452 1.00 . A A .  45 ASP HB2  1 1 
        5  7407 1 1  45 ASP HB3  H   10.035 -11.071  19.476 1.00 . A A .  45 ASP HB3  1 1 
        5  7408 1 1  45 ASP N    N   10.637 -11.248  16.135 1.00 . A A .  45 ASP N    1 1 
        5  7409 1 1  45 ASP O    O    7.893 -10.283  18.235 1.00 . A A .  45 ASP O    1 1 
        5  7410 1 1  45 ASP OD1  O   11.915 -12.870  19.256 1.00 . A A .  45 ASP OD1  1 1 
        5  7411 1 1  45 ASP OD2  O   13.033 -11.164  18.442 1.00 . A A .  45 ASP OD2  1 1 
        5  7412 1 1  46 GLY C    C    6.152 -10.331  14.309 1.00 . A A .  46 GLY C    1 1 
        5  7413 1 1  46 GLY CA   C    6.461 -10.375  15.804 1.00 . A A .  46 GLY CA   1 1 
        5  7414 1 1  46 GLY H    H    8.237 -11.473  15.362 1.00 . A A .  46 GLY H    1 1 
        5  7415 1 1  46 GLY HA2  H    5.679 -10.963  16.287 1.00 . A A .  46 GLY HA2  1 1 
        5  7416 1 1  46 GLY HA3  H    6.415  -9.360  16.200 1.00 . A A .  46 GLY HA3  1 1 
        5  7417 1 1  46 GLY N    N    7.778 -10.949  16.098 1.00 . A A .  46 GLY N    1 1 
        5  7418 1 1  46 GLY O    O    6.577 -11.205  13.544 1.00 . A A .  46 GLY O    1 1 
        5  7419 1 1  47 LYS C    C    5.676  -8.031  11.776 1.00 . A A .  47 LYS C    1 1 
        5  7420 1 1  47 LYS CA   C    4.921  -9.142  12.507 1.00 . A A .  47 LYS CA   1 1 
        5  7421 1 1  47 LYS CB   C    3.389  -8.974  12.462 1.00 . A A .  47 LYS CB   1 1 
        5  7422 1 1  47 LYS CD   C    1.409 -10.637  12.650 1.00 . A A .  47 LYS CD   1 1 
        5  7423 1 1  47 LYS CE   C    0.293  -9.639  12.323 1.00 . A A .  47 LYS CE   1 1 
        5  7424 1 1  47 LYS CG   C    2.662 -10.045  13.305 1.00 . A A .  47 LYS CG   1 1 
        5  7425 1 1  47 LYS H    H    5.131  -8.606  14.565 1.00 . A A .  47 LYS H    1 1 
        5  7426 1 1  47 LYS HA   H    5.148 -10.057  11.962 1.00 . A A .  47 LYS HA   1 1 
        5  7427 1 1  47 LYS HB2  H    3.114  -7.983  12.829 1.00 . A A .  47 LYS HB2  1 1 
        5  7428 1 1  47 LYS HB3  H    3.074  -9.045  11.420 1.00 . A A .  47 LYS HB3  1 1 
        5  7429 1 1  47 LYS HD2  H    1.715 -11.111  11.719 1.00 . A A .  47 LYS HD2  1 1 
        5  7430 1 1  47 LYS HD3  H    1.019 -11.418  13.304 1.00 . A A .  47 LYS HD3  1 1 
        5  7431 1 1  47 LYS HE2  H    0.710  -8.817  11.736 1.00 . A A .  47 LYS HE2  1 1 
        5  7432 1 1  47 LYS HE3  H   -0.440 -10.156  11.695 1.00 . A A .  47 LYS HE3  1 1 
        5  7433 1 1  47 LYS HG2  H    3.331 -10.886  13.485 1.00 . A A .  47 LYS HG2  1 1 
        5  7434 1 1  47 LYS HG3  H    2.404  -9.621  14.277 1.00 . A A .  47 LYS HG3  1 1 
        5  7435 1 1  47 LYS HZ1  H    0.255  -8.584  14.132 1.00 . A A .  47 LYS HZ1  1 1 
        5  7436 1 1  47 LYS HZ2  H   -1.116  -8.461  13.285 1.00 . A A .  47 LYS HZ2  1 1 
        5  7437 1 1  47 LYS HZ3  H   -0.792  -9.854  14.093 1.00 . A A .  47 LYS HZ3  1 1 
        5  7438 1 1  47 LYS N    N    5.397  -9.310  13.890 1.00 . A A .  47 LYS N    1 1 
        5  7439 1 1  47 LYS NZ   N   -0.379  -9.115  13.540 1.00 . A A .  47 LYS NZ   1 1 
        5  7440 1 1  47 LYS O    O    6.077  -7.035  12.381 1.00 . A A .  47 LYS O    1 1 
        5  7441 1 1  48 VAL C    C    6.028  -6.929   8.355 1.00 . A A .  48 VAL C    1 1 
        5  7442 1 1  48 VAL CA   C    6.765  -7.426   9.611 1.00 . A A .  48 VAL CA   1 1 
        5  7443 1 1  48 VAL CB   C    8.034  -8.216   9.223 1.00 . A A .  48 VAL CB   1 1 
        5  7444 1 1  48 VAL CG1  C    8.891  -8.519  10.461 1.00 . A A .  48 VAL CG1  1 1 
        5  7445 1 1  48 VAL CG2  C    7.743  -9.543   8.505 1.00 . A A .  48 VAL CG2  1 1 
        5  7446 1 1  48 VAL H    H    5.474  -9.061  10.064 1.00 . A A .  48 VAL H    1 1 
        5  7447 1 1  48 VAL HA   H    7.092  -6.558  10.181 1.00 . A A .  48 VAL HA   1 1 
        5  7448 1 1  48 VAL HB   H    8.623  -7.597   8.549 1.00 . A A .  48 VAL HB   1 1 
        5  7449 1 1  48 VAL HG11 H    9.116  -7.594  10.993 1.00 . A A .  48 VAL HG11 1 1 
        5  7450 1 1  48 VAL HG12 H    8.367  -9.198  11.133 1.00 . A A .  48 VAL HG12 1 1 
        5  7451 1 1  48 VAL HG13 H    9.830  -8.981  10.157 1.00 . A A .  48 VAL HG13 1 1 
        5  7452 1 1  48 VAL HG21 H    8.682 -10.034   8.249 1.00 . A A .  48 VAL HG21 1 1 
        5  7453 1 1  48 VAL HG22 H    7.160 -10.206   9.143 1.00 . A A .  48 VAL HG22 1 1 
        5  7454 1 1  48 VAL HG23 H    7.190  -9.360   7.585 1.00 . A A .  48 VAL HG23 1 1 
        5  7455 1 1  48 VAL N    N    5.882  -8.226  10.475 1.00 . A A .  48 VAL N    1 1 
        5  7456 1 1  48 VAL O    O    5.180  -7.658   7.830 1.00 . A A .  48 VAL O    1 1 
        5  7457 1 1  49 PRO C    C    6.324  -5.625   5.377 1.00 . A A .  49 PRO C    1 1 
        5  7458 1 1  49 PRO CA   C    5.654  -5.152   6.680 1.00 . A A .  49 PRO CA   1 1 
        5  7459 1 1  49 PRO CB   C    5.736  -3.631   6.846 1.00 . A A .  49 PRO CB   1 1 
        5  7460 1 1  49 PRO CD   C    7.122  -4.677   8.509 1.00 . A A .  49 PRO CD   1 1 
        5  7461 1 1  49 PRO CG   C    7.039  -3.434   7.621 1.00 . A A .  49 PRO CG   1 1 
        5  7462 1 1  49 PRO HA   H    4.605  -5.445   6.680 1.00 . A A .  49 PRO HA   1 1 
        5  7463 1 1  49 PRO HB2  H    5.750  -3.110   5.887 1.00 . A A .  49 PRO HB2  1 1 
        5  7464 1 1  49 PRO HB3  H    4.897  -3.284   7.450 1.00 . A A .  49 PRO HB3  1 1 
        5  7465 1 1  49 PRO HD2  H    8.159  -5.001   8.608 1.00 . A A .  49 PRO HD2  1 1 
        5  7466 1 1  49 PRO HD3  H    6.705  -4.445   9.490 1.00 . A A .  49 PRO HD3  1 1 
        5  7467 1 1  49 PRO HG2  H    7.883  -3.423   6.932 1.00 . A A .  49 PRO HG2  1 1 
        5  7468 1 1  49 PRO HG3  H    7.021  -2.518   8.212 1.00 . A A .  49 PRO HG3  1 1 
        5  7469 1 1  49 PRO N    N    6.308  -5.703   7.865 1.00 . A A .  49 PRO N    1 1 
        5  7470 1 1  49 PRO O    O    7.532  -5.464   5.188 1.00 . A A .  49 PRO O    1 1 
        5  7471 1 1  50 HIS C    C    5.588  -5.400   2.132 1.00 . A A .  50 HIS C    1 1 
        5  7472 1 1  50 HIS CA   C    5.975  -6.521   3.086 1.00 . A A .  50 HIS CA   1 1 
        5  7473 1 1  50 HIS CB   C    5.361  -7.868   2.661 1.00 . A A .  50 HIS CB   1 1 
        5  7474 1 1  50 HIS CD2  C    6.754  -9.135   4.393 1.00 . A A .  50 HIS CD2  1 1 
        5  7475 1 1  50 HIS CE1  C    6.846 -11.113   3.425 1.00 . A A .  50 HIS CE1  1 1 
        5  7476 1 1  50 HIS CG   C    6.077  -9.076   3.210 1.00 . A A .  50 HIS CG   1 1 
        5  7477 1 1  50 HIS H    H    4.573  -6.372   4.698 1.00 . A A .  50 HIS H    1 1 
        5  7478 1 1  50 HIS HA   H    7.057  -6.607   3.038 1.00 . A A .  50 HIS HA   1 1 
        5  7479 1 1  50 HIS HB2  H    4.315  -7.908   2.966 1.00 . A A .  50 HIS HB2  1 1 
        5  7480 1 1  50 HIS HB3  H    5.382  -7.939   1.573 1.00 . A A .  50 HIS HB3  1 1 
        5  7481 1 1  50 HIS HD2  H    6.845  -8.329   5.106 1.00 . A A .  50 HIS HD2  1 1 
        5  7482 1 1  50 HIS HE1  H    7.027 -12.170   3.271 1.00 . A A .  50 HIS HE1  1 1 
        5  7483 1 1  50 HIS HE2  H    7.771 -10.797   5.284 1.00 . A A .  50 HIS HE2  1 1 
        5  7484 1 1  50 HIS N    N    5.539  -6.176   4.448 1.00 . A A .  50 HIS N    1 1 
        5  7485 1 1  50 HIS ND1  N    6.142 -10.328   2.592 1.00 . A A .  50 HIS ND1  1 1 
        5  7486 1 1  50 HIS NE2  N    7.247 -10.417   4.503 1.00 . A A .  50 HIS NE2  1 1 
        5  7487 1 1  50 HIS O    O    4.426  -5.323   1.754 1.00 . A A .  50 HIS O    1 1 
        5  7488 1 1  51 TRP C    C    6.175  -3.670  -0.534 1.00 . A A .  51 TRP C    1 1 
        5  7489 1 1  51 TRP CA   C    6.268  -3.332   0.959 1.00 . A A .  51 TRP CA   1 1 
        5  7490 1 1  51 TRP CB   C    7.357  -2.276   1.174 1.00 . A A .  51 TRP CB   1 1 
        5  7491 1 1  51 TRP CD1  C    8.410  -2.244   3.473 1.00 . A A .  51 TRP CD1  1 1 
        5  7492 1 1  51 TRP CD2  C    6.742  -0.744   3.274 1.00 . A A .  51 TRP CD2  1 1 
        5  7493 1 1  51 TRP CE2  C    7.214  -0.680   4.621 1.00 . A A .  51 TRP CE2  1 1 
        5  7494 1 1  51 TRP CE3  C    5.677   0.121   2.923 1.00 . A A .  51 TRP CE3  1 1 
        5  7495 1 1  51 TRP CG   C    7.508  -1.779   2.577 1.00 . A A .  51 TRP CG   1 1 
        5  7496 1 1  51 TRP CH2  C    5.562   0.977   5.214 1.00 . A A .  51 TRP CH2  1 1 
        5  7497 1 1  51 TRP CZ2  C    6.647   0.167   5.580 1.00 . A A .  51 TRP CZ2  1 1 
        5  7498 1 1  51 TRP CZ3  C    5.072   0.949   3.895 1.00 . A A .  51 TRP CZ3  1 1 
        5  7499 1 1  51 TRP H    H    7.461  -4.639   2.131 1.00 . A A .  51 TRP H    1 1 
        5  7500 1 1  51 TRP HA   H    5.324  -2.886   1.277 1.00 . A A .  51 TRP HA   1 1 
        5  7501 1 1  51 TRP HB2  H    8.313  -2.680   0.838 1.00 . A A .  51 TRP HB2  1 1 
        5  7502 1 1  51 TRP HB3  H    7.126  -1.415   0.544 1.00 . A A .  51 TRP HB3  1 1 
        5  7503 1 1  51 TRP HD1  H    9.138  -3.025   3.278 1.00 . A A .  51 TRP HD1  1 1 
        5  7504 1 1  51 TRP HE1  H    8.822  -1.774   5.490 1.00 . A A .  51 TRP HE1  1 1 
        5  7505 1 1  51 TRP HE3  H    5.304   0.116   1.904 1.00 . A A .  51 TRP HE3  1 1 
        5  7506 1 1  51 TRP HH2  H    5.107   1.623   5.952 1.00 . A A .  51 TRP HH2  1 1 
        5  7507 1 1  51 TRP HZ2  H    7.032   0.185   6.589 1.00 . A A .  51 TRP HZ2  1 1 
        5  7508 1 1  51 TRP HZ3  H    4.207   1.553   3.648 1.00 . A A .  51 TRP HZ3  1 1 
        5  7509 1 1  51 TRP N    N    6.525  -4.515   1.786 1.00 . A A .  51 TRP N    1 1 
        5  7510 1 1  51 TRP NE1  N    8.251  -1.585   4.674 1.00 . A A .  51 TRP NE1  1 1 
        5  7511 1 1  51 TRP O    O    6.879  -4.536  -1.050 1.00 . A A .  51 TRP O    1 1 
        5  7512 1 1  52 TYR C    C    4.933  -1.546  -3.244 1.00 . A A .  52 TYR C    1 1 
        5  7513 1 1  52 TYR CA   C    5.296  -2.946  -2.712 1.00 . A A .  52 TYR CA   1 1 
        5  7514 1 1  52 TYR CB   C    4.328  -4.034  -3.236 1.00 . A A .  52 TYR CB   1 1 
        5  7515 1 1  52 TYR CD1  C    3.159  -5.132  -1.223 1.00 . A A .  52 TYR CD1  1 1 
        5  7516 1 1  52 TYR CD2  C    4.308  -6.532  -2.846 1.00 . A A .  52 TYR CD2  1 1 
        5  7517 1 1  52 TYR CE1  C    2.747  -6.289  -0.524 1.00 . A A .  52 TYR CE1  1 1 
        5  7518 1 1  52 TYR CE2  C    3.897  -7.687  -2.155 1.00 . A A .  52 TYR CE2  1 1 
        5  7519 1 1  52 TYR CG   C    3.952  -5.248  -2.387 1.00 . A A .  52 TYR CG   1 1 
        5  7520 1 1  52 TYR CZ   C    3.124  -7.568  -0.983 1.00 . A A .  52 TYR CZ   1 1 
        5  7521 1 1  52 TYR H    H    4.785  -2.231  -0.785 1.00 . A A .  52 TYR H    1 1 
        5  7522 1 1  52 TYR HA   H    6.290  -3.184  -3.092 1.00 . A A .  52 TYR HA   1 1 
        5  7523 1 1  52 TYR HB2  H    3.397  -3.560  -3.539 1.00 . A A .  52 TYR HB2  1 1 
        5  7524 1 1  52 TYR HB3  H    4.816  -4.431  -4.124 1.00 . A A .  52 TYR HB3  1 1 
        5  7525 1 1  52 TYR HD1  H    2.888  -4.154  -0.851 1.00 . A A .  52 TYR HD1  1 1 
        5  7526 1 1  52 TYR HD2  H    4.904  -6.632  -3.740 1.00 . A A .  52 TYR HD2  1 1 
        5  7527 1 1  52 TYR HE1  H    2.171  -6.216   0.387 1.00 . A A .  52 TYR HE1  1 1 
        5  7528 1 1  52 TYR HE2  H    4.179  -8.666  -2.514 1.00 . A A .  52 TYR HE2  1 1 
        5  7529 1 1  52 TYR HH   H    3.099  -9.495  -0.689 1.00 . A A .  52 TYR HH   1 1 
        5  7530 1 1  52 TYR N    N    5.354  -2.923  -1.259 1.00 . A A .  52 TYR N    1 1 
        5  7531 1 1  52 TYR O    O    4.392  -0.705  -2.515 1.00 . A A .  52 TYR O    1 1 
        5  7532 1 1  52 TYR OH   O    2.745  -8.681  -0.296 1.00 . A A .  52 TYR OH   1 1 
        5  7533 1 1  53 HIS C    C    3.105  -0.086  -5.110 1.00 . A A .  53 HIS C    1 1 
        5  7534 1 1  53 HIS CA   C    4.643  -0.118  -5.237 1.00 . A A .  53 HIS CA   1 1 
        5  7535 1 1  53 HIS CB   C    5.032  -0.150  -6.726 1.00 . A A .  53 HIS CB   1 1 
        5  7536 1 1  53 HIS CD2  C    7.212   1.146  -6.956 1.00 . A A .  53 HIS CD2  1 1 
        5  7537 1 1  53 HIS CE1  C    8.542  -0.425  -7.746 1.00 . A A .  53 HIS CE1  1 1 
        5  7538 1 1  53 HIS CG   C    6.506  -0.021  -7.035 1.00 . A A .  53 HIS CG   1 1 
        5  7539 1 1  53 HIS H    H    5.679  -2.003  -5.056 1.00 . A A .  53 HIS H    1 1 
        5  7540 1 1  53 HIS HA   H    5.036   0.796  -4.787 1.00 . A A .  53 HIS HA   1 1 
        5  7541 1 1  53 HIS HB2  H    4.642  -1.057  -7.170 1.00 . A A .  53 HIS HB2  1 1 
        5  7542 1 1  53 HIS HB3  H    4.528   0.670  -7.231 1.00 . A A .  53 HIS HB3  1 1 
        5  7543 1 1  53 HIS HD2  H    6.826   2.105  -6.637 1.00 . A A .  53 HIS HD2  1 1 
        5  7544 1 1  53 HIS HE1  H    9.425  -0.916  -8.137 1.00 . A A .  53 HIS HE1  1 1 
        5  7545 1 1  53 HIS HE2  H    9.246   1.536  -7.519 1.00 . A A .  53 HIS HE2  1 1 
        5  7546 1 1  53 HIS N    N    5.202  -1.286  -4.528 1.00 . A A .  53 HIS N    1 1 
        5  7547 1 1  53 HIS ND1  N    7.355  -1.014  -7.536 1.00 . A A .  53 HIS ND1  1 1 
        5  7548 1 1  53 HIS NE2  N    8.486   0.873  -7.406 1.00 . A A .  53 HIS NE2  1 1 
        5  7549 1 1  53 HIS O    O    2.477  -1.138  -4.948 1.00 . A A .  53 HIS O    1 1 
        5  7550 1 1  54 PHE C    C    0.268   0.303  -6.080 1.00 . A A .  54 PHE C    1 1 
        5  7551 1 1  54 PHE CA   C    1.018   1.222  -5.094 1.00 . A A .  54 PHE CA   1 1 
        5  7552 1 1  54 PHE CB   C    0.580   2.681  -5.297 1.00 . A A .  54 PHE CB   1 1 
        5  7553 1 1  54 PHE CD1  C   -1.802   2.533  -4.398 1.00 . A A .  54 PHE CD1  1 1 
        5  7554 1 1  54 PHE CD2  C   -1.462   3.252  -6.699 1.00 . A A .  54 PHE CD2  1 1 
        5  7555 1 1  54 PHE CE1  C   -3.193   2.583  -4.588 1.00 . A A .  54 PHE CE1  1 1 
        5  7556 1 1  54 PHE CE2  C   -2.856   3.323  -6.878 1.00 . A A .  54 PHE CE2  1 1 
        5  7557 1 1  54 PHE CG   C   -0.927   2.847  -5.459 1.00 . A A .  54 PHE CG   1 1 
        5  7558 1 1  54 PHE CZ   C   -3.718   2.971  -5.828 1.00 . A A .  54 PHE CZ   1 1 
        5  7559 1 1  54 PHE H    H    3.019   1.933  -5.393 1.00 . A A .  54 PHE H    1 1 
        5  7560 1 1  54 PHE HA   H    0.737   0.937  -4.078 1.00 . A A .  54 PHE HA   1 1 
        5  7561 1 1  54 PHE HB2  H    0.905   3.265  -4.438 1.00 . A A .  54 PHE HB2  1 1 
        5  7562 1 1  54 PHE HB3  H    1.077   3.082  -6.181 1.00 . A A .  54 PHE HB3  1 1 
        5  7563 1 1  54 PHE HD1  H   -1.414   2.229  -3.439 1.00 . A A .  54 PHE HD1  1 1 
        5  7564 1 1  54 PHE HD2  H   -0.804   3.499  -7.521 1.00 . A A .  54 PHE HD2  1 1 
        5  7565 1 1  54 PHE HE1  H   -3.864   2.319  -3.783 1.00 . A A .  54 PHE HE1  1 1 
        5  7566 1 1  54 PHE HE2  H   -3.272   3.648  -7.822 1.00 . A A .  54 PHE HE2  1 1 
        5  7567 1 1  54 PHE HZ   H   -4.787   3.009  -5.972 1.00 . A A .  54 PHE HZ   1 1 
        5  7568 1 1  54 PHE N    N    2.480   1.095  -5.216 1.00 . A A .  54 PHE N    1 1 
        5  7569 1 1  54 PHE O    O   -0.713  -0.329  -5.698 1.00 . A A .  54 PHE O    1 1 
        5  7570 1 1  55 SER C    C    0.501  -2.167  -8.134 1.00 . A A .  55 SER C    1 1 
        5  7571 1 1  55 SER CA   C    0.157  -0.688  -8.352 1.00 . A A .  55 SER CA   1 1 
        5  7572 1 1  55 SER CB   C    0.615  -0.226  -9.740 1.00 . A A .  55 SER CB   1 1 
        5  7573 1 1  55 SER H    H    1.602   0.654  -7.573 1.00 . A A .  55 SER H    1 1 
        5  7574 1 1  55 SER HA   H   -0.929  -0.592  -8.319 1.00 . A A .  55 SER HA   1 1 
        5  7575 1 1  55 SER HB2  H    0.253  -0.927 -10.495 1.00 . A A .  55 SER HB2  1 1 
        5  7576 1 1  55 SER HB3  H    0.188   0.758  -9.944 1.00 . A A .  55 SER HB3  1 1 
        5  7577 1 1  55 SER HG   H    2.287   0.173 -10.684 1.00 . A A .  55 SER HG   1 1 
        5  7578 1 1  55 SER N    N    0.745   0.179  -7.325 1.00 . A A .  55 SER N    1 1 
        5  7579 1 1  55 SER O    O   -0.367  -3.031  -8.297 1.00 . A A .  55 SER O    1 1 
        5  7580 1 1  55 SER OG   O    2.032  -0.141  -9.796 1.00 . A A .  55 SER OG   1 1 
        5  7581 1 1  56 CYS C    C    1.391  -4.574  -6.397 1.00 . A A .  56 CYS C    1 1 
        5  7582 1 1  56 CYS CA   C    2.212  -3.818  -7.459 1.00 . A A .  56 CYS CA   1 1 
        5  7583 1 1  56 CYS CB   C    3.693  -3.787  -7.075 1.00 . A A .  56 CYS CB   1 1 
        5  7584 1 1  56 CYS H    H    2.408  -1.717  -7.649 1.00 . A A .  56 CYS H    1 1 
        5  7585 1 1  56 CYS HA   H    2.120  -4.347  -8.399 1.00 . A A .  56 CYS HA   1 1 
        5  7586 1 1  56 CYS HB2  H    3.838  -3.057  -6.277 1.00 . A A .  56 CYS HB2  1 1 
        5  7587 1 1  56 CYS HB3  H    3.960  -4.766  -6.675 1.00 . A A .  56 CYS HB3  1 1 
        5  7588 1 1  56 CYS N    N    1.733  -2.463  -7.706 1.00 . A A .  56 CYS N    1 1 
        5  7589 1 1  56 CYS O    O    1.171  -5.772  -6.550 1.00 . A A .  56 CYS O    1 1 
        5  7590 1 1  56 CYS SG   S    4.769  -3.420  -8.513 1.00 . A A .  56 CYS SG   1 1 
        5  7591 1 1  57 PHE C    C   -1.207  -5.177  -4.968 1.00 . A A .  57 PHE C    1 1 
        5  7592 1 1  57 PHE CA   C   -0.002  -4.450  -4.340 1.00 . A A .  57 PHE CA   1 1 
        5  7593 1 1  57 PHE CB   C   -0.467  -3.316  -3.419 1.00 . A A .  57 PHE CB   1 1 
        5  7594 1 1  57 PHE CD1  C   -2.826  -3.876  -2.709 1.00 . A A .  57 PHE CD1  1 1 
        5  7595 1 1  57 PHE CD2  C   -1.034  -4.143  -1.087 1.00 . A A .  57 PHE CD2  1 1 
        5  7596 1 1  57 PHE CE1  C   -3.756  -4.352  -1.775 1.00 . A A .  57 PHE CE1  1 1 
        5  7597 1 1  57 PHE CE2  C   -1.972  -4.590  -0.138 1.00 . A A .  57 PHE CE2  1 1 
        5  7598 1 1  57 PHE CG   C   -1.464  -3.773  -2.373 1.00 . A A .  57 PHE CG   1 1 
        5  7599 1 1  57 PHE CZ   C   -3.330  -4.700  -0.483 1.00 . A A .  57 PHE CZ   1 1 
        5  7600 1 1  57 PHE H    H    1.147  -2.915  -5.292 1.00 . A A .  57 PHE H    1 1 
        5  7601 1 1  57 PHE HA   H    0.534  -5.161  -3.714 1.00 . A A .  57 PHE HA   1 1 
        5  7602 1 1  57 PHE HB2  H    0.405  -2.892  -2.924 1.00 . A A .  57 PHE HB2  1 1 
        5  7603 1 1  57 PHE HB3  H   -0.927  -2.527  -4.016 1.00 . A A .  57 PHE HB3  1 1 
        5  7604 1 1  57 PHE HD1  H   -3.155  -3.614  -3.703 1.00 . A A .  57 PHE HD1  1 1 
        5  7605 1 1  57 PHE HD2  H    0.014  -4.085  -0.826 1.00 . A A .  57 PHE HD2  1 1 
        5  7606 1 1  57 PHE HE1  H   -4.798  -4.441  -2.050 1.00 . A A .  57 PHE HE1  1 1 
        5  7607 1 1  57 PHE HE2  H   -1.648  -4.848   0.857 1.00 . A A .  57 PHE HE2  1 1 
        5  7608 1 1  57 PHE HZ   H   -4.052  -5.048   0.241 1.00 . A A .  57 PHE HZ   1 1 
        5  7609 1 1  57 PHE N    N    0.900  -3.890  -5.358 1.00 . A A .  57 PHE N    1 1 
        5  7610 1 1  57 PHE O    O   -1.491  -6.334  -4.649 1.00 . A A .  57 PHE O    1 1 
        5  7611 1 1  58 TRP C    C   -2.662  -6.133  -7.633 1.00 . A A .  58 TRP C    1 1 
        5  7612 1 1  58 TRP CA   C   -3.064  -5.075  -6.597 1.00 . A A .  58 TRP CA   1 1 
        5  7613 1 1  58 TRP CB   C   -3.866  -3.939  -7.240 1.00 . A A .  58 TRP CB   1 1 
        5  7614 1 1  58 TRP CD1  C   -3.384  -1.643  -6.300 1.00 . A A .  58 TRP CD1  1 1 
        5  7615 1 1  58 TRP CD2  C   -5.113  -2.626  -5.268 1.00 . A A .  58 TRP CD2  1 1 
        5  7616 1 1  58 TRP CE2  C   -4.873  -1.387  -4.595 1.00 . A A .  58 TRP CE2  1 1 
        5  7617 1 1  58 TRP CE3  C   -6.175  -3.424  -4.792 1.00 . A A .  58 TRP CE3  1 1 
        5  7618 1 1  58 TRP CG   C   -4.121  -2.773  -6.332 1.00 . A A .  58 TRP CG   1 1 
        5  7619 1 1  58 TRP CH2  C   -6.705  -1.773  -3.072 1.00 . A A .  58 TRP CH2  1 1 
        5  7620 1 1  58 TRP CZ2  C   -5.657  -0.958  -3.513 1.00 . A A .  58 TRP CZ2  1 1 
        5  7621 1 1  58 TRP CZ3  C   -6.965  -3.001  -3.707 1.00 . A A .  58 TRP CZ3  1 1 
        5  7622 1 1  58 TRP H    H   -1.619  -3.572  -6.126 1.00 . A A .  58 TRP H    1 1 
        5  7623 1 1  58 TRP HA   H   -3.707  -5.559  -5.861 1.00 . A A .  58 TRP HA   1 1 
        5  7624 1 1  58 TRP HB2  H   -3.331  -3.580  -8.122 1.00 . A A .  58 TRP HB2  1 1 
        5  7625 1 1  58 TRP HB3  H   -4.822  -4.345  -7.569 1.00 . A A .  58 TRP HB3  1 1 
        5  7626 1 1  58 TRP HD1  H   -2.544  -1.436  -6.950 1.00 . A A .  58 TRP HD1  1 1 
        5  7627 1 1  58 TRP HE1  H   -3.335   0.033  -5.020 1.00 . A A .  58 TRP HE1  1 1 
        5  7628 1 1  58 TRP HE3  H   -6.383  -4.372  -5.268 1.00 . A A .  58 TRP HE3  1 1 
        5  7629 1 1  58 TRP HH2  H   -7.302  -1.446  -2.236 1.00 . A A .  58 TRP HH2  1 1 
        5  7630 1 1  58 TRP HZ2  H   -5.468  -0.017  -3.017 1.00 . A A .  58 TRP HZ2  1 1 
        5  7631 1 1  58 TRP HZ3  H   -7.776  -3.627  -3.361 1.00 . A A .  58 TRP HZ3  1 1 
        5  7632 1 1  58 TRP N    N   -1.894  -4.519  -5.907 1.00 . A A .  58 TRP N    1 1 
        5  7633 1 1  58 TRP NE1  N   -3.803  -0.835  -5.263 1.00 . A A .  58 TRP NE1  1 1 
        5  7634 1 1  58 TRP O    O   -3.397  -7.095  -7.857 1.00 . A A .  58 TRP O    1 1 
        5  7635 1 1  59 LYS C    C   -0.440  -8.299  -8.369 1.00 . A A .  59 LYS C    1 1 
        5  7636 1 1  59 LYS CA   C   -0.817  -6.991  -9.086 1.00 . A A .  59 LYS CA   1 1 
        5  7637 1 1  59 LYS CB   C    0.391  -6.295  -9.730 1.00 . A A .  59 LYS CB   1 1 
        5  7638 1 1  59 LYS CD   C    2.023  -6.123 -11.664 1.00 . A A .  59 LYS CD   1 1 
        5  7639 1 1  59 LYS CE   C    3.209  -5.729 -10.766 1.00 . A A .  59 LYS CE   1 1 
        5  7640 1 1  59 LYS CG   C    1.007  -7.020 -10.933 1.00 . A A .  59 LYS CG   1 1 
        5  7641 1 1  59 LYS H    H   -0.926  -5.173  -7.985 1.00 . A A .  59 LYS H    1 1 
        5  7642 1 1  59 LYS HA   H   -1.525  -7.256  -9.874 1.00 . A A .  59 LYS HA   1 1 
        5  7643 1 1  59 LYS HB2  H    0.083  -5.300 -10.057 1.00 . A A .  59 LYS HB2  1 1 
        5  7644 1 1  59 LYS HB3  H    1.159  -6.190  -8.972 1.00 . A A .  59 LYS HB3  1 1 
        5  7645 1 1  59 LYS HD2  H    2.399  -6.647 -12.544 1.00 . A A .  59 LYS HD2  1 1 
        5  7646 1 1  59 LYS HD3  H    1.502  -5.226 -12.003 1.00 . A A .  59 LYS HD3  1 1 
        5  7647 1 1  59 LYS HE2  H    2.846  -5.548  -9.753 1.00 . A A .  59 LYS HE2  1 1 
        5  7648 1 1  59 LYS HE3  H    3.918  -6.561 -10.714 1.00 . A A .  59 LYS HE3  1 1 
        5  7649 1 1  59 LYS HG2  H    1.502  -7.928 -10.593 1.00 . A A .  59 LYS HG2  1 1 
        5  7650 1 1  59 LYS HG3  H    0.210  -7.284 -11.626 1.00 . A A .  59 LYS HG3  1 1 
        5  7651 1 1  59 LYS HZ1  H    4.455  -4.662 -12.054 1.00 . A A .  59 LYS HZ1  1 1 
        5  7652 1 1  59 LYS HZ2  H    3.217  -3.768 -11.450 1.00 . A A .  59 LYS HZ2  1 1 
        5  7653 1 1  59 LYS HZ3  H    4.467  -4.124 -10.487 1.00 . A A .  59 LYS HZ3  1 1 
        5  7654 1 1  59 LYS N    N   -1.455  -6.009  -8.199 1.00 . A A .  59 LYS N    1 1 
        5  7655 1 1  59 LYS NZ   N    3.885  -4.496 -11.237 1.00 . A A .  59 LYS NZ   1 1 
        5  7656 1 1  59 LYS O    O   -0.313  -9.325  -9.037 1.00 . A A .  59 LYS O    1 1 
        5  7657 1 1  60 VAL C    C   -1.627 -10.323  -6.244 1.00 . A A .  60 VAL C    1 1 
        5  7658 1 1  60 VAL CA   C   -0.267  -9.590  -6.261 1.00 . A A .  60 VAL CA   1 1 
        5  7659 1 1  60 VAL CB   C    0.224  -9.404  -4.805 1.00 . A A .  60 VAL CB   1 1 
        5  7660 1 1  60 VAL CG1  C    0.777 -10.714  -4.217 1.00 . A A .  60 VAL CG1  1 1 
        5  7661 1 1  60 VAL CG2  C    1.333  -8.367  -4.624 1.00 . A A .  60 VAL CG2  1 1 
        5  7662 1 1  60 VAL H    H   -0.331  -7.427  -6.529 1.00 . A A .  60 VAL H    1 1 
        5  7663 1 1  60 VAL HA   H    0.444 -10.246  -6.761 1.00 . A A .  60 VAL HA   1 1 
        5  7664 1 1  60 VAL HB   H   -0.624  -9.082  -4.210 1.00 . A A .  60 VAL HB   1 1 
        5  7665 1 1  60 VAL HG11 H    1.589 -11.092  -4.837 1.00 . A A .  60 VAL HG11 1 1 
        5  7666 1 1  60 VAL HG12 H    1.155 -10.548  -3.208 1.00 . A A .  60 VAL HG12 1 1 
        5  7667 1 1  60 VAL HG13 H   -0.008 -11.466  -4.150 1.00 . A A .  60 VAL HG13 1 1 
        5  7668 1 1  60 VAL HG21 H    1.713  -8.398  -3.605 1.00 . A A .  60 VAL HG21 1 1 
        5  7669 1 1  60 VAL HG22 H    2.144  -8.547  -5.326 1.00 . A A .  60 VAL HG22 1 1 
        5  7670 1 1  60 VAL HG23 H    0.927  -7.374  -4.773 1.00 . A A .  60 VAL HG23 1 1 
        5  7671 1 1  60 VAL N    N   -0.331  -8.317  -7.029 1.00 . A A .  60 VAL N    1 1 
        5  7672 1 1  60 VAL O    O   -1.680 -11.533  -6.023 1.00 . A A .  60 VAL O    1 1 
        5  7673 1 1  61 GLY C    C   -4.862  -9.935  -5.165 1.00 . A A .  61 GLY C    1 1 
        5  7674 1 1  61 GLY CA   C   -4.104 -10.142  -6.486 1.00 . A A .  61 GLY CA   1 1 
        5  7675 1 1  61 GLY H    H   -2.624  -8.640  -6.760 1.00 . A A .  61 GLY H    1 1 
        5  7676 1 1  61 GLY HA2  H   -4.671  -9.639  -7.270 1.00 . A A .  61 GLY HA2  1 1 
        5  7677 1 1  61 GLY HA3  H   -4.095 -11.209  -6.715 1.00 . A A .  61 GLY HA3  1 1 
        5  7678 1 1  61 GLY N    N   -2.733  -9.613  -6.504 1.00 . A A .  61 GLY N    1 1 
        5  7679 1 1  61 GLY O    O   -5.875 -10.600  -4.937 1.00 . A A .  61 GLY O    1 1 
        5  7680 1 1  62 HIS C    C   -6.322  -7.875  -3.193 1.00 . A A .  62 HIS C    1 1 
        5  7681 1 1  62 HIS CA   C   -5.050  -8.720  -3.010 1.00 . A A .  62 HIS CA   1 1 
        5  7682 1 1  62 HIS CB   C   -4.070  -8.025  -2.057 1.00 . A A .  62 HIS CB   1 1 
        5  7683 1 1  62 HIS CD2  C   -1.607  -8.636  -1.876 1.00 . A A .  62 HIS CD2  1 1 
        5  7684 1 1  62 HIS CE1  C   -1.760 -10.589  -0.860 1.00 . A A .  62 HIS CE1  1 1 
        5  7685 1 1  62 HIS CG   C   -2.920  -8.912  -1.654 1.00 . A A .  62 HIS CG   1 1 
        5  7686 1 1  62 HIS H    H   -3.552  -8.533  -4.526 1.00 . A A .  62 HIS H    1 1 
        5  7687 1 1  62 HIS HA   H   -5.344  -9.654  -2.532 1.00 . A A .  62 HIS HA   1 1 
        5  7688 1 1  62 HIS HB2  H   -3.682  -7.125  -2.535 1.00 . A A .  62 HIS HB2  1 1 
        5  7689 1 1  62 HIS HB