NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
605100 2n3l 25650 cing 4-filtered-FRED STAR entry full 884


data_FRED_restraints_with_modified_coordinates_PDB_code_2n3l

# This FRED archive file contains, for PDB entry <2n3l>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2n3l
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2n3l
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        9981.07

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $serine_arginine_rich_protein_1__PfSR1_RRM1 A . 1 1 
    stop_

save_


save_serine_arginine_rich_protein_1__PfSR1_RRM1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "serine arginine rich protein 1  PfSR1 RRM1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE
    _Entity.Number_of_monomers           89

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 GLY . 1 1 
        2 SER . 1 1 
        3 HIS . 1 1 
        4 MET . 1 1 
        5 VAL . 1 1 
        6 ILE . 1 1 
        7 ARG . 1 1 
        8 GLU . 1 1 
        9 SER . 1 1 
       10 VAL . 1 1 
       11 SER . 1 1 
       12 ARG . 1 1 
       13 ILE . 1 1 
       14 TYR . 1 1 
       15 VAL . 1 1 
       16 GLY . 1 1 
       17 ASN . 1 1 
       18 LEU . 1 1 
       19 PRO . 1 1 
       20 SER . 1 1 
       21 HIS . 1 1 
       22 VAL . 1 1 
       23 SER . 1 1 
       24 SER . 1 1 
       25 ARG . 1 1 
       26 ASP . 1 1 
       27 VAL . 1 1 
       28 GLU . 1 1 
       29 ASN . 1 1 
       30 GLU . 1 1 
       31 PHE . 1 1 
       32 ARG . 1 1 
       33 LYS . 1 1 
       34 TYR . 1 1 
       35 GLY . 1 1 
       36 ASN . 1 1 
       37 ILE . 1 1 
       38 LEU . 1 1 
       39 LYS . 1 1 
       40 CYS . 1 1 
       41 ASP . 1 1 
       42 VAL . 1 1 
       43 LYS . 1 1 
       44 LYS . 1 1 
       45 THR . 1 1 
       46 VAL . 1 1 
       47 SER . 1 1 
       48 GLY . 1 1 
       49 ALA . 1 1 
       50 ALA . 1 1 
       51 PHE . 1 1 
       52 ALA . 1 1 
       53 PHE . 1 1 
       54 ILE . 1 1 
       55 GLU . 1 1 
       56 PHE . 1 1 
       57 GLU . 1 1 
       58 ASP . 1 1 
       59 ALA . 1 1 
       60 ARG . 1 1 
       61 ASP . 1 1 
       62 ALA . 1 1 
       63 ALA . 1 1 
       64 ASP . 1 1 
       65 ALA . 1 1 
       66 ILE . 1 1 
       67 LYS . 1 1 
       68 GLU . 1 1 
       69 LYS . 1 1 
       70 ASP . 1 1 
       71 GLY . 1 1 
       72 CYS . 1 1 
       73 ASP . 1 1 
       74 PHE . 1 1 
       75 GLU . 1 1 
       76 GLY . 1 1 
       77 ASN . 1 1 
       78 LYS . 1 1 
       79 LEU . 1 1 
       80 ARG . 1 1 
       81 VAL . 1 1 
       82 GLU . 1 1 
       83 VAL . 1 1 
       84 PRO . 1 1 
       85 PHE . 1 1 
       86 ASN . 1 1 
       87 ALA . 1 1 
       88 ARG . 1 1 
       89 GLU . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY  1  1 1 1 
       SER  2  2 1 1 
       HIS  3  3 1 1 
       MET  4  4 1 1 
       VAL  5  5 1 1 
       ILE  6  6 1 1 
       ARG  7  7 1 1 
       GLU  8  8 1 1 
       SER  9  9 1 1 
       VAL 10 10 1 1 
       SER 11 11 1 1 
       ARG 12 12 1 1 
       ILE 13 13 1 1 
       TYR 14 14 1 1 
       VAL 15 15 1 1 
       GLY 16 16 1 1 
       ASN 17 17 1 1 
       LEU 18 18 1 1 
       PRO 19 19 1 1 
       SER 20 20 1 1 
       HIS 21 21 1 1 
       VAL 22 22 1 1 
       SER 23 23 1 1 
       SER 24 24 1 1 
       ARG 25 25 1 1 
       ASP 26 26 1 1 
       VAL 27 27 1 1 
       GLU 28 28 1 1 
       ASN 29 29 1 1 
       GLU 30 30 1 1 
       PHE 31 31 1 1 
       ARG 32 32 1 1 
       LYS 33 33 1 1 
       TYR 34 34 1 1 
       GLY 35 35 1 1 
       ASN 36 36 1 1 
       ILE 37 37 1 1 
       LEU 38 38 1 1 
       LYS 39 39 1 1 
       CYS 40 40 1 1 
       ASP 41 41 1 1 
       VAL 42 42 1 1 
       LYS 43 43 1 1 
       LYS 44 44 1 1 
       THR 45 45 1 1 
       VAL 46 46 1 1 
       SER 47 47 1 1 
       GLY 48 48 1 1 
       ALA 49 49 1 1 
       ALA 50 50 1 1 
       PHE 51 51 1 1 
       ALA 52 52 1 1 
       PHE 53 53 1 1 
       ILE 54 54 1 1 
       GLU 55 55 1 1 
       PHE 56 56 1 1 
       GLU 57 57 1 1 
       ASP 58 58 1 1 
       ALA 59 59 1 1 
       ARG 60 60 1 1 
       ASP 61 61 1 1 
       ALA 62 62 1 1 
       ALA 63 63 1 1 
       ASP 64 64 1 1 
       ALA 65 65 1 1 
       ILE 66 66 1 1 
       LYS 67 67 1 1 
       GLU 68 68 1 1 
       LYS 69 69 1 1 
       ASP 70 70 1 1 
       GLY 71 71 1 1 
       CYS 72 72 1 1 
       ASP 73 73 1 1 
       PHE 74 74 1 1 
       GLU 75 75 1 1 
       GLY 76 76 1 1 
       ASN 77 77 1 1 
       LYS 78 78 1 1 
       LEU 79 79 1 1 
       ARG 80 80 1 1 
       VAL 81 81 1 1 
       GLU 82 82 1 1 
       VAL 83 83 1 1 
       PRO 84 84 1 1 
       PHE 85 85 1 1 
       ASN 86 86 1 1 
       ALA 87 87 1 1 
       ARG 88 88 1 1 
       GLU 89 89 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
       491 1 . . . 1 1 
       492 1 . . . 1 1 
       493 1 . . . 1 1 
       494 1 . . . 1 1 
       495 1 . . . 1 1 
       496 1 . . . 1 1 
       497 1 . . . 1 1 
       498 1 . . . 1 1 
       499 1 . . . 1 1 
       500 1 . . . 1 1 
       501 1 . . . 1 1 
       502 1 . . . 1 1 
       503 1 . . . 1 1 
       504 1 . . . 1 1 
       505 1 . . . 1 1 
       506 1 . . . 1 1 
       507 1 . . . 1 1 
       508 1 . . . 1 1 
       509 1 . . . 1 1 
       510 1 . . . 1 1 
       511 1 . . . 1 1 
       512 1 . . . 1 1 
       513 1 . . . 1 1 
       514 1 . . . 1 1 
       515 1 . . . 1 1 
       516 1 . . . 1 1 
       517 1 . . . 1 1 
       518 1 . . . 1 1 
       519 1 . . . 1 1 
       520 1 . . . 1 1 
       521 1 . . . 1 1 
       522 1 . . . 1 1 
       523 1 . . . 1 1 
       524 1 . . . 1 1 
       525 1 . . . 1 1 
       526 1 . . . 1 1 
       527 1 . . . 1 1 
       528 1 . . . 1 1 
       529 1 . . . 1 1 
       530 1 . . . 1 1 
       531 1 . . . 1 1 
       532 1 . . . 1 1 
       533 1 . . . 1 1 
       534 1 . . . 1 1 
       535 1 . . . 1 1 
       536 1 . . . 1 1 
       537 1 . . . 1 1 
       538 1 . . . 1 1 
       539 1 . . . 1 1 
       540 1 . . . 1 1 
       541 1 . . . 1 1 
       542 1 . . . 1 1 
       543 1 . . . 1 1 
       544 1 . . . 1 1 
       545 1 . . . 1 1 
       546 1 . . . 1 1 
       547 1 . . . 1 1 
       548 1 . . . 1 1 
       549 1 . . . 1 1 
       550 1 . . . 1 1 
       551 1 . . . 1 1 
       552 1 . . . 1 1 
       553 1 . . . 1 1 
       554 1 . . . 1 1 
       555 1 . . . 1 1 
       556 1 . . . 1 1 
       557 1 . . . 1 1 
       558 1 . . . 1 1 
       559 1 . . . 1 1 
       560 1 . . . 1 1 
       561 1 . . . 1 1 
       562 1 . . . 1 1 
       563 1 . . . 1 1 
       564 1 . . . 1 1 
       565 1 . . . 1 1 
       566 1 . . . 1 1 
       567 1 . . . 1 1 
       568 1 . . . 1 1 
       569 1 . . . 1 1 
       570 1 . . . 1 1 
       571 1 . . . 1 1 
       572 1 . . . 1 1 
       573 1 . . . 1 1 
       574 1 . . . 1 1 
       575 1 . . . 1 1 
       576 1 . . . 1 1 
       577 1 . . . 1 1 
       578 1 . . . 1 1 
       579 1 . . . 1 1 
       580 1 . . . 1 1 
       581 1 . . . 1 1 
       582 1 . . . 1 1 
       583 1 . . . 1 1 
       584 1 . . . 1 1 
       585 1 . . . 1 1 
       586 1 . . . 1 1 
       587 1 . . . 1 1 
       588 1 . . . 1 1 
       589 1 . . . 1 1 
       590 1 . . . 1 1 
       591 1 . . . 1 1 
       592 1 . . . 1 1 
       593 1 . . . 1 1 
       594 1 . . . 1 1 
       595 1 . . . 1 1 
       596 1 . . . 1 1 
       597 1 . . . 1 1 
       598 1 . . . 1 1 
       599 1 . . . 1 1 
       600 1 . . . 1 1 
       601 1 . . . 1 1 
       602 1 . . . 1 1 
       603 1 . . . 1 1 
       604 1 . . . 1 1 
       605 1 . . . 1 1 
       606 1 . . . 1 1 
       607 1 . . . 1 1 
       608 1 . . . 1 1 
       609 1 . . . 1 1 
       610 1 . . . 1 1 
       611 1 . . . 1 1 
       612 1 . . . 1 1 
       613 1 . . . 1 1 
       614 1 . . . 1 1 
       615 1 . . . 1 1 
       616 1 . . . 1 1 
       617 1 . . . 1 1 
       618 1 . . . 1 1 
       619 1 . . . 1 1 
       620 1 . . . 1 1 
       621 1 . . . 1 1 
       622 1 . . . 1 1 
       623 1 . . . 1 1 
       624 1 . . . 1 1 
       625 1 . . . 1 1 
       626 1 . . . 1 1 
       627 1 . . . 1 1 
       628 1 . . . 1 1 
       629 1 . . . 1 1 
       630 1 . . . 1 1 
       631 1 . . . 1 1 
       632 1 . . . 1 1 
       633 1 . . . 1 1 
       634 1 . . . 1 1 
       635 1 . . . 1 1 
       636 1 . . . 1 1 
       637 1 . . . 1 1 
       638 1 . . . 1 1 
       639 1 . . . 1 1 
       640 1 . . . 1 1 
       641 1 . . . 1 1 
       642 1 . . . 1 1 
       643 1 . . . 1 1 
       644 1 . . . 1 1 
       645 1 . . . 1 1 
       646 1 . . . 1 1 
       647 1 . . . 1 1 
       648 1 . . . 1 1 
       649 1 . . . 1 1 
       650 1 . . . 1 1 
       651 1 . . . 1 1 
       652 1 . . . 1 1 
       653 1 . . . 1 1 
       654 1 . . . 1 1 
       655 1 . . . 1 1 
       656 1 . . . 1 1 
       657 1 . . . 1 1 
       658 1 . . . 1 1 
       659 1 . . . 1 1 
       660 1 . . . 1 1 
       661 1 . . . 1 1 
       662 1 . . . 1 1 
       663 1 . . . 1 1 
       664 1 . . . 1 1 
       665 1 . . . 1 1 
       666 1 . . . 1 1 
       667 1 . . . 1 1 
       668 1 . . . 1 1 
       669 1 . . . 1 1 
       670 1 . . . 1 1 
       671 1 . . . 1 1 
       672 1 . . . 1 1 
       673 1 . . . 1 1 
       674 1 . . . 1 1 
       675 1 . . . 1 1 
       676 1 . . . 1 1 
       677 1 . . . 1 1 
       678 1 . . . 1 1 
       679 1 . . . 1 1 
       680 1 . . . 1 1 
       681 1 . . . 1 1 
       682 1 . . . 1 1 
       683 1 . . . 1 1 
       684 1 . . . 1 1 
       685 1 . . . 1 1 
       686 1 . . . 1 1 
       687 1 . . . 1 1 
       688 1 . . . 1 1 
       689 1 . . . 1 1 
       690 1 . . . 1 1 
       691 1 . . . 1 1 
       692 1 . . . 1 1 
       693 1 . . . 1 1 
       694 1 . . . 1 1 
       695 1 . . . 1 1 
       696 1 . . . 1 1 
       697 1 . . . 1 1 
       698 1 . . . 1 1 
       699 1 . . . 1 1 
       700 1 . . . 1 1 
       701 1 . . . 1 1 
       702 1 . . . 1 1 
       703 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1 59 ALA H   . 59 ALA H    1 1 
         1 1 2 1 1 61 ASP H   . 61 ASP H    1 1 
         2 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
         2 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
         3 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
         3 1 2 1 1 44 LYS H   . 44 LYS H    1 1 
         4 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
         4 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
         5 1 1 1 1 59 ALA H   . 59 ALA H    1 1 
         5 1 2 1 1 88 ARG QG  . 88 ARG QG   1 1 
         6 1 1 1 1 41 ASP H   . 41 ASP H    1 1 
         6 1 2 1 1 53 PHE H   . 53 PHE H    1 1 
         7 1 1 1 1 40 CYS H   . 40 CYS H    1 1 
         7 1 2 1 1 41 ASP H   . 41 ASP H    1 1 
         8 1 1 1 1 41 ASP H   . 41 ASP H    1 1 
         8 1 2 1 1 42 VAL HA  . 42 VAL HA   1 1 
         9 1 1 1 1 40 CYS QB  . 40 CYS HB2  1 1 
         9 1 2 1 1 41 ASP H   . 41 ASP H    1 1 
        10 1 1 1 1 74 PHE H   . 74 PHE H    1 1 
        10 1 2 1 1 76 GLY H   . 76 GLY H    1 1 
        11 1 1 1 1 73 ASP H   . 73 ASP H    1 1 
        11 1 2 1 1 74 PHE H   . 74 PHE H    1 1 
        12 1 1 1 1 74 PHE H   . 74 PHE H    1 1 
        12 1 2 1 1 77 ASN QB  . 77 ASN HB2  1 1 
        13 1 1 1 1 74 PHE H   . 74 PHE H    1 1 
        13 1 2 1 1 78 LYS QE  . 78 LYS QE   1 1 
        14 1 1 1 1 72 CYS QB  . 72 CYS HB3  1 1 
        14 1 2 1 1 74 PHE H   . 74 PHE H    1 1 
        15 1 1 1 1 74 PHE H   . 74 PHE H    1 1 
        15 1 2 1 1 75 GLU H   . 75 GLU H    1 1 
        16 1 1 1 1 79 LEU H   . 79 LEU H    1 1 
        16 1 2 1 1 79 LEU QB  . 79 LEU QB   1 1 
        17 1 1 1 1 78 LYS QG  . 78 LYS QG   1 1 
        17 1 2 1 1 79 LEU H   . 79 LEU H    1 1 
        18 1 1 1 1 79 LEU H   . 79 LEU H    1 1 
        18 1 2 1 1 79 LEU HG  . 79 LEU HG   1 1 
        19 1 1 1 1 78 LYS H   . 78 LYS H    1 1 
        19 1 2 1 1 79 LEU H   . 79 LEU H    1 1 
        20 1 1 1 1 79 LEU H   . 79 LEU H    1 1 
        20 1 2 1 1 80 ARG HA  . 80 ARG HA   1 1 
        21 1 1 1 1 71 GLY H   . 71 GLY H    1 1 
        21 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
        22 1 1 1 1 70 ASP HA  . 70 ASP HA   1 1 
        22 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
        23 1 1 1 1 81 VAL H   . 81 VAL H    1 1 
        23 1 2 1 1 82 GLU QB  . 82 GLU HB3  1 1 
        24 1 1 1 1 80 ARG QD  . 80 ARG HD3  1 1 
        24 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
        25 1 1 1 1 70 ASP QB  . 70 ASP HB2  1 1 
        25 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
        26 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
        26 1 2 1 1 56 PHE HA  . 56 PHE HA   1 1 
        27 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
        27 1 2 1 1 55 GLU H   . 55 GLU H    1 1 
        28 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
        28 1 2 1 1 58 ASP H   . 58 ASP H    1 1 
        29 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
        29 1 2 1 1 39 LYS H   . 39 LYS H    1 1 
        30 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
        30 1 2 1 1 38 LEU QB  . 38 LEU QB   1 1 
        31 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
        31 1 2 1 1 38 LEU QD  . 38 LEU QD1  1 1 
        32 1 1 1 1 37 ILE H   . 37 ILE H    1 1 
        32 1 2 1 1 38 LEU QD  . 38 LEU QD2  1 1 
        33 1 1 1 1 35 GLY QA  . 35 GLY HA2  1 1 
        33 1 2 1 1 37 ILE H   . 37 ILE H    1 1 
        34 1 1 1 1 28 GLU HA  . 28 GLU HA   1 1 
        34 1 2 1 1 37 ILE H   . 37 ILE H    1 1 
        35 1 1 1 1 33 LYS HA  . 33 LYS HA   1 1 
        35 1 2 1 1 37 ILE H   . 37 ILE H    1 1 
        36 1 1 1 1 37 ILE H   . 37 ILE H    1 1 
        36 1 2 1 1 38 LEU H   . 38 LEU H    1 1 
        37 1 1 1 1  6 ILE HB  .  6 ILE HB   1 1 
        37 1 2 1 1  7 ARG H   .  7 ARG H    1 1 
        38 1 1 1 1  6 ILE MG  .  6 ILE QG2  1 1 
        38 1 2 1 1  7 ARG H   .  7 ARG H    1 1 
        39 1 1 1 1  5 VAL QG  .  5 VAL QG2  1 1 
        39 1 2 1 1  7 ARG H   .  7 ARG H    1 1 
        40 1 1 1 1 15 VAL H   . 15 VAL H    1 1 
        40 1 2 1 1 15 VAL QG  . 15 VAL QG2  1 1 
        41 1 1 1 1  7 ARG H   .  7 ARG H    1 1 
        41 1 2 1 1  8 GLU QB  .  8 GLU HB3  1 1 
        42 1 1 1 1 56 PHE H   . 56 PHE H    1 1 
        42 1 2 1 1 57 GLU H   . 57 GLU H    1 1 
        43 1 1 1 1 39 LYS QE  . 39 LYS QE   1 1 
        43 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
        44 1 1 1 1 39 LYS H   . 39 LYS H    1 1 
        44 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
        45 1 1 1 1 39 LYS QG  . 39 LYS QG   1 1 
        45 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
        46 1 1 1 1 14 TYR H   . 14 TYR H    1 1 
        46 1 2 1 1 15 VAL H   . 15 VAL H    1 1 
        47 1 1 1 1 49 ALA H   . 49 ALA H    1 1 
        47 1 2 1 1 50 ALA H   . 50 ALA H    1 1 
        48 1 1 1 1 45 THR H   . 45 THR H    1 1 
        48 1 2 1 1 49 ALA H   . 49 ALA H    1 1 
        49 1 1 1 1 48 GLY H   . 48 GLY H    1 1 
        49 1 2 1 1 49 ALA H   . 49 ALA H    1 1 
        50 1 1 1 1 13 ILE HB  . 13 ILE HB   1 1 
        50 1 2 1 1 14 TYR H   . 14 TYR H    1 1 
        51 1 1 1 1 12 ARG H   . 12 ARG H    1 1 
        51 1 2 1 1 13 ILE H   . 13 ILE H    1 1 
        52 1 1 1 1 12 ARG H   . 12 ARG H    1 1 
        52 1 2 1 1 13 ILE QG  . 13 ILE HG12 1 1 
        53 1 1 1 1 10 VAL QG  . 10 VAL QG2  1 1 
        53 1 2 1 1 12 ARG H   . 12 ARG H    1 1 
        54 1 1 1 1 53 PHE QB  . 53 PHE QB   1 1 
        54 1 2 1 1 54 ILE H   . 54 ILE H    1 1 
        55 1 1 1 1 73 ASP H   . 73 ASP H    1 1 
        55 1 2 1 1 74 PHE QD  . 74 PHE QD   1 1 
        56 1 1 1 1 79 LEU HG  . 79 LEU HG   1 1 
        56 1 2 1 1 80 ARG H   . 80 ARG H    1 1 
        57 1 1 1 1 78 LYS QG  . 78 LYS QG   1 1 
        57 1 2 1 1 80 ARG H   . 80 ARG H    1 1 
        58 1 1 1 1 79 LEU MD2 . 79 LEU QD2  1 1 
        58 1 2 1 1 80 ARG H   . 80 ARG H    1 1 
        59 1 1 1 1 79 LEU H   . 79 LEU H    1 1 
        59 1 2 1 1 80 ARG H   . 80 ARG H    1 1 
        60 1 1 1 1 79 LEU HA  . 79 LEU HA   1 1 
        60 1 2 1 1 80 ARG H   . 80 ARG H    1 1 
        61 1 1 1 1 72 CYS QB  . 72 CYS HB3  1 1 
        61 1 2 1 1 73 ASP H   . 73 ASP H    1 1 
        62 1 1 1 1 64 ASP H   . 64 ASP H    1 1 
        62 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
        63 1 1 1 1 65 ALA H   . 65 ALA H    1 1 
        63 1 2 1 1 66 ILE H   . 66 ILE H    1 1 
        64 1 1 1 1 34 TYR QD  . 34 TYR QD   1 1 
        64 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
        65 1 1 1 1 33 LYS QE  . 33 LYS QE   1 1 
        65 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
        66 1 1 1 1 65 ALA H   . 65 ALA H    1 1 
        66 1 2 1 1 66 ILE HA  . 66 ILE HA   1 1 
        67 1 1 1 1 34 TYR QE  . 34 TYR QE   1 1 
        67 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
        68 1 1 1 1 62 ALA H   . 62 ALA H    1 1 
        68 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
        69 1 1 1 1 81 VAL HB  . 81 VAL HB   1 1 
        69 1 2 1 1 82 GLU H   . 82 GLU H    1 1 
        70 1 1 1 1 82 GLU H   . 82 GLU H    1 1 
        70 1 2 1 1 82 GLU HG3 . 82 GLU HG3  1 1 
        71 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
        71 1 2 1 1 82 GLU H   . 82 GLU H    1 1 
        72 1 1 1 1 81 VAL QG  . 81 VAL QG2  1 1 
        72 1 2 1 1 82 GLU H   . 82 GLU H    1 1 
        73 1 1 1 1 66 ILE MG  . 66 ILE QG2  1 1 
        73 1 2 1 1 82 GLU H   . 82 GLU H    1 1 
        74 1 1 1 1 31 PHE H   . 31 PHE H    1 1 
        74 1 2 1 1 32 ARG H   . 32 ARG H    1 1 
        75 1 1 1 1 30 GLU H   . 30 GLU H    1 1 
        75 1 2 1 1 32 ARG H   . 32 ARG H    1 1 
        76 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
        76 1 2 1 1 34 TYR H   . 34 TYR H    1 1 
        77 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
        77 1 2 1 1 35 GLY H   . 35 GLY H    1 1 
        78 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
        78 1 2 1 1 34 TYR QD  . 34 TYR QD   1 1 
        79 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
        79 1 2 1 1 32 ARG HB3 . 32 ARG HB3  1 1 
        80 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
        80 1 2 1 1 33 LYS QG  . 33 LYS HG2  1 1 
        81 1 1 1 1 27 VAL H   . 27 VAL H    1 1 
        81 1 2 1 1 28 GLU H   . 28 GLU H    1 1 
        82 1 1 1 1 28 GLU H   . 28 GLU H    1 1 
        82 1 2 1 1 30 GLU H   . 30 GLU H    1 1 
        83 1 1 1 1 28 GLU H   . 28 GLU H    1 1 
        83 1 2 1 1 28 GLU QG  . 28 GLU QG   1 1 
        84 1 1 1 1 25 ARG HA  . 25 ARG HA   1 1 
        84 1 2 1 1 28 GLU H   . 28 GLU H    1 1 
        85 1 1 1 1 78 LYS H   . 78 LYS H    1 1 
        85 1 2 1 1 78 LYS QE  . 78 LYS QE   1 1 
        86 1 1 1 1 77 ASN QB  . 77 ASN HB2  1 1 
        86 1 2 1 1 78 LYS H   . 78 LYS H    1 1 
        87 1 1 1 1 78 LYS H   . 78 LYS H    1 1 
        87 1 2 1 1 78 LYS HB2 . 78 LYS HB2  1 1 
        88 1 1 1 1 78 LYS H   . 78 LYS H    1 1 
        88 1 2 1 1 78 LYS QD  . 78 LYS QD   1 1 
        89 1 1 1 1 85 PHE H   . 85 PHE H    1 1 
        89 1 2 1 1 86 ASN HA  . 86 ASN HA   1 1 
        90 1 1 1 1 23 SER HA  . 23 SER HA   1 1 
        90 1 2 1 1 25 ARG H   . 25 ARG H    1 1 
        91 1 1 1 1 23 SER HB3 . 23 SER HB3  1 1 
        91 1 2 1 1 25 ARG H   . 25 ARG H    1 1 
        92 1 1 1 1 25 ARG QG  . 25 ARG QG   1 1 
        92 1 2 1 1 28 GLU H   . 28 GLU H    1 1 
        93 1 1 1 1 74 PHE H   . 74 PHE H    1 1 
        93 1 2 1 1 77 ASN H   . 77 ASN H    1 1 
        94 1 1 1 1 77 ASN H   . 77 ASN H    1 1 
        94 1 2 1 1 77 ASN QB  . 77 ASN HB2  1 1 
        95 1 1 1 1 77 ASN H   . 77 ASN H    1 1 
        95 1 2 1 1 78 LYS QE  . 78 LYS QE   1 1 
        96 1 1 1 1 82 GLU H   . 82 GLU H    1 1 
        96 1 2 1 1 83 VAL H   . 83 VAL H    1 1 
        97 1 1 1 1 82 GLU QB  . 82 GLU HB2  1 1 
        97 1 2 1 1 83 VAL H   . 83 VAL H    1 1 
        98 1 1 1 1 82 GLU HG2 . 82 GLU HG2  1 1 
        98 1 2 1 1 83 VAL H   . 83 VAL H    1 1 
        99 1 1 1 1 66 ILE MG  . 66 ILE QG2  1 1 
        99 1 2 1 1 83 VAL H   . 83 VAL H    1 1 
       100 1 1 1 1 82 GLU HG3 . 82 GLU HG3  1 1 
       100 1 2 1 1 83 VAL H   . 83 VAL H    1 1 
       101 1 1 1 1 61 ASP H   . 61 ASP H    1 1 
       101 1 2 1 1 63 ALA MB  . 63 ALA QB   1 1 
       102 1 1 1 1 60 ARG H   . 60 ARG H    1 1 
       102 1 2 1 1 61 ASP H   . 61 ASP H    1 1 
       103 1 1 1 1 61 ASP H   . 61 ASP H    1 1 
       103 1 2 1 1 62 ALA H   . 62 ALA H    1 1 
       104 1 1 1 1 57 GLU H   . 57 GLU H    1 1 
       104 1 2 1 1 58 ASP H   . 58 ASP H    1 1 
       105 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
       105 1 2 1 1 57 GLU H   . 57 GLU H    1 1 
       106 1 1 1 1 86 ASN H   . 86 ASN H    1 1 
       106 1 2 1 1 87 ALA H   . 87 ALA H    1 1 
       107 1 1 1 1 45 THR HA  . 45 THR HA   1 1 
       107 1 2 1 1 46 VAL H   . 46 VAL H    1 1 
       108 1 1 1 1 44 LYS QD  . 44 LYS QD   1 1 
       108 1 2 1 1 46 VAL H   . 46 VAL H    1 1 
       109 1 1 1 1 44 LYS QG  . 44 LYS QG   1 1 
       109 1 2 1 1 46 VAL H   . 46 VAL H    1 1 
       110 1 1 1 1 52 ALA H   . 52 ALA H    1 1 
       110 1 2 1 1 53 PHE H   . 53 PHE H    1 1 
       111 1 1 1 1 51 PHE H   . 51 PHE H    1 1 
       111 1 2 1 1 52 ALA H   . 52 ALA H    1 1 
       112 1 1 1 1 45 THR HB  . 45 THR HB   1 1 
       112 1 2 1 1 46 VAL H   . 46 VAL H    1 1 
       113 1 1 1 1 46 VAL H   . 46 VAL H    1 1 
       113 1 2 1 1 46 VAL MG2 . 46 VAL QG2  1 1 
       114 1 1 1 1 88 ARG H   . 88 ARG H    1 1 
       114 1 2 1 1 89 GLU H   . 89 GLU H    1 1 
       115 1 1 1 1 63 ALA H   . 63 ALA H    1 1 
       115 1 2 1 1 64 ASP H   . 64 ASP H    1 1 
       116 1 1 1 1 33 LYS QE  . 33 LYS QE   1 1 
       116 1 2 1 1 64 ASP H   . 64 ASP H    1 1 
       117 1 1 1 1 87 ALA MB  . 87 ALA QB   1 1 
       117 1 2 1 1 88 ARG H   . 88 ARG H    1 1 
       118 1 1 1 1 10 VAL H   . 10 VAL H    1 1 
       118 1 2 1 1 11 SER HA  . 11 SER HA   1 1 
       119 1 1 1 1 10 VAL H   . 10 VAL H    1 1 
       119 1 2 1 1 11 SER QB  . 11 SER HB2  1 1 
       120 1 1 1 1 62 ALA H   . 62 ALA H    1 1 
       120 1 2 1 1 63 ALA MB  . 63 ALA QB   1 1 
       121 1 1 1 1 33 LYS QE  . 33 LYS QE   1 1 
       121 1 2 1 1 62 ALA H   . 62 ALA H    1 1 
       122 1 1 1 1 27 VAL H   . 27 VAL H    1 1 
       122 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       123 1 1 1 1 25 ARG QD  . 25 ARG QD   1 1 
       123 1 2 1 1 27 VAL H   . 27 VAL H    1 1 
       124 1 1 1 1 26 ASP QB  . 26 ASP HB2  1 1 
       124 1 2 1 1 27 VAL H   . 27 VAL H    1 1 
       125 1 1 1 1 23 SER H   . 23 SER H    1 1 
       125 1 2 1 1 27 VAL H   . 27 VAL H    1 1 
       126 1 1 1 1 25 ARG H   . 25 ARG H    1 1 
       126 1 2 1 1 27 VAL H   . 27 VAL H    1 1 
       127 1 1 1 1 27 VAL H   . 27 VAL H    1 1 
       127 1 2 1 1 28 GLU HA  . 28 GLU HA   1 1 
       128 1 1 1 1 72 CYS H   . 72 CYS H    1 1 
       128 1 2 1 1 82 GLU QB  . 82 GLU HB2  1 1 
       129 1 1 1 1 72 CYS H   . 72 CYS H    1 1 
       129 1 2 1 1 73 ASP H   . 73 ASP H    1 1 
       130 1 1 1 1 60 ARG H   . 60 ARG H    1 1 
       130 1 2 1 1 88 ARG QG  . 88 ARG QG   1 1 
       131 1 1 1 1 59 ALA H   . 59 ALA H    1 1 
       131 1 2 1 1 60 ARG H   . 60 ARG H    1 1 
       132 1 1 1 1 60 ARG H   . 60 ARG H    1 1 
       132 1 2 1 1 62 ALA H   . 62 ALA H    1 1 
       133 1 1 1 1 22 VAL H   . 22 VAL H    1 1 
       133 1 2 1 1 23 SER H   . 23 SER H    1 1 
       134 1 1 1 1 23 SER H   . 23 SER H    1 1 
       134 1 2 1 1 23 SER HB2 . 23 SER HB2  1 1 
       135 1 1 1 1 22 VAL QG  . 22 VAL QG1  1 1 
       135 1 2 1 1 23 SER H   . 23 SER H    1 1 
       136 1 1 1 1 72 CYS H   . 72 CYS H    1 1 
       136 1 2 1 1 82 GLU H   . 82 GLU H    1 1 
       137 1 1 1 1 72 CYS H   . 72 CYS H    1 1 
       137 1 2 1 1 79 LEU H   . 79 LEU H    1 1 
       138 1 1 1 1 71 GLY H   . 71 GLY H    1 1 
       138 1 2 1 1 72 CYS H   . 72 CYS H    1 1 
       139 1 1 1 1 72 CYS H   . 72 CYS H    1 1 
       139 1 2 1 1 80 ARG H   . 80 ARG H    1 1 
       140 1 1 1 1 23 SER H   . 23 SER H    1 1 
       140 1 2 1 1 23 SER HB3 . 23 SER HB3  1 1 
       141 1 1 1 1 23 SER H   . 23 SER H    1 1 
       141 1 2 1 1 25 ARG QD  . 25 ARG QD   1 1 
       142 1 1 1 1 70 ASP H   . 70 ASP H    1 1 
       142 1 2 1 1 71 GLY H   . 71 GLY H    1 1 
       143 1 1 1 1 69 LYS H   . 69 LYS H    1 1 
       143 1 2 1 1 70 ASP H   . 70 ASP H    1 1 
       144 1 1 1 1 69 LYS QB  . 69 LYS QB   1 1 
       144 1 2 1 1 70 ASP H   . 70 ASP H    1 1 
       145 1 1 1 1 70 ASP H   . 70 ASP H    1 1 
       145 1 2 1 1 81 VAL HB  . 81 VAL HB   1 1 
       146 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       146 1 2 1 1 70 ASP H   . 70 ASP H    1 1 
       147 1 1 1 1 70 ASP H   . 70 ASP H    1 1 
       147 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       148 1 1 1 1 25 ARG HB3 . 25 ARG HB3  1 1 
       148 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       149 1 1 1 1 30 GLU H   . 30 GLU H    1 1 
       149 1 2 1 1 31 PHE H   . 31 PHE H    1 1 
       150 1 1 1 1 27 VAL HA  . 27 VAL HA   1 1 
       150 1 2 1 1 30 GLU H   . 30 GLU H    1 1 
       151 1 1 1 1 30 GLU H   . 30 GLU H    1 1 
       151 1 2 1 1 31 PHE QB  . 31 PHE HB2  1 1 
       152 1 1 1 1 30 GLU H   . 30 GLU H    1 1 
       152 1 2 1 1 30 GLU QG  . 30 GLU QG   1 1 
       153 1 1 1 1 23 SER H   . 23 SER H    1 1 
       153 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       154 1 1 1 1 26 ASP H   . 26 ASP H    1 1 
       154 1 2 1 1 28 GLU H   . 28 GLU H    1 1 
       155 1 1 1 1 25 ARG QD  . 25 ARG QD   1 1 
       155 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       156 1 1 1 1 25 ARG HB2 . 25 ARG HB2  1 1 
       156 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       157 1 1 1 1 25 ARG H   . 25 ARG H    1 1 
       157 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       158 1 1 1 1 50 ALA H   . 50 ALA H    1 1 
       158 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       159 1 1 1 1 43 LYS QB  . 43 LYS HB2  1 1 
       159 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       160 1 1 1 1 43 LYS QG  . 43 LYS QG   1 1 
       160 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       161 1 1 1 1 45 THR H   . 45 THR H    1 1 
       161 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       162 1 1 1 1 44 LYS H   . 44 LYS H    1 1 
       162 1 2 1 1 45 THR H   . 45 THR H    1 1 
       163 1 1 1 1 43 LYS QB  . 43 LYS HB2  1 1 
       163 1 2 1 1 44 LYS H   . 44 LYS H    1 1 
       164 1 1 1 1 43 LYS QG  . 43 LYS QG   1 1 
       164 1 2 1 1 44 LYS H   . 44 LYS H    1 1 
       165 1 1 1 1 24 SER H   . 24 SER H    1 1 
       165 1 2 1 1 42 VAL HB  . 42 VAL HB   1 1 
       166 1 1 1 1 24 SER H   . 24 SER H    1 1 
       166 1 2 1 1 25 ARG H   . 25 ARG H    1 1 
       167 1 1 1 1 24 SER H   . 24 SER H    1 1 
       167 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       168 1 1 1 1 23 SER HA  . 23 SER HA   1 1 
       168 1 2 1 1 24 SER H   . 24 SER H    1 1 
       169 1 1 1 1 23 SER HB2 . 23 SER HB2  1 1 
       169 1 2 1 1 24 SER H   . 24 SER H    1 1 
       170 1 1 1 1 24 SER H   . 24 SER H    1 1 
       170 1 2 1 1 25 ARG HA  . 25 ARG HA   1 1 
       171 1 1 1 1 23 SER HB3 . 23 SER HB3  1 1 
       171 1 2 1 1 24 SER H   . 24 SER H    1 1 
       172 1 1 1 1 10 VAL H   . 10 VAL H    1 1 
       172 1 2 1 1 11 SER H   . 11 SER H    1 1 
       173 1 1 1 1  9 SER QB  .  9 SER QB   1 1 
       173 1 2 1 1 11 SER H   . 11 SER H    1 1 
       174 1 1 1 1 67 LYS H   . 67 LYS H    1 1 
       174 1 2 1 1 67 LYS QD  . 67 LYS HD3  1 1 
       175 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       175 1 2 1 1 67 LYS H   . 67 LYS H    1 1 
       176 1 1 1 1 66 ILE MG  . 66 ILE QG2  1 1 
       176 1 2 1 1 67 LYS H   . 67 LYS H    1 1 
       177 1 1 1 1 67 LYS H   . 67 LYS H    1 1 
       177 1 2 1 1 68 GLU H   . 68 GLU H    1 1 
       178 1 1 1 1 61 ASP H   . 61 ASP H    1 1 
       178 1 2 1 1 63 ALA H   . 63 ALA H    1 1 
       179 1 1 1 1 62 ALA H   . 62 ALA H    1 1 
       179 1 2 1 1 63 ALA H   . 63 ALA H    1 1 
       180 1 1 1 1 60 ARG H   . 60 ARG H    1 1 
       180 1 2 1 1 63 ALA H   . 63 ALA H    1 1 
       181 1 1 1 1 33 LYS H   . 33 LYS H    1 1 
       181 1 2 1 1 34 TYR H   . 34 TYR H    1 1 
       182 1 1 1 1 64 ASP HA  . 64 ASP HA   1 1 
       182 1 2 1 1 67 LYS H   . 67 LYS H    1 1 
       183 1 1 1 1 67 LYS H   . 67 LYS H    1 1 
       183 1 2 1 1 70 ASP HA  . 70 ASP HA   1 1 
       184 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
       184 1 2 1 1 33 LYS H   . 33 LYS H    1 1 
       185 1 1 1 1 66 ILE H   . 66 ILE H    1 1 
       185 1 2 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       186 1 1 1 1 39 LYS H   . 39 LYS H    1 1 
       186 1 2 1 1 55 GLU QG  . 55 GLU HG3  1 1 
       187 1 1 1 1 56 PHE HA  . 56 PHE HA   1 1 
       187 1 2 1 1 58 ASP H   . 58 ASP H    1 1 
       188 1 1 1 1  9 SER H   .  9 SER H    1 1 
       188 1 2 1 1 10 VAL H   . 10 VAL H    1 1 
       189 1 1 1 1  8 GLU QG  .  8 GLU QG   1 1 
       189 1 2 1 1  9 SER H   .  9 SER H    1 1 
       190 1 1 1 1 34 TYR H   . 34 TYR H    1 1 
       190 1 2 1 1 34 TYR QD  . 34 TYR QD   1 1 
       191 1 1 1 1 34 TYR H   . 34 TYR H    1 1 
       191 1 2 1 1 35 GLY H   . 35 GLY H    1 1 
       192 1 1 1 1 31 PHE HA  . 31 PHE HA   1 1 
       192 1 2 1 1 34 TYR H   . 34 TYR H    1 1 
       193 1 1 1 1 39 LYS H   . 39 LYS H    1 1 
       193 1 2 1 1 55 GLU H   . 55 GLU H    1 1 
       194 1 1 1 1 38 LEU QB  . 38 LEU QB   1 1 
       194 1 2 1 1 39 LYS H   . 39 LYS H    1 1 
       195 1 1 1 1 37 ILE MG  . 37 ILE QG2  1 1 
       195 1 2 1 1 39 LYS H   . 39 LYS H    1 1 
       196 1 1 1 1 66 ILE H   . 66 ILE H    1 1 
       196 1 2 1 1 67 LYS H   . 67 LYS H    1 1 
       197 1 1 1 1 42 VAL H   . 42 VAL H    1 1 
       197 1 2 1 1 53 PHE H   . 53 PHE H    1 1 
       198 1 1 1 1 18 LEU H   . 18 LEU H    1 1 
       198 1 2 1 1 50 ALA H   . 50 ALA H    1 1 
       199 1 1 1 1 18 LEU H   . 18 LEU H    1 1 
       199 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       200 1 1 1 1 20 SER H   . 20 SER H    1 1 
       200 1 2 1 1 20 SER QB  . 20 SER QB   1 1 
       201 1 1 1 1 35 GLY QA  . 35 GLY HA2  1 1 
       201 1 2 1 1 36 ASN H   . 36 ASN H    1 1 
       202 1 1 1 1 28 GLU H   . 28 GLU H    1 1 
       202 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       203 1 1 1 1 26 ASP H   . 26 ASP H    1 1 
       203 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       204 1 1 1 1 29 ASN H   . 29 ASN H    1 1 
       204 1 2 1 1 30 GLU H   . 30 GLU H    1 1 
       205 1 1 1 1 27 VAL HA  . 27 VAL HA   1 1 
       205 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       206 1 1 1 1 28 GLU QG  . 28 GLU QG   1 1 
       206 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       207 1 1 1 1 28 GLU QB  . 28 GLU HB3  1 1 
       207 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       208 1 1 1 1 29 ASN H   . 29 ASN H    1 1 
       208 1 2 1 1 30 GLU QB  . 30 GLU QB   1 1 
       209 1 1 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       209 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       210 1 1 1 1 13 ILE H   . 13 ILE H    1 1 
       210 1 2 1 1 14 TYR HA  . 14 TYR HA   1 1 
       211 1 1 1 1 67 LYS H   . 67 LYS H    1 1 
       211 1 2 1 1 69 LYS H   . 69 LYS H    1 1 
       212 1 1 1 1 69 LYS H   . 69 LYS H    1 1 
       212 1 2 1 1 69 LYS QE  . 69 LYS QE   1 1 
       213 1 1 1 1 68 GLU QG  . 68 GLU HG3  1 1 
       213 1 2 1 1 69 LYS H   . 69 LYS H    1 1 
       214 1 1 1 1 67 LYS QD  . 67 LYS HD2  1 1 
       214 1 2 1 1 69 LYS H   . 69 LYS H    1 1 
       215 1 1 1 1 16 GLY H   . 16 GLY H    1 1 
       215 1 2 1 1 17 ASN H   . 17 ASN H    1 1 
       216 1 1 1 1 17 ASN H   . 17 ASN H    1 1 
       216 1 2 1 1 18 LEU H   . 18 LEU H    1 1 
       217 1 1 1 1 30 GLU QG  . 30 GLU QG   1 1 
       217 1 2 1 1 31 PHE H   . 31 PHE H    1 1 
       218 1 1 1 1 27 VAL HB  . 27 VAL HB   1 1 
       218 1 2 1 1 31 PHE H   . 31 PHE H    1 1 
       219 1 1 1 1 30 GLU QB  . 30 GLU QB   1 1 
       219 1 2 1 1 31 PHE H   . 31 PHE H    1 1 
       220 1 1 1 1 68 GLU H   . 68 GLU H    1 1 
       220 1 2 1 1 69 LYS H   . 69 LYS H    1 1 
       221 1 1 1 1 68 GLU H   . 68 GLU H    1 1 
       221 1 2 1 1 69 LYS QE  . 69 LYS QE   1 1 
       222 1 1 1 1 68 GLU H   . 68 GLU H    1 1 
       222 1 2 1 1 69 LYS QB  . 69 LYS QB   1 1 
       223 1 1 1 1 67 LYS QD  . 67 LYS HD2  1 1 
       223 1 2 1 1 68 GLU H   . 68 GLU H    1 1 
       224 1 1 1 1 46 VAL H   . 46 VAL H    1 1 
       224 1 2 1 1 47 SER H   . 47 SER H    1 1 
       225 1 1 1 1 45 THR H   . 45 THR H    1 1 
       225 1 2 1 1 50 ALA HA  . 50 ALA HA   1 1 
       226 1 1 1 1 44 LYS QD  . 44 LYS QD   1 1 
       226 1 2 1 1 45 THR H   . 45 THR H    1 1 
       227 1 1 1 1 44 LYS QG  . 44 LYS QG   1 1 
       227 1 2 1 1 45 THR H   . 45 THR H    1 1 
       228 1 1 1 1 15 VAL HB  . 15 VAL HB   1 1 
       228 1 2 1 1 16 GLY H   . 16 GLY H    1 1 
       229 1 1 1 1 45 THR H   . 45 THR H    1 1 
       229 1 2 1 1 48 GLY H   . 48 GLY H    1 1 
       230 1 1 1 1 76 GLY H   . 76 GLY H    1 1 
       230 1 2 1 1 77 ASN H   . 77 ASN H    1 1 
       231 1 1 1 1 75 GLU H   . 75 GLU H    1 1 
       231 1 2 1 1 76 GLY H   . 76 GLY H    1 1 
       232 1 1 1 1 35 GLY H   . 35 GLY H    1 1 
       232 1 2 1 1 36 ASN H   . 36 ASN H    1 1 
       233 1 1 1 1 32 ARG HA  . 32 ARG HA   1 1 
       233 1 2 1 1 35 GLY H   . 35 GLY H    1 1 
       234 1 1 1 1 27 VAL HA  . 27 VAL HA   1 1 
       234 1 2 1 1 30 GLU QB  . 30 GLU QB   1 1 
       235 1 1 1 1 27 VAL HA  . 27 VAL HA   1 1 
       235 1 2 1 1 28 GLU QB  . 28 GLU HB3  1 1 
       236 1 1 1 1 23 SER HB2 . 23 SER HB2  1 1 
       236 1 2 1 1 25 ARG H   . 25 ARG H    1 1 
       237 1 1 1 1 66 ILE HA  . 66 ILE HA   1 1 
       237 1 2 1 1 66 ILE MG  . 66 ILE QG2  1 1 
       238 1 1 1 1 66 ILE HA  . 66 ILE HA   1 1 
       238 1 2 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       239 1 1 1 1 46 VAL HA  . 46 VAL HA   1 1 
       239 1 2 1 1 46 VAL MG2 . 46 VAL QG2  1 1 
       240 1 1 1 1  9 SER QB  .  9 SER QB   1 1 
       240 1 2 1 1 10 VAL HA  . 10 VAL HA   1 1 
       241 1 1 1 1  9 SER QB  .  9 SER QB   1 1 
       241 1 2 1 1 11 SER HA  . 11 SER HA   1 1 
       242 1 1 1 1 11 SER QB  . 11 SER HB2  1 1 
       242 1 2 1 1 12 ARG H   . 12 ARG H    1 1 
       243 1 1 1 1 47 SER H   . 47 SER H    1 1 
       243 1 2 1 1 47 SER QB  . 47 SER QB   1 1 
       244 1 1 1 1 19 PRO QG  . 19 PRO QG   1 1 
       244 1 2 1 1 20 SER QB  . 20 SER QB   1 1 
       245 1 1 1 1 84 PRO HA  . 84 PRO HA   1 1 
       245 1 2 1 1 85 PHE H   . 85 PHE H    1 1 
       246 1 1 1 1 19 PRO HA  . 19 PRO HA   1 1 
       246 1 2 1 1 20 SER H   . 20 SER H    1 1 
       247 1 1 1 1 24 SER HA  . 24 SER HA   1 1 
       247 1 2 1 1 27 VAL HB  . 27 VAL HB   1 1 
       248 1 1 1 1 24 SER HA  . 24 SER HA   1 1 
       248 1 2 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       249 1 1 1 1 24 SER HA  . 24 SER HA   1 1 
       249 1 2 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       250 1 1 1 1 22 VAL HA  . 22 VAL HA   1 1 
       250 1 2 1 1 23 SER H   . 23 SER H    1 1 
       251 1 1 1 1 22 VAL HA  . 22 VAL HA   1 1 
       251 1 2 1 1 26 ASP QB  . 26 ASP HB2  1 1 
       252 1 1 1 1 42 VAL HA  . 42 VAL HA   1 1 
       252 1 2 1 1 53 PHE H   . 53 PHE H    1 1 
       253 1 1 1 1 42 VAL HA  . 42 VAL HA   1 1 
       253 1 2 1 1 43 LYS H   . 43 LYS H    1 1 
       254 1 1 1 1 37 ILE HA  . 37 ILE HA   1 1 
       254 1 2 1 1 38 LEU H   . 38 LEU H    1 1 
       255 1 1 1 1 37 ILE HA  . 37 ILE HA   1 1 
       255 1 2 1 1 56 PHE HA  . 56 PHE HA   1 1 
       256 1 1 1 1 81 VAL HA  . 81 VAL HA   1 1 
       256 1 2 1 1 82 GLU H   . 82 GLU H    1 1 
       257 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       257 1 2 1 1 81 VAL HA  . 81 VAL HA   1 1 
       258 1 1 1 1 28 GLU HA  . 28 GLU HA   1 1 
       258 1 2 1 1 28 GLU QG  . 28 GLU QG   1 1 
       259 1 1 1 1 27 VAL QG  . 27 VAL QG2  1 1 
       259 1 2 1 1 28 GLU HA  . 28 GLU HA   1 1 
       260 1 1 1 1 34 TYR HA  . 34 TYR HA   1 1 
       260 1 2 1 1 34 TYR QD  . 34 TYR QD   1 1 
       261 1 1 1 1 34 TYR HA  . 34 TYR HA   1 1 
       261 1 2 1 1 35 GLY H   . 35 GLY H    1 1 
       262 1 1 1 1 38 LEU QD  . 38 LEU QD1  1 1 
       262 1 2 1 1 57 GLU HA  . 57 GLU HA   1 1 
       263 1 1 1 1 60 ARG HA  . 60 ARG HA   1 1 
       263 1 2 1 1 63 ALA H   . 63 ALA H    1 1 
       264 1 1 1 1 25 ARG HA  . 25 ARG HA   1 1 
       264 1 2 1 1 28 GLU QB  . 28 GLU HB2  1 1 
       265 1 1 1 1 25 ARG HA  . 25 ARG HA   1 1 
       265 1 2 1 1 25 ARG QG  . 25 ARG QG   1 1 
       266 1 1 1 1 60 ARG HA  . 60 ARG HA   1 1 
       266 1 2 1 1 60 ARG QG  . 60 ARG QG   1 1 
       267 1 1 1 1 32 ARG HA  . 32 ARG HA   1 1 
       267 1 2 1 1 32 ARG QD  . 32 ARG QD   1 1 
       268 1 1 1 1 70 ASP HA  . 70 ASP HA   1 1 
       268 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       269 1 1 1 1  9 SER HA  .  9 SER HA   1 1 
       269 1 2 1 1 10 VAL H   . 10 VAL H    1 1 
       270 1 1 1 1 85 PHE HA  . 85 PHE HA   1 1 
       270 1 2 1 1 86 ASN H   . 86 ASN H    1 1 
       271 1 1 1 1 10 VAL QG  . 10 VAL QG2  1 1 
       271 1 2 1 1 11 SER HA  . 11 SER HA   1 1 
       272 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       272 1 2 1 1 70 ASP HA  . 70 ASP HA   1 1 
       273 1 1 1 1 70 ASP HA  . 70 ASP HA   1 1 
       273 1 2 1 1 81 VAL HB  . 81 VAL HB   1 1 
       274 1 1 1 1 67 LYS QD  . 67 LYS HD2  1 1 
       274 1 2 1 1 68 GLU HA  . 68 GLU HA   1 1 
       275 1 1 1 1 85 PHE HA  . 85 PHE HA   1 1 
       275 1 2 1 1 85 PHE QD  . 85 PHE QD   1 1 
       276 1 1 1 1 33 LYS HA  . 33 LYS HA   1 1 
       276 1 2 1 1 62 ALA MB  . 62 ALA QB   1 1 
       277 1 1 1 1 26 ASP HA  . 26 ASP HA   1 1 
       277 1 2 1 1 29 ASN HB2 . 29 ASN HB2  1 1 
       278 1 1 1 1 30 GLU HA  . 30 GLU HA   1 1 
       278 1 2 1 1 30 GLU QG  . 30 GLU QG   1 1 
       279 1 1 1 1 26 ASP HA  . 26 ASP HA   1 1 
       279 1 2 1 1 29 ASN H   . 29 ASN H    1 1 
       280 1 1 1 1 30 GLU HA  . 30 GLU HA   1 1 
       280 1 2 1 1 32 ARG H   . 32 ARG H    1 1 
       281 1 1 1 1 64 ASP HA  . 64 ASP HA   1 1 
       281 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
       282 1 1 1 1 75 GLU HA  . 75 GLU HA   1 1 
       282 1 2 1 1 75 GLU HG2 . 75 GLU HG2  1 1 
       283 1 1 1 1 75 GLU HA  . 75 GLU HA   1 1 
       283 1 2 1 1 75 GLU HG3 . 75 GLU HG3  1 1 
       284 1 1 1 1 53 PHE HA  . 53 PHE HA   1 1 
       284 1 2 1 1 53 PHE QE  . 53 PHE QE   1 1 
       285 1 1 1 1 53 PHE HA  . 53 PHE HA   1 1 
       285 1 2 1 1 54 ILE H   . 54 ILE H    1 1 
       286 1 1 1 1  8 GLU HA  .  8 GLU HA   1 1 
       286 1 2 1 1  9 SER H   .  9 SER H    1 1 
       287 1 1 1 1 29 ASN HA  . 29 ASN HA   1 1 
       287 1 2 1 1 32 ARG QG  . 32 ARG HG2  1 1 
       288 1 1 1 1 14 TYR HA  . 14 TYR HA   1 1 
       288 1 2 1 1 15 VAL H   . 15 VAL H    1 1 
       289 1 1 1 1 39 LYS HA  . 39 LYS HA   1 1 
       289 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
       290 1 1 1 1  7 ARG HA  .  7 ARG HA   1 1 
       290 1 2 1 1  8 GLU H   .  8 GLU H    1 1 
       291 1 1 1 1 88 ARG HA  . 88 ARG HA   1 1 
       291 1 2 1 1 89 GLU H   . 89 GLU H    1 1 
       292 1 1 1 1 18 LEU QD  . 18 LEU QD1  1 1 
       292 1 2 1 1 51 PHE HA  . 51 PHE HA   1 1 
       293 1 1 1 1 21 HIS HA  . 21 HIS HA   1 1 
       293 1 2 1 1 21 HIS HB2 . 21 HIS HB3  1 1 
       294 1 1 1 1 78 LYS HA  . 78 LYS HA   1 1 
       294 1 2 1 1 79 LEU H   . 79 LEU H    1 1 
       295 1 1 1 1 59 ALA HA  . 59 ALA HA   1 1 
       295 1 2 1 1 62 ALA H   . 62 ALA H    1 1 
       296 1 1 1 1 59 ALA HA  . 59 ALA HA   1 1 
       296 1 2 1 1 61 ASP H   . 61 ASP H    1 1 
       297 1 1 1 1 55 GLU HA  . 55 GLU HA   1 1 
       297 1 2 1 1 56 PHE H   . 56 PHE H    1 1 
       298 1 1 1 1 63 ALA HA  . 63 ALA HA   1 1 
       298 1 2 1 1 67 LYS H   . 67 LYS H    1 1 
       299 1 1 1 1 63 ALA HA  . 63 ALA HA   1 1 
       299 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
       300 1 1 1 1 63 ALA HA  . 63 ALA HA   1 1 
       300 1 2 1 1 66 ILE MG  . 66 ILE QG2  1 1 
       301 1 1 1 1 63 ALA HA  . 63 ALA HA   1 1 
       301 1 2 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       302 1 1 1 1 44 LYS HA  . 44 LYS HA   1 1 
       302 1 2 1 1 45 THR H   . 45 THR H    1 1 
       303 1 1 1 1 73 ASP HA  . 73 ASP HA   1 1 
       303 1 2 1 1 74 PHE H   . 74 PHE H    1 1 
       304 1 1 1 1 65 ALA HA  . 65 ALA HA   1 1 
       304 1 2 1 1 67 LYS QD  . 67 LYS HD2  1 1 
       305 1 1 1 1 12 ARG HA  . 12 ARG HA   1 1 
       305 1 2 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       306 1 1 1 1 10 VAL QG  . 10 VAL QG2  1 1 
       306 1 2 1 1 12 ARG HA  . 12 ARG HA   1 1 
       307 1 1 1 1 12 ARG HA  . 12 ARG HA   1 1 
       307 1 2 1 1 13 ILE H   . 13 ILE H    1 1 
       308 1 1 1 1 62 ALA HA  . 62 ALA HA   1 1 
       308 1 2 1 1 64 ASP H   . 64 ASP H    1 1 
       309 1 1 1 1 62 ALA HA  . 62 ALA HA   1 1 
       309 1 2 1 1 66 ILE H   . 66 ILE H    1 1 
       310 1 1 1 1 62 ALA HA  . 62 ALA HA   1 1 
       310 1 2 1 1 63 ALA MB  . 63 ALA QB   1 1 
       311 1 1 1 1 62 ALA HA  . 62 ALA HA   1 1 
       311 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
       312 1 1 1 1 36 ASN HA  . 36 ASN HA   1 1 
       312 1 2 1 1 37 ILE H   . 37 ILE H    1 1 
       313 1 1 1 1 80 ARG HA  . 80 ARG HA   1 1 
       313 1 2 1 1 80 ARG QG  . 80 ARG QG   1 1 
       314 1 1 1 1 80 ARG HA  . 80 ARG HA   1 1 
       314 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
       315 1 1 1 1 43 LYS HA  . 43 LYS HA   1 1 
       315 1 2 1 1 44 LYS H   . 44 LYS H    1 1 
       316 1 1 1 1 43 LYS HA  . 43 LYS HA   1 1 
       316 1 2 1 1 43 LYS QD  . 43 LYS QD   1 1 
       317 1 1 1 1 43 LYS HA  . 43 LYS HA   1 1 
       317 1 2 1 1 44 LYS QD  . 44 LYS QD   1 1 
       318 1 1 1 1 43 LYS HA  . 43 LYS HA   1 1 
       318 1 2 1 1 44 LYS QB  . 44 LYS HB3  1 1 
       319 1 1 1 1 17 ASN HA  . 17 ASN HA   1 1 
       319 1 2 1 1 18 LEU H   . 18 LEU H    1 1 
       320 1 1 1 1 17 ASN HA  . 17 ASN HA   1 1 
       320 1 2 1 1 50 ALA H   . 50 ALA H    1 1 
       321 1 1 1 1 41 ASP HA  . 41 ASP HA   1 1 
       321 1 2 1 1 42 VAL H   . 42 VAL H    1 1 
       322 1 1 1 1 86 ASN HA  . 86 ASN HA   1 1 
       322 1 2 1 1 87 ALA MB  . 87 ALA QB   1 1 
       323 1 1 1 1 86 ASN HA  . 86 ASN HA   1 1 
       323 1 2 1 1 87 ALA H   . 87 ALA H    1 1 
       324 1 1 1 1 58 ASP HA  . 58 ASP HA   1 1 
       324 1 2 1 1 59 ALA H   . 59 ALA H    1 1 
       325 1 1 1 1 58 ASP HA  . 58 ASP HA   1 1 
       325 1 2 1 1 59 ALA MB  . 59 ALA QB   1 1 
       326 1 1 1 1 87 ALA HA  . 87 ALA HA   1 1 
       326 1 2 1 1 88 ARG H   . 88 ARG H    1 1 
       327 1 1 1 1 49 ALA HA  . 49 ALA HA   1 1 
       327 1 2 1 1 50 ALA H   . 50 ALA H    1 1 
       328 1 1 1 1 17 ASN HA  . 17 ASN HA   1 1 
       328 1 2 1 1 49 ALA HA  . 49 ALA HA   1 1 
       329 1 1 1 1 44 LYS QB  . 44 LYS HB3  1 1 
       329 1 2 1 1 50 ALA HA  . 50 ALA HA   1 1 
       330 1 1 1 1 44 LYS QD  . 44 LYS QD   1 1 
       330 1 2 1 1 50 ALA HA  . 50 ALA HA   1 1 
       331 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       331 1 2 1 1 50 ALA HA  . 50 ALA HA   1 1 
       332 1 1 1 1 50 ALA HA  . 50 ALA HA   1 1 
       332 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       333 1 1 1 1 44 LYS HA  . 44 LYS HA   1 1 
       333 1 2 1 1 50 ALA HA  . 50 ALA HA   1 1 
       334 1 1 1 1 18 LEU HB2 . 18 LEU HB3  1 1 
       334 1 2 1 1 19 PRO HD2 . 19 PRO HD2  1 1 
       335 1 1 1 1 18 LEU HB2 . 18 LEU HB3  1 1 
       335 1 2 1 1 19 PRO HD3 . 19 PRO HD3  1 1 
       336 1 1 1 1 51 PHE H   . 51 PHE H    1 1 
       336 1 2 1 1 52 ALA HA  . 52 ALA HA   1 1 
       337 1 1 1 1 52 ALA HA  . 52 ALA HA   1 1 
       337 1 2 1 1 54 ILE H   . 54 ILE H    1 1 
       338 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
       338 1 2 1 1 52 ALA HA  . 52 ALA HA   1 1 
       339 1 1 1 1 52 ALA HA  . 52 ALA HA   1 1 
       339 1 2 1 1 53 PHE H   . 53 PHE H    1 1 
       340 1 1 1 1 42 VAL HA  . 42 VAL HA   1 1 
       340 1 2 1 1 52 ALA HA  . 52 ALA HA   1 1 
       341 1 1 1 1 42 VAL QG  . 42 VAL QG2  1 1 
       341 1 2 1 1 52 ALA HA  . 52 ALA HA   1 1 
       342 1 1 1 1 58 ASP QB  . 58 ASP HB2  1 1 
       342 1 2 1 1 59 ALA H   . 59 ALA H    1 1 
       343 1 1 1 1 58 ASP QB  . 58 ASP HB2  1 1 
       343 1 2 1 1 60 ARG H   . 60 ARG H    1 1 
       344 1 1 1 1 58 ASP QB  . 58 ASP HB2  1 1 
       344 1 2 1 1 61 ASP H   . 61 ASP H    1 1 
       345 1 1 1 1 39 LYS QD  . 39 LYS QD   1 1 
       345 1 2 1 1 41 ASP QB  . 41 ASP HB2  1 1 
       346 1 1 1 1 39 LYS HB3 . 39 LYS HB3  1 1 
       346 1 2 1 1 41 ASP QB  . 41 ASP HB2  1 1 
       347 1 1 1 1 39 LYS QG  . 39 LYS QG   1 1 
       347 1 2 1 1 41 ASP QB  . 41 ASP HB2  1 1 
       348 1 1 1 1 40 CYS HA  . 40 CYS HA   1 1 
       348 1 2 1 1 41 ASP QB  . 41 ASP HB2  1 1 
       349 1 1 1 1 41 ASP QB  . 41 ASP HB2  1 1 
       349 1 2 1 1 53 PHE QB  . 53 PHE QB   1 1 
       350 1 1 1 1 40 CYS QB  . 40 CYS HB2  1 1 
       350 1 2 1 1 41 ASP QB  . 41 ASP HB2  1 1 
       351 1 1 1 1 57 GLU QG  . 57 GLU HG3  1 1 
       351 1 2 1 1 58 ASP QB  . 58 ASP HB3  1 1 
       352 1 1 1 1 41 ASP H   . 41 ASP H    1 1 
       352 1 2 1 1 41 ASP QB  . 41 ASP HB3  1 1 
       353 1 1 1 1 41 ASP QB  . 41 ASP HB3  1 1 
       353 1 2 1 1 42 VAL H   . 42 VAL H    1 1 
       354 1 1 1 1 80 ARG HA  . 80 ARG HA   1 1 
       354 1 2 1 1 80 ARG QD  . 80 ARG HD2  1 1 
       355 1 1 1 1 60 ARG HA  . 60 ARG HA   1 1 
       355 1 2 1 1 60 ARG QD  . 60 ARG QD   1 1 
       356 1 1 1 1 58 ASP QB  . 58 ASP HB3  1 1 
       356 1 2 1 1 60 ARG QD  . 60 ARG QD   1 1 
       357 1 1 1 1 14 TYR QE  . 14 TYR QE   1 1 
       357 1 2 1 1 16 GLY HA3 . 16 GLY HA3  1 1 
       358 1 1 1 1 60 ARG QB  . 60 ARG QB   1 1 
       358 1 2 1 1 60 ARG QD  . 60 ARG QD   1 1 
       359 1 1 1 1 88 ARG HA  . 88 ARG HA   1 1 
       359 1 2 1 1 88 ARG QD  . 88 ARG QD   1 1 
       360 1 1 1 1 25 ARG HA  . 25 ARG HA   1 1 
       360 1 2 1 1 25 ARG QD  . 25 ARG QD   1 1 
       361 1 1 1 1 73 ASP HB2 . 73 ASP HB2  1 1 
       361 1 2 1 1 74 PHE H   . 74 PHE H    1 1 
       362 1 1 1 1 73 ASP H   . 73 ASP H    1 1 
       362 1 2 1 1 73 ASP HB2 . 73 ASP HB2  1 1 
       363 1 1 1 1 73 ASP H   . 73 ASP H    1 1 
       363 1 2 1 1 73 ASP HB3 . 73 ASP HB3  1 1 
       364 1 1 1 1 53 PHE H   . 53 PHE H    1 1 
       364 1 2 1 1 53 PHE QB  . 53 PHE QB   1 1 
       365 1 1 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       365 1 2 1 1 53 PHE QB  . 53 PHE QB   1 1 
       366 1 1 1 1 53 PHE QB  . 53 PHE QB   1 1 
       366 1 2 1 1 54 ILE QG  . 54 ILE HG13 1 1 
       367 1 1 1 1 42 VAL QG  . 42 VAL QG2  1 1 
       367 1 2 1 1 44 LYS QE  . 44 LYS QE   1 1 
       368 1 1 1 1 53 PHE QB  . 53 PHE QB   1 1 
       368 1 2 1 1 55 GLU H   . 55 GLU H    1 1 
       369 1 1 1 1 67 LYS QE  . 67 LYS QE   1 1 
       369 1 2 1 1 68 GLU QB  . 68 GLU QB   1 1 
       370 1 1 1 1 67 LYS QE  . 67 LYS QE   1 1 
       370 1 2 1 1 68 GLU QG  . 68 GLU HG3  1 1 
       371 1 1 1 1 40 CYS HA  . 40 CYS HA   1 1 
       371 1 2 1 1 53 PHE QB  . 53 PHE QB   1 1 
       372 1 1 1 1 44 LYS QE  . 44 LYS QE   1 1 
       372 1 2 1 1 45 THR HA  . 45 THR HA   1 1 
       373 1 1 1 1 39 LYS QE  . 39 LYS QE   1 1 
       373 1 2 1 1 40 CYS HA  . 40 CYS HA   1 1 
       374 1 1 1 1 76 GLY HA3 . 76 GLY HA3  1 1 
       374 1 2 1 1 78 LYS QE  . 78 LYS QE   1 1 
       375 1 1 1 1 39 LYS QE  . 39 LYS QE   1 1 
       375 1 2 1 1 41 ASP QB  . 41 ASP HB3  1 1 
       376 1 1 1 1 34 TYR QE  . 34 TYR QE   1 1 
       376 1 2 1 1 69 LYS QE  . 69 LYS QE   1 1 
       377 1 1 1 1 69 LYS HA  . 69 LYS HA   1 1 
       377 1 2 1 1 69 LYS QE  . 69 LYS QE   1 1 
       378 1 1 1 1 33 LYS QE  . 33 LYS QE   1 1 
       378 1 2 1 1 62 ALA MB  . 62 ALA QB   1 1 
       379 1 1 1 1 33 LYS QE  . 33 LYS QE   1 1 
       379 1 2 1 1 34 TYR QE  . 34 TYR QE   1 1 
       380 1 1 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       380 1 2 1 1 69 LYS QE  . 69 LYS QE   1 1 
       381 1 1 1 1 70 ASP H   . 70 ASP H    1 1 
       381 1 2 1 1 70 ASP QB  . 70 ASP HB2  1 1 
       382 1 1 1 1 70 ASP QB  . 70 ASP HB2  1 1 
       382 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       383 1 1 1 1 51 PHE HB2 . 51 PHE HB2  1 1 
       383 1 2 1 1 52 ALA H   . 52 ALA H    1 1 
       384 1 1 1 1 51 PHE HB3 . 51 PHE HB3  1 1 
       384 1 2 1 1 52 ALA H   . 52 ALA H    1 1 
       385 1 1 1 1 70 ASP QB  . 70 ASP HB3  1 1 
       385 1 2 1 1 81 VAL HB  . 81 VAL HB   1 1 
       386 1 1 1 1 56 PHE HB2 . 56 PHE HB2  1 1 
       386 1 2 1 1 57 GLU H   . 57 GLU H    1 1 
       387 1 1 1 1 31 PHE QB  . 31 PHE HB2  1 1 
       387 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       388 1 1 1 1 23 SER H   . 23 SER H    1 1 
       388 1 2 1 1 26 ASP QB  . 26 ASP HB2  1 1 
       389 1 1 1 1 26 ASP H   . 26 ASP H    1 1 
       389 1 2 1 1 26 ASP QB  . 26 ASP HB2  1 1 
       390 1 1 1 1 22 VAL HB  . 22 VAL HB   1 1 
       390 1 2 1 1 26 ASP QB  . 26 ASP HB2  1 1 
       391 1 1 1 1 26 ASP QB  . 26 ASP HB2  1 1 
       391 1 2 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       392 1 1 1 1 14 TYR QB  . 14 TYR QB   1 1 
       392 1 2 1 1 15 VAL H   . 15 VAL H    1 1 
       393 1 1 1 1 14 TYR H   . 14 TYR H    1 1 
       393 1 2 1 1 14 TYR QB  . 14 TYR QB   1 1 
       394 1 1 1 1 54 ILE HB  . 54 ILE HB   1 1 
       394 1 2 1 1 85 PHE QE  . 85 PHE QE   1 1 
       395 1 1 1 1 54 ILE H   . 54 ILE H    1 1 
       395 1 2 1 1 54 ILE HB  . 54 ILE HB   1 1 
       396 1 1 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       396 1 2 1 1 54 ILE HB  . 54 ILE HB   1 1 
       397 1 1 1 1 27 VAL QG  . 27 VAL QG2  1 1 
       397 1 2 1 1 54 ILE HB  . 54 ILE HB   1 1 
       398 1 1 1 1 64 ASP H   . 64 ASP H    1 1 
       398 1 2 1 1 64 ASP HB2 . 64 ASP HB2  1 1 
       399 1 1 1 1 64 ASP H   . 64 ASP H    1 1 
       399 1 2 1 1 64 ASP HB3 . 64 ASP HB3  1 1 
       400 1 1 1 1 64 ASP HB3 . 64 ASP HB3  1 1 
       400 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
       401 1 1 1 1 61 ASP HB2 . 61 ASP HB2  1 1 
       401 1 2 1 1 62 ALA H   . 62 ALA H    1 1 
       402 1 1 1 1 61 ASP H   . 61 ASP H    1 1 
       402 1 2 1 1 61 ASP HB3 . 61 ASP HB3  1 1 
       403 1 1 1 1 37 ILE HB  . 37 ILE HB   1 1 
       403 1 2 1 1 54 ILE HA  . 54 ILE HA   1 1 
       404 1 1 1 1 36 ASN HA  . 36 ASN HA   1 1 
       404 1 2 1 1 37 ILE HB  . 37 ILE HB   1 1 
       405 1 1 1 1 37 ILE HB  . 37 ILE HB   1 1 
       405 1 2 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       406 1 1 1 1 76 GLY HA3 . 76 GLY HA3  1 1 
       406 1 2 1 1 77 ASN QB  . 77 ASN HB3  1 1 
       407 1 1 1 1 61 ASP H   . 61 ASP H    1 1 
       407 1 2 1 1 61 ASP HB2 . 61 ASP HB2  1 1 
       408 1 1 1 1 61 ASP HB3 . 61 ASP HB3  1 1 
       408 1 2 1 1 62 ALA H   . 62 ALA H    1 1 
       409 1 1 1 1 85 PHE H   . 85 PHE H    1 1 
       409 1 2 1 1 85 PHE HB2 . 85 PHE HB2  1 1 
       410 1 1 1 1 85 PHE H   . 85 PHE H    1 1 
       410 1 2 1 1 85 PHE HB3 . 85 PHE HB3  1 1 
       411 1 1 1 1 66 ILE H   . 66 ILE H    1 1 
       411 1 2 1 1 66 ILE HB  . 66 ILE HB   1 1 
       412 1 1 1 1 66 ILE HB  . 66 ILE HB   1 1 
       412 1 2 1 1 69 LYS QG  . 69 LYS QG   1 1 
       413 1 1 1 1 66 ILE HB  . 66 ILE HB   1 1 
       413 1 2 1 1 67 LYS QG  . 67 LYS QG   1 1 
       414 1 1 1 1 63 ALA MB  . 63 ALA QB   1 1 
       414 1 2 1 1 66 ILE HB  . 66 ILE HB   1 1 
       415 1 1 1 1 86 ASN H   . 86 ASN H    1 1 
       415 1 2 1 1 86 ASN HB2 . 86 ASN HB2  1 1 
       416 1 1 1 1 86 ASN H   . 86 ASN H    1 1 
       416 1 2 1 1 86 ASN HB3 . 86 ASN HB3  1 1 
       417 1 1 1 1 86 ASN HB3 . 86 ASN HB3  1 1 
       417 1 2 1 1 87 ALA H   . 87 ALA H    1 1 
       418 1 1 1 1 36 ASN QB  . 36 ASN HB2  1 1 
       418 1 2 1 1 57 GLU QB  . 57 GLU QB   1 1 
       419 1 1 1 1 36 ASN H   . 36 ASN H    1 1 
       419 1 2 1 1 36 ASN QB  . 36 ASN HB2  1 1 
       420 1 1 1 1 36 ASN QB  . 36 ASN HB2  1 1 
       420 1 2 1 1 37 ILE H   . 37 ILE H    1 1 
       421 1 1 1 1 36 ASN QB  . 36 ASN HB3  1 1 
       421 1 2 1 1 57 GLU QG  . 57 GLU HG3  1 1 
       422 1 1 1 1 29 ASN H   . 29 ASN H    1 1 
       422 1 2 1 1 29 ASN HB2 . 29 ASN HB2  1 1 
       423 1 1 1 1 29 ASN HB2 . 29 ASN HB2  1 1 
       423 1 2 1 1 30 GLU H   . 30 GLU H    1 1 
       424 1 1 1 1 29 ASN H   . 29 ASN H    1 1 
       424 1 2 1 1 29 ASN HB3 . 29 ASN HB3  1 1 
       425 1 1 1 1 34 TYR QB  . 34 TYR HB3  1 1 
       425 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       426 1 1 1 1 34 TYR QE  . 34 TYR QE   1 1 
       426 1 2 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       427 1 1 1 1 68 GLU HA  . 68 GLU HA   1 1 
       427 1 2 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       428 1 1 1 1 68 GLU H   . 68 GLU H    1 1 
       428 1 2 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       429 1 1 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       429 1 2 1 1 69 LYS QB  . 69 LYS QB   1 1 
       430 1 1 1 1 67 LYS QD  . 67 LYS HD2  1 1 
       430 1 2 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       431 1 1 1 1 67 LYS QG  . 67 LYS QG   1 1 
       431 1 2 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       432 1 1 1 1 68 GLU QG  . 68 GLU HG2  1 1 
       432 1 2 1 1 69 LYS QG  . 69 LYS QG   1 1 
       433 1 1 1 1 28 GLU QG  . 28 GLU QG   1 1 
       433 1 2 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       434 1 1 1 1 39 LYS HB2 . 39 LYS HB2  1 1 
       434 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
       435 1 1 1 1 38 LEU QD  . 38 LEU QD2  1 1 
       435 1 2 1 1 57 GLU QG  . 57 GLU HG3  1 1 
       436 1 1 1 1 39 LYS HB3 . 39 LYS HB3  1 1 
       436 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
       437 1 1 1 1 57 GLU H   . 57 GLU H    1 1 
       437 1 2 1 1 57 GLU QG  . 57 GLU HG2  1 1 
       438 1 1 1 1 89 GLU H   . 89 GLU H    1 1 
       438 1 2 1 1 89 GLU QG  . 89 GLU QG   1 1 
       439 1 1 1 1 89 GLU QB  . 89 GLU QB   1 1 
       439 1 2 1 1 89 GLU QG  . 89 GLU QG   1 1 
       440 1 1 1 1  8 GLU H   .  8 GLU H    1 1 
       440 1 2 1 1  8 GLU QG  .  8 GLU QG   1 1 
       441 1 1 1 1 43 LYS QB  . 43 LYS HB3  1 1 
       441 1 2 1 1 51 PHE QD  . 51 PHE QD   1 1 
       442 1 1 1 1 44 LYS QB  . 44 LYS HB2  1 1 
       442 1 2 1 1 45 THR H   . 45 THR H    1 1 
       443 1 1 1 1 44 LYS H   . 44 LYS H    1 1 
       443 1 2 1 1 44 LYS QB  . 44 LYS HB2  1 1 
       444 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
       444 1 2 1 1 44 LYS QB  . 44 LYS HB3  1 1 
       445 1 1 1 1 75 GLU H   . 75 GLU H    1 1 
       445 1 2 1 1 75 GLU HG2 . 75 GLU HG2  1 1 
       446 1 1 1 1 75 GLU H   . 75 GLU H    1 1 
       446 1 2 1 1 75 GLU HG3 . 75 GLU HG3  1 1 
       447 1 1 1 1 82 GLU H   . 82 GLU H    1 1 
       447 1 2 1 1 82 GLU HG2 . 82 GLU HG2  1 1 
       448 1 1 1 1 69 LYS H   . 69 LYS H    1 1 
       448 1 2 1 1 69 LYS QB  . 69 LYS QB   1 1 
       449 1 1 1 1 69 LYS QB  . 69 LYS QB   1 1 
       449 1 2 1 1 69 LYS QD  . 69 LYS QD   1 1 
       450 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       450 1 2 1 1 81 VAL HB  . 81 VAL HB   1 1 
       451 1 1 1 1 81 VAL H   . 81 VAL H    1 1 
       451 1 2 1 1 81 VAL HB  . 81 VAL HB   1 1 
       452 1 1 1 1 15 VAL H   . 15 VAL H    1 1 
       452 1 2 1 1 15 VAL HB  . 15 VAL HB   1 1 
       453 1 1 1 1 42 VAL HB  . 42 VAL HB   1 1 
       453 1 2 1 1 43 LYS H   . 43 LYS H    1 1 
       454 1 1 1 1 42 VAL H   . 42 VAL H    1 1 
       454 1 2 1 1 42 VAL HB  . 42 VAL HB   1 1 
       455 1 1 1 1 10 VAL HB  . 10 VAL HB   1 1 
       455 1 2 1 1 11 SER H   . 11 SER H    1 1 
       456 1 1 1 1 10 VAL H   . 10 VAL H    1 1 
       456 1 2 1 1 10 VAL HB  . 10 VAL HB   1 1 
       457 1 1 1 1 22 VAL HB  . 22 VAL HB   1 1 
       457 1 2 1 1 27 VAL H   . 27 VAL H    1 1 
       458 1 1 1 1 22 VAL HB  . 22 VAL HB   1 1 
       458 1 2 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       459 1 1 1 1 67 LYS H   . 67 LYS H    1 1 
       459 1 2 1 1 67 LYS QB  . 67 LYS QB   1 1 
       460 1 1 1 1 67 LYS QB  . 67 LYS QB   1 1 
       460 1 2 1 1 68 GLU H   . 68 GLU H    1 1 
       461 1 1 1 1 22 VAL HB  . 22 VAL HB   1 1 
       461 1 2 1 1 23 SER H   . 23 SER H    1 1 
       462 1 1 1 1 80 ARG QB  . 80 ARG QB   1 1 
       462 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
       463 1 1 1 1 19 PRO HB2 . 19 PRO HB2  1 1 
       463 1 2 1 1 20 SER H   . 20 SER H    1 1 
       464 1 1 1 1 78 LYS HB2 . 78 LYS HB2  1 1 
       464 1 2 1 1 78 LYS QE  . 78 LYS QE   1 1 
       465 1 1 1 1 78 LYS H   . 78 LYS H    1 1 
       465 1 2 1 1 78 LYS HB3 . 78 LYS HB3  1 1 
       466 1 1 1 1 46 VAL H   . 46 VAL H    1 1 
       466 1 2 1 1 46 VAL HB  . 46 VAL HB   1 1 
       467 1 1 1 1 46 VAL HB  . 46 VAL HB   1 1 
       467 1 2 1 1 47 SER H   . 47 SER H    1 1 
       468 1 1 1 1 39 LYS H   . 39 LYS H    1 1 
       468 1 2 1 1 55 GLU QB  . 55 GLU QB   1 1 
       469 1 1 1 1 27 VAL HB  . 27 VAL HB   1 1 
       469 1 2 1 1 28 GLU H   . 28 GLU H    1 1 
       470 1 1 1 1 27 VAL H   . 27 VAL H    1 1 
       470 1 2 1 1 27 VAL HB  . 27 VAL HB   1 1 
       471 1 1 1 1  7 ARG QB  .  7 ARG QB   1 1 
       471 1 2 1 1  7 ARG HG2 .  7 ARG HG2  1 1 
       472 1 1 1 1 33 LYS H   . 33 LYS H    1 1 
       472 1 2 1 1 33 LYS HB2 . 33 LYS HB2  1 1 
       473 1 1 1 1 33 LYS H   . 33 LYS H    1 1 
       473 1 2 1 1 33 LYS HB3 . 33 LYS HB3  1 1 
       474 1 1 1 1 38 LEU HG  . 38 LEU HG   1 1 
       474 1 2 1 1 57 GLU QB  . 57 GLU QB   1 1 
       475 1 1 1 1 38 LEU QD  . 38 LEU QD1  1 1 
       475 1 2 1 1 57 GLU QB  . 57 GLU QB   1 1 
       476 1 1 1 1 57 GLU H   . 57 GLU H    1 1 
       476 1 2 1 1 57 GLU QB  . 57 GLU QB   1 1 
       477 1 1 1 1 88 ARG HB2 . 88 ARG HB2  1 1 
       477 1 2 1 1 89 GLU H   . 89 GLU H    1 1 
       478 1 1 1 1 88 ARG H   . 88 ARG H    1 1 
       478 1 2 1 1 88 ARG HB3 . 88 ARG HB3  1 1 
       479 1 1 1 1  8 GLU QB  .  8 GLU HB2  1 1 
       479 1 2 1 1  9 SER H   .  9 SER H    1 1 
       480 1 1 1 1  8 GLU H   .  8 GLU H    1 1 
       480 1 2 1 1  8 GLU QB  .  8 GLU HB2  1 1 
       481 1 1 1 1 33 LYS H   . 33 LYS H    1 1 
       481 1 2 1 1 33 LYS QD  . 33 LYS QD   1 1 
       482 1 1 1 1 33 LYS QD  . 33 LYS QD   1 1 
       482 1 2 1 1 64 ASP H   . 64 ASP H    1 1 
       483 1 1 1 1 25 ARG H   . 25 ARG H    1 1 
       483 1 2 1 1 25 ARG HB2 . 25 ARG HB2  1 1 
       484 1 1 1 1 25 ARG H   . 25 ARG H    1 1 
       484 1 2 1 1 25 ARG HB3 . 25 ARG HB3  1 1 
       485 1 1 1 1 28 GLU QB  . 28 GLU HB2  1 1 
       485 1 2 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       486 1 1 1 1 28 GLU H   . 28 GLU H    1 1 
       486 1 2 1 1 28 GLU QB  . 28 GLU HB2  1 1 
       487 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
       487 1 2 1 1 32 ARG HB2 . 32 ARG HB2  1 1 
       488 1 1 1 1 30 GLU H   . 30 GLU H    1 1 
       488 1 2 1 1 30 GLU QB  . 30 GLU QB   1 1 
       489 1 1 1 1 25 ARG QG  . 25 ARG QG   1 1 
       489 1 2 1 1 28 GLU QB  . 28 GLU HB3  1 1 
       490 1 1 1 1 28 GLU QB  . 28 GLU HB3  1 1 
       490 1 2 1 1 32 ARG QG  . 32 ARG HG3  1 1 
       491 1 1 1 1 30 GLU QB  . 30 GLU QB   1 1 
       491 1 2 1 1 32 ARG QG  . 32 ARG HG3  1 1 
       492 1 1 1 1 32 ARG HB3 . 32 ARG HB3  1 1 
       492 1 2 1 1 33 LYS H   . 33 LYS H    1 1 
       493 1 1 1 1 60 ARG H   . 60 ARG H    1 1 
       493 1 2 1 1 60 ARG QB  . 60 ARG QB   1 1 
       494 1 1 1 1 60 ARG QB  . 60 ARG QB   1 1 
       494 1 2 1 1 61 ASP H   . 61 ASP H    1 1 
       495 1 1 1 1 59 ALA H   . 59 ALA H    1 1 
       495 1 2 1 1 60 ARG QB  . 60 ARG QB   1 1 
       496 1 1 1 1 67 LYS HA  . 67 LYS HA   1 1 
       496 1 2 1 1 67 LYS QD  . 67 LYS HD3  1 1 
       497 1 1 1 1 29 ASN HA  . 29 ASN HA   1 1 
       497 1 2 1 1 32 ARG HB2 . 32 ARG HB2  1 1 
       498 1 1 1 1 29 ASN HA  . 29 ASN HA   1 1 
       498 1 2 1 1 30 GLU QB  . 30 GLU QB   1 1 
       499 1 1 1 1 78 LYS HA  . 78 LYS HA   1 1 
       499 1 2 1 1 78 LYS QD  . 78 LYS QD   1 1 
       500 1 1 1 1 42 VAL H   . 42 VAL H    1 1 
       500 1 2 1 1 43 LYS QD  . 43 LYS QD   1 1 
       501 1 1 1 1 44 LYS H   . 44 LYS H    1 1 
       501 1 2 1 1 44 LYS QD  . 44 LYS QD   1 1 
       502 1 1 1 1 72 CYS QB  . 72 CYS HB2  1 1 
       502 1 2 1 1 82 GLU QB  . 82 GLU HB2  1 1 
       503 1 1 1 1 72 CYS H   . 72 CYS H    1 1 
       503 1 2 1 1 72 CYS QB  . 72 CYS HB2  1 1 
       504 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
       504 1 2 1 1 43 LYS QD  . 43 LYS QD   1 1 
       505 1 1 1 1 43 LYS QD  . 43 LYS QD   1 1 
       505 1 2 1 1 51 PHE QD  . 51 PHE QD   1 1 
       506 1 1 1 1 44 LYS QD  . 44 LYS QD   1 1 
       506 1 2 1 1 51 PHE QD  . 51 PHE QD   1 1 
       507 1 1 1 1 44 LYS QD  . 44 LYS QD   1 1 
       507 1 2 1 1 45 THR HA  . 45 THR HA   1 1 
       508 1 1 1 1 39 LYS QD  . 39 LYS QD   1 1 
       508 1 2 1 1 40 CYS HA  . 40 CYS HA   1 1 
       509 1 1 1 1 42 VAL HA  . 42 VAL HA   1 1 
       509 1 2 1 1 43 LYS QD  . 43 LYS QD   1 1 
       510 1 1 1 1 69 LYS HA  . 69 LYS HA   1 1 
       510 1 2 1 1 69 LYS QD  . 69 LYS QD   1 1 
       511 1 1 1 1 12 ARG HG2 . 12 ARG HG2  1 1 
       511 1 2 1 1 13 ILE H   . 13 ILE H    1 1 
       512 1 1 1 1 12 ARG H   . 12 ARG H    1 1 
       512 1 2 1 1 12 ARG HG2 . 12 ARG HG2  1 1 
       513 1 1 1 1 12 ARG HG3 . 12 ARG HG3  1 1 
       513 1 2 1 1 13 ILE H   . 13 ILE H    1 1 
       514 1 1 1 1 52 ALA MB  . 52 ALA QB   1 1 
       514 1 2 1 1 54 ILE QG  . 54 ILE HG13 1 1 
       515 1 1 1 1 40 CYS H   . 40 CYS H    1 1 
       515 1 2 1 1 40 CYS QB  . 40 CYS HB2  1 1 
       516 1 1 1 1 32 ARG H   . 32 ARG H    1 1 
       516 1 2 1 1 32 ARG QG  . 32 ARG HG2  1 1 
       517 1 1 1 1 38 LEU H   . 38 LEU H    1 1 
       517 1 2 1 1 38 LEU HG  . 38 LEU HG   1 1 
       518 1 1 1 1 54 ILE H   . 54 ILE H    1 1 
       518 1 2 1 1 54 ILE QG  . 54 ILE HG12 1 1 
       519 1 1 1 1 54 ILE QG  . 54 ILE HG12 1 1 
       519 1 2 1 1 55 GLU H   . 55 GLU H    1 1 
       520 1 1 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       520 1 2 1 1 54 ILE QG  . 54 ILE HG12 1 1 
       521 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       521 1 2 1 1 40 CYS QB  . 40 CYS HB3  1 1 
       522 1 1 1 1 60 ARG QG  . 60 ARG QG   1 1 
       522 1 2 1 1 61 ASP H   . 61 ASP H    1 1 
       523 1 1 1 1 80 ARG QG  . 80 ARG QG   1 1 
       523 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
       524 1 1 1 1 80 ARG QB  . 80 ARG QB   1 1 
       524 1 2 1 1 80 ARG QG  . 80 ARG QG   1 1 
       525 1 1 1 1 80 ARG H   . 80 ARG H    1 1 
       525 1 2 1 1 80 ARG QG  . 80 ARG QG   1 1 
       526 1 1 1 1 88 ARG H   . 88 ARG H    1 1 
       526 1 2 1 1 88 ARG QG  . 88 ARG QG   1 1 
       527 1 1 1 1 60 ARG H   . 60 ARG H    1 1 
       527 1 2 1 1 60 ARG QG  . 60 ARG QG   1 1 
       528 1 1 1 1 25 ARG QG  . 25 ARG QG   1 1 
       528 1 2 1 1 26 ASP H   . 26 ASP H    1 1 
       529 1 1 1 1 25 ARG H   . 25 ARG H    1 1 
       529 1 2 1 1 25 ARG QG  . 25 ARG QG   1 1 
       530 1 1 1 1 18 LEU QD  . 18 LEU QD1  1 1 
       530 1 2 1 1 52 ALA H   . 52 ALA H    1 1 
       531 1 1 1 1 18 LEU H   . 18 LEU H    1 1 
       531 1 2 1 1 18 LEU QD  . 18 LEU QD1  1 1 
       532 1 1 1 1 13 ILE H   . 13 ILE H    1 1 
       532 1 2 1 1 13 ILE QG  . 13 ILE QG1  1 1 
       533 1 1 1 1 44 LYS H   . 44 LYS H    1 1 
       533 1 2 1 1 44 LYS QG  . 44 LYS QG   1 1 
       534 1 1 1 1 43 LYS QG  . 43 LYS QG   1 1 
       534 1 2 1 1 44 LYS QE  . 44 LYS QE   1 1 
       535 1 1 1 1 43 LYS QG  . 43 LYS QG   1 1 
       535 1 2 1 1 53 PHE QB  . 53 PHE QB   1 1 
       536 1 1 1 1 39 LYS QE  . 39 LYS QE   1 1 
       536 1 2 1 1 43 LYS QG  . 43 LYS QG   1 1 
       537 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
       537 1 2 1 1 43 LYS QG  . 43 LYS QG   1 1 
       538 1 1 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       538 1 2 1 1 28 GLU H   . 28 GLU H    1 1 
       539 1 1 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       539 1 2 1 1 28 GLU QB  . 28 GLU HB2  1 1 
       540 1 1 1 1 22 VAL QG  . 22 VAL QG1  1 1 
       540 1 2 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       541 1 1 1 1 27 VAL H   . 27 VAL H    1 1 
       541 1 2 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       542 1 1 1 1 69 LYS H   . 69 LYS H    1 1 
       542 1 2 1 1 69 LYS QG  . 69 LYS QG   1 1 
       543 1 1 1 1 43 LYS H   . 43 LYS H    1 1 
       543 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       544 1 1 1 1 42 VAL H   . 42 VAL H    1 1 
       544 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       545 1 1 1 1 41 ASP H   . 41 ASP H    1 1 
       545 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       546 1 1 1 1 52 ALA MB  . 52 ALA QB   1 1 
       546 1 2 1 1 53 PHE H   . 53 PHE H    1 1 
       547 1 1 1 1 51 PHE HA  . 51 PHE HA   1 1 
       547 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       548 1 1 1 1 42 VAL HA  . 42 VAL HA   1 1 
       548 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       549 1 1 1 1 52 ALA MB  . 52 ALA QB   1 1 
       549 1 2 1 1 53 PHE QB  . 53 PHE QB   1 1 
       550 1 1 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       550 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       551 1 1 1 1 18 LEU QD  . 18 LEU QD1  1 1 
       551 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       552 1 1 1 1 52 ALA MB  . 52 ALA QB   1 1 
       552 1 2 1 1 54 ILE H   . 54 ILE H    1 1 
       553 1 1 1 1 51 PHE H   . 51 PHE H    1 1 
       553 1 2 1 1 52 ALA MB  . 52 ALA QB   1 1 
       554 1 1 1 1 33 LYS QG  . 33 LYS HG2  1 1 
       554 1 2 1 1 34 TYR H   . 34 TYR H    1 1 
       555 1 1 1 1 33 LYS QG  . 33 LYS HG2  1 1 
       555 1 2 1 1 34 TYR QE  . 34 TYR QE   1 1 
       556 1 1 1 1 33 LYS QG  . 33 LYS HG2  1 1 
       556 1 2 1 1 62 ALA MB  . 62 ALA QB   1 1 
       557 1 1 1 1 33 LYS H   . 33 LYS H    1 1 
       557 1 2 1 1 33 LYS QG  . 33 LYS HG2  1 1 
       558 1 1 1 1 15 VAL QG  . 15 VAL QG2  1 1 
       558 1 2 1 1 16 GLY H   . 16 GLY H    1 1 
       559 1 1 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       559 1 2 1 1 43 LYS H   . 43 LYS H    1 1 
       560 1 1 1 1 80 ARG HA  . 80 ARG HA   1 1 
       560 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       561 1 1 1 1 15 VAL QG  . 15 VAL QG2  1 1 
       561 1 2 1 1 16 GLY HA2 . 16 GLY HA2  1 1 
       562 1 1 1 1 41 ASP HA  . 41 ASP HA   1 1 
       562 1 2 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       563 1 1 1 1 24 SER H   . 24 SER H    1 1 
       563 1 2 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       564 1 1 1 1 42 VAL H   . 42 VAL H    1 1 
       564 1 2 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       565 1 1 1 1 23 SER HA  . 23 SER HA   1 1 
       565 1 2 1 1 42 VAL QG  . 42 VAL QG1  1 1 
       566 1 1 1 1 27 VAL QG  . 27 VAL QG2  1 1 
       566 1 2 1 1 31 PHE QE  . 31 PHE QE   1 1 
       567 1 1 1 1 27 VAL QG  . 27 VAL QG2  1 1 
       567 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       568 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       568 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       569 1 1 1 1 44 LYS HA  . 44 LYS HA   1 1 
       569 1 2 1 1 45 THR MG  . 45 THR QG2  1 1 
       570 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       570 1 2 1 1 49 ALA H   . 49 ALA H    1 1 
       571 1 1 1 1 80 ARG QG  . 80 ARG QG   1 1 
       571 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       572 1 1 1 1 80 ARG QD  . 80 ARG HD2  1 1 
       572 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       573 1 1 1 1 81 VAL H   . 81 VAL H    1 1 
       573 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       574 1 1 1 1 38 LEU HA  . 38 LEU HA   1 1 
       574 1 2 1 1 38 LEU QD  . 38 LEU QD2  1 1 
       575 1 1 1 1 45 THR H   . 45 THR H    1 1 
       575 1 2 1 1 45 THR MG  . 45 THR QG2  1 1 
       576 1 1 1 1 45 THR HA  . 45 THR HA   1 1 
       576 1 2 1 1 45 THR MG  . 45 THR QG2  1 1 
       577 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       577 1 2 1 1 47 SER H   . 47 SER H    1 1 
       578 1 1 1 1 45 THR H   . 45 THR H    1 1 
       578 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       579 1 1 1 1 50 ALA MB  . 50 ALA QB   1 1 
       579 1 2 1 1 51 PHE H   . 51 PHE H    1 1 
       580 1 1 1 1 50 ALA H   . 50 ALA H    1 1 
       580 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       581 1 1 1 1 44 LYS HA  . 44 LYS HA   1 1 
       581 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       582 1 1 1 1 49 ALA HA  . 49 ALA HA   1 1 
       582 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       583 1 1 1 1 44 LYS QE  . 44 LYS QE   1 1 
       583 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       584 1 1 1 1 42 VAL QG  . 42 VAL QG2  1 1 
       584 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       585 1 1 1 1 18 LEU QD  . 18 LEU QD1  1 1 
       585 1 2 1 1 50 ALA MB  . 50 ALA QB   1 1 
       586 1 1 1 1 22 VAL QG  . 22 VAL QG1  1 1 
       586 1 2 1 1 27 VAL H   . 27 VAL H    1 1 
       587 1 1 1 1 42 VAL QG  . 42 VAL QG2  1 1 
       587 1 2 1 1 43 LYS HA  . 43 LYS HA   1 1 
       588 1 1 1 1 46 VAL MG2 . 46 VAL QG2  1 1 
       588 1 2 1 1 47 SER H   . 47 SER H    1 1 
       589 1 1 1 1 18 LEU H   . 18 LEU H    1 1 
       589 1 2 1 1 49 ALA MB  . 49 ALA QB   1 1 
       590 1 1 1 1 49 ALA MB  . 49 ALA QB   1 1 
       590 1 2 1 1 50 ALA HA  . 50 ALA HA   1 1 
       591 1 1 1 1 10 VAL QG  . 10 VAL QG2  1 1 
       591 1 2 1 1 11 SER H   . 11 SER H    1 1 
       592 1 1 1 1 17 ASN H   . 17 ASN H    1 1 
       592 1 2 1 1 49 ALA MB  . 49 ALA QB   1 1 
       593 1 1 1 1 49 ALA MB  . 49 ALA QB   1 1 
       593 1 2 1 1 50 ALA H   . 50 ALA H    1 1 
       594 1 1 1 1 49 ALA H   . 49 ALA H    1 1 
       594 1 2 1 1 49 ALA MB  . 49 ALA QB   1 1 
       595 1 1 1 1 17 ASN HA  . 17 ASN HA   1 1 
       595 1 2 1 1 49 ALA MB  . 49 ALA QB   1 1 
       596 1 1 1 1 48 GLY H   . 48 GLY H    1 1 
       596 1 2 1 1 49 ALA MB  . 49 ALA QB   1 1 
       597 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       597 1 2 1 1 49 ALA MB  . 49 ALA QB   1 1 
       598 1 1 1 1  9 SER HA  .  9 SER HA   1 1 
       598 1 2 1 1 10 VAL QG  . 10 VAL QG2  1 1 
       599 1 1 1 1 87 ALA MB  . 87 ALA QB   1 1 
       599 1 2 1 1 88 ARG HB2 . 88 ARG HB2  1 1 
       600 1 1 1 1 87 ALA MB  . 87 ALA QB   1 1 
       600 1 2 1 1 88 ARG HA  . 88 ARG HA   1 1 
       601 1 1 1 1 87 ALA H   . 87 ALA H    1 1 
       601 1 2 1 1 87 ALA MB  . 87 ALA QB   1 1 
       602 1 1 1 1 87 ALA MB  . 87 ALA QB   1 1 
       602 1 2 1 1 89 GLU H   . 89 GLU H    1 1 
       603 1 1 1 1 59 ALA MB  . 59 ALA QB   1 1 
       603 1 2 1 1 88 ARG H   . 88 ARG H    1 1 
       604 1 1 1 1 59 ALA MB  . 59 ALA QB   1 1 
       604 1 2 1 1 60 ARG HA  . 60 ARG HA   1 1 
       605 1 1 1 1 59 ALA MB  . 59 ALA QB   1 1 
       605 1 2 1 1 88 ARG QG  . 88 ARG QG   1 1 
       606 1 1 1 1 59 ALA MB  . 59 ALA QB   1 1 
       606 1 2 1 1 60 ARG H   . 60 ARG H    1 1 
       607 1 1 1 1 59 ALA H   . 59 ALA H    1 1 
       607 1 2 1 1 59 ALA MB  . 59 ALA QB   1 1 
       608 1 1 1 1 59 ALA MB  . 59 ALA QB   1 1 
       608 1 2 1 1 88 ARG HA  . 88 ARG HA   1 1 
       609 1 1 1 1 59 ALA MB  . 59 ALA QB   1 1 
       609 1 2 1 1 88 ARG HB3 . 88 ARG HB3  1 1 
       610 1 1 1 1 65 ALA MB  . 65 ALA QB   1 1 
       610 1 2 1 1 66 ILE H   . 66 ILE H    1 1 
       611 1 1 1 1 65 ALA H   . 65 ALA H    1 1 
       611 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       612 1 1 1 1 65 ALA MB  . 65 ALA QB   1 1 
       612 1 2 1 1 66 ILE HA  . 66 ILE HA   1 1 
       613 1 1 1 1 62 ALA HA  . 62 ALA HA   1 1 
       613 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       614 1 1 1 1 62 ALA MB  . 62 ALA QB   1 1 
       614 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       615 1 1 1 1 65 ALA MB  . 65 ALA QB   1 1 
       615 1 2 1 1 66 ILE MG  . 66 ILE QG2  1 1 
       616 1 1 1 1 65 ALA MB  . 65 ALA QB   1 1 
       616 1 2 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       617 1 1 1 1 13 ILE H   . 13 ILE H    1 1 
       617 1 2 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       618 1 1 1 1 13 ILE HA  . 13 ILE HA   1 1 
       618 1 2 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       619 1 1 1 1 66 ILE MG  . 66 ILE QG2  1 1 
       619 1 2 1 1 82 GLU HA  . 82 GLU HA   1 1 
       620 1 1 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       620 1 2 1 1 14 TYR H   . 14 TYR H    1 1 
       621 1 1 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       621 1 2 1 1 85 PHE QE  . 85 PHE QE   1 1 
       622 1 1 1 1 62 ALA MB  . 62 ALA QB   1 1 
       622 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
       623 1 1 1 1 62 ALA MB  . 62 ALA QB   1 1 
       623 1 2 1 1 63 ALA H   . 63 ALA H    1 1 
       624 1 1 1 1 34 TYR H   . 34 TYR H    1 1 
       624 1 2 1 1 62 ALA MB  . 62 ALA QB   1 1 
       625 1 1 1 1 62 ALA H   . 62 ALA H    1 1 
       625 1 2 1 1 62 ALA MB  . 62 ALA QB   1 1 
       626 1 1 1 1 59 ALA HA  . 59 ALA HA   1 1 
       626 1 2 1 1 62 ALA MB  . 62 ALA QB   1 1 
       627 1 1 1 1 62 ALA MB  . 62 ALA QB   1 1 
       627 1 2 1 1 63 ALA HA  . 63 ALA HA   1 1 
       628 1 1 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       628 1 2 1 1 54 ILE HB  . 54 ILE HB   1 1 
       629 1 1 1 1 22 VAL QG  . 22 VAL QG2  1 1 
       629 1 2 1 1 54 ILE QG  . 54 ILE HG12 1 1 
       630 1 1 1 1 18 LEU HB2 . 18 LEU HB3  1 1 
       630 1 2 1 1 22 VAL QG  . 22 VAL QG2  1 1 
       631 1 1 1 1 22 VAL QG  . 22 VAL QG2  1 1 
       631 1 2 1 1 23 SER HA  . 23 SER HA   1 1 
       632 1 1 1 1 63 ALA MB  . 63 ALA QB   1 1 
       632 1 2 1 1 64 ASP H   . 64 ASP H    1 1 
       633 1 1 1 1 63 ALA H   . 63 ALA H    1 1 
       633 1 2 1 1 63 ALA MB  . 63 ALA QB   1 1 
       634 1 1 1 1 60 ARG HA  . 60 ARG HA   1 1 
       634 1 2 1 1 63 ALA MB  . 63 ALA QB   1 1 
       635 1 1 1 1 63 ALA MB  . 63 ALA QB   1 1 
       635 1 2 1 1 65 ALA H   . 65 ALA H    1 1 
       636 1 1 1 1 63 ALA MB  . 63 ALA QB   1 1 
       636 1 2 1 1 67 LYS H   . 67 LYS H    1 1 
       637 1 1 1 1 63 ALA MB  . 63 ALA QB   1 1 
       637 1 2 1 1 64 ASP HA  . 64 ASP HA   1 1 
       638 1 1 1 1 60 ARG QG  . 60 ARG QG   1 1 
       638 1 2 1 1 63 ALA MB  . 63 ALA QB   1 1 
       639 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       639 1 2 1 1 54 ILE HA  . 54 ILE HA   1 1 
       640 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       640 1 2 1 1 38 LEU HA  . 38 LEU HA   1 1 
       641 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       641 1 2 1 1 38 LEU H   . 38 LEU H    1 1 
       642 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       642 1 2 1 1 40 CYS H   . 40 CYS H    1 1 
       643 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       643 1 2 1 1 55 GLU H   . 55 GLU H    1 1 
       644 1 1 1 1 28 GLU H   . 28 GLU H    1 1 
       644 1 2 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       645 1 1 1 1 37 ILE H   . 37 ILE H    1 1 
       645 1 2 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       646 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       646 1 2 1 1 39 LYS H   . 39 LYS H    1 1 
       647 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       647 1 2 1 1 39 LYS HA  . 39 LYS HA   1 1 
       648 1 1 1 1 37 ILE HA  . 37 ILE HA   1 1 
       648 1 2 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       649 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       649 1 2 1 1 37 ILE MG  . 37 ILE QG2  1 1 
       650 1 1 1 1 37 ILE MD  . 37 ILE QD1  1 1 
       650 1 2 1 1 38 LEU QD  . 38 LEU QD2  1 1 
       651 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       651 1 2 1 1 82 GLU HA  . 82 GLU HA   1 1 
       652 1 1 1 1 66 ILE HB  . 66 ILE HB   1 1 
       652 1 2 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       653 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       653 1 2 1 1 67 LYS HA  . 67 LYS HA   1 1 
       654 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       654 1 2 1 1 70 ASP QB  . 70 ASP HB2  1 1 
       655 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       655 1 2 1 1 67 LYS QB  . 67 LYS QB   1 1 
       656 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       656 1 2 1 1 81 VAL QG  . 81 VAL QG2  1 1 
       657 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       657 1 2 1 1 81 VAL H   . 81 VAL H    1 1 
       658 1 1 1 1 66 ILE MD  . 66 ILE QD1  1 1 
       658 1 2 1 1 83 VAL H   . 83 VAL H    1 1 
       659 1 1 1 1 13 ILE H   . 13 ILE H    1 1 
       659 1 2 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       660 1 1 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       660 1 2 1 1 31 PHE QD  . 31 PHE QD   1 1 
       661 1 1 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       661 1 2 1 1 85 PHE QE  . 85 PHE QE   1 1 
       662 1 1 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       662 1 2 1 1 85 PHE QD  . 85 PHE QD   1 1 
       663 1 1 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       663 1 2 1 1 31 PHE QE  . 31 PHE QE   1 1 
       664 1 1 1 1 13 ILE HB  . 13 ILE HB   1 1 
       664 1 2 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       665 1 1 1 1 13 ILE MD  . 13 ILE QD1  1 1 
       665 1 2 1 1 13 ILE MG  . 13 ILE QG2  1 1 
       666 1 1 1 1 54 ILE H   . 54 ILE H    1 1 
       666 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       667 1 1 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       667 1 2 1 1 55 GLU H   . 55 GLU H    1 1 
       668 1 1 1 1 31 PHE QD  . 31 PHE QD   1 1 
       668 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       669 1 1 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       669 1 2 1 1 85 PHE QE  . 85 PHE QE   1 1 
       670 1 1 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       670 1 2 1 1 85 PHE QD  . 85 PHE QD   1 1 
       671 1 1 1 1 31 PHE QE  . 31 PHE QE   1 1 
       671 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       672 1 1 1 1 52 ALA MB  . 52 ALA QB   1 1 
       672 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       673 1 1 1 1 22 VAL QG  . 22 VAL QG2  1 1 
       673 1 2 1 1 54 ILE MD  . 54 ILE QD1  1 1 
       674 1 1 1 1 14 TYR QD  . 14 TYR QD   1 1 
       674 1 2 1 1 15 VAL H   . 15 VAL H    1 1 
       675 1 1 1 1 14 TYR QD  . 14 TYR QD   1 1 
       675 1 2 1 1 16 GLY HA3 . 16 GLY HA3  1 1 
       676 1 1 1 1 31 PHE HA  . 31 PHE HA   1 1 
       676 1 2 1 1 34 TYR QD  . 34 TYR QD   1 1 
       677 1 1 1 1 34 TYR QD  . 34 TYR QD   1 1 
       677 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       678 1 1 1 1 51 PHE H   . 51 PHE H    1 1 
       678 1 2 1 1 51 PHE QE  . 51 PHE QE   1 1 
       679 1 1 1 1 44 LYS HA  . 44 LYS HA   1 1 
       679 1 2 1 1 51 PHE QE  . 51 PHE QE   1 1 
       680 1 1 1 1 51 PHE HA  . 51 PHE HA   1 1 
       680 1 2 1 1 51 PHE QE  . 51 PHE QE   1 1 
       681 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       681 1 2 1 1 51 PHE QE  . 51 PHE QE   1 1 
       682 1 1 1 1 27 VAL QG  . 27 VAL QG1  1 1 
       682 1 2 1 1 31 PHE QD  . 31 PHE QD   1 1 
       683 1 1 1 1 31 PHE QD  . 31 PHE QD   1 1 
       683 1 2 1 1 34 TYR QD  . 34 TYR QD   1 1 
       684 1 1 1 1 31 PHE QD  . 31 PHE QD   1 1 
       684 1 2 1 1 35 GLY H   . 35 GLY H    1 1 
       685 1 1 1 1 31 PHE H   . 31 PHE H    1 1 
       685 1 2 1 1 31 PHE QD  . 31 PHE QD   1 1 
       686 1 1 1 1 31 PHE HA  . 31 PHE HA   1 1 
       686 1 2 1 1 31 PHE QD  . 31 PHE QD   1 1 
       687 1 1 1 1 27 VAL HB  . 27 VAL HB   1 1 
       687 1 2 1 1 31 PHE QD  . 31 PHE QD   1 1 
       688 1 1 1 1 30 GLU QG  . 30 GLU QG   1 1 
       688 1 2 1 1 31 PHE QD  . 31 PHE QD   1 1 
       689 1 1 1 1 74 PHE QD  . 74 PHE QD   1 1 
       689 1 2 1 1 75 GLU HG3 . 75 GLU HG3  1 1 
       690 1 1 1 1 45 THR MG  . 45 THR QG2  1 1 
       690 1 2 1 1 51 PHE QD  . 51 PHE QD   1 1 
       691 1 1 1 1 43 LYS QG  . 43 LYS QG   1 1 
       691 1 2 1 1 51 PHE QD  . 51 PHE QD   1 1 
       692 1 1 1 1 13 ILE QG  . 13 ILE HG12 1 1 
       692 1 2 1 1 31 PHE QE  . 31 PHE QE   1 1 
       693 1 1 1 1 34 TYR H   . 34 TYR H    1 1 
       693 1 2 1 1 34 TYR QE  . 34 TYR QE   1 1 
       694 1 1 1 1 34 TYR QE  . 34 TYR QE   1 1 
       694 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       695 1 1 1 1 14 TYR QE  . 14 TYR QE   1 1 
       695 1 2 1 1 16 GLY H   . 16 GLY H    1 1 
       696 1 1 1 1 31 PHE QE  . 31 PHE QE   1 1 
       696 1 2 1 1 56 PHE QE  . 56 PHE QE   1 1 
       697 1 1 1 1 31 PHE HA  . 31 PHE HA   1 1 
       697 1 2 1 1 56 PHE QE  . 56 PHE QE   1 1 
       698 1 1 1 1 31 PHE QB  . 31 PHE HB2  1 1 
       698 1 2 1 1 56 PHE QE  . 56 PHE QE   1 1 
       699 1 1 1 1 56 PHE QD  . 56 PHE QD   1 1 
       699 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       700 1 1 1 1 56 PHE QE  . 56 PHE QE   1 1 
       700 1 2 1 1 65 ALA MB  . 65 ALA QB   1 1 
       701 1 1 1 1 34 TYR QB  . 34 TYR HB2  1 1 
       701 1 2 1 1 56 PHE QE  . 56 PHE QE   1 1 
       702 1 1 1 1 34 TYR QB  . 34 TYR HB3  1 1 
       702 1 2 1 1 56 PHE QD  . 56 PHE QD   1 1 
       703 1 1 1 1 31 PHE QD  . 31 PHE QD   1 1 
       703 1 2 1 1 69 LYS QG  . 69 LYS QG   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . . .  5.5 1 1 
         2 1 . . . . . . . 4.21 1 1 
         3 1 . . . . . . .  5.0 1 1 
         4 1 . . . . . . .  5.0 1 1 
         5 1 . . . . . . . 3.76 1 1 
         6 1 . . . . . . . 4.13 1 1 
         7 1 . . . . . . . 4.23 1 1 
         8 1 . . . . . . .  5.5 1 1 
         9 1 . . . . . . . 4.61 1 1 
        10 1 . . . . . . . 4.74 1 1 
        11 1 . . . . . . . 4.98 1 1 
        12 1 . . . . . . . 4.72 1 1 
        13 1 . . . . . . .  5.0 1 1 
        14 1 . . . . . . .  5.0 1 1 
        15 1 . . . . . . . 4.64 1 1 
        16 1 . . . . . . . 3.83 1 1 
        17 1 . . . . . . . 4.65 1 1 
        18 1 . . . . . . .  4.0 1 1 
        19 1 . . . . . . .  5.2 1 1 
        20 1 . . . . . . .  5.5 1 1 
        21 1 . . . . . . . 4.86 1 1 
        22 1 . . . . . . . 4.87 1 1 
        23 1 . . . . . . .  5.5 1 1 
        24 1 . . . . . . .  5.5 1 1 
        25 1 . . . . . . .  5.0 1 1 
        26 1 . . . . . . . 5.07 1 1 
        27 1 . . . . . . . 5.03 1 1 
        28 1 . . . . . . .  5.0 1 1 
        29 1 . . . . . . . 3.59 1 1 
        30 1 . . . . . . . 3.82 1 1 
        31 1 . . . . . . . 5.15 1 1 
        32 1 . . . . . . .  5.5 1 1 
        33 1 . . . . . . . 4.75 1 1 
        34 1 . . . . . . . 5.44 1 1 
        35 1 . . . . . . .  5.0 1 1 
        36 1 . . . . . . . 5.37 1 1 
        37 1 . . . . . . . 4.86 1 1 
        38 1 . . . . . . .  4.7 1 1 
        39 1 . . . . . . .  5.0 1 1 
        40 1 . . . . . . . 4.09 1 1 
        41 1 . . . . . . . 5.11 1 1 
        42 1 . . . . . . .  5.5 1 1 
        43 1 . . . . . . . 4.66 1 1 
        44 1 . . . . . . . 5.05 1 1 
        45 1 . . . . . . .  5.5 1 1 
        46 1 . . . . . . . 5.39 1 1 
        47 1 . . . . . . . 5.04 1 1 
        48 1 . . . . . . . 4.45 1 1 
        49 1 . . . . . . . 3.59 1 1 
        50 1 . . . . . . . 4.59 1 1 
        51 1 . . . . . . .  5.5 1 1 
        52 1 . . . . . . .  5.5 1 1 
        53 1 . . . . . . .  5.5 1 1 
        54 1 . . . . . . .  4.6 1 1 
        55 1 . . . . . . .  5.5 1 1 
        56 1 . . . . . . . 4.77 1 1 
        57 1 . . . . . . .  5.0 1 1 
        58 1 . . . . . . . 4.86 1 1 
        59 1 . . . . . . . 5.28 1 1 
        60 1 . . . . . . . 3.51 1 1 
        61 1 . . . . . . . 4.26 1 1 
        62 1 . . . . . . . 3.54 1 1 
        63 1 . . . . . . .  5.0 1 1 
        64 1 . . . . . . . 5.46 1 1 
        65 1 . . . . . . . 4.43 1 1 
        66 1 . . . . . . .  5.5 1 1 
        67 1 . . . . . . .  5.5 1 1 
        68 1 . . . . . . .  5.0 1 1 
        69 1 . . . . . . .  5.3 1 1 
        70 1 . . . . . . .  5.0 1 1 
        71 1 . . . . . . .  5.5 1 1 
        72 1 . . . . . . . 4.68 1 1 
        73 1 . . . . . . .  5.0 1 1 
        74 1 . . . . . . . 3.56 1 1 
        75 1 . . . . . . . 5.33 1 1 
        76 1 . . . . . . .  5.0 1 1 
        77 1 . . . . . . .  5.5 1 1 
        78 1 . . . . . . .  5.0 1 1 
        79 1 . . . . . . . 3.83 1 1 
        80 1 . . . . . . .  5.5 1 1 
        81 1 . . . . . . . 3.57 1 1 
        82 1 . . . . . . . 5.22 1 1 
        83 1 . . . . . . . 3.89 1 1 
        84 1 . . . . . . .  5.5 1 1 
        85 1 . . . . . . . 5.11 1 1 
        86 1 . . . . . . . 4.61 1 1 
        87 1 . . . . . . . 3.64 1 1 
        88 1 . . . . . . .  4.0 1 1 
        89 1 . . . . . . . 3.82 1 1 
        90 1 . . . . . . . 4.17 1 1 
        91 1 . . . . . . . 4.23 1 1 
        92 1 . . . . . . .  5.5 1 1 
        93 1 . . . . . . . 4.05 1 1 
        94 1 . . . . . . . 3.82 1 1 
        95 1 . . . . . . . 4.32 1 1 
        96 1 . . . . . . . 4.82 1 1 
        97 1 . . . . . . . 4.05 1 1 
        98 1 . . . . . . . 4.84 1 1 
        99 1 . . . . . . . 4.37 1 1 
       100 1 . . . . . . . 4.24 1 1 
       101 1 . . . . . . . 5.22 1 1 
       102 1 . . . . . . . 3.64 1 1 
       103 1 . . . . . . . 3.73 1 1 
       104 1 . . . . . . . 4.37 1 1 
       105 1 . . . . . . .  5.2 1 1 
       106 1 . . . . . . . 3.78 1 1 
       107 1 . . . . . . . 3.57 1 1 
       108 1 . . . . . . .  5.5 1 1 
       109 1 . . . . . . .  5.5 1 1 
       110 1 . . . . . . . 5.28 1 1 
       111 1 . . . . . . . 5.06 1 1 
       112 1 . . . . . . . 3.73 1 1 
       113 1 . . . . . . . 4.64 1 1 
       114 1 . . . . . . . 4.74 1 1 
       115 1 . . . . . . . 3.97 1 1 
       116 1 . . . . . . . 4.86 1 1 
       117 1 . . . . . . .  5.5 1 1 
       118 1 . . . . . . . 4.77 1 1 
       119 1 . . . . . . .  5.5 1 1 
       120 1 . . . . . . . 4.37 1 1 
       121 1 . . . . . . .  5.5 1 1 
       122 1 . . . . . . . 4.89 1 1 
       123 1 . . . . . . . 5.26 1 1 
       124 1 . . . . . . .  5.0 1 1 
       125 1 . . . . . . .  5.5 1 1 
       126 1 . . . . . . .  5.5 1 1 
       127 1 . . . . . . .  5.5 1 1 
       128 1 . . . . . . . 5.15 1 1 
       129 1 . . . . . . . 5.06 1 1 
       130 1 . . . . . . . 5.02 1 1 
       131 1 . . . . . . . 3.78 1 1 
       132 1 . . . . . . . 5.27 1 1 
       133 1 . . . . . . . 5.21 1 1 
       134 1 . . . . . . . 4.11 1 1 
       135 1 . . . . . . .  5.5 1 1 
       136 1 . . . . . . . 5.07 1 1 
       137 1 . . . . . . .  5.0 1 1 
       138 1 . . . . . . . 3.82 1 1 
       139 1 . . . . . . . 5.39 1 1 
       140 1 . . . . . . . 3.74 1 1 
       141 1 . . . . . . . 4.81 1 1 
       142 1 . . . . . . . 5.11 1 1 
       143 1 . . . . . . . 3.64 1 1 
       144 1 . . . . . . . 4.99 1 1 
       145 1 . . . . . . .  5.0 1 1 
       146 1 . . . . . . .  5.5 1 1 
       147 1 . . . . . . .  5.0 1 1 
       148 1 . . . . . . . 3.86 1 1 
       149 1 . . . . . . . 3.78 1 1 
       150 1 . . . . . . . 5.03 1 1 
       151 1 . . . . . . .  5.0 1 1 
       152 1 . . . . . . . 4.43 1 1 
       153 1 . . . . . . . 4.65 1 1 
       154 1 . . . . . . . 5.17 1 1 
       155 1 . . . . . . . 4.54 1 1 
       156 1 . . . . . . . 3.75 1 1 
       157 1 . . . . . . . 3.79 1 1 
       158 1 . . . . . . . 5.05 1 1 
       159 1 . . . . . . . 4.07 1 1 
       160 1 . . . . . . .  5.0 1 1 
       161 1 . . . . . . .  5.0 1 1 
       162 1 . . . . . . . 5.08 1 1 
       163 1 . . . . . . . 3.94 1 1 
       164 1 . . . . . . .  5.0 1 1 
       165 1 . . . . . . . 5.44 1 1 
       166 1 . . . . . . . 3.89 1 1 
       167 1 . . . . . . .  5.5 1 1 
       168 1 . . . . . . . 3.44 1 1 
       169 1 . . . . . . . 3.71 1 1 
       170 1 . . . . . . .  5.0 1 1 
       171 1 . . . . . . . 3.78 1 1 
       172 1 . . . . . . . 4.41 1 1 
       173 1 . . . . . . . 5.03 1 1 
       174 1 . . . . . . .  4.0 1 1 
       175 1 . . . . . . .  4.2 1 1 
       176 1 . . . . . . .  5.0 1 1 
       177 1 . . . . . . . 3.99 1 1 
       178 1 . . . . . . . 5.27 1 1 
       179 1 . . . . . . . 3.86 1 1 
       180 1 . . . . . . .  5.5 1 1 
       181 1 . . . . . . . 4.29 1 1 
       182 1 . . . . . . .  5.0 1 1 
       183 1 . . . . . . .  5.0 1 1 
       184 1 . . . . . . . 4.25 1 1 
       185 1 . . . . . . .  4.0 1 1 
       186 1 . . . . . . . 4.86 1 1 
       187 1 . . . . . . .  5.5 1 1 
       188 1 . . . . . . . 4.63 1 1 
       189 1 . . . . . . .  5.5 1 1 
       190 1 . . . . . . . 2.75 1 1 
       191 1 . . . . . . . 3.52 1 1 
       192 1 . . . . . . .  5.5 1 1 
       193 1 . . . . . . . 4.18 1 1 
       194 1 . . . . . . . 4.78 1 1 
       195 1 . . . . . . .  5.0 1 1 
       196 1 . . . . . . . 3.62 1 1 
       197 1 . . . . . . .  5.0 1 1 
       198 1 . . . . . . . 4.82 1 1 
       199 1 . . . . . . .  5.5 1 1 
       200 1 . . . . . . . 3.25 1 1 
       201 1 . . . . . . . 3.45 1 1 
       202 1 . . . . . . . 3.93 1 1 
       203 1 . . . . . . .  5.0 1 1 
       204 1 . . . . . . . 3.85 1 1 
       205 1 . . . . . . . 5.29 1 1 
       206 1 . . . . . . .  5.1 1 1 
       207 1 . . . . . . . 3.93 1 1 
       208 1 . . . . . . .  5.0 1 1 
       209 1 . . . . . . .  5.5 1 1 
       210 1 . . . . . . .  5.5 1 1 
       211 1 . . . . . . . 5.47 1 1 
       212 1 . . . . . . .  5.5 1 1 
       213 1 . . . . . . . 4.51 1 1 
       214 1 . . . . . . .  5.5 1 1 
       215 1 . . . . . . . 5.44 1 1 
       216 1 . . . . . . . 3.91 1 1 
       217 1 . . . . . . . 5.17 1 1 
       218 1 . . . . . . .  5.0 1 1 
       219 1 . . . . . . . 4.57 1 1 
       220 1 . . . . . . .  3.7 1 1 
       221 1 . . . . . . . 4.73 1 1 
       222 1 . . . . . . . 4.24 1 1 
       223 1 . . . . . . .  4.4 1 1 
       224 1 . . . . . . . 3.91 1 1 
       225 1 . . . . . . .  3.6 1 1 
       226 1 . . . . . . . 4.27 1 1 
       227 1 . . . . . . . 4.16 1 1 
       228 1 . . . . . . .  5.5 1 1 
       229 1 . . . . . . . 4.81 1 1 
       230 1 . . . . . . . 3.82 1 1 
       231 1 . . . . . . . 4.07 1 1 
       232 1 . . . . . . . 5.14 1 1 
       233 1 . . . . . . .  5.5 1 1 
       234 1 . . . . . . . 4.54 1 1 
       235 1 . . . . . . .  5.0 1 1 
       236 1 . . . . . . . 4.03 1 1 
       237 1 . . . . . . . 3.35 1 1 
       238 1 . . . . . . . 3.52 1 1 
       239 1 . . . . . . .  3.3 1 1 
       240 1 . . . . . . . 4.52 1 1 
       241 1 . . . . . . .  5.0 1 1 
       242 1 . . . . . . . 4.27 1 1 
       243 1 . . . . . . . 3.84 1 1 
       244 1 . . . . . . . 4.58 1 1 
       245 1 . . . . . . . 3.08 1 1 
       246 1 . . . . . . . 3.04 1 1 
       247 1 . . . . . . . 4.07 1 1 
       248 1 . . . . . . . 3.56 1 1 
       249 1 . . . . . . . 4.54 1 1 
       250 1 . . . . . . . 2.85 1 1 
       251 1 . . . . . . . 4.21 1 1 
       252 1 . . . . . . . 4.09 1 1 
       253 1 . . . . . . . 3.02 1 1 
       254 1 . . . . . . . 3.19 1 1 
       255 1 . . . . . . . 3.54 1 1 
       256 1 . . . . . . . 3.17 1 1 
       257 1 . . . . . . . 3.84 1 1 
       258 1 . . . . . . . 3.89 1 1 
       259 1 . . . . . . . 4.62 1 1 
       260 1 . . . . . . .  3.2 1 1 
       261 1 . . . . . . .  5.0 1 1 
       262 1 . . . . . . . 3.42 1 1 
       263 1 . . . . . . . 4.42 1 1 
       264 1 . . . . . . . 3.63 1 1 
       265 1 . . . . . . . 3.53 1 1 
       266 1 . . . . . . . 3.29 1 1 
       267 1 . . . . . . . 4.34 1 1 
       268 1 . . . . . . .  5.0 1 1 
       269 1 . . . . . . . 2.83 1 1 
       270 1 . . . . . . . 3.19 1 1 
       271 1 . . . . . . . 4.87 1 1 
       272 1 . . . . . . .  5.0 1 1 
       273 1 . . . . . . . 3.74 1 1 
       274 1 . . . . . . . 3.84 1 1 
       275 1 . . . . . . . 4.18 1 1 
       276 1 . . . . . . .  5.0 1 1 
       277 1 . . . . . . . 3.82 1 1 
       278 1 . . . . . . . 3.51 1 1 
       279 1 . . . . . . . 4.19 1 1 
       280 1 . . . . . . .  4.7 1 1 
       281 1 . . . . . . . 3.53 1 1 
       282 1 . . . . . . .  3.6 1 1 
       283 1 . . . . . . .  4.0 1 1 
       284 1 . . . . . . . 4.31 1 1 
       285 1 . . . . . . . 3.25 1 1 
       286 1 . . . . . . .  2.9 1 1 
       287 1 . . . . . . . 4.47 1 1 
       288 1 . . . . . . . 3.13 1 1 
       289 1 . . . . . . . 2.85 1 1 
       290 1 . . . . . . . 2.92 1 1 
       291 1 . . . . . . . 3.28 1 1 
       292 1 . . . . . . . 3.94 1 1 
       293 1 . . . . . . .  2.5 1 1 
       294 1 . . . . . . . 2.94 1 1 
       295 1 . . . . . . .  4.0 1 1 
       296 1 . . . . . . . 4.62 1 1 
       297 1 . . . . . . . 2.88 1 1 
       298 1 . . . . . . . 4.13 1 1 
       299 1 . . . . . . .  5.0 1 1 
       300 1 . . . . . . . 4.41 1 1 
       301 1 . . . . . . . 4.78 1 1 
       302 1 . . . . . . . 3.11 1 1 
       303 1 . . . . . . .  3.2 1 1 
       304 1 . . . . . . . 4.56 1 1 
       305 1 . . . . . . . 5.32 1 1 
       306 1 . . . . . . .  5.0 1 1 
       307 1 . . . . . . . 3.11 1 1 
       308 1 . . . . . . . 4.81 1 1 
       309 1 . . . . . . .  5.0 1 1 
       310 1 . . . . . . . 5.01 1 1 
       311 1 . . . . . . .  4.4 1 1 
       312 1 . . . . . . .  2.8 1 1 
       313 1 . . . . . . . 3.44 1 1 
       314 1 . . . . . . . 3.11 1 1 
       315 1 . . . . . . . 2.99 1 1 
       316 1 . . . . . . . 4.04 1 1 
       317 1 . . . . . . .  5.0 1 1 
       318 1 . . . . . . .  5.0 1 1 
       319 1 . . . . . . . 3.54 1 1 
       320 1 . . . . . . . 4.27 1 1 
       321 1 . . . . . . . 2.69 1 1 
       322 1 . . . . . . . 4.29 1 1 
       323 1 . . . . . . . 3.05 1 1 
       324 1 . . . . . . . 2.99 1 1 
       325 1 . . . . . . . 4.36 1 1 
       326 1 . . . . . . .  3.1 1 1 
       327 1 . . . . . . . 2.82 1 1 
       328 1 . . . . . . . 3.48 1 1 
       329 1 . . . . . . . 4.78 1 1 
       330 1 . . . . . . .  5.0 1 1 
       331 1 . . . . . . .  4.9 1 1 
       332 1 . . . . . . .  2.9 1 1 
       333 1 . . . . . . . 3.15 1 1 
       334 1 . . . . . . . 4.63 1 1 
       335 1 . . . . . . . 4.28 1 1 
       336 1 . . . . . . . 4.84 1 1 
       337 1 . . . . . . .  5.0 1 1 
       338 1 . . . . . . . 3.74 1 1 
       339 1 . . . . . . . 2.95 1 1 
       340 1 . . . . . . . 3.17 1 1 
       341 1 . . . . . . . 4.23 1 1 
       342 1 . . . . . . . 4.44 1 1 
       343 1 . . . . . . . 4.47 1 1 
       344 1 . . . . . . . 4.37 1 1 
       345 1 . . . . . . .  4.7 1 1 
       346 1 . . . . . . .  5.0 1 1 
       347 1 . . . . . . .  4.9 1 1 
       348 1 . . . . . . . 4.77 1 1 
       349 1 . . . . . . . 4.45 1 1 
       350 1 . . . . . . .  5.0 1 1 
       351 1 . . . . . . . 4.99 1 1 
       352 1 . . . . . . . 3.43 1 1 
       353 1 . . . . . . .  4.0 1 1 
       354 1 . . . . . . . 4.42 1 1 
       355 1 . . . . . . . 4.61 1 1 
       356 1 . . . . . . . 4.79 1 1 
       357 1 . . . . . . . 4.23 1 1 
       358 1 . . . . . . . 3.43 1 1 
       359 1 . . . . . . . 4.56 1 1 
       360 1 . . . . . . . 3.95 1 1 
       361 1 . . . . . . . 4.65 1 1 
       362 1 . . . . . . .  3.2 1 1 
       363 1 . . . . . . . 3.17 1 1 
       364 1 . . . . . . . 3.84 1 1 
       365 1 . . . . . . . 4.76 1 1 
       366 1 . . . . . . .  5.0 1 1 
       367 1 . . . . . . .  5.0 1 1 
       368 1 . . . . . . .  5.0 1 1 
       369 1 . . . . . . . 4.95 1 1 
       370 1 . . . . . . .  5.0 1 1 
       371 1 . . . . . . . 3.85 1 1 
       372 1 . . . . . . .  5.0 1 1 
       373 1 . . . . . . .  5.0 1 1 
       374 1 . . . . . . . 4.52 1 1 
       375 1 . . . . . . . 4.66 1 1 
       376 1 . . . . . . . 4.19 1 1 
       377 1 . . . . . . . 4.39 1 1 
       378 1 . . . . . . . 4.14 1 1 
       379 1 . . . . . . . 3.88 1 1 
       380 1 . . . . . . . 2.72 1 1 
       381 1 . . . . . . . 3.51 1 1 
       382 1 . . . . . . .  5.0 1 1 
       383 1 . . . . . . . 4.41 1 1 
       384 1 . . . . . . . 4.43 1 1 
       385 1 . . . . . . . 3.59 1 1 
       386 1 . . . . . . . 4.17 1 1 
       387 1 . . . . . . . 4.91 1 1 
       388 1 . . . . . . . 3.89 1 1 
       389 1 . . . . . . . 3.64 1 1 
       390 1 . . . . . . . 4.17 1 1 
       391 1 . . . . . . . 3.93 1 1 
       392 1 . . . . . . . 4.76 1 1 
       393 1 . . . . . . . 3.58 1 1 
       394 1 . . . . . . . 4.82 1 1 
       395 1 . . . . . . .  4.0 1 1 
       396 1 . . . . . . . 4.33 1 1 
       397 1 . . . . . . .  5.0 1 1 
       398 1 . . . . . . . 3.56 1 1 
       399 1 . . . . . . . 3.54 1 1 
       400 1 . . . . . . . 3.91 1 1 
       401 1 . . . . . . . 4.23 1 1 
       402 1 . . . . . . .  4.2 1 1 
       403 1 . . . . . . . 4.53 1 1 
       404 1 . . . . . . .  5.0 1 1 
       405 1 . . . . . . . 3.61 1 1 
       406 1 . . . . . . .  4.6 1 1 
       407 1 . . . . . . . 3.93 1 1 
       408 1 . . . . . . . 4.39 1 1 
       409 1 . . . . . . . 3.84 1 1 
       410 1 . . . . . . . 3.86 1 1 
       411 1 . . . . . . . 3.55 1 1 
       412 1 . . . . . . . 4.97 1 1 
       413 1 . . . . . . .  5.0 1 1 
       414 1 . . . . . . .  5.0 1 1 
       415 1 . . . . . . . 4.03 1 1 
       416 1 . . . . . . . 4.06 1 1 
       417 1 . . . . . . . 4.36 1 1 
       418 1 . . . . . . . 4.09 1 1 
       419 1 . . . . . . . 3.45 1 1 
       420 1 . . . . . . . 4.31 1 1 
       421 1 . . . . . . . 4.06 1 1 
       422 1 . . . . . . . 3.45 1 1 
       423 1 . . . . . . . 4.76 1 1 
       424 1 . . . . . . . 3.34 1 1 
       425 1 . . . . . . . 4.14 1 1 
       426 1 . . . . . . . 4.54 1 1 
       427 1 . . . . . . . 3.87 1 1 
       428 1 . . . . . . . 3.96 1 1 
       429 1 . . . . . . . 3.64 1 1 
       430 1 . . . . . . . 4.01 1 1 
       431 1 . . . . . . . 4.93 1 1 
       432 1 . . . . . . .  5.0 1 1 
       433 1 . . . . . . . 4.72 1 1 
       434 1 . . . . . . . 4.48 1 1 
       435 1 . . . . . . . 5.05 1 1 
       436 1 . . . . . . . 4.58 1 1 
       437 1 . . . . . . .  4.6 1 1 
       438 1 . . . . . . . 4.71 1 1 
       439 1 . . . . . . . 2.47 1 1 
       440 1 . . . . . . . 4.28 1 1 
       441 1 . . . . . . . 4.56 1 1 
       442 1 . . . . . . .  4.1 1 1 
       443 1 . . . . . . . 3.92 1 1 
       444 1 . . . . . . .  5.0 1 1 
       445 1 . . . . . . . 4.29 1 1 
       446 1 . . . . . . . 4.23 1 1 
       447 1 . . . . . . . 4.91 1 1 
       448 1 . . . . . . . 3.86 1 1 
       449 1 . . . . . . . 3.44 1 1 
       450 1 . . . . . . . 3.76 1 1 
       451 1 . . . . . . .  4.0 1 1 
       452 1 . . . . . . . 4.05 1 1 
       453 1 . . . . . . . 4.81 1 1 
       454 1 . . . . . . . 3.35 1 1 
       455 1 . . . . . . . 3.87 1 1 
       456 1 . . . . . . .  3.8 1 1 
       457 1 . . . . . . . 4.81 1 1 
       458 1 . . . . . . . 4.29 1 1 
       459 1 . . . . . . . 3.32 1 1 
       460 1 . . . . . . . 3.84 1 1 
       461 1 . . . . . . .  4.8 1 1 
       462 1 . . . . . . . 4.49 1 1 
       463 1 . . . . . . . 4.14 1 1 
       464 1 . . . . . . . 4.68 1 1 
       465 1 . . . . . . . 3.77 1 1 
       466 1 . . . . . . . 3.36 1 1 
       467 1 . . . . . . . 4.29 1 1 
       468 1 . . . . . . . 4.32 1 1 
       469 1 . . . . . . .  3.6 1 1 
       470 1 . . . . . . . 3.38 1 1 
       471 1 . . . . . . . 2.76 1 1 
       472 1 . . . . . . . 3.88 1 1 
       473 1 . . . . . . . 3.88 1 1 
       474 1 . . . . . . . 4.32 1 1 
       475 1 . . . . . . . 4.48 1 1 
       476 1 . . . . . . . 3.81 1 1 
       477 1 . . . . . . . 4.23 1 1 
       478 1 . . . . . . . 4.14 1 1 
       479 1 . . . . . . . 4.36 1 1 
       480 1 . . . . . . . 3.89 1 1 
       481 1 . . . . . . . 4.75 1 1 
       482 1 . . . . . . .  5.0 1 1 
       483 1 . . . . . . . 3.58 1 1 
       484 1 . . . . . . . 3.63 1 1 
       485 1 . . . . . . . 4.72 1 1 
       486 1 . . . . . . . 3.61 1 1 
       487 1 . . . . . . . 3.95 1 1 
       488 1 . . . . . . . 3.64 1 1 
       489 1 . . . . . . . 4.68 1 1 
       490 1 . . . . . . .  5.0 1 1 
       491 1 . . . . . . .  5.0 1 1 
       492 1 . . . . . . . 4.76 1 1 
       493 1 . . . . . . . 3.43 1 1 
       494 1 . . . . . . . 4.42 1 1 
       495 1 . . . . . . . 4.81 1 1 
       496 1 . . . . . . . 4.46 1 1 
       497 1 . . . . . . . 4.71 1 1 
       498 1 . . . . . . .  5.0 1 1 
       499 1 . . . . . . .  4.8 1 1 
       500 1 . . . . . . .  5.0 1 1 
       501 1 . . . . . . . 4.83 1 1 
       502 1 . . . . . . . 4.57 1 1 
       503 1 . . . . . . . 3.41 1 1 
       504 1 . . . . . . . 4.69 1 1 
       505 1 . . . . . . . 4.99 1 1 
       506 1 . . . . . . .  5.0 1 1 
       507 1 . . . . . . . 4.32 1 1 
       508 1 . . . . . . .  5.0 1 1 
       509 1 . . . . . . .  5.0 1 1 
       510 1 . . . . . . . 3.82 1 1 
       511 1 . . . . . . . 4.98 1 1 
       512 1 . . . . . . . 5.01 1 1 
       513 1 . . . . . . . 4.89 1 1 
       514 1 . . . . . . .  3.7 1 1 
       515 1 . . . . . . . 3.85 1 1 
       516 1 . . . . . . . 4.65 1 1 
       517 1 . . . . . . . 4.67 1 1 
       518 1 . . . . . . . 4.51 1 1 
       519 1 . . . . . . .  5.0 1 1 
       520 1 . . . . . . . 4.06 1 1 
       521 1 . . . . . . .  3.9 1 1 
       522 1 . . . . . . .  4.8 1 1 
       523 1 . . . . . . . 4.34 1 1 
       524 1 . . . . . . . 2.46 1 1 
       525 1 . . . . . . . 3.97 1 1 
       526 1 . . . . . . . 4.63 1 1 
       527 1 . . . . . . . 3.59 1 1 
       528 1 . . . . . . .  4.2 1 1 
       529 1 . . . . . . .  4.0 1 1 
       530 1 . . . . . . . 5.24 1 1 
       531 1 . . . . . . . 5.05 1 1 
       532 1 . . . . . . . 4.71 1 1 
       533 1 . . . . . . .  4.6 1 1 
       534 1 . . . . . . . 4.13 1 1 
       535 1 . . . . . . .  5.0 1 1 
       536 1 . . . . . . .  5.0 1 1 
       537 1 . . . . . . . 4.16 1 1 
       538 1 . . . . . . . 4.53 1 1 
       539 1 . . . . . . .  5.0 1 1 
       540 1 . . . . . . . 4.27 1 1 
       541 1 . . . . . . . 3.42 1 1 
       542 1 . . . . . . . 4.74 1 1 
       543 1 . . . . . . . 4.92 1 1 
       544 1 . . . . . . . 4.43 1 1 
       545 1 . . . . . . .  5.0 1 1 
       546 1 . . . . . . . 3.67 1 1 
       547 1 . . . . . . . 4.82 1 1 
       548 1 . . . . . . . 3.76 1 1 
       549 1 . . . . . . . 5.01 1 1 
       550 1 . . . . . . . 3.33 1 1 
       551 1 . . . . . . . 3.66 1 1 
       552 1 . . . . . . . 5.08 1 1 
       553 1 . . . . . . .  5.0 1 1 
       554 1 . . . . . . . 4.87 1 1 
       555 1 . . . . . . . 5.07 1 1 
       556 1 . . . . . . .  4.5 1 1 
       557 1 . . . . . . . 4.17 1 1 
       558 1 . . . . . . . 4.29 1 1 
       559 1 . . . . . . . 3.73 1 1 
       560 1 . . . . . . . 4.81 1 1 
       561 1 . . . . . . . 4.28 1 1 
       562 1 . . . . . . .  5.1 1 1 
       563 1 . . . . . . . 4.87 1 1 
       564 1 . . . . . . . 3.81 1 1 
       565 1 . . . . . . . 4.85 1 1 
       566 1 . . . . . . .  4.6 1 1 
       567 1 . . . . . . . 3.81 1 1 
       568 1 . . . . . . . 4.79 1 1 
       569 1 . . . . . . . 4.66 1 1 
       570 1 . . . . . . . 4.77 1 1 
       571 1 . . . . . . . 4.53 1 1 
       572 1 . . . . . . . 4.36 1 1 
       573 1 . . . . . . . 4.04 1 1 
       574 1 . . . . . . . 3.75 1 1 
       575 1 . . . . . . . 3.42 1 1 
       576 1 . . . . . . .  3.2 1 1 
       577 1 . . . . . . .  5.0 1 1 
       578 1 . . . . . . . 4.73 1 1 
       579 1 . . . . . . . 3.55 1 1 
       580 1 . . . . . . .  3.4 1 1 
       581 1 . . . . . . . 3.89 1 1 
       582 1 . . . . . . . 4.32 1 1 
       583 1 . . . . . . . 4.85 1 1 
       584 1 . . . . . . . 4.05 1 1 
       585 1 . . . . . . . 4.22 1 1 
       586 1 . . . . . . .  5.0 1 1 
       587 1 . . . . . . .  5.0 1 1 
       588 1 . . . . . . . 4.44 1 1 
       589 1 . . . . . . . 4.69 1 1 
       590 1 . . . . . . . 5.29 1 1 
       591 1 . . . . . . . 4.72 1 1 
       592 1 . . . . . . . 5.26 1 1 
       593 1 . . . . . . . 3.43 1 1 
       594 1 . . . . . . . 3.24 1 1 
       595 1 . . . . . . . 3.92 1 1 
       596 1 . . . . . . . 5.12 1 1 
       597 1 . . . . . . . 2.78 1 1 
       598 1 . . . . . . .  5.0 1 1 
       599 1 . . . . . . . 4.39 1 1 
       600 1 . . . . . . . 4.82 1 1 
       601 1 . . . . . . . 3.44 1 1 
       602 1 . . . . . . . 4.98 1 1 
       603 1 . . . . . . . 5.09 1 1 
       604 1 . . . . . . . 4.17 1 1 
       605 1 . . . . . . . 3.85 1 1 
       606 1 . . . . . . . 4.04 1 1 
       607 1 . . . . . . . 3.21 1 1 
       608 1 . . . . . . . 5.09 1 1 
       609 1 . . . . . . . 4.01 1 1 
       610 1 . . . . . . . 3.76 1 1 
       611 1 . . . . . . . 3.17 1 1 
       612 1 . . . . . . . 5.26 1 1 
       613 1 . . . . . . . 3.66 1 1 
       614 1 . . . . . . . 4.21 1 1 
       615 1 . . . . . . . 4.33 1 1 
       616 1 . . . . . . .  5.0 1 1 
       617 1 . . . . . . . 4.22 1 1 
       618 1 . . . . . . . 3.71 1 1 
       619 1 . . . . . . . 4.94 1 1 
       620 1 . . . . . . .  4.4 1 1 
       621 1 . . . . . . . 4.44 1 1 
       622 1 . . . . . . . 5.12 1 1 
       623 1 . . . . . . . 3.65 1 1 
       624 1 . . . . . . .  5.0 1 1 
       625 1 . . . . . . . 3.32 1 1 
       626 1 . . . . . . . 3.57 1 1 
       627 1 . . . . . . .  5.0 1 1 
       628 1 . . . . . . . 4.86 1 1 
       629 1 . . . . . . . 4.58 1 1 
       630 1 . . . . . . .  5.0 1 1 
       631 1 . . . . . . . 5.07 1 1 
       632 1 . . . . . . . 3.51 1 1 
       633 1 . . . . . . . 3.11 1 1 
       634 1 . . . . . . .  3.5 1 1 
       635 1 . . . . . . . 4.72 1 1 
       636 1 . . . . . . .  5.0 1 1 
       637 1 . . . . . . . 5.02 1 1 
       638 1 . . . . . . . 3.92 1 1 
       639 1 . . . . . . . 5.05 1 1 
       640 1 . . . . . . . 5.21 1 1 
       641 1 . . . . . . . 4.03 1 1 
       642 1 . . . . . . . 4.45 1 1 
       643 1 . . . . . . .  5.0 1 1 
       644 1 . . . . . . .  5.0 1 1 
       645 1 . . . . . . . 4.59 1 1 
       646 1 . . . . . . . 3.67 1 1 
       647 1 . . . . . . . 4.93 1 1 
       648 1 . . . . . . .  3.9 1 1 
       649 1 . . . . . . .  4.0 1 1 
       650 1 . . . . . . . 5.25 1 1 
       651 1 . . . . . . . 4.11 1 1 
       652 1 . . . . . . . 3.29 1 1 
       653 1 . . . . . . . 4.23 1 1 
       654 1 . . . . . . .  5.0 1 1 
       655 1 . . . . . . .  5.0 1 1 
       656 1 . . . . . . . 2.99 1 1 
       657 1 . . . . . . . 5.18 1 1 
       658 1 . . . . . . . 4.83 1 1 
       659 1 . . . . . . . 4.84 1 1 
       660 1 . . . . . . . 4.81 1 1 
       661 1 . . . . . . . 3.94 1 1 
       662 1 . . . . . . .  5.0 1 1 
       663 1 . . . . . . . 3.73 1 1 
       664 1 . . . . . . . 3.75 1 1 
       665 1 . . . . . . . 3.53 1 1 
       666 1 . . . . . . . 4.77 1 1 
       667 1 . . . . . . .  5.0 1 1 
       668 1 . . . . . . . 4.44 1 1 
       669 1 . . . . . . . 5.25 1 1 
       670 1 . . . . . . .  5.0 1 1 
       671 1 . . . . . . . 5.45 1 1 
       672 1 . . . . . . . 4.54 1 1 
       673 1 . . . . . . . 3.49 1 1 
       674 1 . . . . . . .  3.9 1 1 
       675 1 . . . . . . . 4.16 1 1 
       676 1 . . . . . . . 3.12 1 1 
       677 1 . . . . . . . 3.52 1 1 
       678 1 . . . . . . . 3.84 1 1 
       679 1 . . . . . . . 3.76 1 1 
       680 1 . . . . . . .  4.0 1 1 
       681 1 . . . . . . . 3.41 1 1 
       682 1 . . . . . . . 3.29 1 1 
       683 1 . . . . . . . 3.65 1 1 
       684 1 . . . . . . .  5.0 1 1 
       685 1 . . . . . . . 3.83 1 1 
       686 1 . . . . . . .  3.7 1 1 
       687 1 . . . . . . . 3.67 1 1 
       688 1 . . . . . . .  5.0 1 1 
       689 1 . . . . . . . 3.63 1 1 
       690 1 . . . . . . . 4.13 1 1 
       691 1 . . . . . . .  5.0 1 1 
       692 1 . . . . . . . 3.74 1 1 
       693 1 . . . . . . . 4.36 1 1 
       694 1 . . . . . . . 3.89 1 1 
       695 1 . . . . . . . 4.09 1 1 
       696 1 . . . . . . . 4.52 1 1 
       697 1 . . . . . . .  5.5 1 1 
       698 1 . . . . . . . 4.23 1 1 
       699 1 . . . . . . .  4.5 1 1 
       700 1 . . . . . . .  4.0 1 1 
       701 1 . . . . . . . 4.74 1 1 
       702 1 . . . . . . . 5.06 1 1 
       703 1 . . . . . . . 5.48 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
       45 1 . . . 1 2 
       46 1 . . . 1 2 
       47 1 . . . 1 2 
       48 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1 41 ASP H . 41 ASP H 1 2 
        1 1 2 1 1 53 PHE O . 53 PHE O 1 2 
        2 1 1 1 1 41 ASP N . 41 ASP N 1 2 
        2 1 2 1 1 53 PHE O . 53 PHE O 1 2 
        3 1 1 1 1 39 LYS O . 39 LYS O 1 2 
        3 1 2 1 1 55 GLU H . 55 GLU H 1 2 
        4 1 1 1 1 39 LYS O . 39 LYS O 1 2 
        4 1 2 1 1 55 GLU N . 55 GLU N 1 2 
        5 1 1 1 1 38 LEU H . 38 LEU H 1 2 
        5 1 2 1 1 55 GLU O . 55 GLU O 1 2 
        6 1 1 1 1 38 LEU N . 38 LEU N 1 2 
        6 1 2 1 1 55 GLU O . 55 GLU O 1 2 
        7 1 1 1 1 15 VAL H . 15 VAL H 1 2 
        7 1 2 1 1 52 ALA O . 52 ALA O 1 2 
        8 1 1 1 1 15 VAL N . 15 VAL N 1 2 
        8 1 2 1 1 52 ALA O . 52 ALA O 1 2 
        9 1 1 1 1 15 VAL O . 15 VAL O 1 2 
        9 1 2 1 1 52 ALA H . 52 ALA H 1 2 
       10 1 1 1 1 15 VAL O . 15 VAL O 1 2 
       10 1 2 1 1 52 ALA N . 52 ALA N 1 2 
       11 1 1 1 1 13 ILE O . 13 ILE O 1 2 
       11 1 2 1 1 54 ILE H . 54 ILE H 1 2 
       12 1 1 1 1 13 ILE O . 13 ILE O 1 2 
       12 1 2 1 1 54 ILE N . 54 ILE N 1 2 
       13 1 1 1 1 13 ILE H . 13 ILE H 1 2 
       13 1 2 1 1 54 ILE O . 54 ILE O 1 2 
       14 1 1 1 1 13 ILE N . 13 ILE N 1 2 
       14 1 2 1 1 54 ILE O . 54 ILE O 1 2 
       15 1 1 1 1 14 TYR O . 14 TYR O 1 2 
       15 1 2 1 1 82 GLU H . 82 GLU H 1 2 
       16 1 1 1 1 14 TYR O . 14 TYR O 1 2 
       16 1 2 1 1 82 GLU N . 82 GLU N 1 2 
       17 1 1 1 1 14 TYR H . 14 TYR H 1 2 
       17 1 2 1 1 82 GLU O . 82 GLU O 1 2 
       18 1 1 1 1 14 TYR N . 14 TYR N 1 2 
       18 1 2 1 1 82 GLU O . 82 GLU O 1 2 
       19 1 1 1 1 16 GLY H . 16 GLY H 1 2 
       19 1 2 1 1 80 ARG O . 80 ARG O 1 2 
       20 1 1 1 1 16 GLY N . 16 GLY N 1 2 
       20 1 2 1 1 80 ARG O . 80 ARG O 1 2 
       21 1 1 1 1 16 GLY O . 16 GLY O 1 2 
       21 1 2 1 1 80 ARG H . 80 ARG H 1 2 
       22 1 1 1 1 16 GLY O . 16 GLY O 1 2 
       22 1 2 1 1 80 ARG N . 80 ARG N 1 2 
       23 1 1 1 1 24 SER O . 24 SER O 1 2 
       23 1 2 1 1 28 GLU H . 28 GLU H 1 2 
       24 1 1 1 1 24 SER O . 24 SER O 1 2 
       24 1 2 1 1 28 GLU N . 28 GLU N 1 2 
       25 1 1 1 1 25 ARG O . 25 ARG O 1 2 
       25 1 2 1 1 29 ASN H . 29 ASN H 1 2 
       26 1 1 1 1 25 ARG O . 25 ARG O 1 2 
       26 1 2 1 1 29 ASN N . 29 ASN N 1 2 
       27 1 1 1 1 26 ASP O . 26 ASP O 1 2 
       27 1 2 1 1 30 GLU H . 30 GLU H 1 2 
       28 1 1 1 1 26 ASP O . 26 ASP O 1 2 
       28 1 2 1 1 30 GLU N . 30 GLU N 1 2 
       29 1 1 1 1 27 VAL O . 27 VAL O 1 2 
       29 1 2 1 1 31 PHE H . 31 PHE H 1 2 
       30 1 1 1 1 27 VAL O . 27 VAL O 1 2 
       30 1 2 1 1 31 PHE N . 31 PHE N 1 2 
       31 1 1 1 1 28 GLU O . 28 GLU O 1 2 
       31 1 2 1 1 32 ARG H . 32 ARG H 1 2 
       32 1 1 1 1 28 GLU O . 28 GLU O 1 2 
       32 1 2 1 1 32 ARG N . 32 ARG N 1 2 
       33 1 1 1 1 29 ASN O . 29 ASN O 1 2 
       33 1 2 1 1 33 LYS H . 33 LYS H 1 2 
       34 1 1 1 1 29 ASN O . 29 ASN O 1 2 
       34 1 2 1 1 33 LYS N . 33 LYS N 1 2 
       35 1 1 1 1 62 ALA O . 62 ALA O 1 2 
       35 1 2 1 1 66 ILE H . 66 ILE H 1 2 
       36 1 1 1 1 62 ALA O . 62 ALA O 1 2 
       36 1 2 1 1 66 ILE N . 66 ILE N 1 2 
       37 1 1 1 1 63 ALA O . 63 ALA O 1 2 
       37 1 2 1 1 67 LYS H . 67 LYS H 1 2 
       38 1 1 1 1 63 ALA O . 63 ALA O 1 2 
       38 1 2 1 1 67 LYS N . 67 LYS N 1 2 
       39 1 1 1 1 64 ASP O . 64 ASP O 1 2 
       39 1 2 1 1 68 GLU H . 68 GLU H 1 2 
       40 1 1 1 1 64 ASP O . 64 ASP O 1 2 
       40 1 2 1 1 68 GLU N . 68 GLU N 1 2 
       41 1 1 1 1 65 ALA O . 65 ALA O 1 2 
       41 1 2 1 1 69 LYS H . 69 LYS H 1 2 
       42 1 1 1 1 65 ALA O . 65 ALA O 1 2 
       42 1 2 1 1 69 LYS N . 69 LYS N 1 2 
       43 1 1 1 1 11 SER O . 11 SER O 1 2 
       43 1 2 1 1 56 PHE H . 56 PHE H 1 2 
       44 1 1 1 1 11 SER O . 11 SER O 1 2 
       44 1 2 1 1 56 PHE N . 56 PHE N 1 2 
       45 1 1 1 1 73 ASP H . 73 ASP H 1 2 
       45 1 2 1 1 79 LEU O . 79 LEU O 1 2 
       46 1 1 1 1 73 ASP N . 73 ASP N 1 2 
       46 1 2 1 1 79 LEU O . 79 LEU O 1 2 
       47 1 1 1 1 73 ASP O . 73 ASP O 1 2 
       47 1 2 1 1 79 LEU H . 79 LEU H 1 2 
       48 1 1 1 1 73 ASP O . 73 ASP O 1 2 
       48 1 2 1 1 79 LEU N . 79 LEU N 1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . . . 1.8 1 2 
        2 1 . . . . . . . 2.4 1 2 
        3 1 . . . . . . . 1.8 1 2 
        4 1 . . . . . . . 2.4 1 2 
        5 1 . . . . . . . 1.8 1 2 
        6 1 . . . . . . . 2.4 1 2 
        7 1 . . . . . . . 1.8 1 2 
        8 1 . . . . . . . 2.4 1 2 
        9 1 . . . . . . . 1.8 1 2 
       10 1 . . . . . . . 2.4 1 2 
       11 1 . . . . . . . 1.8 1 2 
       12 1 . . . . . . . 2.4 1 2 
       13 1 . . . . . . . 1.8 1 2 
       14 1 . . . . . . . 2.4 1 2 
       15 1 . . . . . . . 1.8 1 2 
       16 1 . . . . . . . 2.4 1 2 
       17 1 . . . . . . . 1.8 1 2 
       18 1 . . . . . . . 2.4 1 2 
       19 1 . . . . . . . 1.8 1 2 
       20 1 . . . . . . . 2.4 1 2 
       21 1 . . . . . . . 1.8 1 2 
       22 1 . . . . . . . 2.4 1 2 
       23 1 . . . . . . . 1.8 1 2 
       24 1 . . . . . . . 2.4 1 2 
       25 1 . . . . . . . 1.8 1 2 
       26 1 . . . . . . . 2.4 1 2 
       27 1 . . . . . . . 1.8 1 2 
       28 1 . . . . . . . 2.4 1 2 
       29 1 . . . . . . . 1.8 1 2 
       30 1 . . . . . . . 2.4 1 2 
       31 1 . . . . . . . 1.8 1 2 
       32 1 . . . . . . . 2.4 1 2 
       33 1 . . . . . . . 1.8 1 2 
       34 1 . . . . . . . 2.4 1 2 
       35 1 . . . . . . . 1.8 1 2 
       36 1 . . . . . . . 2.4 1 2 
       37 1 . . . . . . . 1.8 1 2 
       38 1 . . . . . . . 2.4 1 2 
       39 1 . . . . . . . 1.8 1 2 
       40 1 . . . . . . . 2.4 1 2 
       41 1 . . . . . . . 1.8 1 2 
       42 1 . . . . . . . 2.4 1 2 
       43 1 . . . . . . . 1.8 1 2 
       44 1 . . . . . . . 2.4 1 2 
       45 1 . . . . . . . 1.8 1 2 
       46 1 . . . . . . . 2.4 1 2 
       47 1 . . . . . . . 1.8 1 2 
       48 1 . . . . . . . 2.4 1 2 
    stop_

save_


save_DYANA/DIANA_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 PHI 1 1 10 VAL C 1 1 11 SER N  1 1 11 SER CA 1 1 11 SER C       -91.2       -51.2 . 11 SER . . 11 SER . . 11 SER . . 11 SER . 1 1 
         2 PSI 1 1 11 SER N 1 1 11 SER CA 1 1 11 SER C  1 1 12 ARG N       118.9       158.9 . 11 SER . . 11 SER . . 11 SER . . 11 SER . 1 1 
         3 PHI 1 1 11 SER C 1 1 12 ARG N  1 1 12 ARG CA 1 1 12 ARG C      -148.7      -108.7 . 12 ARG . . 12 ARG . . 12 ARG . . 12 ARG . 1 1 
         4 PSI 1 1 12 ARG N 1 1 12 ARG CA 1 1 12 ARG C  1 1 13 ILE N       129.4       169.4 . 12 ARG . . 12 ARG . . 12 ARG . . 12 ARG . 1 1 
         5 PHI 1 1 12 ARG C 1 1 13 ILE N  1 1 13 ILE CA 1 1 13 ILE C      -150.4      -110.4 . 13 ILE . . 13 ILE . . 13 ILE . . 13 ILE . 1 1 
         6 PSI 1 1 13 ILE N 1 1 13 ILE CA 1 1 13 ILE C  1 1 14 TYR N       118.5       158.5 . 13 ILE . . 13 ILE . . 13 ILE . . 13 ILE . 1 1 
         7 PHI 1 1 13 ILE C 1 1 14 TYR N  1 1 14 TYR CA 1 1 14 TYR C      -132.3       -92.3 . 14 TYR . . 14 TYR . . 14 TYR . . 14 TYR . 1 1 
         8 PSI 1 1 14 TYR N 1 1 14 TYR CA 1 1 14 TYR C  1 1 15 VAL N       106.3       146.3 . 14 TYR . . 14 TYR . . 14 TYR . . 14 TYR . 1 1 
         9 PHI 1 1 14 TYR C 1 1 15 VAL N  1 1 15 VAL CA 1 1 15 VAL C      -134.5       -94.5 . 15 VAL . . 15 VAL . . 15 VAL . . 15 VAL . 1 1 
        10 PSI 1 1 15 VAL N 1 1 15 VAL CA 1 1 15 VAL C  1 1 16 GLY N       102.7       142.7 . 15 VAL . . 15 VAL . . 15 VAL . . 15 VAL . 1 1 
        11 PHI 1 1 16 GLY C 1 1 17 ASN N  1 1 17 ASN CA 1 1 17 ASN C        40.6        80.6 . 17 ASN . . 17 ASN . . 17 ASN . . 17 ASN . 1 1 
        12 PSI 1 1 17 ASN N 1 1 17 ASN CA 1 1 17 ASN C  1 1 18 LEU N        18.1        58.1 . 17 ASN . . 17 ASN . . 17 ASN . . 17 ASN . 1 1 
        13 PHI 1 1 17 ASN C 1 1 18 LEU N  1 1 18 LEU CA 1 1 18 LEU C       -97.1       -57.1 . 18 LEU . . 18 LEU . . 18 LEU . . 18 LEU . 1 1 
        14 PSI 1 1 18 LEU N 1 1 18 LEU CA 1 1 18 LEU C  1 1 19 PRO N       117.2       157.2 . 18 LEU . . 18 LEU . . 18 LEU . . 18 LEU . 1 1 
        15 PSI 1 1 19 PRO N 1 1 19 PRO CA 1 1 19 PRO C  1 1 20 SER N  122.399994       162.4 . 19 PRO . . 19 PRO . . 19 PRO . . 19 PRO . 1 1 
        16 PHI 1 1 21 HIS C 1 1 22 VAL N  1 1 22 VAL CA 1 1 22 VAL C      -101.0  -60.999996 . 22 VAL . . 22 VAL . . 22 VAL . . 22 VAL . 1 1 
        17 PSI 1 1 22 VAL N 1 1 22 VAL CA 1 1 22 VAL C  1 1 23 SER N   116.09999   156.09999 . 22 VAL . . 22 VAL . . 22 VAL . . 22 VAL . 1 1 
        18 PHI 1 1 22 VAL C 1 1 23 SER N  1 1 23 SER CA 1 1 23 SER C      -116.9       -76.9 . 23 SER . . 23 SER . . 23 SER . . 23 SER . 1 1 
        19 PSI 1 1 23 SER N 1 1 23 SER CA 1 1 23 SER C  1 1 24 SER N       147.1       187.1 . 23 SER . . 23 SER . . 23 SER . . 23 SER . 1 1 
        20 PHI 1 1 23 SER C 1 1 24 SER N  1 1 24 SER CA 1 1 24 SER C       -79.9       -39.9 . 24 SER . . 24 SER . . 24 SER . . 24 SER . 1 1 
        21 PSI 1 1 24 SER N 1 1 24 SER CA 1 1 24 SER C  1 1 25 ARG N       -58.2       -18.2 . 24 SER . . 24 SER . . 24 SER . . 24 SER . 1 1 
        22 PHI 1 1 24 SER C 1 1 25 ARG N  1 1 25 ARG CA 1 1 25 ARG C       -85.4       -45.4 . 25 ARG . . 25 ARG . . 25 ARG . . 25 ARG . 1 1 
        23 PSI 1 1 25 ARG N 1 1 25 ARG CA 1 1 25 ARG C  1 1 26 ASP N       -56.7       -16.7 . 25 ARG . . 25 ARG . . 25 ARG . . 25 ARG . 1 1 
        24 PHI 1 1 25 ARG C 1 1 26 ASP N  1 1 26 ASP CA 1 1 26 ASP C       -86.5       -46.5 . 26 ASP . . 26 ASP . . 26 ASP . . 26 ASP . 1 1 
        25 PSI 1 1 26 ASP N 1 1 26 ASP CA 1 1 26 ASP C  1 1 27 VAL N       -62.5  -22.499998 . 26 ASP . . 26 ASP . . 26 ASP . . 26 ASP . 1 1 
        26 PHI 1 1 26 ASP C 1 1 27 VAL N  1 1 27 VAL CA 1 1 27 VAL C       -84.4       -44.4 . 27 VAL . . 27 VAL . . 27 VAL . . 27 VAL . 1 1 
        27 PSI 1 1 27 VAL N 1 1 27 VAL CA 1 1 27 VAL C  1 1 28 GLU N       -64.5       -24.5 . 27 VAL . . 27 VAL . . 27 VAL . . 27 VAL . 1 1 
        28 PHI 1 1 27 VAL C 1 1 28 GLU N  1 1 28 GLU CA 1 1 28 GLU C       -80.4       -40.4 . 28 GLU . . 28 GLU . . 28 GLU . . 28 GLU . 1 1 
        29 PSI 1 1 28 GLU N 1 1 28 GLU CA 1 1 28 GLU C  1 1 29 ASN N       -61.5       -21.5 . 28 GLU . . 28 GLU . . 28 GLU . . 28 GLU . 1 1 
        30 PHI 1 1 28 GLU C 1 1 29 ASN N  1 1 29 ASN CA 1 1 29 ASN C       -85.9       -45.9 . 29 ASN . . 29 ASN . . 29 ASN . . 29 ASN . 1 1 
        31 PSI 1 1 29 ASN N 1 1 29 ASN CA 1 1 29 ASN C  1 1 30 GLU N       -57.1       -17.1 . 29 ASN . . 29 ASN . . 29 ASN . . 29 ASN . 1 1 
        32 PHI 1 1 29 ASN C 1 1 30 GLU N  1 1 30 GLU CA 1 1 30 GLU C       -88.8       -48.8 . 30 GLU . . 30 GLU . . 30 GLU . . 30 GLU . 1 1 
        33 PSI 1 1 30 GLU N 1 1 30 GLU CA 1 1 30 GLU C  1 1 31 PHE N       -55.8       -15.8 . 30 GLU . . 30 GLU . . 30 GLU . . 30 GLU . 1 1 
        34 PHI 1 1 30 GLU C 1 1 31 PHE N  1 1 31 PHE CA 1 1 31 PHE C       -89.9  -49.899998 . 31 PHE . . 31 PHE . . 31 PHE . . 31 PHE . 1 1 
        35 PSI 1 1 31 PHE N 1 1 31 PHE CA 1 1 31 PHE C  1 1 32 ARG N       -56.4       -16.4 . 31 PHE . . 31 PHE . . 31 PHE . . 31 PHE . 1 1 
        36 PHI 1 1 31 PHE C 1 1 32 ARG N  1 1 32 ARG CA 1 1 32 ARG C       -85.2       -45.2 . 32 ARG . . 32 ARG . . 32 ARG . . 32 ARG . 1 1 
        37 PSI 1 1 32 ARG N 1 1 32 ARG CA 1 1 32 ARG C  1 1 33 LYS N       -54.5       -14.5 . 32 ARG . . 32 ARG . . 32 ARG . . 32 ARG . 1 1 
        38 PHI 1 1 32 ARG C 1 1 33 LYS N  1 1 33 LYS CA 1 1 33 LYS C       -86.1  -46.099995 . 33 LYS . . 33 LYS . . 33 LYS . . 33 LYS . 1 1 
        39 PSI 1 1 33 LYS N 1 1 33 LYS CA 1 1 33 LYS C  1 1 34 TYR N       -51.4       -11.4 . 33 LYS . . 33 LYS . . 33 LYS . . 33 LYS . 1 1 
        40 PHI 1 1 33 LYS C 1 1 34 TYR N  1 1 34 TYR CA 1 1 34 TYR C       -98.4       -58.4 . 34 TYR . . 34 TYR . . 34 TYR . . 34 TYR . 1 1 
        41 PSI 1 1 34 TYR N 1 1 34 TYR CA 1 1 34 TYR C  1 1 35 GLY N       -42.5        -2.5 . 34 TYR . . 34 TYR . . 34 TYR . . 34 TYR . 1 1 
        42 PHI 1 1 36 ASN C 1 1 37 ILE N  1 1 37 ILE CA 1 1 37 ILE C      -106.2       -66.2 . 37 ILE . . 37 ILE . . 37 ILE . . 37 ILE . 1 1 
        43 PSI 1 1 37 ILE N 1 1 37 ILE CA 1 1 37 ILE C  1 1 38 LEU N       106.5       146.5 . 37 ILE . . 37 ILE . . 37 ILE . . 37 ILE . 1 1 
        44 PHI 1 1 37 ILE C 1 1 38 LEU N  1 1 38 LEU CA 1 1 38 LEU C      -109.4       -69.4 . 38 LEU . . 38 LEU . . 38 LEU . . 38 LEU . 1 1 
        45 PSI 1 1 38 LEU N 1 1 38 LEU CA 1 1 38 LEU C  1 1 39 LYS N       -57.1       -17.1 . 38 LEU . . 38 LEU . . 38 LEU . . 38 LEU . 1 1 
        46 PHI 1 1 38 LEU C 1 1 39 LYS N  1 1 39 LYS CA 1 1 39 LYS C  -174.99998      -135.0 . 39 LYS . . 39 LYS . . 39 LYS . . 39 LYS . 1 1 
        47 PSI 1 1 39 LYS N 1 1 39 LYS CA 1 1 39 LYS C  1 1 40 CYS N   122.90001       162.9 . 39 LYS . . 39 LYS . . 39 LYS . . 39 LYS . 1 1 
        48 PHI 1 1 39 LYS C 1 1 40 CYS N  1 1 40 CYS CA 1 1 40 CYS C      -138.6       -98.6 . 40 CYS . . 40 CYS . . 40 CYS . . 40 CYS . 1 1 
        49 PSI 1 1 40 CYS N 1 1 40 CYS CA 1 1 40 CYS C  1 1 41 ASP N       107.3       147.3 . 40 CYS . . 40 CYS . . 40 CYS . . 40 CYS . 1 1 
        50 PHI 1 1 40 CYS C 1 1 41 ASP N  1 1 41 ASP CA 1 1 41 ASP C      -138.5       -98.5 . 41 ASP . . 41 ASP . . 41 ASP . . 41 ASP . 1 1 
        51 PSI 1 1 41 ASP N 1 1 41 ASP CA 1 1 41 ASP C  1 1 42 VAL N       113.5       153.5 . 41 ASP . . 41 ASP . . 41 ASP . . 41 ASP . 1 1 
        52 PHI 1 1 41 ASP C 1 1 42 VAL N  1 1 42 VAL CA 1 1 42 VAL C      -126.2   -86.19999 . 42 VAL . . 42 VAL . . 42 VAL . . 42 VAL . 1 1 
        53 PSI 1 1 42 VAL N 1 1 42 VAL CA 1 1 42 VAL C  1 1 43 LYS N       105.1       145.1 . 42 VAL . . 42 VAL . . 42 VAL . . 42 VAL . 1 1 
        54 PHI 1 1 42 VAL C 1 1 43 LYS N  1 1 43 LYS CA 1 1 43 LYS C      -141.9  -101.99999 . 43 LYS . . 43 LYS . . 43 LYS . . 43 LYS . 1 1 
        55 PSI 1 1 43 LYS N 1 1 43 LYS CA 1 1 43 LYS C  1 1 44 LYS N  127.799995       167.8 . 43 LYS . . 43 LYS . . 43 LYS . . 43 LYS . 1 1 
        56 PHI 1 1 43 LYS C 1 1 44 LYS N  1 1 44 LYS CA 1 1 44 LYS C      -131.5       -91.5 . 44 LYS . . 44 LYS . . 44 LYS . . 44 LYS . 1 1 
        57 PSI 1 1 44 LYS N 1 1 44 LYS CA 1 1 44 LYS C  1 1 45 THR N       118.1       158.1 . 44 LYS . . 44 LYS . . 44 LYS . . 44 LYS . 1 1 
        58 PHI 1 1 44 LYS C 1 1 45 THR N  1 1 45 THR CA 1 1 45 THR C      -105.3       -65.3 . 45 THR . . 45 THR . . 45 THR . . 45 THR . 1 1 
        59 PSI 1 1 45 THR N 1 1 45 THR CA 1 1 45 THR C  1 1 46 VAL N       151.7       191.7 . 45 THR . . 45 THR . . 45 THR . . 45 THR . 1 1 
        60 PHI 1 1 45 THR C 1 1 46 VAL N  1 1 46 VAL CA 1 1 46 VAL C       -84.7  -44.699997 . 46 VAL . . 46 VAL . . 46 VAL . . 46 VAL . 1 1 
        61 PSI 1 1 46 VAL N 1 1 46 VAL CA 1 1 46 VAL C  1 1 47 SER N       -40.9  -0.8999999 . 46 VAL . . 46 VAL . . 46 VAL . . 46 VAL . 1 1 
        62 PHI 1 1 46 VAL C 1 1 47 SER N  1 1 47 SER CA 1 1 47 SER C      -106.9       -66.9 . 47 SER . . 47 SER . . 47 SER . . 47 SER . 1 1 
        63 PSI 1 1 47 SER N 1 1 47 SER CA 1 1 47 SER C  1 1 48 GLY N       -23.4        16.6 . 47 SER . . 47 SER . . 47 SER . . 47 SER . 1 1 
        64 PHI 1 1 47 SER C 1 1 48 GLY N  1 1 48 GLY CA 1 1 48 GLY C        72.3       112.3 . 48 GLY . . 48 GLY . . 48 GLY . . 48 GLY . 1 1 
        65 PSI 1 1 48 GLY N 1 1 48 GLY CA 1 1 48 GLY C  1 1 49 ALA N  -13.499999        26.5 . 48 GLY . . 48 GLY . . 48 GLY . . 48 GLY . 1 1 
        66 PHI 1 1 48 GLY C 1 1 49 ALA N  1 1 49 ALA CA 1 1 49 ALA C       -96.8       -56.8 . 49 ALA . . 49 ALA . . 49 ALA . . 49 ALA . 1 1 
        67 PSI 1 1 49 ALA N 1 1 49 ALA CA 1 1 49 ALA C  1 1 50 ALA N       121.8       161.8 . 49 ALA . . 49 ALA . . 49 ALA . . 49 ALA . 1 1 
        68 PHI 1 1 49 ALA C 1 1 50 ALA N  1 1 50 ALA CA 1 1 50 ALA C      -143.8      -103.8 . 50 ALA . . 50 ALA . . 50 ALA . . 50 ALA . 1 1 
        69 PSI 1 1 50 ALA N 1 1 50 ALA CA 1 1 50 ALA C  1 1 51 PHE N   116.99999       157.0 . 50 ALA . . 50 ALA . . 50 ALA . . 50 ALA . 1 1 
        70 PHI 1 1 50 ALA C 1 1 51 PHE N  1 1 51 PHE CA 1 1 51 PHE C      -171.3      -131.3 . 51 PHE . . 51 PHE . . 51 PHE . . 51 PHE . 1 1 
        71 PSI 1 1 51 PHE N 1 1 51 PHE CA 1 1 51 PHE C  1 1 52 ALA N       142.6       182.6 . 51 PHE . . 51 PHE . . 51 PHE . . 51 PHE . 1 1 
        72 PHI 1 1 51 PHE C 1 1 52 ALA N  1 1 52 ALA CA 1 1 52 ALA C      -148.0  -107.99999 . 52 ALA . . 52 ALA . . 52 ALA . . 52 ALA . 1 1 
        73 PSI 1 1 52 ALA N 1 1 52 ALA CA 1 1 52 ALA C  1 1 53 PHE N       130.9       170.9 . 52 ALA . . 52 ALA . . 52 ALA . . 52 ALA . 1 1 
        74 PHI 1 1 52 ALA C 1 1 53 PHE N  1 1 53 PHE CA 1 1 53 PHE C      -139.2       -99.2 . 53 PHE . . 53 PHE . . 53 PHE . . 53 PHE . 1 1 
        75 PSI 1 1 53 PHE N 1 1 53 PHE CA 1 1 53 PHE C  1 1 54 ILE N  112.399994       152.4 . 53 PHE . . 53 PHE . . 53 PHE . . 53 PHE . 1 1 
        76 PHI 1 1 53 PHE C 1 1 54 ILE N  1 1 54 ILE CA 1 1 54 ILE C      -140.5      -100.5 . 54 ILE . . 54 ILE . . 54 ILE . . 54 ILE . 1 1 
        77 PSI 1 1 54 ILE N 1 1 54 ILE CA 1 1 54 ILE C  1 1 55 GLU N       103.2       143.2 . 54 ILE . . 54 ILE . . 54 ILE . . 54 ILE . 1 1 
        78 PHI 1 1 54 ILE C 1 1 55 GLU N  1 1 55 GLU CA 1 1 55 GLU C -121.600006       -81.6 . 55 GLU . . 55 GLU . . 55 GLU . . 55 GLU . 1 1 
        79 PSI 1 1 55 GLU N 1 1 55 GLU CA 1 1 55 GLU C  1 1 56 PHE N        99.9       139.9 . 55 GLU . . 55 GLU . . 55 GLU . . 55 GLU . 1 1 
        80 PHI 1 1 55 GLU C 1 1 56 PHE N  1 1 56 PHE CA 1 1 56 PHE C      -112.5       -72.5 . 56 PHE . . 56 PHE . . 56 PHE . . 56 PHE . 1 1 
        81 PSI 1 1 56 PHE N 1 1 56 PHE CA 1 1 56 PHE C  1 1 57 GLU N       135.6       175.6 . 56 PHE . . 56 PHE . . 56 PHE . . 56 PHE . 1 1 
        82 PHI 1 1 56 PHE C 1 1 57 GLU N  1 1 57 GLU CA 1 1 57 GLU C       -88.4       -48.4 . 57 GLU . . 57 GLU . . 57 GLU . . 57 GLU . 1 1 
        83 PSI 1 1 57 GLU N 1 1 57 GLU CA 1 1 57 GLU C  1 1 58 ASP N       -55.4  -15.400001 . 57 GLU . . 57 GLU . . 57 GLU . . 57 GLU . 1 1 
        84 PHI 1 1 57 GLU C 1 1 58 ASP N  1 1 58 ASP CA 1 1 58 ASP C      -152.8      -112.8 . 58 ASP . . 58 ASP . . 58 ASP . . 58 ASP . 1 1 
        85 PSI 1 1 58 ASP N 1 1 58 ASP CA 1 1 58 ASP C  1 1 59 ALA N  124.399994       164.4 . 58 ASP . . 58 ASP . . 58 ASP . . 58 ASP . 1 1 
        86 PHI 1 1 58 ASP C 1 1 59 ALA N  1 1 59 ALA CA 1 1 59 ALA C       -82.7       -42.7 . 59 ALA . . 59 ALA . . 59 ALA . . 59 ALA . 1 1 
        87 PSI 1 1 59 ALA N 1 1 59 ALA CA 1 1 59 ALA C  1 1 60 ARG N  -54.299995       -14.3 . 59 ALA . . 59 ALA . . 59 ALA . . 59 ALA . 1 1 
        88 PHI 1 1 59 ALA C 1 1 60 ARG N  1 1 60 ARG CA 1 1 60 ARG C       -84.0       -44.0 . 60 ARG . . 60 ARG . . 60 ARG . . 60 ARG . 1 1 
        89 PSI 1 1 60 ARG N 1 1 60 ARG CA 1 1 60 ARG C  1 1 61 ASP N       -56.5       -16.5 . 60 ARG . . 60 ARG . . 60 ARG . . 60 ARG . 1 1 
        90 PHI 1 1 60 ARG C 1 1 61 ASP N  1 1 61 ASP CA 1 1 61 ASP C       -87.6       -47.6 . 61 ASP . . 61 ASP . . 61 ASP . . 61 ASP . 1 1 
        91 PSI 1 1 61 ASP N 1 1 61 ASP CA 1 1 61 ASP C  1 1 62 ALA N       -58.2       -18.2 . 61 ASP . . 61 ASP . . 61 ASP . . 61 ASP . 1 1 
        92 PHI 1 1 61 ASP C 1 1 62 ALA N  1 1 62 ALA CA 1 1 62 ALA C       -85.2       -45.2 . 62 ALA . . 62 ALA . . 62 ALA . . 62 ALA . 1 1 
        93 PSI 1 1 62 ALA N 1 1 62 ALA CA 1 1 62 ALA C  1 1 63 ALA N  -62.599995       -22.6 . 62 ALA . . 62 ALA . . 62 ALA . . 62 ALA . 1 1 
        94 PHI 1 1 62 ALA C 1 1 63 ALA N  1 1 63 ALA CA 1 1 63 ALA C   -83.69999       -43.7 . 63 ALA . . 63 ALA . . 63 ALA . . 63 ALA . 1 1 
        95 PSI 1 1 63 ALA N 1 1 63 ALA CA 1 1 63 ALA C  1 1 64 ASP N       -58.4  -18.399998 . 63 ALA . . 63 ALA . . 63 ALA . . 63 ALA . 1 1 
        96 PHI 1 1 63 ALA C 1 1 64 ASP N  1 1 64 ASP CA 1 1 64 ASP C       -85.7       -45.7 . 64 ASP . . 64 ASP . . 64 ASP . . 64 ASP . 1 1 
        97 PSI 1 1 64 ASP N 1 1 64 ASP CA 1 1 64 ASP C  1 1 65 ALA N  -62.199997       -22.2 . 64 ASP . . 64 ASP . . 64 ASP . . 64 ASP . 1 1 
        98 PHI 1 1 64 ASP C 1 1 65 ALA N  1 1 65 ALA CA 1 1 65 ALA C       -85.0  -44.999996 . 65 ALA . . 65 ALA . . 65 ALA . . 65 ALA . 1 1 
        99 PSI 1 1 65 ALA N 1 1 65 ALA CA 1 1 65 ALA C  1 1 66 ILE N       -62.5  -22.499998 . 65 ALA . . 65 ALA . . 65 ALA . . 65 ALA . 1 1 
       100 PHI 1 1 65 ALA C 1 1 66 ILE N  1 1 66 ILE CA 1 1 66 ILE C       -82.7       -42.7 . 66 ILE . . 66 ILE . . 66 ILE . . 66 ILE . 1 1 
       101 PSI 1 1 66 ILE N 1 1 66 ILE CA 1 1 66 ILE C  1 1 67 LYS N       -64.1       -24.1 . 66 ILE . . 66 ILE . . 66 ILE . . 66 ILE . 1 1 
       102 PHI 1 1 66 ILE C 1 1 67 LYS N  1 1 67 LYS CA 1 1 67 LYS C       -86.9  -46.899998 . 67 LYS . . 67 LYS . . 67 LYS . . 67 LYS . 1 1 
       103 PSI 1 1 67 LYS N 1 1 67 LYS CA 1 1 67 LYS C  1 1 68 GLU N       -53.7       -13.7 . 67 LYS . . 67 LYS . . 67 LYS . . 67 LYS . 1 1 
       104 PHI 1 1 67 LYS C 1 1 68 GLU N  1 1 68 GLU CA 1 1 68 GLU C   -95.99999       -56.0 . 68 GLU . . 68 GLU . . 68 GLU . . 68 GLU . 1 1 
       105 PSI 1 1 68 GLU N 1 1 68 GLU CA 1 1 68 GLU C  1 1 69 LYS N       -51.5       -11.5 . 68 GLU . . 68 GLU . . 68 GLU . . 68 GLU . 1 1 
       106 PHI 1 1 68 GLU C 1 1 69 LYS N  1 1 69 LYS CA 1 1 69 LYS C -119.899994       -79.9 . 69 LYS . . 69 LYS . . 69 LYS . . 69 LYS . 1 1 
       107 PSI 1 1 69 LYS N 1 1 69 LYS CA 1 1 69 LYS C  1 1 70 ASP N       -19.5        20.5 . 69 LYS . . 69 LYS . . 69 LYS . . 69 LYS . 1 1 
       108 PHI 1 1 69 LYS C 1 1 70 ASP N  1 1 70 ASP CA 1 1 70 ASP C       -78.6       -38.6 . 70 ASP . . 70 ASP . . 70 ASP . . 70 ASP . 1 1 
       109 PSI 1 1 70 ASP N 1 1 70 ASP CA 1 1 70 ASP C  1 1 71 GLY N       107.7       147.7 . 70 ASP . . 70 ASP . . 70 ASP . . 70 ASP . 1 1 
       110 PHI 1 1 70 ASP C 1 1 71 GLY N  1 1 71 GLY CA 1 1 71 GLY C        67.4       107.4 . 71 GLY . . 71 GLY . . 71 GLY . . 71 GLY . 1 1 
       111 PSI 1 1 71 GLY N 1 1 71 GLY CA 1 1 71 GLY C  1 1 72 CYS N       -25.2        14.8 . 71 GLY . . 71 GLY . . 71 GLY . . 71 GLY . 1 1 
       112 PHI 1 1 71 GLY C 1 1 72 CYS N  1 1 72 CYS CA 1 1 72 CYS C       -97.1       -57.1 . 72 CYS . . 72 CYS . . 72 CYS . . 72 CYS . 1 1 
       113 PSI 1 1 72 CYS N 1 1 72 CYS CA 1 1 72 CYS C  1 1 73 ASP N       129.5       169.5 . 72 CYS . . 72 CYS . . 72 CYS . . 72 CYS . 1 1 
       114 PHI 1 1 72 CYS C 1 1 73 ASP N  1 1 73 ASP CA 1 1 73 ASP C      -114.2       -74.2 . 73 ASP . . 73 ASP . . 73 ASP . . 73 ASP . 1 1 
       115 PSI 1 1 73 ASP N 1 1 73 ASP CA 1 1 73 ASP C  1 1 74 PHE N       106.6       146.6 . 73 ASP . . 73 ASP . . 73 ASP . . 73 ASP . 1 1 
       116 PHI 1 1 73 ASP C 1 1 74 PHE N  1 1 74 PHE CA 1 1 74 PHE C      -146.1  -106.09999 . 74 PHE . . 74 PHE . . 74 PHE . . 74 PHE . 1 1 
       117 PSI 1 1 74 PHE N 1 1 74 PHE CA 1 1 74 PHE C  1 1 75 GLU N        97.2       137.2 . 74 PHE . . 74 PHE . . 74 PHE . . 74 PHE . 1 1 
       118 PHI 1 1 74 PHE C 1 1 75 GLU N  1 1 75 GLU CA 1 1 75 GLU C        32.1        72.1 . 75 GLU . . 75 GLU . . 75 GLU . . 75 GLU . 1 1 
       119 PSI 1 1 75 GLU N 1 1 75 GLU CA 1 1 75 GLU C  1 1 76 GLY N        21.3        61.3 . 75 GLU . . 75 GLU . . 75 GLU . . 75 GLU . 1 1 
       120 PHI 1 1 75 GLU C 1 1 76 GLY N  1 1 76 GLY CA 1 1 76 GLY C        60.7   100.69999 . 76 GLY . . 76 GLY . . 76 GLY . . 76 GLY . 1 1 
       121 PSI 1 1 76 GLY N 1 1 76 GLY CA 1 1 76 GLY C  1 1 77 ASN N       -17.8        22.2 . 76 GLY . . 76 GLY . . 76 GLY . . 76 GLY . 1 1 
       122 PHI 1 1 76 GLY C 1 1 77 ASN N  1 1 77 ASN CA 1 1 77 ASN C      -127.5   -87.49999 . 77 ASN . . 77 ASN . . 77 ASN . . 77 ASN . 1 1 
       123 PSI 1 1 77 ASN N 1 1 77 ASN CA 1 1 77 ASN C  1 1 78 LYS N   115.69999       155.7 . 77 ASN . . 77 ASN . . 77 ASN . . 77 ASN . 1 1 
       124 PHI 1 1 77 ASN C 1 1 78 LYS N  1 1 78 LYS CA 1 1 78 LYS C       -98.7  -58.699997 . 78 LYS . . 78 LYS . . 78 LYS . . 78 LYS . 1 1 
       125 PSI 1 1 78 LYS N 1 1 78 LYS CA 1 1 78 LYS C  1 1 79 LEU N        99.7       139.7 . 78 LYS . . 78 LYS . . 78 LYS . . 78 LYS . 1 1 
       126 PHI 1 1 79 LEU C 1 1 80 ARG N  1 1 80 ARG CA 1 1 80 ARG C      -126.8       -86.8 . 80 ARG . . 80 ARG . . 80 ARG . . 80 ARG . 1 1 
       127 PSI 1 1 80 ARG N 1 1 80 ARG CA 1 1 80 ARG C  1 1 81 VAL N       106.5       146.5 . 80 ARG . . 80 ARG . . 80 ARG . . 80 ARG . 1 1 
       128 PHI 1 1 80 ARG C 1 1 81 VAL N  1 1 81 VAL CA 1 1 81 VAL C      -135.9       -95.9 . 81 VAL . . 81 VAL . . 81 VAL . . 81 VAL . 1 1 
       129 PSI 1 1 81 VAL N 1 1 81 VAL CA 1 1 81 VAL C  1 1 82 GLU N       111.8       151.8 . 81 VAL . . 81 VAL . . 81 VAL . . 81 VAL . 1 1 
       130 PHI 1 1 81 VAL C 1 1 82 GLU N  1 1 82 GLU CA 1 1 82 GLU C  -157.89998 -117.899994 . 82 GLU . . 82 GLU . . 82 GLU . . 82 GLU . 1 1 
       131 PSI 1 1 82 GLU N 1 1 82 GLU CA 1 1 82 GLU C  1 1 83 VAL N       133.5       173.5 . 82 GLU . . 82 GLU . . 82 GLU . . 82 GLU . 1 1 
       132 PHI 1 1 82 GLU C 1 1 83 VAL N  1 1 83 VAL CA 1 1 83 VAL C       -96.5       -56.5 . 83 VAL . . 83 VAL . . 83 VAL . . 83 VAL . 1 1 
       133 PSI 1 1 83 VAL N 1 1 83 VAL CA 1 1 83 VAL C  1 1 84 PRO N       123.0   162.99998 . 83 VAL . . 83 VAL . . 83 VAL . . 83 VAL . 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 GLY C    C  -7.978   3.553  -4.607 1.00 . A A . -2 GLY C    1 1 
        1     2 1 1  1 GLY CA   C  -9.289   3.552  -5.347 1.00 . A A . -2 GLY CA   1 1 
        1     3 1 1  1 GLY H1   H  -9.014   1.738  -6.328 1.00 . A A . -2 GLY H1   1 1 
        1     4 1 1  1 GLY H2   H  -8.488   3.077  -7.215 1.00 . A A . -2 GLY H2   1 1 
        1     5 1 1  1 GLY H3   H -10.143   2.753  -7.079 1.00 . A A . -2 GLY H3   1 1 
        1     6 1 1  1 GLY HA2  H  -9.549   4.569  -5.613 1.00 . A A . -2 GLY HA2  1 1 
        1     7 1 1  1 GLY HA3  H -10.057   3.155  -4.698 1.00 . A A . -2 GLY HA3  1 1 
        1     8 1 1  1 GLY N    N  -9.230   2.722  -6.579 1.00 . A A . -2 GLY N    1 1 
        1     9 1 1  1 GLY O    O  -7.495   2.494  -4.209 1.00 . A A . -2 GLY O    1 1 
        1    10 1 1  2 SER C    C  -5.954   6.359  -3.262 1.00 . A A . -1 SER C    1 1 
        1    11 1 1  2 SER CA   C  -6.126   4.910  -3.737 1.00 . A A . -1 SER CA   1 1 
        1    12 1 1  2 SER CB   C  -4.935   4.477  -4.611 1.00 . A A . -1 SER CB   1 1 
        1    13 1 1  2 SER H    H  -7.820   5.536  -4.838 1.00 . A A . -1 SER H    1 1 
        1    14 1 1  2 SER HA   H  -6.166   4.272  -2.872 1.00 . A A . -1 SER HA   1 1 
        1    15 1 1  2 SER HB2  H  -4.015   4.802  -4.143 1.00 . A A . -1 SER HB2  1 1 
        1    16 1 1  2 SER HB3  H  -4.928   3.402  -4.709 1.00 . A A . -1 SER HB3  1 1 
        1    17 1 1  2 SER HG   H  -5.374   5.947  -5.826 1.00 . A A . -1 SER HG   1 1 
        1    18 1 1  2 SER N    N  -7.387   4.743  -4.459 1.00 . A A . -1 SER N    1 1 
        1    19 1 1  2 SER O    O  -5.611   7.257  -4.048 1.00 . A A . -1 SER O    1 1 
        1    20 1 1  2 SER OG   O  -5.010   5.056  -5.904 1.00 . A A . -1 SER OG   1 1 
        1    21 1 1  3 HIS C    C  -5.701   7.756   0.099 1.00 . A A .  0 HIS C    1 1 
        1    22 1 1  3 HIS CA   C  -6.089   7.907  -1.379 1.00 . A A .  0 HIS CA   1 1 
        1    23 1 1  3 HIS CB   C  -7.419   8.655  -1.525 1.00 . A A .  0 HIS CB   1 1 
        1    24 1 1  3 HIS CD2  C  -7.632  11.237  -1.472 1.00 . A A .  0 HIS CD2  1 1 
        1    25 1 1  3 HIS CE1  C  -6.708  11.675  -3.414 1.00 . A A .  0 HIS CE1  1 1 
        1    26 1 1  3 HIS CG   C  -7.277  10.057  -2.029 1.00 . A A .  0 HIS CG   1 1 
        1    27 1 1  3 HIS H    H  -6.536   5.833  -1.418 1.00 . A A .  0 HIS H    1 1 
        1    28 1 1  3 HIS HA   H  -5.315   8.447  -1.903 1.00 . A A .  0 HIS HA   1 1 
        1    29 1 1  3 HIS HB2  H  -8.051   8.117  -2.216 1.00 . A A .  0 HIS HB2  1 1 
        1    30 1 1  3 HIS HB3  H  -7.904   8.694  -0.560 1.00 . A A .  0 HIS HB3  1 1 
        1    31 1 1  3 HIS HD1  H  -6.344   9.711  -3.889 1.00 . A A .  0 HIS HD1  1 1 
        1    32 1 1  3 HIS HD2  H  -8.120  11.376  -0.518 1.00 . A A .  0 HIS HD2  1 1 
        1    33 1 1  3 HIS HE1  H  -6.324  12.203  -4.274 1.00 . A A .  0 HIS HE1  1 1 
        1    34 1 1  3 HIS HE2  H  -7.354  13.191  -2.192 1.00 . A A .  0 HIS HE2  1 1 
        1    35 1 1  3 HIS N    N  -6.220   6.584  -1.984 1.00 . A A .  0 HIS N    1 1 
        1    36 1 1  3 HIS ND1  N  -6.701  10.365  -3.246 1.00 . A A .  0 HIS ND1  1 1 
        1    37 1 1  3 HIS NE2  N  -7.266  12.225  -2.353 1.00 . A A .  0 HIS NE2  1 1 
        1    38 1 1  3 HIS O    O  -5.420   6.643   0.524 1.00 . A A .  0 HIS O    1 1 
        1    39 1 1  4 MET C    C  -4.010   8.546   2.762 1.00 . A A .  1 MET C    1 1 
        1    40 1 1  4 MET CA   C  -5.440   8.932   2.324 1.00 . A A .  1 MET CA   1 1 
        1    41 1 1  4 MET CB   C  -6.467   8.071   3.096 1.00 . A A .  1 MET CB   1 1 
        1    42 1 1  4 MET CE   C -10.516   8.512   2.028 1.00 . A A .  1 MET CE   1 1 
        1    43 1 1  4 MET CG   C  -7.919   8.573   3.062 1.00 . A A .  1 MET CG   1 1 
        1    44 1 1  4 MET H    H  -5.751   9.741   0.386 1.00 . A A .  1 MET H    1 1 
        1    45 1 1  4 MET HA   H  -5.592   9.960   2.620 1.00 . A A .  1 MET HA   1 1 
        1    46 1 1  4 MET HB2  H  -6.449   7.079   2.673 1.00 . A A .  1 MET HB2  1 1 
        1    47 1 1  4 MET HB3  H  -6.158   8.011   4.129 1.00 . A A .  1 MET HB3  1 1 
        1    48 1 1  4 MET HE1  H -10.567   9.586   2.103 1.00 . A A .  1 MET HE1  1 1 
        1    49 1 1  4 MET HE2  H -10.791   8.068   2.974 1.00 . A A .  1 MET HE2  1 1 
        1    50 1 1  4 MET HE3  H -11.196   8.165   1.262 1.00 . A A .  1 MET HE3  1 1 
        1    51 1 1  4 MET HG2  H  -8.430   8.214   3.940 1.00 . A A .  1 MET HG2  1 1 
        1    52 1 1  4 MET HG3  H  -7.913   9.653   3.070 1.00 . A A .  1 MET HG3  1 1 
        1    53 1 1  4 MET N    N  -5.648   8.890   0.846 1.00 . A A .  1 MET N    1 1 
        1    54 1 1  4 MET O    O  -3.322   7.745   2.119 1.00 . A A .  1 MET O    1 1 
        1    55 1 1  4 MET SD   S  -8.840   8.037   1.608 1.00 . A A .  1 MET SD   1 1 
        1    56 1 1  5 VAL C    C  -2.325   8.682   5.970 1.00 . A A .  2 VAL C    1 1 
        1    57 1 1  5 VAL CA   C  -2.233   8.866   4.448 1.00 . A A .  2 VAL CA   1 1 
        1    58 1 1  5 VAL CB   C  -1.168   9.971   4.132 1.00 . A A .  2 VAL CB   1 1 
        1    59 1 1  5 VAL CG1  C  -0.788   9.962   2.656 1.00 . A A .  2 VAL CG1  1 1 
        1    60 1 1  5 VAL CG2  C  -1.647  11.366   4.545 1.00 . A A .  2 VAL CG2  1 1 
        1    61 1 1  5 VAL H    H  -4.138   9.802   4.322 1.00 . A A .  2 VAL H    1 1 
        1    62 1 1  5 VAL HA   H  -1.892   7.938   4.011 1.00 . A A .  2 VAL HA   1 1 
        1    63 1 1  5 VAL HB   H  -0.276   9.743   4.705 1.00 . A A .  2 VAL HB   1 1 
        1    64 1 1  5 VAL HG11 H  -1.667  10.156   2.061 1.00 . A A .  2 VAL HG11 1 1 
        1    65 1 1  5 VAL HG12 H  -0.381   8.997   2.393 1.00 . A A .  2 VAL HG12 1 1 
        1    66 1 1  5 VAL HG13 H  -0.050  10.728   2.469 1.00 . A A .  2 VAL HG13 1 1 
        1    67 1 1  5 VAL HG21 H  -1.833  11.384   5.610 1.00 . A A .  2 VAL HG21 1 1 
        1    68 1 1  5 VAL HG22 H  -2.559  11.605   4.018 1.00 . A A .  2 VAL HG22 1 1 
        1    69 1 1  5 VAL HG23 H  -0.889  12.094   4.301 1.00 . A A .  2 VAL HG23 1 1 
        1    70 1 1  5 VAL N    N  -3.558   9.154   3.868 1.00 . A A .  2 VAL N    1 1 
        1    71 1 1  5 VAL O    O  -3.309   9.093   6.590 1.00 . A A .  2 VAL O    1 1 
        1    72 1 1  6 ILE C    C   0.218   7.740   8.505 1.00 . A A .  3 ILE C    1 1 
        1    73 1 1  6 ILE CA   C  -1.248   7.832   8.009 1.00 . A A .  3 ILE CA   1 1 
        1    74 1 1  6 ILE CB   C  -2.107   6.571   8.412 1.00 . A A .  3 ILE CB   1 1 
        1    75 1 1  6 ILE CD1  C  -3.192   5.490  10.458 1.00 . A A .  3 ILE CD1  1 1 
        1    76 1 1  6 ILE CG1  C  -2.082   6.375   9.940 1.00 . A A .  3 ILE CG1  1 1 
        1    77 1 1  6 ILE CG2  C  -1.678   5.282   7.662 1.00 . A A .  3 ILE CG2  1 1 
        1    78 1 1  6 ILE H    H  -0.533   7.772   6.014 1.00 . A A .  3 ILE H    1 1 
        1    79 1 1  6 ILE HA   H  -1.696   8.695   8.481 1.00 . A A .  3 ILE HA   1 1 
        1    80 1 1  6 ILE HB   H  -3.129   6.775   8.118 1.00 . A A .  3 ILE HB   1 1 
        1    81 1 1  6 ILE HD11 H  -3.117   5.412  11.531 1.00 . A A .  3 ILE HD11 1 1 
        1    82 1 1  6 ILE HD12 H  -3.099   4.509  10.016 1.00 . A A .  3 ILE HD12 1 1 
        1    83 1 1  6 ILE HD13 H  -4.147   5.918  10.193 1.00 . A A .  3 ILE HD13 1 1 
        1    84 1 1  6 ILE HG12 H  -1.145   5.923  10.218 1.00 . A A .  3 ILE HG12 1 1 
        1    85 1 1  6 ILE HG13 H  -2.172   7.341  10.427 1.00 . A A .  3 ILE HG13 1 1 
        1    86 1 1  6 ILE HG21 H  -2.301   4.451   7.970 1.00 . A A .  3 ILE HG21 1 1 
        1    87 1 1  6 ILE HG22 H  -0.645   5.050   7.881 1.00 . A A .  3 ILE HG22 1 1 
        1    88 1 1  6 ILE HG23 H  -1.788   5.429   6.594 1.00 . A A .  3 ILE HG23 1 1 
        1    89 1 1  6 ILE N    N  -1.291   8.068   6.562 1.00 . A A .  3 ILE N    1 1 
        1    90 1 1  6 ILE O    O   1.004   6.936   8.007 1.00 . A A .  3 ILE O    1 1 
        1    91 1 1  7 ARG C    C   2.038   8.236  11.464 1.00 . A A .  4 ARG C    1 1 
        1    92 1 1  7 ARG CA   C   1.980   8.618   9.972 1.00 . A A .  4 ARG CA   1 1 
        1    93 1 1  7 ARG CB   C   2.651   9.992   9.784 1.00 . A A .  4 ARG CB   1 1 
        1    94 1 1  7 ARG CD   C   2.022  11.213   7.654 1.00 . A A .  4 ARG CD   1 1 
        1    95 1 1  7 ARG CG   C   3.056  10.328   8.342 1.00 . A A .  4 ARG CG   1 1 
        1    96 1 1  7 ARG CZ   C   3.126  13.053   6.402 1.00 . A A .  4 ARG CZ   1 1 
        1    97 1 1  7 ARG H    H  -0.027   9.305   9.780 1.00 . A A .  4 ARG H    1 1 
        1    98 1 1  7 ARG HA   H   2.535   7.884   9.407 1.00 . A A .  4 ARG HA   1 1 
        1    99 1 1  7 ARG HB2  H   1.959  10.751  10.125 1.00 . A A .  4 ARG HB2  1 1 
        1   100 1 1  7 ARG HB3  H   3.533  10.022  10.412 1.00 . A A .  4 ARG HB3  1 1 
        1   101 1 1  7 ARG HD2  H   1.167  10.608   7.387 1.00 . A A .  4 ARG HD2  1 1 
        1   102 1 1  7 ARG HD3  H   1.714  11.989   8.338 1.00 . A A .  4 ARG HD3  1 1 
        1   103 1 1  7 ARG HE   H   2.506  11.308   5.611 1.00 . A A .  4 ARG HE   1 1 
        1   104 1 1  7 ARG HG2  H   4.010  10.847   8.335 1.00 . A A .  4 ARG HG2  1 1 
        1   105 1 1  7 ARG HG3  H   3.149   9.407   7.784 1.00 . A A .  4 ARG HG3  1 1 
        1   106 1 1  7 ARG HH11 H   2.897  13.452   8.380 1.00 . A A .  4 ARG HH11 1 1 
        1   107 1 1  7 ARG HH12 H   3.660  14.702   7.458 1.00 . A A .  4 ARG HH12 1 1 
        1   108 1 1  7 ARG HH21 H   3.520  12.992   4.418 1.00 . A A .  4 ARG HH21 1 1 
        1   109 1 1  7 ARG HH22 H   4.010  14.442   5.227 1.00 . A A .  4 ARG HH22 1 1 
        1   110 1 1  7 ARG N    N   0.606   8.624   9.449 1.00 . A A .  4 ARG N    1 1 
        1   111 1 1  7 ARG NE   N   2.561  11.832   6.442 1.00 . A A .  4 ARG NE   1 1 
        1   112 1 1  7 ARG NH1  N   3.236  13.796   7.505 1.00 . A A .  4 ARG NH1  1 1 
        1   113 1 1  7 ARG NH2  N   3.588  13.533   5.256 1.00 . A A .  4 ARG NH2  1 1 
        1   114 1 1  7 ARG O    O   2.758   8.870  12.244 1.00 . A A .  4 ARG O    1 1 
        1   115 1 1  8 GLU C    C   0.937   5.244  13.349 1.00 . A A .  5 GLU C    1 1 
        1   116 1 1  8 GLU CA   C   1.348   6.729  13.266 1.00 . A A .  5 GLU CA   1 1 
        1   117 1 1  8 GLU CB   C   0.409   7.595  14.178 1.00 . A A .  5 GLU CB   1 1 
        1   118 1 1  8 GLU CD   C  -0.202   8.307  16.553 1.00 . A A .  5 GLU CD   1 1 
        1   119 1 1  8 GLU CG   C   0.882   7.752  15.651 1.00 . A A .  5 GLU CG   1 1 
        1   120 1 1  8 GLU H    H   0.835   6.651  11.176 1.00 . A A .  5 GLU H    1 1 
        1   121 1 1  8 GLU HA   H   2.369   6.824  13.614 1.00 . A A .  5 GLU HA   1 1 
        1   122 1 1  8 GLU HB2  H   0.309   8.594  13.756 1.00 . A A .  5 GLU HB2  1 1 
        1   123 1 1  8 GLU HB3  H  -0.570   7.132  14.193 1.00 . A A .  5 GLU HB3  1 1 
        1   124 1 1  8 GLU HG2  H   1.174   6.786  16.046 1.00 . A A .  5 GLU HG2  1 1 
        1   125 1 1  8 GLU HG3  H   1.734   8.427  15.697 1.00 . A A .  5 GLU HG3  1 1 
        1   126 1 1  8 GLU N    N   1.330   7.178  11.855 1.00 . A A .  5 GLU N    1 1 
        1   127 1 1  8 GLU O    O   0.527   4.763  14.410 1.00 . A A .  5 GLU O    1 1 
        1   128 1 1  8 GLU OE1  O  -0.778   9.365  16.222 1.00 . A A .  5 GLU OE1  1 1 
        1   129 1 1  8 GLU OE2  O  -0.485   7.668  17.589 1.00 . A A .  5 GLU OE2  1 1 
        1   130 1 1  9 SER C    C   1.789   2.213  11.701 1.00 . A A .  6 SER C    1 1 
        1   131 1 1  9 SER CA   C   0.644   3.102  12.215 1.00 . A A .  6 SER CA   1 1 
        1   132 1 1  9 SER CB   C  -0.634   2.937  11.343 1.00 . A A .  6 SER CB   1 1 
        1   133 1 1  9 SER H    H   1.484   4.888  11.428 1.00 . A A .  6 SER H    1 1 
        1   134 1 1  9 SER HA   H   0.412   2.822  13.234 1.00 . A A .  6 SER HA   1 1 
        1   135 1 1  9 SER HB2  H  -1.308   3.762  11.536 1.00 . A A .  6 SER HB2  1 1 
        1   136 1 1  9 SER HB3  H  -0.358   2.944  10.296 1.00 . A A .  6 SER HB3  1 1 
        1   137 1 1  9 SER HG   H  -2.200   1.745  11.193 1.00 . A A .  6 SER HG   1 1 
        1   138 1 1  9 SER N    N   1.065   4.504  12.234 1.00 . A A .  6 SER N    1 1 
        1   139 1 1  9 SER O    O   2.864   2.703  11.348 1.00 . A A .  6 SER O    1 1 
        1   140 1 1  9 SER OG   O  -1.329   1.722  11.616 1.00 . A A .  6 SER OG   1 1 
        1   141 1 1 10 VAL C    C   1.709  -0.989  10.241 1.00 . A A .  7 VAL C    1 1 
        1   142 1 1 10 VAL CA   C   2.476  -0.075  11.152 1.00 . A A .  7 VAL CA   1 1 
        1   143 1 1 10 VAL CB   C   3.217  -0.942  12.228 1.00 . A A .  7 VAL CB   1 1 
        1   144 1 1 10 VAL CG1  C   4.676  -0.563  12.245 1.00 . A A .  7 VAL CG1  1 1 
        1   145 1 1 10 VAL CG2  C   2.627  -0.862  13.655 1.00 . A A .  7 VAL CG2  1 1 
        1   146 1 1 10 VAL H    H   0.643   0.603  11.913 1.00 . A A .  7 VAL H    1 1 
        1   147 1 1 10 VAL HA   H   3.223   0.452  10.547 1.00 . A A .  7 VAL HA   1 1 
        1   148 1 1 10 VAL HB   H   3.159  -1.973  11.902 1.00 . A A .  7 VAL HB   1 1 
        1   149 1 1 10 VAL HG11 H   5.102  -0.752  11.269 1.00 . A A .  7 VAL HG11 1 1 
        1   150 1 1 10 VAL HG12 H   5.200  -1.153  12.982 1.00 . A A .  7 VAL HG12 1 1 
        1   151 1 1 10 VAL HG13 H   4.776   0.486  12.481 1.00 . A A .  7 VAL HG13 1 1 
        1   152 1 1 10 VAL HG21 H   3.135  -1.580  14.285 1.00 . A A .  7 VAL HG21 1 1 
        1   153 1 1 10 VAL HG22 H   1.571  -1.101  13.636 1.00 . A A .  7 VAL HG22 1 1 
        1   154 1 1 10 VAL HG23 H   2.770   0.126  14.066 1.00 . A A .  7 VAL HG23 1 1 
        1   155 1 1 10 VAL N    N   1.537   0.907  11.663 1.00 . A A .  7 VAL N    1 1 
        1   156 1 1 10 VAL O    O   0.891  -1.788  10.680 1.00 . A A .  7 VAL O    1 1 
        1   157 1 1 11 SER C    C   1.821  -2.889   7.653 1.00 . A A .  8 SER C    1 1 
        1   158 1 1 11 SER CA   C   1.160  -1.530   7.952 1.00 . A A .  8 SER CA   1 1 
        1   159 1 1 11 SER CB   C   1.023  -0.636   6.701 1.00 . A A .  8 SER CB   1 1 
        1   160 1 1 11 SER H    H   2.643  -0.191   8.677 1.00 . A A .  8 SER H    1 1 
        1   161 1 1 11 SER HA   H   0.178  -1.711   8.362 1.00 . A A .  8 SER HA   1 1 
        1   162 1 1 11 SER HB2  H   1.071  -1.256   5.823 1.00 . A A .  8 SER HB2  1 1 
        1   163 1 1 11 SER HB3  H   0.068  -0.113   6.706 1.00 . A A .  8 SER HB3  1 1 
        1   164 1 1 11 SER HG   H   2.667   0.079   5.902 1.00 . A A .  8 SER HG   1 1 
        1   165 1 1 11 SER N    N   1.921  -0.805   8.957 1.00 . A A .  8 SER N    1 1 
        1   166 1 1 11 SER O    O   2.945  -2.936   7.172 1.00 . A A .  8 SER O    1 1 
        1   167 1 1 11 SER OG   O   2.072   0.316   6.632 1.00 . A A .  8 SER OG   1 1 
        1   168 1 1 12 ARG C    C   0.708  -6.341   6.953 1.00 . A A .  9 ARG C    1 1 
        1   169 1 1 12 ARG CA   C   1.688  -5.378   7.682 1.00 . A A .  9 ARG CA   1 1 
        1   170 1 1 12 ARG CB   C   2.186  -6.063   9.004 1.00 . A A .  9 ARG CB   1 1 
        1   171 1 1 12 ARG CD   C   1.754  -5.001  11.297 1.00 . A A .  9 ARG CD   1 1 
        1   172 1 1 12 ARG CG   C   2.694  -5.095  10.083 1.00 . A A .  9 ARG CG   1 1 
        1   173 1 1 12 ARG CZ   C  -0.653  -4.554  11.753 1.00 . A A .  9 ARG CZ   1 1 
        1   174 1 1 12 ARG H    H   0.132  -3.903   8.166 1.00 . A A .  9 ARG H    1 1 
        1   175 1 1 12 ARG HA   H   2.536  -5.216   7.041 1.00 . A A .  9 ARG HA   1 1 
        1   176 1 1 12 ARG HB2  H   1.395  -6.675   9.424 1.00 . A A .  9 ARG HB2  1 1 
        1   177 1 1 12 ARG HB3  H   3.011  -6.723   8.748 1.00 . A A .  9 ARG HB3  1 1 
        1   178 1 1 12 ARG HD2  H   1.850  -5.893  11.891 1.00 . A A .  9 ARG HD2  1 1 
        1   179 1 1 12 ARG HD3  H   2.049  -4.143  11.895 1.00 . A A .  9 ARG HD3  1 1 
        1   180 1 1 12 ARG HE   H   0.138  -4.938   9.956 1.00 . A A .  9 ARG HE   1 1 
        1   181 1 1 12 ARG HG2  H   3.666  -5.428  10.422 1.00 . A A .  9 ARG HG2  1 1 
        1   182 1 1 12 ARG HG3  H   2.791  -4.111   9.643 1.00 . A A .  9 ARG HG3  1 1 
        1   183 1 1 12 ARG HH11 H   0.495  -4.482  13.421 1.00 . A A .  9 ARG HH11 1 1 
        1   184 1 1 12 ARG HH12 H  -1.192  -4.179  13.674 1.00 . A A .  9 ARG HH12 1 1 
        1   185 1 1 12 ARG HH21 H  -2.069  -4.526  10.305 1.00 . A A .  9 ARG HH21 1 1 
        1   186 1 1 12 ARG HH22 H  -2.645  -4.206  11.906 1.00 . A A .  9 ARG HH22 1 1 
        1   187 1 1 12 ARG N    N   1.090  -4.008   7.891 1.00 . A A .  9 ARG N    1 1 
        1   188 1 1 12 ARG NE   N   0.348  -4.831  10.909 1.00 . A A .  9 ARG NE   1 1 
        1   189 1 1 12 ARG NH1  N  -0.431  -4.399  13.056 1.00 . A A .  9 ARG NH1  1 1 
        1   190 1 1 12 ARG NH2  N  -1.889  -4.419  11.281 1.00 . A A .  9 ARG NH2  1 1 
        1   191 1 1 12 ARG O    O  -0.483  -6.119   7.019 1.00 . A A .  9 ARG O    1 1 
        1   192 1 1 13 ILE C    C   0.530  -9.754   6.192 1.00 . A A . 10 ILE C    1 1 
        1   193 1 1 13 ILE CA   C   0.411  -8.376   5.516 1.00 . A A . 10 ILE CA   1 1 
        1   194 1 1 13 ILE CB   C   0.884  -8.498   3.989 1.00 . A A . 10 ILE CB   1 1 
        1   195 1 1 13 ILE CD1  C   0.958  -7.070   1.726 1.00 . A A . 10 ILE CD1  1 1 
        1   196 1 1 13 ILE CG1  C   0.914  -7.108   3.273 1.00 . A A . 10 ILE CG1  1 1 
        1   197 1 1 13 ILE CG2  C   0.025  -9.507   3.189 1.00 . A A . 10 ILE CG2  1 1 
        1   198 1 1 13 ILE H    H   2.189  -7.621   6.364 1.00 . A A . 10 ILE H    1 1 
        1   199 1 1 13 ILE HA   H  -0.618  -8.049   5.569 1.00 . A A . 10 ILE HA   1 1 
        1   200 1 1 13 ILE HB   H   1.897  -8.895   4.022 1.00 . A A . 10 ILE HB   1 1 
        1   201 1 1 13 ILE HD11 H   0.464  -7.937   1.308 1.00 . A A . 10 ILE HD11 1 1 
        1   202 1 1 13 ILE HD12 H   1.974  -7.017   1.382 1.00 . A A . 10 ILE HD12 1 1 
        1   203 1 1 13 ILE HD13 H   0.439  -6.188   1.378 1.00 . A A . 10 ILE HD13 1 1 
        1   204 1 1 13 ILE HG12 H   0.050  -6.548   3.573 1.00 . A A . 10 ILE HG12 1 1 
        1   205 1 1 13 ILE HG13 H   1.798  -6.585   3.605 1.00 . A A . 10 ILE HG13 1 1 
        1   206 1 1 13 ILE HG21 H   0.480  -9.699   2.227 1.00 . A A . 10 ILE HG21 1 1 
        1   207 1 1 13 ILE HG22 H  -0.967  -9.106   3.036 1.00 . A A . 10 ILE HG22 1 1 
        1   208 1 1 13 ILE HG23 H  -0.045 -10.439   3.737 1.00 . A A . 10 ILE HG23 1 1 
        1   209 1 1 13 ILE N    N   1.221  -7.433   6.302 1.00 . A A . 10 ILE N    1 1 
        1   210 1 1 13 ILE O    O   1.614 -10.082   6.730 1.00 . A A . 10 ILE O    1 1 
        1   211 1 1 14 TYR C    C  -0.588 -13.011   5.856 1.00 . A A . 11 TYR C    1 1 
        1   212 1 1 14 TYR CA   C  -0.640 -11.830   6.880 1.00 . A A . 11 TYR CA   1 1 
        1   213 1 1 14 TYR CB   C  -1.971 -11.872   7.664 1.00 . A A . 11 TYR CB   1 1 
        1   214 1 1 14 TYR CD1  C  -2.191 -14.173   8.694 1.00 . A A . 11 TYR CD1  1 1 
        1   215 1 1 14 TYR CD2  C  -1.824 -12.313  10.136 1.00 . A A . 11 TYR CD2  1 1 
        1   216 1 1 14 TYR CE1  C  -2.226 -15.017   9.784 1.00 . A A . 11 TYR CE1  1 1 
        1   217 1 1 14 TYR CE2  C  -1.854 -13.152  11.234 1.00 . A A . 11 TYR CE2  1 1 
        1   218 1 1 14 TYR CG   C  -1.989 -12.809   8.850 1.00 . A A . 11 TYR CG   1 1 
        1   219 1 1 14 TYR CZ   C  -2.055 -14.503  11.054 1.00 . A A . 11 TYR CZ   1 1 
        1   220 1 1 14 TYR H    H  -1.411 -10.183   5.741 1.00 . A A . 11 TYR H    1 1 
        1   221 1 1 14 TYR HA   H   0.179 -11.890   7.581 1.00 . A A . 11 TYR HA   1 1 
        1   222 1 1 14 TYR HB2  H  -2.192 -10.881   8.036 1.00 . A A . 11 TYR HB2  1 1 
        1   223 1 1 14 TYR HB3  H  -2.768 -12.173   6.990 1.00 . A A . 11 TYR HB3  1 1 
        1   224 1 1 14 TYR HD1  H  -2.320 -14.573   7.696 1.00 . A A . 11 TYR HD1  1 1 
        1   225 1 1 14 TYR HD2  H  -1.673 -11.253  10.273 1.00 . A A . 11 TYR HD2  1 1 
        1   226 1 1 14 TYR HE1  H  -2.389 -16.071   9.643 1.00 . A A . 11 TYR HE1  1 1 
        1   227 1 1 14 TYR HE2  H  -1.722 -12.745  12.225 1.00 . A A . 11 TYR HE2  1 1 
        1   228 1 1 14 TYR HH   H  -1.563 -16.127  11.975 1.00 . A A . 11 TYR HH   1 1 
        1   229 1 1 14 TYR N    N  -0.586 -10.525   6.199 1.00 . A A . 11 TYR N    1 1 
        1   230 1 1 14 TYR O    O  -1.553 -13.164   5.096 1.00 . A A . 11 TYR O    1 1 
        1   231 1 1 14 TYR OH   O  -2.085 -15.339  12.153 1.00 . A A . 11 TYR OH   1 1 
        1   232 1 1 15 VAL C    C   0.776 -16.327   5.564 1.00 . A A . 12 VAL C    1 1 
        1   233 1 1 15 VAL CA   C   0.485 -14.985   4.837 1.00 . A A . 12 VAL CA   1 1 
        1   234 1 1 15 VAL CB   C   1.474 -14.762   3.594 1.00 . A A . 12 VAL CB   1 1 
        1   235 1 1 15 VAL CG1  C   1.001 -13.680   2.610 1.00 . A A . 12 VAL CG1  1 1 
        1   236 1 1 15 VAL CG2  C   2.898 -14.418   4.020 1.00 . A A . 12 VAL CG2  1 1 
        1   237 1 1 15 VAL H    H   1.242 -13.808   6.463 1.00 . A A . 12 VAL H    1 1 
        1   238 1 1 15 VAL HA   H  -0.530 -15.058   4.457 1.00 . A A . 12 VAL HA   1 1 
        1   239 1 1 15 VAL HB   H   1.525 -15.690   3.041 1.00 . A A . 12 VAL HB   1 1 
        1   240 1 1 15 VAL HG11 H   1.776 -13.520   1.870 1.00 . A A . 12 VAL HG11 1 1 
        1   241 1 1 15 VAL HG12 H   0.810 -12.747   3.121 1.00 . A A . 12 VAL HG12 1 1 
        1   242 1 1 15 VAL HG13 H   0.106 -14.005   2.106 1.00 . A A . 12 VAL HG13 1 1 
        1   243 1 1 15 VAL HG21 H   3.278 -15.204   4.657 1.00 . A A . 12 VAL HG21 1 1 
        1   244 1 1 15 VAL HG22 H   2.906 -13.479   4.556 1.00 . A A . 12 VAL HG22 1 1 
        1   245 1 1 15 VAL HG23 H   3.519 -14.336   3.142 1.00 . A A . 12 VAL HG23 1 1 
        1   246 1 1 15 VAL N    N   0.491 -13.863   5.806 1.00 . A A . 12 VAL N    1 1 
        1   247 1 1 15 VAL O    O   1.895 -16.602   5.951 1.00 . A A . 12 VAL O    1 1 
        1   248 1 1 16 GLY C    C  -0.626 -19.673   5.851 1.00 . A A . 13 GLY C    1 1 
        1   249 1 1 16 GLY CA   C  -0.049 -18.431   6.512 1.00 . A A . 13 GLY CA   1 1 
        1   250 1 1 16 GLY H    H  -1.107 -16.988   5.288 1.00 . A A . 13 GLY H    1 1 
        1   251 1 1 16 GLY HA2  H   1.006 -18.588   6.669 1.00 . A A . 13 GLY HA2  1 1 
        1   252 1 1 16 GLY HA3  H  -0.517 -18.307   7.466 1.00 . A A . 13 GLY HA3  1 1 
        1   253 1 1 16 GLY N    N  -0.235 -17.186   5.724 1.00 . A A . 13 GLY N    1 1 
        1   254 1 1 16 GLY O    O  -1.146 -19.575   4.750 1.00 . A A . 13 GLY O    1 1 
        1   255 1 1 17 ASN C    C  -0.519 -22.471   4.524 1.00 . A A . 14 ASN C    1 1 
        1   256 1 1 17 ASN CA   C  -0.998 -22.174   5.979 1.00 . A A . 14 ASN CA   1 1 
        1   257 1 1 17 ASN CB   C  -2.540 -22.222   6.041 1.00 . A A . 14 ASN CB   1 1 
        1   258 1 1 17 ASN CG   C  -3.111 -21.918   7.423 1.00 . A A . 14 ASN CG   1 1 
        1   259 1 1 17 ASN H    H  -0.153 -20.844   7.456 1.00 . A A . 14 ASN H    1 1 
        1   260 1 1 17 ASN HA   H  -0.620 -22.957   6.618 1.00 . A A . 14 ASN HA   1 1 
        1   261 1 1 17 ASN HB2  H  -2.932 -21.495   5.354 1.00 . A A . 14 ASN HB2  1 1 
        1   262 1 1 17 ASN HB3  H  -2.875 -23.205   5.747 1.00 . A A . 14 ASN HB3  1 1 
        1   263 1 1 17 ASN HD21 H  -2.958 -23.818   7.936 1.00 . A A . 14 ASN HD21 1 1 
        1   264 1 1 17 ASN HD22 H  -3.581 -22.764   9.150 1.00 . A A . 14 ASN HD22 1 1 
        1   265 1 1 17 ASN N    N  -0.513 -20.858   6.523 1.00 . A A . 14 ASN N    1 1 
        1   266 1 1 17 ASN ND2  N  -3.230 -22.939   8.251 1.00 . A A . 14 ASN ND2  1 1 
        1   267 1 1 17 ASN O    O  -1.083 -23.294   3.856 1.00 . A A . 14 ASN O    1 1 
        1   268 1 1 17 ASN OD1  O  -3.435 -20.773   7.739 1.00 . A A . 14 ASN OD1  1 1 
        1   269 1 1 18 LEU C    C   1.959 -22.998   2.418 1.00 . A A . 15 LEU C    1 1 
        1   270 1 1 18 LEU CA   C   1.012 -21.818   2.718 1.00 . A A . 15 LEU CA   1 1 
        1   271 1 1 18 LEU CB   C   1.676 -20.434   2.431 1.00 . A A . 15 LEU CB   1 1 
        1   272 1 1 18 LEU CD1  C   3.772 -19.036   2.400 1.00 . A A . 15 LEU CD1  1 1 
        1   273 1 1 18 LEU CD2  C   2.842 -19.655   4.577 1.00 . A A . 15 LEU CD2  1 1 
        1   274 1 1 18 LEU CG   C   3.020 -20.119   3.136 1.00 . A A . 15 LEU CG   1 1 
        1   275 1 1 18 LEU H    H   1.134 -21.419   4.734 1.00 . A A . 15 LEU H    1 1 
        1   276 1 1 18 LEU HA   H   0.135 -21.921   2.102 1.00 . A A . 15 LEU HA   1 1 
        1   277 1 1 18 LEU HB2  H   1.828 -20.352   1.365 1.00 . A A . 15 LEU HB2  1 1 
        1   278 1 1 18 LEU HB3  H   0.966 -19.661   2.732 1.00 . A A . 15 LEU HB3  1 1 
        1   279 1 1 18 LEU HD11 H   4.122 -19.416   1.453 1.00 . A A . 15 LEU HD11 1 1 
        1   280 1 1 18 LEU HD12 H   4.613 -18.723   3.007 1.00 . A A . 15 LEU HD12 1 1 
        1   281 1 1 18 LEU HD13 H   3.119 -18.191   2.236 1.00 . A A . 15 LEU HD13 1 1 
        1   282 1 1 18 LEU HD21 H   3.742 -19.158   4.899 1.00 . A A . 15 LEU HD21 1 1 
        1   283 1 1 18 LEU HD22 H   2.658 -20.508   5.214 1.00 . A A . 15 LEU HD22 1 1 
        1   284 1 1 18 LEU HD23 H   2.013 -18.972   4.632 1.00 . A A . 15 LEU HD23 1 1 
        1   285 1 1 18 LEU HG   H   3.626 -21.012   3.141 1.00 . A A . 15 LEU HG   1 1 
        1   286 1 1 18 LEU N    N   0.579 -21.852   4.099 1.00 . A A . 15 LEU N    1 1 
        1   287 1 1 18 LEU O    O   2.759 -23.363   3.291 1.00 . A A . 15 LEU O    1 1 
        1   288 1 1 19 PRO C    C   4.241 -24.236   0.699 1.00 . A A . 16 PRO C    1 1 
        1   289 1 1 19 PRO CA   C   2.777 -24.723   0.822 1.00 . A A . 16 PRO CA   1 1 
        1   290 1 1 19 PRO CB   C   2.243 -25.197  -0.543 1.00 . A A . 16 PRO CB   1 1 
        1   291 1 1 19 PRO CD   C   0.859 -23.356   0.165 1.00 . A A . 16 PRO CD   1 1 
        1   292 1 1 19 PRO CG   C   1.322 -24.135  -1.030 1.00 . A A . 16 PRO CG   1 1 
        1   293 1 1 19 PRO HA   H   2.704 -25.537   1.534 1.00 . A A . 16 PRO HA   1 1 
        1   294 1 1 19 PRO HB2  H   3.064 -25.326  -1.234 1.00 . A A . 16 PRO HB2  1 1 
        1   295 1 1 19 PRO HB3  H   1.707 -26.126  -0.424 1.00 . A A . 16 PRO HB3  1 1 
        1   296 1 1 19 PRO HD2  H   0.835 -22.313  -0.079 1.00 . A A . 16 PRO HD2  1 1 
        1   297 1 1 19 PRO HD3  H  -0.115 -23.696   0.472 1.00 . A A . 16 PRO HD3  1 1 
        1   298 1 1 19 PRO HG2  H   1.854 -23.481  -1.711 1.00 . A A . 16 PRO HG2  1 1 
        1   299 1 1 19 PRO HG3  H   0.477 -24.583  -1.524 1.00 . A A . 16 PRO HG3  1 1 
        1   300 1 1 19 PRO N    N   1.867 -23.630   1.212 1.00 . A A . 16 PRO N    1 1 
        1   301 1 1 19 PRO O    O   4.453 -23.155   0.145 1.00 . A A . 16 PRO O    1 1 
        1   302 1 1 20 SER C    C   7.068 -23.742   2.420 1.00 . A A . 17 SER C    1 1 
        1   303 1 1 20 SER CA   C   6.681 -24.739   1.313 1.00 . A A . 17 SER CA   1 1 
        1   304 1 1 20 SER CB   C   7.306 -24.323  -0.060 1.00 . A A . 17 SER CB   1 1 
        1   305 1 1 20 SER H    H   4.931 -25.811   1.786 1.00 . A A . 17 SER H    1 1 
        1   306 1 1 20 SER HA   H   7.133 -25.681   1.592 1.00 . A A . 17 SER HA   1 1 
        1   307 1 1 20 SER HB2  H   8.347 -24.608  -0.070 1.00 . A A . 17 SER HB2  1 1 
        1   308 1 1 20 SER HB3  H   6.792 -24.841  -0.859 1.00 . A A . 17 SER HB3  1 1 
        1   309 1 1 20 SER HG   H   7.845 -22.688  -1.006 1.00 . A A . 17 SER HG   1 1 
        1   310 1 1 20 SER N    N   5.215 -25.011   1.292 1.00 . A A . 17 SER N    1 1 
        1   311 1 1 20 SER O    O   8.086 -23.959   3.090 1.00 . A A . 17 SER O    1 1 
        1   312 1 1 20 SER OG   O   7.231 -22.922  -0.306 1.00 . A A . 17 SER OG   1 1 
        1   313 1 1 21 HIS C    C   7.635 -20.697   3.014 1.00 . A A . 18 HIS C    1 1 
        1   314 1 1 21 HIS CA   C   6.475 -21.559   3.526 1.00 . A A . 18 HIS CA   1 1 
        1   315 1 1 21 HIS CB   C   6.666 -21.995   5.000 1.00 . A A . 18 HIS CB   1 1 
        1   316 1 1 21 HIS CD2  C   6.371 -19.755   6.327 1.00 . A A . 18 HIS CD2  1 1 
        1   317 1 1 21 HIS CE1  C   8.252 -19.814   7.448 1.00 . A A . 18 HIS CE1  1 1 
        1   318 1 1 21 HIS CG   C   7.030 -20.885   5.965 1.00 . A A . 18 HIS CG   1 1 
        1   319 1 1 21 HIS H    H   5.394 -22.689   2.099 1.00 . A A . 18 HIS H    1 1 
        1   320 1 1 21 HIS HA   H   5.599 -20.946   3.487 1.00 . A A . 18 HIS HA   1 1 
        1   321 1 1 21 HIS HB2  H   5.750 -22.452   5.354 1.00 . A A . 18 HIS HB2  1 1 
        1   322 1 1 21 HIS HB3  H   7.447 -22.724   5.024 1.00 . A A . 18 HIS HB3  1 1 
        1   323 1 1 21 HIS HD1  H   8.899 -21.577   6.639 1.00 . A A . 18 HIS HD1  1 1 
        1   324 1 1 21 HIS HD2  H   5.419 -19.423   5.950 1.00 . A A . 18 HIS HD2  1 1 
        1   325 1 1 21 HIS HE1  H   9.057 -19.551   8.119 1.00 . A A . 18 HIS HE1  1 1 
        1   326 1 1 21 HIS HE2  H   7.000 -18.200   7.585 1.00 . A A . 18 HIS HE2  1 1 
        1   327 1 1 21 HIS N    N   6.223 -22.699   2.621 1.00 . A A . 18 HIS N    1 1 
        1   328 1 1 21 HIS ND1  N   8.197 -20.888   6.689 1.00 . A A . 18 HIS ND1  1 1 
        1   329 1 1 21 HIS NE2  N   7.155 -19.107   7.248 1.00 . A A . 18 HIS NE2  1 1 
        1   330 1 1 21 HIS O    O   8.778 -21.151   2.920 1.00 . A A . 18 HIS O    1 1 
        1   331 1 1 22 VAL C    C   9.262 -18.131   3.471 1.00 . A A . 19 VAL C    1 1 
        1   332 1 1 22 VAL CA   C   8.338 -18.500   2.226 1.00 . A A . 19 VAL CA   1 1 
        1   333 1 1 22 VAL CB   C   7.636 -17.240   1.487 1.00 . A A . 19 VAL CB   1 1 
        1   334 1 1 22 VAL CG1  C   6.639 -17.702   0.417 1.00 . A A . 19 VAL CG1  1 1 
        1   335 1 1 22 VAL CG2  C   6.909 -16.273   2.442 1.00 . A A . 19 VAL CG2  1 1 
        1   336 1 1 22 VAL H    H   6.392 -19.143   2.804 1.00 . A A . 19 VAL H    1 1 
        1   337 1 1 22 VAL HA   H   8.932 -19.028   1.493 1.00 . A A . 19 VAL HA   1 1 
        1   338 1 1 22 VAL HB   H   8.379 -16.674   0.948 1.00 . A A . 19 VAL HB   1 1 
        1   339 1 1 22 VAL HG11 H   7.131 -18.322  -0.315 1.00 . A A . 19 VAL HG11 1 1 
        1   340 1 1 22 VAL HG12 H   6.220 -16.836  -0.076 1.00 . A A . 19 VAL HG12 1 1 
        1   341 1 1 22 VAL HG13 H   5.839 -18.255   0.884 1.00 . A A . 19 VAL HG13 1 1 
        1   342 1 1 22 VAL HG21 H   6.155 -16.814   2.996 1.00 . A A . 19 VAL HG21 1 1 
        1   343 1 1 22 VAL HG22 H   6.434 -15.482   1.874 1.00 . A A . 19 VAL HG22 1 1 
        1   344 1 1 22 VAL HG23 H   7.621 -15.837   3.128 1.00 . A A . 19 VAL HG23 1 1 
        1   345 1 1 22 VAL N    N   7.320 -19.439   2.702 1.00 . A A . 19 VAL N    1 1 
        1   346 1 1 22 VAL O    O   8.756 -17.628   4.488 1.00 . A A . 19 VAL O    1 1 
        1   347 1 1 23 SER C    C  11.986 -16.682   4.463 1.00 . A A . 20 SER C    1 1 
        1   348 1 1 23 SER CA   C  11.529 -18.156   4.551 1.00 . A A . 20 SER CA   1 1 
        1   349 1 1 23 SER CB   C  12.743 -19.134   4.459 1.00 . A A . 20 SER CB   1 1 
        1   350 1 1 23 SER H    H  10.944 -19.099   2.751 1.00 . A A . 20 SER H    1 1 
        1   351 1 1 23 SER HA   H  11.018 -18.316   5.482 1.00 . A A . 20 SER HA   1 1 
        1   352 1 1 23 SER HB2  H  13.611 -18.640   4.052 1.00 . A A . 20 SER HB2  1 1 
        1   353 1 1 23 SER HB3  H  12.980 -19.512   5.444 1.00 . A A . 20 SER HB3  1 1 
        1   354 1 1 23 SER HG   H  12.893 -20.166   2.795 1.00 . A A . 20 SER HG   1 1 
        1   355 1 1 23 SER N    N  10.596 -18.483   3.446 1.00 . A A . 20 SER N    1 1 
        1   356 1 1 23 SER O    O  11.933 -16.126   3.367 1.00 . A A . 20 SER O    1 1 
        1   357 1 1 23 SER OG   O  12.431 -20.251   3.637 1.00 . A A . 20 SER OG   1 1 
        1   358 1 1 24 SER C    C  13.687 -14.083   4.560 1.00 . A A . 21 SER C    1 1 
        1   359 1 1 24 SER CA   C  12.754 -14.603   5.669 1.00 . A A . 21 SER CA   1 1 
        1   360 1 1 24 SER CB   C  13.356 -14.255   7.025 1.00 . A A . 21 SER CB   1 1 
        1   361 1 1 24 SER H    H  12.440 -16.536   6.467 1.00 . A A . 21 SER H    1 1 
        1   362 1 1 24 SER HA   H  11.815 -14.077   5.589 1.00 . A A . 21 SER HA   1 1 
        1   363 1 1 24 SER HB2  H  14.184 -14.919   7.230 1.00 . A A . 21 SER HB2  1 1 
        1   364 1 1 24 SER HB3  H  13.710 -13.233   7.004 1.00 . A A . 21 SER HB3  1 1 
        1   365 1 1 24 SER HG   H  12.154 -13.521   8.375 1.00 . A A . 21 SER HG   1 1 
        1   366 1 1 24 SER N    N  12.419 -16.046   5.610 1.00 . A A . 21 SER N    1 1 
        1   367 1 1 24 SER O    O  13.430 -12.992   4.041 1.00 . A A . 21 SER O    1 1 
        1   368 1 1 24 SER OG   O  12.402 -14.393   8.059 1.00 . A A . 21 SER OG   1 1 
        1   369 1 1 25 ARG C    C  14.836 -14.209   1.704 1.00 . A A . 22 ARG C    1 1 
        1   370 1 1 25 ARG CA   C  15.632 -14.423   3.062 1.00 . A A . 22 ARG CA   1 1 
        1   371 1 1 25 ARG CB   C  16.904 -15.359   2.905 1.00 . A A . 22 ARG CB   1 1 
        1   372 1 1 25 ARG CD   C  16.918 -16.764   0.775 1.00 . A A . 22 ARG CD   1 1 
        1   373 1 1 25 ARG CG   C  17.478 -15.536   1.490 1.00 . A A . 22 ARG CG   1 1 
        1   374 1 1 25 ARG CZ   C  18.899 -17.756  -0.358 1.00 . A A . 22 ARG CZ   1 1 
        1   375 1 1 25 ARG H    H  15.031 -15.574   4.809 1.00 . A A . 22 ARG H    1 1 
        1   376 1 1 25 ARG HA   H  16.000 -13.454   3.359 1.00 . A A . 22 ARG HA   1 1 
        1   377 1 1 25 ARG HB2  H  17.691 -14.912   3.484 1.00 . A A . 22 ARG HB2  1 1 
        1   378 1 1 25 ARG HB3  H  16.726 -16.344   3.321 1.00 . A A . 22 ARG HB3  1 1 
        1   379 1 1 25 ARG HD2  H  16.117 -17.181   1.370 1.00 . A A . 22 ARG HD2  1 1 
        1   380 1 1 25 ARG HD3  H  16.531 -16.468  -0.188 1.00 . A A . 22 ARG HD3  1 1 
        1   381 1 1 25 ARG HE   H  17.898 -18.583   1.174 1.00 . A A . 22 ARG HE   1 1 
        1   382 1 1 25 ARG HG2  H  17.256 -14.662   0.900 1.00 . A A . 22 ARG HG2  1 1 
        1   383 1 1 25 ARG HG3  H  18.554 -15.646   1.567 1.00 . A A . 22 ARG HG3  1 1 
        1   384 1 1 25 ARG HH11 H  18.334 -15.964  -1.146 1.00 . A A . 22 ARG HH11 1 1 
        1   385 1 1 25 ARG HH12 H  19.710 -16.698  -1.903 1.00 . A A . 22 ARG HH12 1 1 
        1   386 1 1 25 ARG HH21 H  19.696 -19.544   0.176 1.00 . A A . 22 ARG HH21 1 1 
        1   387 1 1 25 ARG HH22 H  20.487 -18.747  -1.144 1.00 . A A . 22 ARG HH22 1 1 
        1   388 1 1 25 ARG N    N  14.765 -14.824   4.216 1.00 . A A . 22 ARG N    1 1 
        1   389 1 1 25 ARG NE   N  17.937 -17.801   0.579 1.00 . A A . 22 ARG NE   1 1 
        1   390 1 1 25 ARG NH1  N  18.990 -16.725  -1.207 1.00 . A A . 22 ARG NH1  1 1 
        1   391 1 1 25 ARG NH2  N  19.764 -18.762  -0.452 1.00 . A A . 22 ARG NH2  1 1 
        1   392 1 1 25 ARG O    O  14.996 -13.146   1.038 1.00 . A A . 22 ARG O    1 1 
        1   393 1 1 26 ASP C    C  12.105 -14.031   0.089 1.00 . A A . 23 ASP C    1 1 
        1   394 1 1 26 ASP CA   C  13.200 -15.099   0.063 1.00 . A A . 23 ASP CA   1 1 
        1   395 1 1 26 ASP CB   C  12.579 -16.461  -0.318 1.00 . A A . 23 ASP CB   1 1 
        1   396 1 1 26 ASP CG   C  13.590 -17.411  -0.920 1.00 . A A . 23 ASP CG   1 1 
        1   397 1 1 26 ASP H    H  13.772 -15.919   1.915 1.00 . A A . 23 ASP H    1 1 
        1   398 1 1 26 ASP HA   H  13.914 -14.835  -0.708 1.00 . A A . 23 ASP HA   1 1 
        1   399 1 1 26 ASP HB2  H  12.162 -16.933   0.549 1.00 . A A . 23 ASP HB2  1 1 
        1   400 1 1 26 ASP HB3  H  11.788 -16.301  -1.035 1.00 . A A . 23 ASP HB3  1 1 
        1   401 1 1 26 ASP N    N  13.944 -15.166   1.330 1.00 . A A . 23 ASP N    1 1 
        1   402 1 1 26 ASP O    O  11.866 -13.387  -0.944 1.00 . A A . 23 ASP O    1 1 
        1   403 1 1 26 ASP OD1  O  13.840 -17.325  -2.138 1.00 . A A . 23 ASP OD1  1 1 
        1   404 1 1 26 ASP OD2  O  14.138 -18.249  -0.168 1.00 . A A . 23 ASP OD2  1 1 
        1   405 1 1 27 VAL C    C  11.088 -11.401   1.341 1.00 . A A . 24 VAL C    1 1 
        1   406 1 1 27 VAL CA   C  10.433 -12.786   1.378 1.00 . A A . 24 VAL CA   1 1 
        1   407 1 1 27 VAL CB   C   9.409 -13.030   2.562 1.00 . A A . 24 VAL CB   1 1 
        1   408 1 1 27 VAL CG1  C  10.059 -13.471   3.830 1.00 . A A . 24 VAL CG1  1 1 
        1   409 1 1 27 VAL CG2  C   8.507 -11.857   2.900 1.00 . A A . 24 VAL CG2  1 1 
        1   410 1 1 27 VAL H    H  11.616 -14.398   2.030 1.00 . A A . 24 VAL H    1 1 
        1   411 1 1 27 VAL HA   H   9.867 -12.855   0.475 1.00 . A A . 24 VAL HA   1 1 
        1   412 1 1 27 VAL HB   H   8.767 -13.833   2.250 1.00 . A A . 24 VAL HB   1 1 
        1   413 1 1 27 VAL HG11 H   9.292 -13.714   4.549 1.00 . A A . 24 VAL HG11 1 1 
        1   414 1 1 27 VAL HG12 H  10.663 -12.672   4.215 1.00 . A A . 24 VAL HG12 1 1 
        1   415 1 1 27 VAL HG13 H  10.667 -14.340   3.632 1.00 . A A . 24 VAL HG13 1 1 
        1   416 1 1 27 VAL HG21 H   7.681 -12.226   3.488 1.00 . A A . 24 VAL HG21 1 1 
        1   417 1 1 27 VAL HG22 H   8.142 -11.389   2.008 1.00 . A A . 24 VAL HG22 1 1 
        1   418 1 1 27 VAL HG23 H   9.049 -11.139   3.489 1.00 . A A . 24 VAL HG23 1 1 
        1   419 1 1 27 VAL N    N  11.435 -13.831   1.255 1.00 . A A . 24 VAL N    1 1 
        1   420 1 1 27 VAL O    O  10.603 -10.559   0.616 1.00 . A A . 24 VAL O    1 1 
        1   421 1 1 28 GLU C    C  13.315  -9.755   0.267 1.00 . A A . 25 GLU C    1 1 
        1   422 1 1 28 GLU CA   C  13.029  -9.940   1.775 1.00 . A A . 25 GLU CA   1 1 
        1   423 1 1 28 GLU CB   C  14.399  -9.877   2.523 1.00 . A A . 25 GLU CB   1 1 
        1   424 1 1 28 GLU CD   C  16.181  -8.289   3.380 1.00 . A A . 25 GLU CD   1 1 
        1   425 1 1 28 GLU CG   C  15.182  -8.565   2.286 1.00 . A A . 25 GLU CG   1 1 
        1   426 1 1 28 GLU H    H  12.381 -11.733   2.821 1.00 . A A . 25 GLU H    1 1 
        1   427 1 1 28 GLU HA   H  12.432  -9.094   2.095 1.00 . A A . 25 GLU HA   1 1 
        1   428 1 1 28 GLU HB2  H  14.263  -9.983   3.589 1.00 . A A . 25 GLU HB2  1 1 
        1   429 1 1 28 GLU HB3  H  15.014 -10.690   2.171 1.00 . A A . 25 GLU HB3  1 1 
        1   430 1 1 28 GLU HG2  H  15.725  -8.626   1.349 1.00 . A A . 25 GLU HG2  1 1 
        1   431 1 1 28 GLU HG3  H  14.497  -7.739   2.235 1.00 . A A . 25 GLU HG3  1 1 
        1   432 1 1 28 GLU N    N  12.209 -11.174   2.051 1.00 . A A . 25 GLU N    1 1 
        1   433 1 1 28 GLU O    O  12.797  -8.802  -0.275 1.00 . A A . 25 GLU O    1 1 
        1   434 1 1 28 GLU OE1  O  17.276  -8.878   3.336 1.00 . A A . 25 GLU OE1  1 1 
        1   435 1 1 28 GLU OE2  O  15.876  -7.475   4.276 1.00 . A A . 25 GLU OE2  1 1 
        1   436 1 1 29 ASN C    C  13.149 -10.343  -2.886 1.00 . A A . 26 ASN C    1 1 
        1   437 1 1 29 ASN CA   C  14.377 -10.380  -1.871 1.00 . A A . 26 ASN CA   1 1 
        1   438 1 1 29 ASN CB   C  15.488 -11.362  -2.404 1.00 . A A . 26 ASN CB   1 1 
        1   439 1 1 29 ASN CG   C  15.980 -10.987  -3.789 1.00 . A A . 26 ASN CG   1 1 
        1   440 1 1 29 ASN H    H  14.311 -11.478  -0.003 1.00 . A A . 26 ASN H    1 1 
        1   441 1 1 29 ASN HA   H  14.815  -9.403  -1.849 1.00 . A A . 26 ASN HA   1 1 
        1   442 1 1 29 ASN HB2  H  16.369 -11.351  -1.747 1.00 . A A . 26 ASN HB2  1 1 
        1   443 1 1 29 ASN HB3  H  15.094 -12.373  -2.461 1.00 . A A . 26 ASN HB3  1 1 
        1   444 1 1 29 ASN HD21 H  17.372  -9.801  -2.984 1.00 . A A . 26 ASN HD21 1 1 
        1   445 1 1 29 ASN HD22 H  17.351  -9.865  -4.712 1.00 . A A . 26 ASN HD22 1 1 
        1   446 1 1 29 ASN N    N  13.997 -10.686  -0.443 1.00 . A A . 26 ASN N    1 1 
        1   447 1 1 29 ASN ND2  N  17.002 -10.130  -3.835 1.00 . A A . 26 ASN ND2  1 1 
        1   448 1 1 29 ASN O    O  12.768  -9.225  -3.437 1.00 . A A . 26 ASN O    1 1 
        1   449 1 1 29 ASN OD1  O  15.461 -11.465  -4.799 1.00 . A A . 26 ASN OD1  1 1 
        1   450 1 1 30 GLU C    C  10.111 -10.695  -3.504 1.00 . A A . 27 GLU C    1 1 
        1   451 1 1 30 GLU CA   C  11.311 -11.520  -3.990 1.00 . A A . 27 GLU CA   1 1 
        1   452 1 1 30 GLU CB   C  10.904 -12.967  -4.426 1.00 . A A . 27 GLU CB   1 1 
        1   453 1 1 30 GLU CD   C  10.343 -14.135  -6.635 1.00 . A A . 27 GLU CD   1 1 
        1   454 1 1 30 GLU CG   C   9.939 -13.058  -5.649 1.00 . A A . 27 GLU CG   1 1 
        1   455 1 1 30 GLU H    H  12.714 -12.341  -2.629 1.00 . A A . 27 GLU H    1 1 
        1   456 1 1 30 GLU HA   H  11.689 -11.011  -4.866 1.00 . A A . 27 GLU HA   1 1 
        1   457 1 1 30 GLU HB2  H  11.798 -13.506  -4.682 1.00 . A A . 27 GLU HB2  1 1 
        1   458 1 1 30 GLU HB3  H  10.426 -13.463  -3.597 1.00 . A A . 27 GLU HB3  1 1 
        1   459 1 1 30 GLU HG2  H   8.945 -13.301  -5.302 1.00 . A A . 27 GLU HG2  1 1 
        1   460 1 1 30 GLU HG3  H   9.910 -12.116  -6.181 1.00 . A A . 27 GLU HG3  1 1 
        1   461 1 1 30 GLU N    N  12.427 -11.494  -3.051 1.00 . A A . 27 GLU N    1 1 
        1   462 1 1 30 GLU O    O   9.493 -10.054  -4.350 1.00 . A A . 27 GLU O    1 1 
        1   463 1 1 30 GLU OE1  O  11.230 -13.869  -7.473 1.00 . A A . 27 GLU OE1  1 1 
        1   464 1 1 30 GLU OE2  O   9.763 -15.244  -6.578 1.00 . A A . 27 GLU OE2  1 1 
        1   465 1 1 31 PHE C    C   9.028  -8.243  -1.861 1.00 . A A . 28 PHE C    1 1 
        1   466 1 1 31 PHE CA   C   8.656  -9.747  -1.837 1.00 . A A . 28 PHE CA   1 1 
        1   467 1 1 31 PHE CB   C   7.968 -10.123  -0.520 1.00 . A A . 28 PHE CB   1 1 
        1   468 1 1 31 PHE CD1  C   5.472 -10.060  -0.766 1.00 . A A . 28 PHE CD1  1 1 
        1   469 1 1 31 PHE CD2  C   6.521 -12.212  -0.658 1.00 . A A . 28 PHE CD2  1 1 
        1   470 1 1 31 PHE CE1  C   4.236 -10.664  -0.873 1.00 . A A . 28 PHE CE1  1 1 
        1   471 1 1 31 PHE CE2  C   5.273 -12.820  -0.775 1.00 . A A . 28 PHE CE2  1 1 
        1   472 1 1 31 PHE CG   C   6.632 -10.818  -0.668 1.00 . A A . 28 PHE CG   1 1 
        1   473 1 1 31 PHE CZ   C   4.136 -12.044  -0.870 1.00 . A A . 28 PHE CZ   1 1 
        1   474 1 1 31 PHE H    H  10.294 -11.070  -1.460 1.00 . A A . 28 PHE H    1 1 
        1   475 1 1 31 PHE HA   H   7.953  -9.924  -2.630 1.00 . A A . 28 PHE HA   1 1 
        1   476 1 1 31 PHE HB2  H   8.619 -10.785   0.030 1.00 . A A . 28 PHE HB2  1 1 
        1   477 1 1 31 PHE HB3  H   7.811  -9.222   0.060 1.00 . A A . 28 PHE HB3  1 1 
        1   478 1 1 31 PHE HD1  H   5.541  -8.979  -0.778 1.00 . A A . 28 PHE HD1  1 1 
        1   479 1 1 31 PHE HD2  H   7.420 -12.826  -0.576 1.00 . A A . 28 PHE HD2  1 1 
        1   480 1 1 31 PHE HE1  H   3.343 -10.059  -0.952 1.00 . A A . 28 PHE HE1  1 1 
        1   481 1 1 31 PHE HE2  H   5.193 -13.903  -0.787 1.00 . A A . 28 PHE HE2  1 1 
        1   482 1 1 31 PHE HZ   H   3.167 -12.515  -0.952 1.00 . A A . 28 PHE HZ   1 1 
        1   483 1 1 31 PHE N    N   9.787 -10.602  -2.182 1.00 . A A . 28 PHE N    1 1 
        1   484 1 1 31 PHE O    O   8.168  -7.427  -2.214 1.00 . A A . 28 PHE O    1 1 
        1   485 1 1 32 ARG C    C  10.715  -6.046  -3.239 1.00 . A A . 29 ARG C    1 1 
        1   486 1 1 32 ARG CA   C  10.786  -6.471  -1.747 1.00 . A A . 29 ARG CA   1 1 
        1   487 1 1 32 ARG CB   C  12.222  -6.099  -1.232 1.00 . A A . 29 ARG CB   1 1 
        1   488 1 1 32 ARG CD   C  14.506  -5.274  -2.011 1.00 . A A . 29 ARG CD   1 1 
        1   489 1 1 32 ARG CG   C  13.335  -6.191  -2.293 1.00 . A A . 29 ARG CG   1 1 
        1   490 1 1 32 ARG CZ   C  15.051  -4.353  -4.242 1.00 . A A . 29 ARG CZ   1 1 
        1   491 1 1 32 ARG H    H  10.759  -8.439  -0.795 1.00 . A A . 29 ARG H    1 1 
        1   492 1 1 32 ARG HA   H  10.104  -5.819  -1.226 1.00 . A A . 29 ARG HA   1 1 
        1   493 1 1 32 ARG HB2  H  12.197  -5.083  -0.865 1.00 . A A . 29 ARG HB2  1 1 
        1   494 1 1 32 ARG HB3  H  12.496  -6.746  -0.395 1.00 . A A . 29 ARG HB3  1 1 
        1   495 1 1 32 ARG HD2  H  14.138  -4.294  -1.729 1.00 . A A . 29 ARG HD2  1 1 
        1   496 1 1 32 ARG HD3  H  15.105  -5.683  -1.212 1.00 . A A . 29 ARG HD3  1 1 
        1   497 1 1 32 ARG HE   H  16.150  -5.695  -3.230 1.00 . A A . 29 ARG HE   1 1 
        1   498 1 1 32 ARG HG2  H  13.703  -7.198  -2.361 1.00 . A A . 29 ARG HG2  1 1 
        1   499 1 1 32 ARG HG3  H  12.908  -5.897  -3.250 1.00 . A A . 29 ARG HG3  1 1 
        1   500 1 1 32 ARG HH11 H  13.333  -3.582  -3.477 1.00 . A A . 29 ARG HH11 1 1 
        1   501 1 1 32 ARG HH12 H  13.777  -2.993  -5.044 1.00 . A A . 29 ARG HH12 1 1 
        1   502 1 1 32 ARG HH21 H  16.644  -4.967  -5.317 1.00 . A A . 29 ARG HH21 1 1 
        1   503 1 1 32 ARG HH22 H  15.650  -3.779  -6.085 1.00 . A A . 29 ARG HH22 1 1 
        1   504 1 1 32 ARG N    N  10.283  -7.862  -1.447 1.00 . A A . 29 ARG N    1 1 
        1   505 1 1 32 ARG NE   N  15.329  -5.150  -3.205 1.00 . A A . 29 ARG NE   1 1 
        1   506 1 1 32 ARG NH1  N  13.965  -3.580  -4.256 1.00 . A A . 29 ARG NH1  1 1 
        1   507 1 1 32 ARG NH2  N  15.842  -4.369  -5.294 1.00 . A A . 29 ARG NH2  1 1 
        1   508 1 1 32 ARG O    O  10.668  -4.821  -3.453 1.00 . A A . 29 ARG O    1 1 
        1   509 1 1 33 LYS C    C   8.996  -5.746  -5.629 1.00 . A A . 30 LYS C    1 1 
        1   510 1 1 33 LYS CA   C  10.403  -6.381  -5.655 1.00 . A A . 30 LYS CA   1 1 
        1   511 1 1 33 LYS CB   C  10.551  -7.417  -6.860 1.00 . A A . 30 LYS CB   1 1 
        1   512 1 1 33 LYS CD   C   8.865  -6.471  -8.652 1.00 . A A . 30 LYS CD   1 1 
        1   513 1 1 33 LYS CE   C   7.346  -6.505  -8.918 1.00 . A A . 30 LYS CE   1 1 
        1   514 1 1 33 LYS CG   C   9.331  -7.685  -7.838 1.00 . A A . 30 LYS CG   1 1 
        1   515 1 1 33 LYS H    H  11.237  -7.849  -4.198 1.00 . A A . 30 LYS H    1 1 
        1   516 1 1 33 LYS HA   H  11.089  -5.563  -5.826 1.00 . A A . 30 LYS HA   1 1 
        1   517 1 1 33 LYS HB2  H  11.371  -7.078  -7.482 1.00 . A A . 30 LYS HB2  1 1 
        1   518 1 1 33 LYS HB3  H  10.848  -8.371  -6.433 1.00 . A A . 30 LYS HB3  1 1 
        1   519 1 1 33 LYS HD2  H   9.102  -5.560  -8.098 1.00 . A A . 30 LYS HD2  1 1 
        1   520 1 1 33 LYS HD3  H   9.384  -6.471  -9.610 1.00 . A A . 30 LYS HD3  1 1 
        1   521 1 1 33 LYS HE2  H   6.815  -6.752  -7.986 1.00 . A A . 30 LYS HE2  1 1 
        1   522 1 1 33 LYS HE3  H   7.029  -5.523  -9.226 1.00 . A A . 30 LYS HE3  1 1 
        1   523 1 1 33 LYS HG2  H   9.643  -8.441  -8.538 1.00 . A A . 30 LYS HG2  1 1 
        1   524 1 1 33 LYS HG3  H   8.500  -8.060  -7.271 1.00 . A A . 30 LYS HG3  1 1 
        1   525 1 1 33 LYS HZ1  H   7.398  -7.233 -10.907 1.00 . A A . 30 LYS HZ1  1 1 
        1   526 1 1 33 LYS HZ2  H   5.943  -7.534 -10.088 1.00 . A A . 30 LYS HZ2  1 1 
        1   527 1 1 33 LYS HZ3  H   7.309  -8.450  -9.730 1.00 . A A . 30 LYS HZ3  1 1 
        1   528 1 1 33 LYS N    N  10.791  -6.943  -4.295 1.00 . A A . 30 LYS N    1 1 
        1   529 1 1 33 LYS NZ   N   6.971  -7.498  -9.982 1.00 . A A . 30 LYS NZ   1 1 
        1   530 1 1 33 LYS O    O   8.843  -4.580  -6.034 1.00 . A A . 30 LYS O    1 1 
        1   531 1 1 34 TYR C    C   6.231  -4.806  -4.419 1.00 . A A . 31 TYR C    1 1 
        1   532 1 1 34 TYR CA   C   6.634  -6.048  -5.261 1.00 . A A . 31 TYR CA   1 1 
        1   533 1 1 34 TYR CB   C   5.712  -7.255  -5.007 1.00 . A A . 31 TYR CB   1 1 
        1   534 1 1 34 TYR CD1  C   5.210  -8.633  -7.145 1.00 . A A . 31 TYR CD1  1 1 
        1   535 1 1 34 TYR CD2  C   6.706  -9.563  -5.540 1.00 . A A . 31 TYR CD2  1 1 
        1   536 1 1 34 TYR CE1  C   5.354  -9.784  -7.933 1.00 . A A . 31 TYR CE1  1 1 
        1   537 1 1 34 TYR CE2  C   6.849 -10.699  -6.319 1.00 . A A . 31 TYR CE2  1 1 
        1   538 1 1 34 TYR CG   C   5.895  -8.499  -5.922 1.00 . A A . 31 TYR CG   1 1 
        1   539 1 1 34 TYR CZ   C   6.175 -10.798  -7.506 1.00 . A A . 31 TYR CZ   1 1 
        1   540 1 1 34 TYR H    H   8.251  -7.190  -4.505 1.00 . A A . 31 TYR H    1 1 
        1   541 1 1 34 TYR HA   H   6.536  -5.764  -6.295 1.00 . A A . 31 TYR HA   1 1 
        1   542 1 1 34 TYR HB2  H   5.866  -7.577  -3.993 1.00 . A A . 31 TYR HB2  1 1 
        1   543 1 1 34 TYR HB3  H   4.692  -6.926  -5.124 1.00 . A A . 31 TYR HB3  1 1 
        1   544 1 1 34 TYR HD1  H   4.575  -7.833  -7.487 1.00 . A A . 31 TYR HD1  1 1 
        1   545 1 1 34 TYR HD2  H   7.239  -9.494  -4.621 1.00 . A A . 31 TYR HD2  1 1 
        1   546 1 1 34 TYR HE1  H   4.808  -9.893  -8.878 1.00 . A A . 31 TYR HE1  1 1 
        1   547 1 1 34 TYR HE2  H   7.487 -11.522  -5.987 1.00 . A A . 31 TYR HE2  1 1 
        1   548 1 1 34 TYR HH   H   5.924 -12.673  -7.823 1.00 . A A . 31 TYR HH   1 1 
        1   549 1 1 34 TYR N    N   8.026  -6.428  -5.064 1.00 . A A . 31 TYR N    1 1 
        1   550 1 1 34 TYR O    O   5.517  -3.958  -4.940 1.00 . A A . 31 TYR O    1 1 
        1   551 1 1 34 TYR OH   O   6.326 -11.919  -8.275 1.00 . A A . 31 TYR OH   1 1 
        1   552 1 1 35 GLY C    C   7.647  -3.110  -1.477 1.00 . A A . 32 GLY C    1 1 
        1   553 1 1 35 GLY CA   C   6.505  -3.398  -2.430 1.00 . A A . 32 GLY CA   1 1 
        1   554 1 1 35 GLY H    H   7.177  -5.390  -2.708 1.00 . A A . 32 GLY H    1 1 
        1   555 1 1 35 GLY HA2  H   6.448  -2.605  -3.153 1.00 . A A . 32 GLY HA2  1 1 
        1   556 1 1 35 GLY HA3  H   5.575  -3.440  -1.877 1.00 . A A . 32 GLY HA3  1 1 
        1   557 1 1 35 GLY N    N   6.714  -4.654  -3.160 1.00 . A A . 32 GLY N    1 1 
        1   558 1 1 35 GLY O    O   8.597  -3.894  -1.417 1.00 . A A . 32 GLY O    1 1 
        1   559 1 1 36 ASN C    C   8.692  -2.075   1.498 1.00 . A A . 33 ASN C    1 1 
        1   560 1 1 36 ASN CA   C   8.732  -1.559   0.047 1.00 . A A . 33 ASN CA   1 1 
        1   561 1 1 36 ASN CB   C   8.902  -0.009   0.015 1.00 . A A . 33 ASN CB   1 1 
        1   562 1 1 36 ASN CG   C  10.347   0.411  -0.162 1.00 . A A . 33 ASN CG   1 1 
        1   563 1 1 36 ASN H    H   6.652  -1.637  -0.483 1.00 . A A . 33 ASN H    1 1 
        1   564 1 1 36 ASN HA   H   9.583  -1.997  -0.450 1.00 . A A . 33 ASN HA   1 1 
        1   565 1 1 36 ASN HB2  H   8.339   0.438  -0.794 1.00 . A A . 33 ASN HB2  1 1 
        1   566 1 1 36 ASN HB3  H   8.557   0.396   0.951 1.00 . A A . 33 ASN HB3  1 1 
        1   567 1 1 36 ASN HD21 H   9.949   2.113   0.775 1.00 . A A . 33 ASN HD21 1 1 
        1   568 1 1 36 ASN HD22 H  11.575   1.914   0.203 1.00 . A A . 33 ASN HD22 1 1 
        1   569 1 1 36 ASN N    N   7.542  -2.036  -0.673 1.00 . A A . 33 ASN N    1 1 
        1   570 1 1 36 ASN ND2  N  10.665   1.592   0.326 1.00 . A A . 33 ASN ND2  1 1 
        1   571 1 1 36 ASN O    O   7.949  -1.539   2.332 1.00 . A A . 33 ASN O    1 1 
        1   572 1 1 36 ASN OD1  O  11.161  -0.301  -0.754 1.00 . A A . 33 ASN OD1  1 1 
        1   573 1 1 37 ILE C    C  10.337  -2.967   4.141 1.00 . A A . 34 ILE C    1 1 
        1   574 1 1 37 ILE CA   C   9.480  -3.778   3.118 1.00 . A A . 34 ILE CA   1 1 
        1   575 1 1 37 ILE CB   C   9.890  -5.315   3.072 1.00 . A A . 34 ILE CB   1 1 
        1   576 1 1 37 ILE CD1  C  12.062  -5.876   4.480 1.00 . A A . 34 ILE CD1  1 1 
        1   577 1 1 37 ILE CG1  C  10.520  -5.841   4.403 1.00 . A A . 34 ILE CG1  1 1 
        1   578 1 1 37 ILE CG2  C  10.765  -5.649   1.872 1.00 . A A . 34 ILE CG2  1 1 
        1   579 1 1 37 ILE H    H   9.890  -3.617   1.009 1.00 . A A . 34 ILE H    1 1 
        1   580 1 1 37 ILE HA   H   8.477  -3.758   3.460 1.00 . A A . 34 ILE HA   1 1 
        1   581 1 1 37 ILE HB   H   8.966  -5.862   2.923 1.00 . A A . 34 ILE HB   1 1 
        1   582 1 1 37 ILE HD11 H  12.417  -6.756   3.980 1.00 . A A . 34 ILE HD11 1 1 
        1   583 1 1 37 ILE HD12 H  12.375  -5.894   5.501 1.00 . A A . 34 ILE HD12 1 1 
        1   584 1 1 37 ILE HD13 H  12.473  -5.004   4.003 1.00 . A A . 34 ILE HD13 1 1 
        1   585 1 1 37 ILE HG12 H  10.179  -5.209   5.214 1.00 . A A . 34 ILE HG12 1 1 
        1   586 1 1 37 ILE HG13 H  10.157  -6.844   4.577 1.00 . A A . 34 ILE HG13 1 1 
        1   587 1 1 37 ILE HG21 H  11.117  -6.666   1.955 1.00 . A A . 34 ILE HG21 1 1 
        1   588 1 1 37 ILE HG22 H  11.607  -4.975   1.834 1.00 . A A . 34 ILE HG22 1 1 
        1   589 1 1 37 ILE HG23 H  10.186  -5.550   0.964 1.00 . A A . 34 ILE HG23 1 1 
        1   590 1 1 37 ILE N    N   9.428  -3.168   1.764 1.00 . A A . 34 ILE N    1 1 
        1   591 1 1 37 ILE O    O  11.436  -2.508   3.815 1.00 . A A . 34 ILE O    1 1 
        1   592 1 1 38 LEU C    C  10.986  -3.263   7.527 1.00 . A A . 35 LEU C    1 1 
        1   593 1 1 38 LEU CA   C  10.594  -2.167   6.486 1.00 . A A . 35 LEU CA   1 1 
        1   594 1 1 38 LEU CB   C   9.897  -0.922   7.170 1.00 . A A . 35 LEU CB   1 1 
        1   595 1 1 38 LEU CD1  C   7.726   0.419   7.047 1.00 . A A . 35 LEU CD1  1 1 
        1   596 1 1 38 LEU CD2  C   9.668   1.225   5.744 1.00 . A A . 35 LEU CD2  1 1 
        1   597 1 1 38 LEU CG   C   8.964  -0.040   6.273 1.00 . A A . 35 LEU CG   1 1 
        1   598 1 1 38 LEU H    H   8.907  -3.087   5.565 1.00 . A A . 35 LEU H    1 1 
        1   599 1 1 38 LEU HA   H  11.524  -1.834   6.041 1.00 . A A . 35 LEU HA   1 1 
        1   600 1 1 38 LEU HB2  H   9.339  -1.243   8.045 1.00 . A A . 35 LEU HB2  1 1 
        1   601 1 1 38 LEU HB3  H  10.692  -0.279   7.527 1.00 . A A . 35 LEU HB3  1 1 
        1   602 1 1 38 LEU HD11 H   7.198  -0.433   7.438 1.00 . A A . 35 LEU HD11 1 1 
        1   603 1 1 38 LEU HD12 H   7.074   0.968   6.386 1.00 . A A . 35 LEU HD12 1 1 
        1   604 1 1 38 LEU HD13 H   8.027   1.059   7.865 1.00 . A A . 35 LEU HD13 1 1 
        1   605 1 1 38 LEU HD21 H  10.173   1.725   6.558 1.00 . A A . 35 LEU HD21 1 1 
        1   606 1 1 38 LEU HD22 H   8.928   1.898   5.332 1.00 . A A . 35 LEU HD22 1 1 
        1   607 1 1 38 LEU HD23 H  10.383   0.979   4.972 1.00 . A A . 35 LEU HD23 1 1 
        1   608 1 1 38 LEU HG   H   8.634  -0.619   5.423 1.00 . A A . 35 LEU HG   1 1 
        1   609 1 1 38 LEU N    N   9.803  -2.770   5.384 1.00 . A A . 35 LEU N    1 1 
        1   610 1 1 38 LEU O    O  12.000  -3.128   8.219 1.00 . A A . 35 LEU O    1 1 
        1   611 1 1 39 LYS C    C   9.792  -6.806   7.793 1.00 . A A . 36 LYS C    1 1 
        1   612 1 1 39 LYS CA   C  10.541  -5.584   8.378 1.00 . A A . 36 LYS CA   1 1 
        1   613 1 1 39 LYS CB   C  10.272  -5.512   9.911 1.00 . A A . 36 LYS CB   1 1 
        1   614 1 1 39 LYS CD   C   8.677  -6.365  11.667 1.00 . A A . 36 LYS CD   1 1 
        1   615 1 1 39 LYS CE   C   7.232  -6.706  12.009 1.00 . A A . 36 LYS CE   1 1 
        1   616 1 1 39 LYS CG   C   8.807  -5.609  10.345 1.00 . A A . 36 LYS CG   1 1 
        1   617 1 1 39 LYS H    H   9.330  -4.329   7.152 1.00 . A A . 36 LYS H    1 1 
        1   618 1 1 39 LYS HA   H  11.599  -5.733   8.226 1.00 . A A . 36 LYS HA   1 1 
        1   619 1 1 39 LYS HB2  H  10.805  -6.322  10.388 1.00 . A A . 36 LYS HB2  1 1 
        1   620 1 1 39 LYS HB3  H  10.667  -4.588  10.289 1.00 . A A . 36 LYS HB3  1 1 
        1   621 1 1 39 LYS HD2  H   9.241  -7.279  11.598 1.00 . A A . 36 LYS HD2  1 1 
        1   622 1 1 39 LYS HD3  H   9.083  -5.759  12.457 1.00 . A A . 36 LYS HD3  1 1 
        1   623 1 1 39 LYS HE2  H   6.764  -7.156  11.149 1.00 . A A . 36 LYS HE2  1 1 
        1   624 1 1 39 LYS HE3  H   7.229  -7.410  12.829 1.00 . A A . 36 LYS HE3  1 1 
        1   625 1 1 39 LYS HG2  H   8.416  -4.608  10.472 1.00 . A A . 36 LYS HG2  1 1 
        1   626 1 1 39 LYS HG3  H   8.238  -6.121   9.584 1.00 . A A . 36 LYS HG3  1 1 
        1   627 1 1 39 LYS HZ1  H   6.446  -4.783  11.653 1.00 . A A . 36 LYS HZ1  1 1 
        1   628 1 1 39 LYS HZ2  H   6.857  -5.082  13.270 1.00 . A A . 36 LYS HZ2  1 1 
        1   629 1 1 39 LYS HZ3  H   5.469  -5.779  12.615 1.00 . A A . 36 LYS HZ3  1 1 
        1   630 1 1 39 LYS N    N  10.177  -4.349   7.623 1.00 . A A . 36 LYS N    1 1 
        1   631 1 1 39 LYS NZ   N   6.443  -5.510  12.412 1.00 . A A . 36 LYS NZ   1 1 
        1   632 1 1 39 LYS O    O   8.717  -6.646   7.202 1.00 . A A . 36 LYS O    1 1 
        1   633 1 1 40 CYS C    C   9.971 -10.309   8.608 1.00 . A A . 37 CYS C    1 1 
        1   634 1 1 40 CYS CA   C   9.712  -9.258   7.542 1.00 . A A . 37 CYS CA   1 1 
        1   635 1 1 40 CYS CB   C  10.255  -9.723   6.176 1.00 . A A . 37 CYS CB   1 1 
        1   636 1 1 40 CYS H    H  11.243  -8.110   8.403 1.00 . A A . 37 CYS H    1 1 
        1   637 1 1 40 CYS HA   H   8.643  -9.083   7.467 1.00 . A A . 37 CYS HA   1 1 
        1   638 1 1 40 CYS HB2  H  10.151 -10.796   6.111 1.00 . A A . 37 CYS HB2  1 1 
        1   639 1 1 40 CYS HB3  H   9.686  -9.259   5.381 1.00 . A A . 37 CYS HB3  1 1 
        1   640 1 1 40 CYS HG   H  12.560  -9.127   7.090 1.00 . A A . 37 CYS HG   1 1 
        1   641 1 1 40 CYS N    N  10.366  -8.024   7.954 1.00 . A A . 37 CYS N    1 1 
        1   642 1 1 40 CYS O    O  11.086 -10.827   8.730 1.00 . A A . 37 CYS O    1 1 
        1   643 1 1 40 CYS SG   S  12.008  -9.356   5.905 1.00 . A A . 37 CYS SG   1 1 
        1   644 1 1 41 ASP C    C   8.429 -12.915  10.367 1.00 . A A . 38 ASP C    1 1 
        1   645 1 1 41 ASP CA   C   9.175 -11.570  10.531 1.00 . A A . 38 ASP CA   1 1 
        1   646 1 1 41 ASP CB   C   8.827 -10.902  11.871 1.00 . A A . 38 ASP CB   1 1 
        1   647 1 1 41 ASP CG   C   9.334 -11.665  13.081 1.00 . A A . 38 ASP CG   1 1 
        1   648 1 1 41 ASP H    H   8.083 -10.110   9.283 1.00 . A A . 38 ASP H    1 1 
        1   649 1 1 41 ASP HA   H  10.247 -11.794  10.545 1.00 . A A . 38 ASP HA   1 1 
        1   650 1 1 41 ASP HB2  H   9.270  -9.913  11.881 1.00 . A A . 38 ASP HB2  1 1 
        1   651 1 1 41 ASP HB3  H   7.752 -10.822  11.968 1.00 . A A . 38 ASP HB3  1 1 
        1   652 1 1 41 ASP N    N   8.954 -10.607   9.403 1.00 . A A . 38 ASP N    1 1 
        1   653 1 1 41 ASP O    O   7.319 -12.966   9.841 1.00 . A A . 38 ASP O    1 1 
        1   654 1 1 41 ASP OD1  O  10.558 -11.909  13.167 1.00 . A A . 38 ASP OD1  1 1 
        1   655 1 1 41 ASP OD2  O   8.502 -12.023  13.939 1.00 . A A . 38 ASP OD2  1 1 
        1   656 1 1 42 VAL C    C   7.892 -15.643  12.242 1.00 . A A . 39 VAL C    1 1 
        1   657 1 1 42 VAL CA   C   8.480 -15.361  10.834 1.00 . A A . 39 VAL CA   1 1 
        1   658 1 1 42 VAL CB   C   9.531 -16.524  10.458 1.00 . A A . 39 VAL CB   1 1 
        1   659 1 1 42 VAL CG1  C   8.982 -17.950  10.657 1.00 . A A . 39 VAL CG1  1 1 
        1   660 1 1 42 VAL CG2  C  10.014 -16.425   9.015 1.00 . A A . 39 VAL CG2  1 1 
        1   661 1 1 42 VAL H    H   9.953 -13.877  11.210 1.00 . A A . 39 VAL H    1 1 
        1   662 1 1 42 VAL HA   H   7.689 -15.348  10.100 1.00 . A A . 39 VAL HA   1 1 
        1   663 1 1 42 VAL HB   H  10.397 -16.441  11.100 1.00 . A A . 39 VAL HB   1 1 
        1   664 1 1 42 VAL HG11 H   9.794 -18.653  10.517 1.00 . A A . 39 VAL HG11 1 1 
        1   665 1 1 42 VAL HG12 H   8.217 -18.162   9.924 1.00 . A A . 39 VAL HG12 1 1 
        1   666 1 1 42 VAL HG13 H   8.587 -18.062  11.657 1.00 . A A . 39 VAL HG13 1 1 
        1   667 1 1 42 VAL HG21 H  10.219 -15.394   8.758 1.00 . A A . 39 VAL HG21 1 1 
        1   668 1 1 42 VAL HG22 H   9.264 -16.832   8.356 1.00 . A A . 39 VAL HG22 1 1 
        1   669 1 1 42 VAL HG23 H  10.918 -17.005   8.907 1.00 . A A . 39 VAL HG23 1 1 
        1   670 1 1 42 VAL N    N   9.074 -14.006  10.827 1.00 . A A . 39 VAL N    1 1 
        1   671 1 1 42 VAL O    O   8.639 -15.727  13.218 1.00 . A A . 39 VAL O    1 1 
        1   672 1 1 43 LYS C    C   5.241 -17.544  13.442 1.00 . A A . 40 LYS C    1 1 
        1   673 1 1 43 LYS CA   C   5.916 -16.145  13.628 1.00 . A A . 40 LYS CA   1 1 
        1   674 1 1 43 LYS CB   C   4.897 -15.022  13.989 1.00 . A A . 40 LYS CB   1 1 
        1   675 1 1 43 LYS CD   C   5.112 -12.490  13.698 1.00 . A A . 40 LYS CD   1 1 
        1   676 1 1 43 LYS CE   C   3.768 -11.911  14.117 1.00 . A A . 40 LYS CE   1 1 
        1   677 1 1 43 LYS CG   C   5.540 -13.729  14.524 1.00 . A A . 40 LYS CG   1 1 
        1   678 1 1 43 LYS H    H   5.986 -15.604  11.566 1.00 . A A . 40 LYS H    1 1 
        1   679 1 1 43 LYS HA   H   6.691 -16.188  14.387 1.00 . A A . 40 LYS HA   1 1 
        1   680 1 1 43 LYS HB2  H   4.348 -14.784  13.089 1.00 . A A . 40 LYS HB2  1 1 
        1   681 1 1 43 LYS HB3  H   4.202 -15.364  14.732 1.00 . A A . 40 LYS HB3  1 1 
        1   682 1 1 43 LYS HD2  H   5.852 -11.703  13.815 1.00 . A A . 40 LYS HD2  1 1 
        1   683 1 1 43 LYS HD3  H   5.051 -12.767  12.662 1.00 . A A . 40 LYS HD3  1 1 
        1   684 1 1 43 LYS HE2  H   3.346 -11.370  13.277 1.00 . A A . 40 LYS HE2  1 1 
        1   685 1 1 43 LYS HE3  H   3.096 -12.709  14.401 1.00 . A A . 40 LYS HE3  1 1 
        1   686 1 1 43 LYS HG2  H   5.223 -13.596  15.553 1.00 . A A . 40 LYS HG2  1 1 
        1   687 1 1 43 LYS HG3  H   6.628 -13.836  14.506 1.00 . A A . 40 LYS HG3  1 1 
        1   688 1 1 43 LYS HZ1  H   4.443 -10.120  14.944 1.00 . A A . 40 LYS HZ1  1 1 
        1   689 1 1 43 LYS HZ2  H   4.466 -11.417  16.020 1.00 . A A . 40 LYS HZ2  1 1 
        1   690 1 1 43 LYS HZ3  H   2.998 -10.686  15.613 1.00 . A A . 40 LYS HZ3  1 1 
        1   691 1 1 43 LYS N    N   6.560 -15.778  12.353 1.00 . A A . 40 LYS N    1 1 
        1   692 1 1 43 LYS NZ   N   3.926 -10.968  15.252 1.00 . A A . 40 LYS NZ   1 1 
        1   693 1 1 43 LYS O    O   4.531 -17.720  12.454 1.00 . A A . 40 LYS O    1 1 
        1   694 1 1 44 LYS C    C   4.049 -20.440  15.179 1.00 . A A . 41 LYS C    1 1 
        1   695 1 1 44 LYS CA   C   4.935 -19.920  14.000 1.00 . A A . 41 LYS CA   1 1 
        1   696 1 1 44 LYS CB   C   6.140 -20.902  13.576 1.00 . A A . 41 LYS CB   1 1 
        1   697 1 1 44 LYS CD   C   7.356 -20.949  15.845 1.00 . A A . 41 LYS CD   1 1 
        1   698 1 1 44 LYS CE   C   8.364 -19.878  15.424 1.00 . A A . 41 LYS CE   1 1 
        1   699 1 1 44 LYS CG   C   6.807 -21.760  14.675 1.00 . A A . 41 LYS CG   1 1 
        1   700 1 1 44 LYS H    H   5.772 -18.387  15.271 1.00 . A A . 41 LYS H    1 1 
        1   701 1 1 44 LYS HA   H   4.299 -19.773  13.146 1.00 . A A . 41 LYS HA   1 1 
        1   702 1 1 44 LYS HB2  H   5.784 -21.586  12.823 1.00 . A A . 41 LYS HB2  1 1 
        1   703 1 1 44 LYS HB3  H   6.941 -20.318  13.117 1.00 . A A . 41 LYS HB3  1 1 
        1   704 1 1 44 LYS HD2  H   6.513 -20.459  16.315 1.00 . A A . 41 LYS HD2  1 1 
        1   705 1 1 44 LYS HD3  H   7.820 -21.619  16.545 1.00 . A A . 41 LYS HD3  1 1 
        1   706 1 1 44 LYS HE2  H   8.827 -20.176  14.501 1.00 . A A . 41 LYS HE2  1 1 
        1   707 1 1 44 LYS HE3  H   7.823 -18.942  15.269 1.00 . A A . 41 LYS HE3  1 1 
        1   708 1 1 44 LYS HG2  H   6.076 -22.462  15.060 1.00 . A A . 41 LYS HG2  1 1 
        1   709 1 1 44 LYS HG3  H   7.623 -22.322  14.233 1.00 . A A . 41 LYS HG3  1 1 
        1   710 1 1 44 LYS HZ1  H  10.088 -18.949  16.120 1.00 . A A . 41 LYS HZ1  1 1 
        1   711 1 1 44 LYS HZ2  H   9.914 -20.550  16.636 1.00 . A A . 41 LYS HZ2  1 1 
        1   712 1 1 44 LYS HZ3  H   8.982 -19.327  17.342 1.00 . A A . 41 LYS HZ3  1 1 
        1   713 1 1 44 LYS N    N   5.421 -18.558  14.345 1.00 . A A . 41 LYS N    1 1 
        1   714 1 1 44 LYS NZ   N   9.409 -19.660  16.453 1.00 . A A . 41 LYS NZ   1 1 
        1   715 1 1 44 LYS O    O   4.351 -20.105  16.329 1.00 . A A . 41 LYS O    1 1 
        1   716 1 1 45 THR C    C   2.361 -23.117  16.419 1.00 . A A . 42 THR C    1 1 
        1   717 1 1 45 THR CA   C   2.102 -21.614  16.068 1.00 . A A . 42 THR CA   1 1 
        1   718 1 1 45 THR CB   C   0.578 -21.340  15.837 1.00 . A A . 42 THR CB   1 1 
        1   719 1 1 45 THR CG2  C  -0.047 -22.277  14.802 1.00 . A A . 42 THR CG2  1 1 
        1   720 1 1 45 THR H    H   2.631 -21.381  14.027 1.00 . A A . 42 THR H    1 1 
        1   721 1 1 45 THR HA   H   2.429 -21.001  16.905 1.00 . A A . 42 THR HA   1 1 
        1   722 1 1 45 THR HB   H   0.465 -20.330  15.490 1.00 . A A . 42 THR HB   1 1 
        1   723 1 1 45 THR HG1  H  -1.051 -21.746  16.877 1.00 . A A . 42 THR HG1  1 1 
        1   724 1 1 45 THR HG21 H   0.294 -23.284  14.973 1.00 . A A . 42 THR HG21 1 1 
        1   725 1 1 45 THR HG22 H   0.220 -21.973  13.806 1.00 . A A . 42 THR HG22 1 1 
        1   726 1 1 45 THR HG23 H  -1.121 -22.244  14.910 1.00 . A A . 42 THR HG23 1 1 
        1   727 1 1 45 THR N    N   2.920 -21.166  14.938 1.00 . A A . 42 THR N    1 1 
        1   728 1 1 45 THR O    O   3.068 -23.809  15.681 1.00 . A A . 42 THR O    1 1 
        1   729 1 1 45 THR OG1  O  -0.152 -21.456  17.064 1.00 . A A . 42 THR OG1  1 1 
        1   730 1 1 46 VAL C    C   1.159 -26.041  17.166 1.00 . A A . 43 VAL C    1 1 
        1   731 1 1 46 VAL CA   C   1.954 -25.003  18.015 1.00 . A A . 43 VAL CA   1 1 
        1   732 1 1 46 VAL CB   C   1.566 -25.147  19.543 1.00 . A A . 43 VAL CB   1 1 
        1   733 1 1 46 VAL CG1  C   2.296 -26.311  20.187 1.00 . A A . 43 VAL CG1  1 1 
        1   734 1 1 46 VAL CG2  C   1.817 -23.862  20.352 1.00 . A A . 43 VAL CG2  1 1 
        1   735 1 1 46 VAL H    H   1.178 -23.026  18.060 1.00 . A A . 43 VAL H    1 1 
        1   736 1 1 46 VAL HA   H   3.008 -25.239  17.911 1.00 . A A . 43 VAL HA   1 1 
        1   737 1 1 46 VAL HB   H   0.510 -25.377  19.612 1.00 . A A . 43 VAL HB   1 1 
        1   738 1 1 46 VAL HG11 H   3.363 -26.154  20.118 1.00 . A A . 43 VAL HG11 1 1 
        1   739 1 1 46 VAL HG12 H   2.031 -27.224  19.674 1.00 . A A . 43 VAL HG12 1 1 
        1   740 1 1 46 VAL HG13 H   2.007 -26.382  21.223 1.00 . A A . 43 VAL HG13 1 1 
        1   741 1 1 46 VAL HG21 H   1.523 -24.028  21.376 1.00 . A A . 43 VAL HG21 1 1 
        1   742 1 1 46 VAL HG22 H   1.232 -23.051  19.946 1.00 . A A . 43 VAL HG22 1 1 
        1   743 1 1 46 VAL HG23 H   2.866 -23.599  20.321 1.00 . A A . 43 VAL HG23 1 1 
        1   744 1 1 46 VAL N    N   1.765 -23.615  17.531 1.00 . A A . 43 VAL N    1 1 
        1   745 1 1 46 VAL O    O   1.374 -27.251  17.298 1.00 . A A . 43 VAL O    1 1 
        1   746 1 1 47 SER C    C   0.120 -26.892  14.161 1.00 . A A . 44 SER C    1 1 
        1   747 1 1 47 SER CA   C  -0.588 -26.474  15.469 1.00 . A A . 44 SER CA   1 1 
        1   748 1 1 47 SER CB   C  -1.964 -25.795  15.136 1.00 . A A . 44 SER CB   1 1 
        1   749 1 1 47 SER H    H   0.237 -24.614  16.094 1.00 . A A . 44 SER H    1 1 
        1   750 1 1 47 SER HA   H  -0.751 -27.364  16.069 1.00 . A A . 44 SER HA   1 1 
        1   751 1 1 47 SER HB2  H  -1.932 -25.364  14.138 1.00 . A A . 44 SER HB2  1 1 
        1   752 1 1 47 SER HB3  H  -2.773 -26.527  15.166 1.00 . A A . 44 SER HB3  1 1 
        1   753 1 1 47 SER HG   H  -2.845 -25.110  16.759 1.00 . A A . 44 SER HG   1 1 
        1   754 1 1 47 SER N    N   0.277 -25.573  16.261 1.00 . A A . 44 SER N    1 1 
        1   755 1 1 47 SER O    O  -0.481 -27.540  13.299 1.00 . A A . 44 SER O    1 1 
        1   756 1 1 47 SER OG   O  -2.263 -24.766  16.074 1.00 . A A . 44 SER OG   1 1 
        1   757 1 1 48 GLY C    C   1.998 -25.882  11.648 1.00 . A A . 45 GLY C    1 1 
        1   758 1 1 48 GLY CA   C   2.187 -26.844  12.826 1.00 . A A . 45 GLY CA   1 1 
        1   759 1 1 48 GLY H    H   1.863 -26.092  14.801 1.00 . A A . 45 GLY H    1 1 
        1   760 1 1 48 GLY HA2  H   3.232 -26.845  13.092 1.00 . A A . 45 GLY HA2  1 1 
        1   761 1 1 48 GLY HA3  H   1.917 -27.838  12.504 1.00 . A A . 45 GLY HA3  1 1 
        1   762 1 1 48 GLY N    N   1.410 -26.526  14.031 1.00 . A A . 45 GLY N    1 1 
        1   763 1 1 48 GLY O    O   2.676 -26.027  10.630 1.00 . A A . 45 GLY O    1 1 
        1   764 1 1 49 ALA C    C   1.901 -22.754  10.899 1.00 . A A . 46 ALA C    1 1 
        1   765 1 1 49 ALA CA   C   0.881 -23.909  10.728 1.00 . A A . 46 ALA CA   1 1 
        1   766 1 1 49 ALA CB   C  -0.578 -23.403  10.751 1.00 . A A . 46 ALA CB   1 1 
        1   767 1 1 49 ALA H    H   0.525 -24.897  12.559 1.00 . A A . 46 ALA H    1 1 
        1   768 1 1 49 ALA HA   H   1.047 -24.400   9.778 1.00 . A A . 46 ALA HA   1 1 
        1   769 1 1 49 ALA HB1  H  -0.836 -23.022  11.728 1.00 . A A . 46 ALA HB1  1 1 
        1   770 1 1 49 ALA HB2  H  -1.247 -24.217  10.502 1.00 . A A . 46 ALA HB2  1 1 
        1   771 1 1 49 ALA HB3  H  -0.704 -22.616  10.029 1.00 . A A . 46 ALA HB3  1 1 
        1   772 1 1 49 ALA N    N   1.085 -24.915  11.768 1.00 . A A . 46 ALA N    1 1 
        1   773 1 1 49 ALA O    O   2.080 -22.243  12.012 1.00 . A A . 46 ALA O    1 1 
        1   774 1 1 50 ALA C    C   3.028 -20.000   9.249 1.00 . A A . 47 ALA C    1 1 
        1   775 1 1 50 ALA CA   C   3.596 -21.285   9.862 1.00 . A A . 47 ALA CA   1 1 
        1   776 1 1 50 ALA CB   C   4.927 -21.680   9.161 1.00 . A A . 47 ALA CB   1 1 
        1   777 1 1 50 ALA H    H   2.345 -22.745   8.939 1.00 . A A . 47 ALA H    1 1 
        1   778 1 1 50 ALA HA   H   3.811 -21.120  10.902 1.00 . A A . 47 ALA HA   1 1 
        1   779 1 1 50 ALA HB1  H   4.821 -21.626   8.081 1.00 . A A . 47 ALA HB1  1 1 
        1   780 1 1 50 ALA HB2  H   5.213 -22.686   9.442 1.00 . A A . 47 ALA HB2  1 1 
        1   781 1 1 50 ALA HB3  H   5.715 -21.001   9.466 1.00 . A A . 47 ALA HB3  1 1 
        1   782 1 1 50 ALA N    N   2.573 -22.351   9.803 1.00 . A A . 47 ALA N    1 1 
        1   783 1 1 50 ALA O    O   2.235 -20.080   8.306 1.00 . A A . 47 ALA O    1 1 
        1   784 1 1 51 PHE C    C   4.078 -16.645   8.899 1.00 . A A . 48 PHE C    1 1 
        1   785 1 1 51 PHE CA   C   2.905 -17.567   9.193 1.00 . A A . 48 PHE CA   1 1 
        1   786 1 1 51 PHE CB   C   2.012 -16.856  10.237 1.00 . A A . 48 PHE CB   1 1 
        1   787 1 1 51 PHE CD1  C  -0.190 -17.992  10.270 1.00 . A A . 48 PHE CD1  1 1 
        1   788 1 1 51 PHE CD2  C   1.310 -18.388  12.072 1.00 . A A . 48 PHE CD2  1 1 
        1   789 1 1 51 PHE CE1  C  -1.102 -18.842  10.832 1.00 . A A . 48 PHE CE1  1 1 
        1   790 1 1 51 PHE CE2  C   0.410 -19.236  12.639 1.00 . A A . 48 PHE CE2  1 1 
        1   791 1 1 51 PHE CG   C   1.016 -17.756  10.879 1.00 . A A . 48 PHE CG   1 1 
        1   792 1 1 51 PHE CZ   C  -0.804 -19.478  12.021 1.00 . A A . 48 PHE CZ   1 1 
        1   793 1 1 51 PHE H    H   3.923 -18.760  10.613 1.00 . A A . 48 PHE H    1 1 
        1   794 1 1 51 PHE HA   H   2.328 -17.785   8.300 1.00 . A A . 48 PHE HA   1 1 
        1   795 1 1 51 PHE HB2  H   2.641 -16.455  11.021 1.00 . A A . 48 PHE HB2  1 1 
        1   796 1 1 51 PHE HB3  H   1.471 -16.046   9.768 1.00 . A A . 48 PHE HB3  1 1 
        1   797 1 1 51 PHE HD1  H  -0.420 -17.486   9.348 1.00 . A A . 48 PHE HD1  1 1 
        1   798 1 1 51 PHE HD2  H   2.271 -18.223  12.557 1.00 . A A . 48 PHE HD2  1 1 
        1   799 1 1 51 PHE HE1  H  -2.030 -19.023  10.333 1.00 . A A . 48 PHE HE1  1 1 
        1   800 1 1 51 PHE HE2  H   0.653 -19.712  13.558 1.00 . A A . 48 PHE HE2  1 1 
        1   801 1 1 51 PHE HZ   H  -1.515 -20.152  12.470 1.00 . A A . 48 PHE HZ   1 1 
        1   802 1 1 51 PHE N    N   3.412 -18.813   9.758 1.00 . A A . 48 PHE N    1 1 
        1   803 1 1 51 PHE O    O   5.109 -16.712   9.578 1.00 . A A . 48 PHE O    1 1 
        1   804 1 1 52 ALA C    C   4.200 -13.386   7.696 1.00 . A A . 49 ALA C    1 1 
        1   805 1 1 52 ALA CA   C   4.910 -14.747   7.687 1.00 . A A . 49 ALA CA   1 1 
        1   806 1 1 52 ALA CB   C   5.826 -15.011   6.466 1.00 . A A . 49 ALA CB   1 1 
        1   807 1 1 52 ALA H    H   3.222 -15.925   7.230 1.00 . A A . 49 ALA H    1 1 
        1   808 1 1 52 ALA HA   H   5.523 -14.771   8.547 1.00 . A A . 49 ALA HA   1 1 
        1   809 1 1 52 ALA HB1  H   6.219 -16.020   6.535 1.00 . A A . 49 ALA HB1  1 1 
        1   810 1 1 52 ALA HB2  H   6.658 -14.321   6.471 1.00 . A A . 49 ALA HB2  1 1 
        1   811 1 1 52 ALA HB3  H   5.274 -14.909   5.547 1.00 . A A . 49 ALA HB3  1 1 
        1   812 1 1 52 ALA N    N   3.952 -15.812   7.871 1.00 . A A . 49 ALA N    1 1 
        1   813 1 1 52 ALA O    O   3.107 -13.218   7.119 1.00 . A A . 49 ALA O    1 1 
        1   814 1 1 53 PHE C    C   5.105 -10.111   7.917 1.00 . A A . 50 PHE C    1 1 
        1   815 1 1 53 PHE CA   C   4.294 -11.147   8.715 1.00 . A A . 50 PHE CA   1 1 
        1   816 1 1 53 PHE CB   C   4.467 -10.933  10.229 1.00 . A A . 50 PHE CB   1 1 
        1   817 1 1 53 PHE CD1  C   2.069 -10.348  10.689 1.00 . A A . 50 PHE CD1  1 1 
        1   818 1 1 53 PHE CD2  C   3.775  -9.006  11.682 1.00 . A A . 50 PHE CD2  1 1 
        1   819 1 1 53 PHE CE1  C   1.100  -9.582  11.303 1.00 . A A . 50 PHE CE1  1 1 
        1   820 1 1 53 PHE CE2  C   2.810  -8.244  12.307 1.00 . A A . 50 PHE CE2  1 1 
        1   821 1 1 53 PHE CG   C   3.418 -10.068  10.870 1.00 . A A . 50 PHE CG   1 1 
        1   822 1 1 53 PHE CZ   C   1.470  -8.530  12.113 1.00 . A A . 50 PHE CZ   1 1 
        1   823 1 1 53 PHE H    H   5.680 -12.656   8.836 1.00 . A A . 50 PHE H    1 1 
        1   824 1 1 53 PHE HA   H   3.249 -11.142   8.458 1.00 . A A . 50 PHE HA   1 1 
        1   825 1 1 53 PHE HB2  H   4.425 -11.903  10.712 1.00 . A A . 50 PHE HB2  1 1 
        1   826 1 1 53 PHE HB3  H   5.450 -10.494  10.425 1.00 . A A . 50 PHE HB3  1 1 
        1   827 1 1 53 PHE HD1  H   1.779 -11.174  10.057 1.00 . A A . 50 PHE HD1  1 1 
        1   828 1 1 53 PHE HD2  H   4.819  -8.776  11.829 1.00 . A A . 50 PHE HD2  1 1 
        1   829 1 1 53 PHE HE1  H   0.054  -9.809  11.148 1.00 . A A . 50 PHE HE1  1 1 
        1   830 1 1 53 PHE HE2  H   3.099  -7.419  12.941 1.00 . A A . 50 PHE HE2  1 1 
        1   831 1 1 53 PHE HZ   H   0.712  -7.934  12.601 1.00 . A A . 50 PHE HZ   1 1 
        1   832 1 1 53 PHE N    N   4.824 -12.447   8.430 1.00 . A A . 50 PHE N    1 1 
        1   833 1 1 53 PHE O    O   6.340 -10.031   8.112 1.00 . A A . 50 PHE O    1 1 
        1   834 1 1 54 ILE C    C   4.911  -7.060   6.116 1.00 . A A . 51 ILE C    1 1 
        1   835 1 1 54 ILE CA   C   5.252  -8.538   6.040 1.00 . A A . 51 ILE CA   1 1 
        1   836 1 1 54 ILE CB   C   5.041  -9.014   4.550 1.00 . A A . 51 ILE CB   1 1 
        1   837 1 1 54 ILE CD1  C   3.582 -10.631   3.090 1.00 . A A . 51 ILE CD1  1 1 
        1   838 1 1 54 ILE CG1  C   4.238 -10.345   4.439 1.00 . A A . 51 ILE CG1  1 1 
        1   839 1 1 54 ILE CG2  C   6.402  -9.208   3.913 1.00 . A A . 51 ILE CG2  1 1 
        1   840 1 1 54 ILE H    H   3.470  -9.117   7.142 1.00 . A A . 51 ILE H    1 1 
        1   841 1 1 54 ILE HA   H   6.310  -8.653   6.280 1.00 . A A . 51 ILE HA   1 1 
        1   842 1 1 54 ILE HB   H   4.530  -8.215   4.015 1.00 . A A . 51 ILE HB   1 1 
        1   843 1 1 54 ILE HD11 H   4.273 -11.149   2.455 1.00 . A A . 51 ILE HD11 1 1 
        1   844 1 1 54 ILE HD12 H   3.273  -9.705   2.621 1.00 . A A . 51 ILE HD12 1 1 
        1   845 1 1 54 ILE HD13 H   2.711 -11.255   3.242 1.00 . A A . 51 ILE HD13 1 1 
        1   846 1 1 54 ILE HG12 H   4.924 -11.187   4.626 1.00 . A A . 51 ILE HG12 1 1 
        1   847 1 1 54 ILE HG13 H   3.454 -10.332   5.189 1.00 . A A . 51 ILE HG13 1 1 
        1   848 1 1 54 ILE HG21 H   6.993  -8.318   4.049 1.00 . A A . 51 ILE HG21 1 1 
        1   849 1 1 54 ILE HG22 H   6.279  -9.398   2.853 1.00 . A A . 51 ILE HG22 1 1 
        1   850 1 1 54 ILE HG23 H   6.902 -10.045   4.373 1.00 . A A . 51 ILE HG23 1 1 
        1   851 1 1 54 ILE N    N   4.457  -9.296   7.046 1.00 . A A . 51 ILE N    1 1 
        1   852 1 1 54 ILE O    O   3.870  -6.632   5.647 1.00 . A A . 51 ILE O    1 1 
        1   853 1 1 55 GLU C    C   5.815  -3.953   5.683 1.00 . A A . 52 GLU C    1 1 
        1   854 1 1 55 GLU CA   C   5.529  -4.847   6.916 1.00 . A A . 52 GLU CA   1 1 
        1   855 1 1 55 GLU CB   C   6.336  -4.373   8.138 1.00 . A A . 52 GLU CB   1 1 
        1   856 1 1 55 GLU CD   C   6.765  -2.627   9.913 1.00 . A A . 52 GLU CD   1 1 
        1   857 1 1 55 GLU CG   C   6.039  -2.950   8.614 1.00 . A A . 52 GLU CG   1 1 
        1   858 1 1 55 GLU H    H   6.714  -6.649   6.803 1.00 . A A . 52 GLU H    1 1 
        1   859 1 1 55 GLU HA   H   4.485  -4.793   7.167 1.00 . A A . 52 GLU HA   1 1 
        1   860 1 1 55 GLU HB2  H   6.157  -5.045   8.972 1.00 . A A . 52 GLU HB2  1 1 
        1   861 1 1 55 GLU HB3  H   7.377  -4.425   7.879 1.00 . A A . 52 GLU HB3  1 1 
        1   862 1 1 55 GLU HG2  H   6.369  -2.260   7.849 1.00 . A A . 52 GLU HG2  1 1 
        1   863 1 1 55 GLU HG3  H   4.968  -2.835   8.762 1.00 . A A . 52 GLU HG3  1 1 
        1   864 1 1 55 GLU N    N   5.835  -6.267   6.622 1.00 . A A . 52 GLU N    1 1 
        1   865 1 1 55 GLU O    O   6.977  -3.682   5.363 1.00 . A A . 52 GLU O    1 1 
        1   866 1 1 55 GLU OE1  O   6.307  -3.087  10.979 1.00 . A A . 52 GLU OE1  1 1 
        1   867 1 1 55 GLU OE2  O   7.799  -1.939   9.875 1.00 . A A . 52 GLU OE2  1 1 
        1   868 1 1 56 PHE C    C   4.360  -1.351   3.757 1.00 . A A . 53 PHE C    1 1 
        1   869 1 1 56 PHE CA   C   4.838  -2.802   3.687 1.00 . A A . 53 PHE CA   1 1 
        1   870 1 1 56 PHE CB   C   4.082  -3.566   2.586 1.00 . A A . 53 PHE CB   1 1 
        1   871 1 1 56 PHE CD1  C   5.837  -5.388   2.605 1.00 . A A . 53 PHE CD1  1 1 
        1   872 1 1 56 PHE CD2  C   4.740  -4.901   0.568 1.00 . A A . 53 PHE CD2  1 1 
        1   873 1 1 56 PHE CE1  C   6.584  -6.352   1.977 1.00 . A A . 53 PHE CE1  1 1 
        1   874 1 1 56 PHE CE2  C   5.481  -5.872  -0.055 1.00 . A A . 53 PHE CE2  1 1 
        1   875 1 1 56 PHE CG   C   4.898  -4.649   1.910 1.00 . A A . 53 PHE CG   1 1 
        1   876 1 1 56 PHE CZ   C   6.413  -6.588   0.643 1.00 . A A . 53 PHE CZ   1 1 
        1   877 1 1 56 PHE H    H   3.820  -3.678   5.366 1.00 . A A . 53 PHE H    1 1 
        1   878 1 1 56 PHE HA   H   5.862  -2.787   3.423 1.00 . A A . 53 PHE HA   1 1 
        1   879 1 1 56 PHE HB2  H   3.215  -4.036   3.022 1.00 . A A . 53 PHE HB2  1 1 
        1   880 1 1 56 PHE HB3  H   3.759  -2.867   1.827 1.00 . A A . 53 PHE HB3  1 1 
        1   881 1 1 56 PHE HD1  H   5.976  -5.205   3.663 1.00 . A A . 53 PHE HD1  1 1 
        1   882 1 1 56 PHE HD2  H   4.007  -4.349  -0.001 1.00 . A A . 53 PHE HD2  1 1 
        1   883 1 1 56 PHE HE1  H   7.306  -6.923   2.537 1.00 . A A . 53 PHE HE1  1 1 
        1   884 1 1 56 PHE HE2  H   5.334  -6.052  -1.104 1.00 . A A . 53 PHE HE2  1 1 
        1   885 1 1 56 PHE HZ   H   7.002  -7.341   0.145 1.00 . A A . 53 PHE HZ   1 1 
        1   886 1 1 56 PHE N    N   4.728  -3.530   4.981 1.00 . A A . 53 PHE N    1 1 
        1   887 1 1 56 PHE O    O   3.377  -1.075   4.439 1.00 . A A . 53 PHE O    1 1 
        1   888 1 1 57 GLU C    C   3.444   1.139   1.860 1.00 . A A . 54 GLU C    1 1 
        1   889 1 1 57 GLU CA   C   4.523   0.979   2.954 1.00 . A A . 54 GLU CA   1 1 
        1   890 1 1 57 GLU CB   C   5.607   2.112   2.865 1.00 . A A . 54 GLU CB   1 1 
        1   891 1 1 57 GLU CD   C   7.340   3.423   1.556 1.00 . A A . 54 GLU CD   1 1 
        1   892 1 1 57 GLU CG   C   6.171   2.464   1.473 1.00 . A A . 54 GLU CG   1 1 
        1   893 1 1 57 GLU H    H   5.893  -0.681   2.592 1.00 . A A . 54 GLU H    1 1 
        1   894 1 1 57 GLU HA   H   4.006   1.130   3.893 1.00 . A A . 54 GLU HA   1 1 
        1   895 1 1 57 GLU HB2  H   5.160   3.015   3.266 1.00 . A A . 54 GLU HB2  1 1 
        1   896 1 1 57 GLU HB3  H   6.431   1.859   3.507 1.00 . A A . 54 GLU HB3  1 1 
        1   897 1 1 57 GLU HG2  H   6.494   1.563   0.970 1.00 . A A . 54 GLU HG2  1 1 
        1   898 1 1 57 GLU HG3  H   5.393   2.946   0.877 1.00 . A A . 54 GLU HG3  1 1 
        1   899 1 1 57 GLU N    N   5.046  -0.419   3.044 1.00 . A A . 54 GLU N    1 1 
        1   900 1 1 57 GLU O    O   2.494   1.902   2.051 1.00 . A A . 54 GLU O    1 1 
        1   901 1 1 57 GLU OE1  O   8.479   2.966   1.777 1.00 . A A . 54 GLU OE1  1 1 
        1   902 1 1 57 GLU OE2  O   7.114   4.651   1.410 1.00 . A A . 54 GLU OE2  1 1 
        1   903 1 1 58 ASP C    C   1.877  -0.860  -0.514 1.00 . A A . 55 ASP C    1 1 
        1   904 1 1 58 ASP CA   C   2.553   0.512  -0.331 1.00 . A A . 55 ASP CA   1 1 
        1   905 1 1 58 ASP CB   C   3.237   0.844  -1.677 1.00 . A A . 55 ASP CB   1 1 
        1   906 1 1 58 ASP CG   C   4.415   1.778  -1.583 1.00 . A A . 55 ASP CG   1 1 
        1   907 1 1 58 ASP H    H   4.332  -0.155   0.593 1.00 . A A . 55 ASP H    1 1 
        1   908 1 1 58 ASP HA   H   1.842   1.285  -0.077 1.00 . A A . 55 ASP HA   1 1 
        1   909 1 1 58 ASP HB2  H   3.614  -0.078  -2.083 1.00 . A A . 55 ASP HB2  1 1 
        1   910 1 1 58 ASP HB3  H   2.516   1.273  -2.368 1.00 . A A . 55 ASP HB3  1 1 
        1   911 1 1 58 ASP N    N   3.554   0.412   0.734 1.00 . A A . 55 ASP N    1 1 
        1   912 1 1 58 ASP O    O   2.571  -1.840  -0.797 1.00 . A A . 55 ASP O    1 1 
        1   913 1 1 58 ASP OD1  O   4.212   3.008  -1.539 1.00 . A A . 55 ASP OD1  1 1 
        1   914 1 1 58 ASP OD2  O   5.558   1.265  -1.569 1.00 . A A . 55 ASP OD2  1 1 
        1   915 1 1 59 ALA C    C  -0.432  -2.295  -2.305 1.00 . A A . 56 ALA C    1 1 
        1   916 1 1 59 ALA CA   C  -0.165  -2.201  -0.787 1.00 . A A . 56 ALA CA   1 1 
        1   917 1 1 59 ALA CB   C  -1.458  -2.496  -0.034 1.00 . A A . 56 ALA CB   1 1 
        1   918 1 1 59 ALA H    H   0.063  -0.289   0.206 1.00 . A A . 56 ALA H    1 1 
        1   919 1 1 59 ALA HA   H   0.500  -2.998  -0.543 1.00 . A A . 56 ALA HA   1 1 
        1   920 1 1 59 ALA HB1  H  -2.241  -1.855  -0.371 1.00 . A A . 56 ALA HB1  1 1 
        1   921 1 1 59 ALA HB2  H  -1.302  -2.365   1.031 1.00 . A A . 56 ALA HB2  1 1 
        1   922 1 1 59 ALA HB3  H  -1.743  -3.524  -0.217 1.00 . A A . 56 ALA HB3  1 1 
        1   923 1 1 59 ALA N    N   0.539  -0.969  -0.337 1.00 . A A . 56 ALA N    1 1 
        1   924 1 1 59 ALA O    O  -0.356  -3.391  -2.850 1.00 . A A . 56 ALA O    1 1 
        1   925 1 1 60 ARG C    C  -0.279  -1.798  -5.410 1.00 . A A . 57 ARG C    1 1 
        1   926 1 1 60 ARG CA   C  -1.297  -1.188  -4.382 1.00 . A A . 57 ARG CA   1 1 
        1   927 1 1 60 ARG CB   C  -1.863   0.187  -4.878 1.00 . A A . 57 ARG CB   1 1 
        1   928 1 1 60 ARG CD   C  -1.420   2.613  -5.482 1.00 . A A . 57 ARG CD   1 1 
        1   929 1 1 60 ARG CG   C  -0.824   1.216  -5.351 1.00 . A A . 57 ARG CG   1 1 
        1   930 1 1 60 ARG CZ   C  -1.818   4.272  -7.264 1.00 . A A . 57 ARG CZ   1 1 
        1   931 1 1 60 ARG H    H  -0.713  -0.322  -2.493 1.00 . A A . 57 ARG H    1 1 
        1   932 1 1 60 ARG HA   H  -2.143  -1.846  -4.352 1.00 . A A . 57 ARG HA   1 1 
        1   933 1 1 60 ARG HB2  H  -2.534  -0.012  -5.717 1.00 . A A . 57 ARG HB2  1 1 
        1   934 1 1 60 ARG HB3  H  -2.469   0.635  -4.090 1.00 . A A . 57 ARG HB3  1 1 
        1   935 1 1 60 ARG HD2  H  -2.349   2.651  -4.932 1.00 . A A . 57 ARG HD2  1 1 
        1   936 1 1 60 ARG HD3  H  -0.729   3.321  -5.056 1.00 . A A . 57 ARG HD3  1 1 
        1   937 1 1 60 ARG HE   H  -1.774   2.277  -7.531 1.00 . A A . 57 ARG HE   1 1 
        1   938 1 1 60 ARG HG2  H   0.007   1.257  -4.672 1.00 . A A . 57 ARG HG2  1 1 
        1   939 1 1 60 ARG HG3  H  -0.460   0.903  -6.326 1.00 . A A . 57 ARG HG3  1 1 
        1   940 1 1 60 ARG HH11 H  -1.520   5.071  -5.420 1.00 . A A . 57 ARG HH11 1 1 
        1   941 1 1 60 ARG HH12 H  -1.794   6.221  -6.682 1.00 . A A . 57 ARG HH12 1 1 
        1   942 1 1 60 ARG HH21 H  -2.139   3.810  -9.210 1.00 . A A . 57 ARG HH21 1 1 
        1   943 1 1 60 ARG HH22 H  -2.148   5.506  -8.844 1.00 . A A . 57 ARG HH22 1 1 
        1   944 1 1 60 ARG N    N  -0.783  -1.163  -2.968 1.00 . A A . 57 ARG N    1 1 
        1   945 1 1 60 ARG NE   N  -1.688   3.001  -6.865 1.00 . A A . 57 ARG NE   1 1 
        1   946 1 1 60 ARG NH1  N  -1.695   5.270  -6.383 1.00 . A A . 57 ARG NH1  1 1 
        1   947 1 1 60 ARG NH2  N  -2.057   4.550  -8.544 1.00 . A A . 57 ARG NH2  1 1 
        1   948 1 1 60 ARG O    O  -0.700  -2.498  -6.325 1.00 . A A . 57 ARG O    1 1 
        1   949 1 1 61 ASP C    C   2.310  -3.726  -5.671 1.00 . A A . 58 ASP C    1 1 
        1   950 1 1 61 ASP CA   C   2.084  -2.216  -6.084 1.00 . A A . 58 ASP CA   1 1 
        1   951 1 1 61 ASP CB   C   3.429  -1.424  -6.082 1.00 . A A . 58 ASP CB   1 1 
        1   952 1 1 61 ASP CG   C   3.221   0.070  -6.310 1.00 . A A . 58 ASP CG   1 1 
        1   953 1 1 61 ASP H    H   1.295  -0.677  -4.793 1.00 . A A . 58 ASP H    1 1 
        1   954 1 1 61 ASP HA   H   1.718  -2.219  -7.098 1.00 . A A . 58 ASP HA   1 1 
        1   955 1 1 61 ASP HB2  H   3.960  -1.563  -5.147 1.00 . A A . 58 ASP HB2  1 1 
        1   956 1 1 61 ASP HB3  H   4.054  -1.796  -6.899 1.00 . A A . 58 ASP HB3  1 1 
        1   957 1 1 61 ASP N    N   1.038  -1.496  -5.289 1.00 . A A . 58 ASP N    1 1 
        1   958 1 1 61 ASP O    O   2.346  -4.588  -6.552 1.00 . A A . 58 ASP O    1 1 
        1   959 1 1 61 ASP OD1  O   2.997   0.811  -5.320 1.00 . A A . 58 ASP OD1  1 1 
        1   960 1 1 61 ASP OD2  O   3.270   0.501  -7.482 1.00 . A A . 58 ASP OD2  1 1 
        1   961 1 1 62 ALA C    C   1.343  -6.385  -4.179 1.00 . A A . 59 ALA C    1 1 
        1   962 1 1 62 ALA CA   C   2.552  -5.434  -3.790 1.00 . A A . 59 ALA CA   1 1 
        1   963 1 1 62 ALA CB   C   2.838  -5.413  -2.276 1.00 . A A . 59 ALA CB   1 1 
        1   964 1 1 62 ALA H    H   2.702  -3.324  -3.746 1.00 . A A . 59 ALA H    1 1 
        1   965 1 1 62 ALA HA   H   3.438  -5.843  -4.222 1.00 . A A . 59 ALA HA   1 1 
        1   966 1 1 62 ALA HB1  H   1.932  -5.370  -1.706 1.00 . A A . 59 ALA HB1  1 1 
        1   967 1 1 62 ALA HB2  H   3.453  -4.551  -2.039 1.00 . A A . 59 ALA HB2  1 1 
        1   968 1 1 62 ALA HB3  H   3.393  -6.296  -2.002 1.00 . A A . 59 ALA HB3  1 1 
        1   969 1 1 62 ALA N    N   2.486  -4.038  -4.350 1.00 . A A . 59 ALA N    1 1 
        1   970 1 1 62 ALA O    O   1.430  -7.633  -4.049 1.00 . A A . 59 ALA O    1 1 
        1   971 1 1 63 ALA C    C  -0.736  -7.476  -6.214 1.00 . A A . 60 ALA C    1 1 
        1   972 1 1 63 ALA CA   C  -1.011  -6.423  -5.095 1.00 . A A . 60 ALA CA   1 1 
        1   973 1 1 63 ALA CB   C  -2.045  -5.345  -5.561 1.00 . A A . 60 ALA CB   1 1 
        1   974 1 1 63 ALA H    H   0.148  -4.829  -4.402 1.00 . A A . 60 ALA H    1 1 
        1   975 1 1 63 ALA HA   H  -1.463  -6.930  -4.268 1.00 . A A . 60 ALA HA   1 1 
        1   976 1 1 63 ALA HB1  H  -2.453  -4.846  -4.688 1.00 . A A . 60 ALA HB1  1 1 
        1   977 1 1 63 ALA HB2  H  -2.858  -5.792  -6.108 1.00 . A A . 60 ALA HB2  1 1 
        1   978 1 1 63 ALA HB3  H  -1.565  -4.599  -6.191 1.00 . A A . 60 ALA HB3  1 1 
        1   979 1 1 63 ALA N    N   0.200  -5.765  -4.559 1.00 . A A . 60 ALA N    1 1 
        1   980 1 1 63 ALA O    O  -1.458  -8.469  -6.215 1.00 . A A . 60 ALA O    1 1 
        1   981 1 1 64 ASP C    C   1.037  -9.723  -7.243 1.00 . A A . 61 ASP C    1 1 
        1   982 1 1 64 ASP CA   C   0.725  -8.437  -8.038 1.00 . A A . 61 ASP CA   1 1 
        1   983 1 1 64 ASP CB   C   1.935  -8.092  -8.946 1.00 . A A . 61 ASP CB   1 1 
        1   984 1 1 64 ASP CG   C   1.620  -6.992  -9.952 1.00 . A A . 61 ASP CG   1 1 
        1   985 1 1 64 ASP H    H   0.692  -6.412  -7.270 1.00 . A A . 61 ASP H    1 1 
        1   986 1 1 64 ASP HA   H  -0.097  -8.649  -8.705 1.00 . A A . 61 ASP HA   1 1 
        1   987 1 1 64 ASP HB2  H   2.790  -7.792  -8.360 1.00 . A A . 61 ASP HB2  1 1 
        1   988 1 1 64 ASP HB3  H   2.204  -8.980  -9.506 1.00 . A A . 61 ASP HB3  1 1 
        1   989 1 1 64 ASP N    N   0.294  -7.308  -7.133 1.00 . A A . 61 ASP N    1 1 
        1   990 1 1 64 ASP O    O   0.410 -10.761  -7.496 1.00 . A A . 61 ASP O    1 1 
        1   991 1 1 64 ASP OD1  O   0.903  -7.276 -10.941 1.00 . A A . 61 ASP OD1  1 1 
        1   992 1 1 64 ASP OD2  O   2.101  -5.860  -9.767 1.00 . A A . 61 ASP OD2  1 1 
        1   993 1 1 65 ALA C    C   1.044 -11.346  -4.649 1.00 . A A . 62 ALA C    1 1 
        1   994 1 1 65 ALA CA   C   2.241 -10.854  -5.410 1.00 . A A . 62 ALA CA   1 1 
        1   995 1 1 65 ALA CB   C   3.395 -10.700  -4.410 1.00 . A A . 62 ALA CB   1 1 
        1   996 1 1 65 ALA H    H   2.351  -8.796  -6.031 1.00 . A A . 62 ALA H    1 1 
        1   997 1 1 65 ALA HA   H   2.527 -11.631  -6.102 1.00 . A A . 62 ALA HA   1 1 
        1   998 1 1 65 ALA HB1  H   3.481 -11.609  -3.822 1.00 . A A . 62 ALA HB1  1 1 
        1   999 1 1 65 ALA HB2  H   3.223  -9.873  -3.734 1.00 . A A . 62 ALA HB2  1 1 
        1  1000 1 1 65 ALA HB3  H   4.307 -10.554  -4.938 1.00 . A A . 62 ALA HB3  1 1 
        1  1001 1 1 65 ALA N    N   1.921  -9.653  -6.227 1.00 . A A . 62 ALA N    1 1 
        1  1002 1 1 65 ALA O    O   0.809 -12.555  -4.624 1.00 . A A . 62 ALA O    1 1 
        1  1003 1 1 66 ILE C    C  -1.961 -11.613  -3.993 1.00 . A A . 63 ILE C    1 1 
        1  1004 1 1 66 ILE CA   C  -0.819 -10.906  -3.196 1.00 . A A . 63 ILE CA   1 1 
        1  1005 1 1 66 ILE CB   C  -1.311  -9.790  -2.201 1.00 . A A . 63 ILE CB   1 1 
        1  1006 1 1 66 ILE CD1  C  -2.354 -10.418   0.104 1.00 . A A . 63 ILE CD1  1 1 
        1  1007 1 1 66 ILE CG1  C  -1.089 -10.273  -0.733 1.00 . A A . 63 ILE CG1  1 1 
        1  1008 1 1 66 ILE CG2  C  -2.767  -9.326  -2.456 1.00 . A A . 63 ILE CG2  1 1 
        1  1009 1 1 66 ILE H    H   0.455  -9.478  -4.135 1.00 . A A . 63 ILE H    1 1 
        1  1010 1 1 66 ILE HA   H  -0.365 -11.679  -2.611 1.00 . A A . 63 ILE HA   1 1 
        1  1011 1 1 66 ILE HB   H  -0.671  -8.939  -2.349 1.00 . A A . 63 ILE HB   1 1 
        1  1012 1 1 66 ILE HD11 H  -3.006 -11.143  -0.347 1.00 . A A . 63 ILE HD11 1 1 
        1  1013 1 1 66 ILE HD12 H  -2.879  -9.463   0.134 1.00 . A A . 63 ILE HD12 1 1 
        1  1014 1 1 66 ILE HD13 H  -2.103 -10.731   1.097 1.00 . A A . 63 ILE HD13 1 1 
        1  1015 1 1 66 ILE HG12 H  -0.605 -11.239  -0.736 1.00 . A A . 63 ILE HG12 1 1 
        1  1016 1 1 66 ILE HG13 H  -0.438  -9.565  -0.232 1.00 . A A . 63 ILE HG13 1 1 
        1  1017 1 1 66 ILE HG21 H  -2.886  -9.026  -3.485 1.00 . A A . 63 ILE HG21 1 1 
        1  1018 1 1 66 ILE HG22 H  -2.996  -8.492  -1.810 1.00 . A A . 63 ILE HG22 1 1 
        1  1019 1 1 66 ILE HG23 H  -3.439 -10.140  -2.238 1.00 . A A . 63 ILE HG23 1 1 
        1  1020 1 1 66 ILE N    N   0.273 -10.441  -4.038 1.00 . A A . 63 ILE N    1 1 
        1  1021 1 1 66 ILE O    O  -2.478 -12.613  -3.515 1.00 . A A . 63 ILE O    1 1 
        1  1022 1 1 67 LYS C    C  -2.554 -13.162  -6.649 1.00 . A A . 64 LYS C    1 1 
        1  1023 1 1 67 LYS CA   C  -3.207 -11.885  -6.100 1.00 . A A . 64 LYS CA   1 1 
        1  1024 1 1 67 LYS CB   C  -3.772 -11.038  -7.291 1.00 . A A . 64 LYS CB   1 1 
        1  1025 1 1 67 LYS CD   C  -2.079 -11.247  -9.325 1.00 . A A . 64 LYS CD   1 1 
        1  1026 1 1 67 LYS CE   C  -1.462 -10.471 -10.469 1.00 . A A . 64 LYS CE   1 1 
        1  1027 1 1 67 LYS CG   C  -2.756 -10.331  -8.266 1.00 . A A . 64 LYS CG   1 1 
        1  1028 1 1 67 LYS H    H  -2.158 -10.210  -5.385 1.00 . A A . 64 LYS H    1 1 
        1  1029 1 1 67 LYS HA   H  -4.041 -12.190  -5.491 1.00 . A A . 64 LYS HA   1 1 
        1  1030 1 1 67 LYS HB2  H  -4.378 -11.695  -7.888 1.00 . A A . 64 LYS HB2  1 1 
        1  1031 1 1 67 LYS HB3  H  -4.429 -10.275  -6.882 1.00 . A A . 64 LYS HB3  1 1 
        1  1032 1 1 67 LYS HD2  H  -1.257 -11.778  -8.852 1.00 . A A . 64 LYS HD2  1 1 
        1  1033 1 1 67 LYS HD3  H  -2.795 -11.953  -9.713 1.00 . A A . 64 LYS HD3  1 1 
        1  1034 1 1 67 LYS HE2  H  -0.694  -9.838 -10.083 1.00 . A A . 64 LYS HE2  1 1 
        1  1035 1 1 67 LYS HE3  H  -1.031 -11.175 -11.159 1.00 . A A . 64 LYS HE3  1 1 
        1  1036 1 1 67 LYS HG2  H  -3.275  -9.548  -8.788 1.00 . A A . 64 LYS HG2  1 1 
        1  1037 1 1 67 LYS HG3  H  -1.965  -9.880  -7.668 1.00 . A A . 64 LYS HG3  1 1 
        1  1038 1 1 67 LYS HZ1  H  -3.243 -10.232 -11.511 1.00 . A A . 64 LYS HZ1  1 1 
        1  1039 1 1 67 LYS HZ2  H  -2.014  -9.183 -12.012 1.00 . A A . 64 LYS HZ2  1 1 
        1  1040 1 1 67 LYS HZ3  H  -2.827  -8.904 -10.554 1.00 . A A . 64 LYS HZ3  1 1 
        1  1041 1 1 67 LYS N    N  -2.339 -11.117  -5.189 1.00 . A A . 64 LYS N    1 1 
        1  1042 1 1 67 LYS NZ   N  -2.453  -9.638 -11.185 1.00 . A A . 64 LYS NZ   1 1 
        1  1043 1 1 67 LYS O    O  -3.251 -14.138  -6.910 1.00 . A A . 64 LYS O    1 1 
        1  1044 1 1 68 GLU C    C  -0.382 -15.440  -6.425 1.00 . A A . 65 GLU C    1 1 
        1  1045 1 1 68 GLU CA   C  -0.556 -14.302  -7.449 1.00 . A A . 65 GLU CA   1 1 
        1  1046 1 1 68 GLU CB   C   0.750 -13.819  -8.127 1.00 . A A . 65 GLU CB   1 1 
        1  1047 1 1 68 GLU CD   C   3.243 -13.397  -7.963 1.00 . A A . 65 GLU CD   1 1 
        1  1048 1 1 68 GLU CG   C   2.051 -14.156  -7.438 1.00 . A A . 65 GLU CG   1 1 
        1  1049 1 1 68 GLU H    H  -0.702 -12.357  -6.603 1.00 . A A . 65 GLU H    1 1 
        1  1050 1 1 68 GLU HA   H  -1.213 -14.699  -8.221 1.00 . A A . 65 GLU HA   1 1 
        1  1051 1 1 68 GLU HB2  H   0.796 -14.248  -9.113 1.00 . A A . 65 GLU HB2  1 1 
        1  1052 1 1 68 GLU HB3  H   0.702 -12.745  -8.224 1.00 . A A . 65 GLU HB3  1 1 
        1  1053 1 1 68 GLU HG2  H   1.976 -13.999  -6.374 1.00 . A A . 65 GLU HG2  1 1 
        1  1054 1 1 68 GLU HG3  H   2.215 -15.171  -7.631 1.00 . A A . 65 GLU HG3  1 1 
        1  1055 1 1 68 GLU N    N  -1.232 -13.155  -6.853 1.00 . A A . 65 GLU N    1 1 
        1  1056 1 1 68 GLU O    O  -0.113 -16.583  -6.803 1.00 . A A . 65 GLU O    1 1 
        1  1057 1 1 68 GLU OE1  O   3.063 -12.330  -8.591 1.00 . A A . 65 GLU OE1  1 1 
        1  1058 1 1 68 GLU OE2  O   4.371 -13.889  -7.764 1.00 . A A . 65 GLU OE2  1 1 
        1  1059 1 1 69 LYS C    C  -2.048 -16.229  -3.496 1.00 . A A . 66 LYS C    1 1 
        1  1060 1 1 69 LYS CA   C  -0.597 -16.146  -4.107 1.00 . A A . 66 LYS CA   1 1 
        1  1061 1 1 69 LYS CB   C   0.491 -15.871  -3.015 1.00 . A A . 66 LYS CB   1 1 
        1  1062 1 1 69 LYS CD   C   3.034 -16.260  -3.326 1.00 . A A . 66 LYS CD   1 1 
        1  1063 1 1 69 LYS CE   C   4.278 -15.799  -4.102 1.00 . A A . 66 LYS CE   1 1 
        1  1064 1 1 69 LYS CG   C   1.839 -15.327  -3.547 1.00 . A A . 66 LYS CG   1 1 
        1  1065 1 1 69 LYS H    H  -0.537 -14.187  -4.846 1.00 . A A . 66 LYS H    1 1 
        1  1066 1 1 69 LYS HA   H  -0.387 -17.096  -4.590 1.00 . A A . 66 LYS HA   1 1 
        1  1067 1 1 69 LYS HB2  H   0.108 -15.145  -2.310 1.00 . A A . 66 LYS HB2  1 1 
        1  1068 1 1 69 LYS HB3  H   0.685 -16.790  -2.492 1.00 . A A . 66 LYS HB3  1 1 
        1  1069 1 1 69 LYS HD2  H   3.273 -16.273  -2.272 1.00 . A A . 66 LYS HD2  1 1 
        1  1070 1 1 69 LYS HD3  H   2.782 -17.255  -3.644 1.00 . A A . 66 LYS HD3  1 1 
        1  1071 1 1 69 LYS HE2  H   4.024 -14.974  -4.754 1.00 . A A . 66 LYS HE2  1 1 
        1  1072 1 1 69 LYS HE3  H   5.026 -15.476  -3.397 1.00 . A A . 66 LYS HE3  1 1 
        1  1073 1 1 69 LYS HG2  H   1.740 -15.146  -4.598 1.00 . A A . 66 LYS HG2  1 1 
        1  1074 1 1 69 LYS HG3  H   2.039 -14.377  -3.051 1.00 . A A . 66 LYS HG3  1 1 
        1  1075 1 1 69 LYS HZ1  H   5.652 -16.540  -5.488 1.00 . A A . 66 LYS HZ1  1 1 
        1  1076 1 1 69 LYS HZ2  H   4.124 -17.262  -5.593 1.00 . A A . 66 LYS HZ2  1 1 
        1  1077 1 1 69 LYS HZ3  H   5.170 -17.676  -4.331 1.00 . A A . 66 LYS HZ3  1 1 
        1  1078 1 1 69 LYS N    N  -0.520 -15.123  -5.125 1.00 . A A . 66 LYS N    1 1 
        1  1079 1 1 69 LYS NZ   N   4.847 -16.897  -4.935 1.00 . A A . 66 LYS NZ   1 1 
        1  1080 1 1 69 LYS O    O  -2.250 -16.914  -2.502 1.00 . A A . 66 LYS O    1 1 
        1  1081 1 1 70 ASP C    C  -5.253 -16.730  -3.913 1.00 . A A . 67 ASP C    1 1 
        1  1082 1 1 70 ASP CA   C  -4.464 -15.469  -3.638 1.00 . A A . 67 ASP CA   1 1 
        1  1083 1 1 70 ASP CB   C  -5.266 -14.163  -3.914 1.00 . A A . 67 ASP CB   1 1 
        1  1084 1 1 70 ASP CG   C  -6.348 -14.221  -5.010 1.00 . A A . 67 ASP CG   1 1 
        1  1085 1 1 70 ASP H    H  -2.871 -15.224  -5.056 1.00 . A A . 67 ASP H    1 1 
        1  1086 1 1 70 ASP HA   H  -4.344 -15.480  -2.582 1.00 . A A . 67 ASP HA   1 1 
        1  1087 1 1 70 ASP HB2  H  -5.750 -13.911  -2.979 1.00 . A A . 67 ASP HB2  1 1 
        1  1088 1 1 70 ASP HB3  H  -4.590 -13.376  -4.136 1.00 . A A . 67 ASP HB3  1 1 
        1  1089 1 1 70 ASP N    N  -3.049 -15.555  -4.146 1.00 . A A . 67 ASP N    1 1 
        1  1090 1 1 70 ASP O    O  -4.870 -17.523  -4.784 1.00 . A A . 67 ASP O    1 1 
        1  1091 1 1 70 ASP OD1  O  -7.509 -14.563  -4.687 1.00 . A A . 67 ASP OD1  1 1 
        1  1092 1 1 70 ASP OD2  O  -6.044 -13.902  -6.180 1.00 . A A . 67 ASP OD2  1 1 
        1  1093 1 1 71 GLY C    C  -6.871 -18.894  -1.708 1.00 . A A . 68 GLY C    1 1 
        1  1094 1 1 71 GLY CA   C  -6.900 -18.272  -3.098 1.00 . A A . 68 GLY CA   1 1 
        1  1095 1 1 71 GLY H    H  -6.765 -16.195  -2.699 1.00 . A A . 68 GLY H    1 1 
        1  1096 1 1 71 GLY HA2  H  -7.930 -18.238  -3.443 1.00 . A A . 68 GLY HA2  1 1 
        1  1097 1 1 71 GLY HA3  H  -6.343 -18.901  -3.774 1.00 . A A . 68 GLY HA3  1 1 
        1  1098 1 1 71 GLY N    N  -6.349 -16.945  -3.167 1.00 . A A . 68 GLY N    1 1 
        1  1099 1 1 71 GLY O    O  -6.710 -20.108  -1.627 1.00 . A A . 68 GLY O    1 1 
        1  1100 1 1 72 CYS C    C  -7.749 -19.757   1.043 1.00 . A A . 69 CYS C    1 1 
        1  1101 1 1 72 CYS CA   C  -6.831 -18.570   0.791 1.00 . A A . 69 CYS CA   1 1 
        1  1102 1 1 72 CYS CB   C  -7.194 -17.485   1.867 1.00 . A A . 69 CYS CB   1 1 
        1  1103 1 1 72 CYS H    H  -6.980 -17.095  -0.768 1.00 . A A . 69 CYS H    1 1 
        1  1104 1 1 72 CYS HA   H  -5.809 -18.880   0.945 1.00 . A A . 69 CYS HA   1 1 
        1  1105 1 1 72 CYS HB2  H  -6.427 -16.728   1.888 1.00 . A A . 69 CYS HB2  1 1 
        1  1106 1 1 72 CYS HB3  H  -8.154 -17.025   1.629 1.00 . A A . 69 CYS HB3  1 1 
        1  1107 1 1 72 CYS HG   H  -8.111 -19.178   3.578 1.00 . A A . 69 CYS HG   1 1 
        1  1108 1 1 72 CYS N    N  -6.946 -18.055  -0.613 1.00 . A A . 69 CYS N    1 1 
        1  1109 1 1 72 CYS O    O  -8.965 -19.695   0.844 1.00 . A A . 69 CYS O    1 1 
        1  1110 1 1 72 CYS SG   S  -7.328 -18.101   3.575 1.00 . A A . 69 CYS SG   1 1 
        1  1111 1 1 73 ASP C    C  -7.451 -22.765   3.042 1.00 . A A . 70 ASP C    1 1 
        1  1112 1 1 73 ASP CA   C  -7.771 -22.104   1.690 1.00 . A A . 70 ASP CA   1 1 
        1  1113 1 1 73 ASP CB   C  -7.419 -23.026   0.528 1.00 . A A . 70 ASP CB   1 1 
        1  1114 1 1 73 ASP CG   C  -8.657 -23.681  -0.046 1.00 . A A . 70 ASP CG   1 1 
        1  1115 1 1 73 ASP H    H  -6.152 -20.733   1.767 1.00 . A A . 70 ASP H    1 1 
        1  1116 1 1 73 ASP HA   H  -8.829 -21.893   1.644 1.00 . A A . 70 ASP HA   1 1 
        1  1117 1 1 73 ASP HB2  H  -6.948 -22.449  -0.253 1.00 . A A . 70 ASP HB2  1 1 
        1  1118 1 1 73 ASP HB3  H  -6.735 -23.797   0.865 1.00 . A A . 70 ASP HB3  1 1 
        1  1119 1 1 73 ASP N    N  -7.108 -20.825   1.528 1.00 . A A . 70 ASP N    1 1 
        1  1120 1 1 73 ASP O    O  -6.300 -22.690   3.527 1.00 . A A . 70 ASP O    1 1 
        1  1121 1 1 73 ASP OD1  O  -9.250 -24.552   0.638 1.00 . A A . 70 ASP OD1  1 1 
        1  1122 1 1 73 ASP OD2  O  -9.039 -23.334  -1.182 1.00 . A A . 70 ASP OD2  1 1 
        1  1123 1 1 74 PHE C    C  -9.304 -25.289   4.844 1.00 . A A . 71 PHE C    1 1 
        1  1124 1 1 74 PHE CA   C  -8.500 -23.991   4.922 1.00 . A A . 71 PHE CA   1 1 
        1  1125 1 1 74 PHE CB   C  -9.130 -23.003   5.912 1.00 . A A . 71 PHE CB   1 1 
        1  1126 1 1 74 PHE CD1  C  -7.599 -22.746   7.890 1.00 . A A . 71 PHE CD1  1 1 
        1  1127 1 1 74 PHE CD2  C  -9.573 -24.071   8.172 1.00 . A A . 71 PHE CD2  1 1 
        1  1128 1 1 74 PHE CE1  C  -7.247 -22.986   9.207 1.00 . A A . 71 PHE CE1  1 1 
        1  1129 1 1 74 PHE CE2  C  -9.220 -24.311   9.488 1.00 . A A . 71 PHE CE2  1 1 
        1  1130 1 1 74 PHE CG   C  -8.766 -23.279   7.355 1.00 . A A . 71 PHE CG   1 1 
        1  1131 1 1 74 PHE CZ   C  -8.057 -23.772  10.003 1.00 . A A . 71 PHE CZ   1 1 
        1  1132 1 1 74 PHE H    H  -9.202 -23.755   3.012 1.00 . A A . 71 PHE H    1 1 
        1  1133 1 1 74 PHE HA   H  -7.486 -24.216   5.229 1.00 . A A . 71 PHE HA   1 1 
        1  1134 1 1 74 PHE HB2  H  -8.797 -22.002   5.669 1.00 . A A . 71 PHE HB2  1 1 
        1  1135 1 1 74 PHE HB3  H -10.203 -23.052   5.822 1.00 . A A . 71 PHE HB3  1 1 
        1  1136 1 1 74 PHE HD1  H  -6.958 -22.136   7.270 1.00 . A A . 71 PHE HD1  1 1 
        1  1137 1 1 74 PHE HD2  H -10.481 -24.508   7.769 1.00 . A A . 71 PHE HD2  1 1 
        1  1138 1 1 74 PHE HE1  H  -6.340 -22.565   9.610 1.00 . A A . 71 PHE HE1  1 1 
        1  1139 1 1 74 PHE HE2  H  -9.855 -24.924  10.112 1.00 . A A . 71 PHE HE2  1 1 
        1  1140 1 1 74 PHE HZ   H  -7.787 -23.956  11.034 1.00 . A A . 71 PHE HZ   1 1 
        1  1141 1 1 74 PHE N    N  -8.458 -23.472   3.584 1.00 . A A . 71 PHE N    1 1 
        1  1142 1 1 74 PHE O    O -10.158 -25.396   3.955 1.00 . A A . 71 PHE O    1 1 
        1  1143 1 1 75 GLU C    C  -9.442 -28.494   4.566 1.00 . A A . 72 GLU C    1 1 
        1  1144 1 1 75 GLU CA   C  -9.692 -27.564   5.786 1.00 . A A . 72 GLU CA   1 1 
        1  1145 1 1 75 GLU CB   C -11.227 -27.311   6.007 1.00 . A A . 72 GLU CB   1 1 
        1  1146 1 1 75 GLU CD   C -13.550 -28.176   6.491 1.00 . A A . 72 GLU CD   1 1 
        1  1147 1 1 75 GLU CG   C -12.063 -28.428   6.646 1.00 . A A . 72 GLU CG   1 1 
        1  1148 1 1 75 GLU H    H  -8.242 -26.107   6.319 1.00 . A A . 72 GLU H    1 1 
        1  1149 1 1 75 GLU HA   H  -9.277 -28.051   6.659 1.00 . A A . 72 GLU HA   1 1 
        1  1150 1 1 75 GLU HB2  H -11.340 -26.429   6.617 1.00 . A A . 72 GLU HB2  1 1 
        1  1151 1 1 75 GLU HB3  H -11.659 -27.100   5.038 1.00 . A A . 72 GLU HB3  1 1 
        1  1152 1 1 75 GLU HG2  H -11.833 -29.374   6.174 1.00 . A A . 72 GLU HG2  1 1 
        1  1153 1 1 75 GLU HG3  H -11.844 -28.475   7.706 1.00 . A A . 72 GLU HG3  1 1 
        1  1154 1 1 75 GLU N    N  -8.966 -26.275   5.690 1.00 . A A . 72 GLU N    1 1 
        1  1155 1 1 75 GLU O    O -10.339 -28.797   3.770 1.00 . A A . 72 GLU O    1 1 
        1  1156 1 1 75 GLU OE1  O -14.055 -27.187   7.070 1.00 . A A . 72 GLU OE1  1 1 
        1  1157 1 1 75 GLU OE2  O -14.213 -28.969   5.791 1.00 . A A . 72 GLU OE2  1 1 
        1  1158 1 1 76 GLY C    C  -7.202 -29.376   2.113 1.00 . A A . 73 GLY C    1 1 
        1  1159 1 1 76 GLY CA   C  -7.756 -29.896   3.434 1.00 . A A . 73 GLY CA   1 1 
        1  1160 1 1 76 GLY H    H  -7.495 -28.506   5.011 1.00 . A A . 73 GLY H    1 1 
        1  1161 1 1 76 GLY HA2  H  -7.000 -30.513   3.891 1.00 . A A . 73 GLY HA2  1 1 
        1  1162 1 1 76 GLY HA3  H  -8.608 -30.519   3.215 1.00 . A A . 73 GLY HA3  1 1 
        1  1163 1 1 76 GLY N    N  -8.170 -28.885   4.419 1.00 . A A . 73 GLY N    1 1 
        1  1164 1 1 76 GLY O    O  -6.587 -30.149   1.369 1.00 . A A . 73 GLY O    1 1 
        1  1165 1 1 77 ASN C    C  -5.698 -26.412   1.678 1.00 . A A . 74 ASN C    1 1 
        1  1166 1 1 77 ASN CA   C  -6.455 -27.440   0.852 1.00 . A A . 74 ASN CA   1 1 
        1  1167 1 1 77 ASN CB   C  -7.116 -26.780  -0.428 1.00 . A A . 74 ASN CB   1 1 
        1  1168 1 1 77 ASN CG   C  -8.092 -27.665  -1.198 1.00 . A A . 74 ASN CG   1 1 
        1  1169 1 1 77 ASN H    H  -8.144 -27.615   2.190 1.00 . A A . 74 ASN H    1 1 
        1  1170 1 1 77 ASN HA   H  -5.743 -28.194   0.537 1.00 . A A . 74 ASN HA   1 1 
        1  1171 1 1 77 ASN HB2  H  -7.624 -25.838  -0.202 1.00 . A A . 74 ASN HB2  1 1 
        1  1172 1 1 77 ASN HB3  H  -6.317 -26.546  -1.109 1.00 . A A . 74 ASN HB3  1 1 
        1  1173 1 1 77 ASN HD21 H  -7.659 -26.654  -2.849 1.00 . A A . 74 ASN HD21 1 1 
        1  1174 1 1 77 ASN HD22 H  -8.821 -27.922  -3.019 1.00 . A A . 74 ASN HD22 1 1 
        1  1175 1 1 77 ASN N    N  -7.377 -28.097   1.805 1.00 . A A . 74 ASN N    1 1 
        1  1176 1 1 77 ASN ND2  N  -8.201 -27.390  -2.485 1.00 . A A . 74 ASN ND2  1 1 
        1  1177 1 1 77 ASN O    O  -6.321 -25.604   2.349 1.00 . A A . 74 ASN O    1 1 
        1  1178 1 1 77 ASN OD1  O  -8.757 -28.549  -0.665 1.00 . A A . 74 ASN OD1  1 1 
        1  1179 1 1 78 LYS C    C  -3.102 -24.354   1.866 1.00 . A A . 75 LYS C    1 1 
        1  1180 1 1 78 LYS CA   C  -3.621 -25.594   2.654 1.00 . A A . 75 LYS CA   1 1 
        1  1181 1 1 78 LYS CB   C  -2.436 -26.341   3.394 1.00 . A A . 75 LYS CB   1 1 
        1  1182 1 1 78 LYS CD   C  -2.882 -27.520   5.700 1.00 . A A . 75 LYS CD   1 1 
        1  1183 1 1 78 LYS CE   C  -4.325 -27.423   6.220 1.00 . A A . 75 LYS CE   1 1 
        1  1184 1 1 78 LYS CG   C  -2.393 -26.237   4.956 1.00 . A A . 75 LYS CG   1 1 
        1  1185 1 1 78 LYS H    H  -3.878 -27.131   1.102 1.00 . A A . 75 LYS H    1 1 
        1  1186 1 1 78 LYS HA   H  -4.327 -25.253   3.392 1.00 . A A . 75 LYS HA   1 1 
        1  1187 1 1 78 LYS HB2  H  -2.447 -27.392   3.143 1.00 . A A . 75 LYS HB2  1 1 
        1  1188 1 1 78 LYS HB3  H  -1.503 -25.924   3.018 1.00 . A A . 75 LYS HB3  1 1 
        1  1189 1 1 78 LYS HD2  H  -2.796 -28.378   5.057 1.00 . A A . 75 LYS HD2  1 1 
        1  1190 1 1 78 LYS HD3  H  -2.234 -27.682   6.560 1.00 . A A . 75 LYS HD3  1 1 
        1  1191 1 1 78 LYS HE2  H  -4.931 -26.830   5.549 1.00 . A A . 75 LYS HE2  1 1 
        1  1192 1 1 78 LYS HE3  H  -4.744 -28.421   6.297 1.00 . A A . 75 LYS HE3  1 1 
        1  1193 1 1 78 LYS HG2  H  -1.365 -26.047   5.254 1.00 . A A . 75 LYS HG2  1 1 
        1  1194 1 1 78 LYS HG3  H  -2.995 -25.404   5.272 1.00 . A A . 75 LYS HG3  1 1 
        1  1195 1 1 78 LYS HZ1  H  -3.986 -25.823   7.500 1.00 . A A . 75 LYS HZ1  1 1 
        1  1196 1 1 78 LYS HZ2  H  -3.809 -27.332   8.241 1.00 . A A . 75 LYS HZ2  1 1 
        1  1197 1 1 78 LYS HZ3  H  -5.353 -26.732   7.895 1.00 . A A . 75 LYS HZ3  1 1 
        1  1198 1 1 78 LYS N    N  -4.365 -26.502   1.735 1.00 . A A . 75 LYS N    1 1 
        1  1199 1 1 78 LYS NZ   N  -4.371 -26.781   7.557 1.00 . A A . 75 LYS NZ   1 1 
        1  1200 1 1 78 LYS O    O  -2.101 -24.504   1.170 1.00 . A A . 75 LYS O    1 1 
        1  1201 1 1 79 LEU C    C  -3.677 -20.528   1.667 1.00 . A A . 76 LEU C    1 1 
        1  1202 1 1 79 LEU CA   C  -3.178 -21.941   1.196 1.00 . A A . 76 LEU CA   1 1 
        1  1203 1 1 79 LEU CB   C  -3.548 -22.067  -0.311 1.00 . A A . 76 LEU CB   1 1 
        1  1204 1 1 79 LEU CD1  C  -2.857 -23.499  -2.237 1.00 . A A . 76 LEU CD1  1 1 
        1  1205 1 1 79 LEU CD2  C  -1.954 -21.181  -2.026 1.00 . A A . 76 LEU CD2  1 1 
        1  1206 1 1 79 LEU CG   C  -2.407 -22.419  -1.269 1.00 . A A . 76 LEU CG   1 1 
        1  1207 1 1 79 LEU H    H  -4.567 -23.015   2.484 1.00 . A A . 76 LEU H    1 1 
        1  1208 1 1 79 LEU HA   H  -2.100 -21.980   1.256 1.00 . A A . 76 LEU HA   1 1 
        1  1209 1 1 79 LEU HB2  H  -4.317 -22.810  -0.418 1.00 . A A . 76 LEU HB2  1 1 
        1  1210 1 1 79 LEU HB3  H  -3.955 -21.118  -0.620 1.00 . A A . 76 LEU HB3  1 1 
        1  1211 1 1 79 LEU HD11 H  -2.052 -23.728  -2.922 1.00 . A A . 76 LEU HD11 1 1 
        1  1212 1 1 79 LEU HD12 H  -3.715 -23.151  -2.790 1.00 . A A . 76 LEU HD12 1 1 
        1  1213 1 1 79 LEU HD13 H  -3.120 -24.387  -1.682 1.00 . A A . 76 LEU HD13 1 1 
        1  1214 1 1 79 LEU HD21 H  -1.128 -21.437  -2.679 1.00 . A A . 76 LEU HD21 1 1 
        1  1215 1 1 79 LEU HD22 H  -1.634 -20.426  -1.324 1.00 . A A . 76 LEU HD22 1 1 
        1  1216 1 1 79 LEU HD23 H  -2.774 -20.801  -2.616 1.00 . A A . 76 LEU HD23 1 1 
        1  1217 1 1 79 LEU HG   H  -1.569 -22.798  -0.709 1.00 . A A . 76 LEU HG   1 1 
        1  1218 1 1 79 LEU N    N  -3.736 -23.121   1.960 1.00 . A A . 76 LEU N    1 1 
        1  1219 1 1 79 LEU O    O  -4.387 -19.925   0.918 1.00 . A A . 76 LEU O    1 1 
        1  1220 1 1 80 ARG C    C  -2.959 -17.404   2.878 1.00 . A A . 77 ARG C    1 1 
        1  1221 1 1 80 ARG CA   C  -3.870 -18.625   3.285 1.00 . A A . 77 ARG CA   1 1 
        1  1222 1 1 80 ARG CB   C  -4.148 -18.685   4.844 1.00 . A A . 77 ARG CB   1 1 
        1  1223 1 1 80 ARG CD   C  -4.678 -16.144   5.374 1.00 . A A . 77 ARG CD   1 1 
        1  1224 1 1 80 ARG CG   C  -3.841 -17.403   5.679 1.00 . A A . 77 ARG CG   1 1 
        1  1225 1 1 80 ARG CZ   C  -6.139 -15.091   7.107 1.00 . A A . 77 ARG CZ   1 1 
        1  1226 1 1 80 ARG H    H  -2.575 -20.324   3.379 1.00 . A A . 77 ARG H    1 1 
        1  1227 1 1 80 ARG HA   H  -4.822 -18.521   2.786 1.00 . A A . 77 ARG HA   1 1 
        1  1228 1 1 80 ARG HB2  H  -5.190 -18.968   5.009 1.00 . A A . 77 ARG HB2  1 1 
        1  1229 1 1 80 ARG HB3  H  -3.540 -19.486   5.255 1.00 . A A . 77 ARG HB3  1 1 
        1  1230 1 1 80 ARG HD2  H  -4.046 -15.279   5.540 1.00 . A A . 77 ARG HD2  1 1 
        1  1231 1 1 80 ARG HD3  H  -4.967 -16.140   4.336 1.00 . A A . 77 ARG HD3  1 1 
        1  1232 1 1 80 ARG HE   H  -6.553 -16.773   6.087 1.00 . A A . 77 ARG HE   1 1 
        1  1233 1 1 80 ARG HG2  H  -3.986 -17.640   6.724 1.00 . A A . 77 ARG HG2  1 1 
        1  1234 1 1 80 ARG HG3  H  -2.801 -17.161   5.534 1.00 . A A . 77 ARG HG3  1 1 
        1  1235 1 1 80 ARG HH11 H  -4.428 -14.057   6.778 1.00 . A A . 77 ARG HH11 1 1 
        1  1236 1 1 80 ARG HH12 H  -5.480 -13.377   7.967 1.00 . A A . 77 ARG HH12 1 1 
        1  1237 1 1 80 ARG HH21 H  -7.932 -15.855   7.670 1.00 . A A . 77 ARG HH21 1 1 
        1  1238 1 1 80 ARG HH22 H  -7.473 -14.401   8.481 1.00 . A A . 77 ARG HH22 1 1 
        1  1239 1 1 80 ARG N    N  -3.282 -19.932   2.833 1.00 . A A . 77 ARG N    1 1 
        1  1240 1 1 80 ARG NE   N  -5.888 -16.061   6.209 1.00 . A A . 77 ARG NE   1 1 
        1  1241 1 1 80 ARG NH1  N  -5.277 -14.097   7.299 1.00 . A A . 77 ARG NH1  1 1 
        1  1242 1 1 80 ARG NH2  N  -7.272 -15.115   7.806 1.00 . A A . 77 ARG NH2  1 1 
        1  1243 1 1 80 ARG O    O  -1.814 -17.303   3.314 1.00 . A A . 77 ARG O    1 1 
        1  1244 1 1 81 VAL C    C  -3.701 -14.010   1.919 1.00 . A A . 78 VAL C    1 1 
        1  1245 1 1 81 VAL CA   C  -2.713 -15.221   1.759 1.00 . A A . 78 VAL CA   1 1 
        1  1246 1 1 81 VAL CB   C  -1.989 -15.267   0.341 1.00 . A A . 78 VAL CB   1 1 
        1  1247 1 1 81 VAL CG1  C  -1.495 -13.893  -0.083 1.00 . A A . 78 VAL CG1  1 1 
        1  1248 1 1 81 VAL CG2  C  -0.786 -16.240   0.386 1.00 . A A . 78 VAL CG2  1 1 
        1  1249 1 1 81 VAL H    H  -4.368 -16.545   1.642 1.00 . A A . 78 VAL H    1 1 
        1  1250 1 1 81 VAL HA   H  -1.947 -15.159   2.521 1.00 . A A . 78 VAL HA   1 1 
        1  1251 1 1 81 VAL HB   H  -2.685 -15.623  -0.431 1.00 . A A . 78 VAL HB   1 1 
        1  1252 1 1 81 VAL HG11 H  -1.648 -13.766  -1.141 1.00 . A A . 78 VAL HG11 1 1 
        1  1253 1 1 81 VAL HG12 H  -0.439 -13.804   0.131 1.00 . A A . 78 VAL HG12 1 1 
        1  1254 1 1 81 VAL HG13 H  -2.035 -13.130   0.460 1.00 . A A . 78 VAL HG13 1 1 
        1  1255 1 1 81 VAL HG21 H  -1.120 -17.252   0.230 1.00 . A A . 78 VAL HG21 1 1 
        1  1256 1 1 81 VAL HG22 H  -0.300 -16.184   1.353 1.00 . A A . 78 VAL HG22 1 1 
        1  1257 1 1 81 VAL HG23 H  -0.069 -15.970  -0.375 1.00 . A A . 78 VAL HG23 1 1 
        1  1258 1 1 81 VAL N    N  -3.458 -16.455   2.033 1.00 . A A . 78 VAL N    1 1 
        1  1259 1 1 81 VAL O    O  -4.703 -13.988   1.203 1.00 . A A . 78 VAL O    1 1 
        1  1260 1 1 82 GLU C    C  -3.846 -10.615   3.487 1.00 . A A . 79 GLU C    1 1 
        1  1261 1 1 82 GLU CA   C  -4.477 -11.968   3.112 1.00 . A A . 79 GLU CA   1 1 
        1  1262 1 1 82 GLU CB   C  -5.432 -12.488   4.220 1.00 . A A . 79 GLU CB   1 1 
        1  1263 1 1 82 GLU CD   C  -7.361 -10.740   3.998 1.00 . A A . 79 GLU CD   1 1 
        1  1264 1 1 82 GLU CG   C  -6.381 -11.481   4.920 1.00 . A A . 79 GLU CG   1 1 
        1  1265 1 1 82 GLU H    H  -2.640 -12.979   3.364 1.00 . A A . 79 GLU H    1 1 
        1  1266 1 1 82 GLU HA   H  -5.057 -11.832   2.217 1.00 . A A . 79 GLU HA   1 1 
        1  1267 1 1 82 GLU HB2  H  -6.056 -13.243   3.765 1.00 . A A . 79 GLU HB2  1 1 
        1  1268 1 1 82 GLU HB3  H  -4.827 -12.963   4.986 1.00 . A A . 79 GLU HB3  1 1 
        1  1269 1 1 82 GLU HG2  H  -6.963 -12.045   5.638 1.00 . A A . 79 GLU HG2  1 1 
        1  1270 1 1 82 GLU HG3  H  -5.796 -10.747   5.472 1.00 . A A . 79 GLU HG3  1 1 
        1  1271 1 1 82 GLU N    N  -3.471 -13.019   2.858 1.00 . A A . 79 GLU N    1 1 
        1  1272 1 1 82 GLU O    O  -2.919 -10.524   4.329 1.00 . A A . 79 GLU O    1 1 
        1  1273 1 1 82 GLU OE1  O  -7.293 -10.908   2.761 1.00 . A A . 79 GLU OE1  1 1 
        1  1274 1 1 82 GLU OE2  O  -8.216  -9.986   4.524 1.00 . A A . 79 GLU OE2  1 1 
        1  1275 1 1 83 VAL C    C  -5.096  -7.624   4.203 1.00 . A A . 80 VAL C    1 1 
        1  1276 1 1 83 VAL CA   C  -4.086  -8.188   3.210 1.00 . A A . 80 VAL CA   1 1 
        1  1277 1 1 83 VAL CB   C  -4.031  -7.217   2.003 1.00 . A A . 80 VAL CB   1 1 
        1  1278 1 1 83 VAL CG1  C  -2.626  -7.115   1.449 1.00 . A A . 80 VAL CG1  1 1 
        1  1279 1 1 83 VAL CG2  C  -5.023  -7.588   0.898 1.00 . A A . 80 VAL CG2  1 1 
        1  1280 1 1 83 VAL H    H  -5.018  -9.723   2.104 1.00 . A A . 80 VAL H    1 1 
        1  1281 1 1 83 VAL HA   H  -3.108  -8.189   3.677 1.00 . A A . 80 VAL HA   1 1 
        1  1282 1 1 83 VAL HB   H  -4.301  -6.242   2.370 1.00 . A A . 80 VAL HB   1 1 
        1  1283 1 1 83 VAL HG11 H  -1.996  -6.607   2.160 1.00 . A A . 80 VAL HG11 1 1 
        1  1284 1 1 83 VAL HG12 H  -2.639  -6.558   0.514 1.00 . A A . 80 VAL HG12 1 1 
        1  1285 1 1 83 VAL HG13 H  -2.227  -8.094   1.275 1.00 . A A . 80 VAL HG13 1 1 
        1  1286 1 1 83 VAL HG21 H  -6.031  -7.523   1.286 1.00 . A A . 80 VAL HG21 1 1 
        1  1287 1 1 83 VAL HG22 H  -4.837  -8.599   0.562 1.00 . A A . 80 VAL HG22 1 1 
        1  1288 1 1 83 VAL HG23 H  -4.912  -6.909   0.065 1.00 . A A . 80 VAL HG23 1 1 
        1  1289 1 1 83 VAL N    N  -4.384  -9.560   2.849 1.00 . A A . 80 VAL N    1 1 
        1  1290 1 1 83 VAL O    O  -6.293  -7.586   3.925 1.00 . A A . 80 VAL O    1 1 
        1  1291 1 1 84 PRO C    C  -5.432  -4.766   5.747 1.00 . A A . 81 PRO C    1 1 
        1  1292 1 1 84 PRO CA   C  -5.452  -6.239   6.199 1.00 . A A . 81 PRO CA   1 1 
        1  1293 1 1 84 PRO CB   C  -4.818  -6.411   7.581 1.00 . A A . 81 PRO CB   1 1 
        1  1294 1 1 84 PRO CD   C  -3.288  -7.297   5.897 1.00 . A A . 81 PRO CD   1 1 
        1  1295 1 1 84 PRO CG   C  -3.468  -7.028   7.370 1.00 . A A . 81 PRO CG   1 1 
        1  1296 1 1 84 PRO HA   H  -6.479  -6.583   6.222 1.00 . A A . 81 PRO HA   1 1 
        1  1297 1 1 84 PRO HB2  H  -4.729  -5.447   8.055 1.00 . A A . 81 PRO HB2  1 1 
        1  1298 1 1 84 PRO HB3  H  -5.430  -7.066   8.184 1.00 . A A . 81 PRO HB3  1 1 
        1  1299 1 1 84 PRO HD2  H  -2.579  -6.602   5.472 1.00 . A A . 81 PRO HD2  1 1 
        1  1300 1 1 84 PRO HD3  H  -2.962  -8.316   5.742 1.00 . A A . 81 PRO HD3  1 1 
        1  1301 1 1 84 PRO HG2  H  -2.707  -6.341   7.710 1.00 . A A . 81 PRO HG2  1 1 
        1  1302 1 1 84 PRO HG3  H  -3.401  -7.955   7.918 1.00 . A A . 81 PRO HG3  1 1 
        1  1303 1 1 84 PRO N    N  -4.625  -7.085   5.336 1.00 . A A . 81 PRO N    1 1 
        1  1304 1 1 84 PRO O    O  -5.670  -3.845   6.534 1.00 . A A . 81 PRO O    1 1 
        1  1305 1 1 85 PHE C    C  -6.367  -3.087   2.905 1.00 . A A . 82 PHE C    1 1 
        1  1306 1 1 85 PHE CA   C  -5.197  -3.210   3.855 1.00 . A A . 82 PHE CA   1 1 
        1  1307 1 1 85 PHE CB   C  -3.908  -2.794   3.085 1.00 . A A . 82 PHE CB   1 1 
        1  1308 1 1 85 PHE CD1  C  -2.362  -2.745   5.056 1.00 . A A . 82 PHE CD1  1 1 
        1  1309 1 1 85 PHE CD2  C  -1.611  -3.788   3.071 1.00 . A A . 82 PHE CD2  1 1 
        1  1310 1 1 85 PHE CE1  C  -1.169  -3.022   5.645 1.00 . A A . 82 PHE CE1  1 1 
        1  1311 1 1 85 PHE CE2  C  -0.406  -4.048   3.666 1.00 . A A . 82 PHE CE2  1 1 
        1  1312 1 1 85 PHE CG   C  -2.608  -3.127   3.757 1.00 . A A . 82 PHE CG   1 1 
        1  1313 1 1 85 PHE CZ   C  -0.190  -3.666   4.945 1.00 . A A . 82 PHE CZ   1 1 
        1  1314 1 1 85 PHE H    H  -4.980  -5.352   3.897 1.00 . A A . 82 PHE H    1 1 
        1  1315 1 1 85 PHE HA   H  -5.353  -2.515   4.661 1.00 . A A . 82 PHE HA   1 1 
        1  1316 1 1 85 PHE HB2  H  -3.891  -3.214   2.081 1.00 . A A . 82 PHE HB2  1 1 
        1  1317 1 1 85 PHE HB3  H  -3.931  -1.718   2.980 1.00 . A A . 82 PHE HB3  1 1 
        1  1318 1 1 85 PHE HD1  H  -3.123  -2.230   5.622 1.00 . A A . 82 PHE HD1  1 1 
        1  1319 1 1 85 PHE HD2  H  -1.782  -4.105   2.053 1.00 . A A . 82 PHE HD2  1 1 
        1  1320 1 1 85 PHE HE1  H  -0.987  -2.722   6.667 1.00 . A A . 82 PHE HE1  1 1 
        1  1321 1 1 85 PHE HE2  H   0.378  -4.565   3.121 1.00 . A A . 82 PHE HE2  1 1 
        1  1322 1 1 85 PHE HZ   H   0.758  -3.874   5.415 1.00 . A A . 82 PHE HZ   1 1 
        1  1323 1 1 85 PHE N    N  -5.167  -4.563   4.455 1.00 . A A . 82 PHE N    1 1 
        1  1324 1 1 85 PHE O    O  -6.893  -1.987   2.719 1.00 . A A . 82 PHE O    1 1 
        1  1325 1 1 86 ASN C    C  -7.451  -3.375   0.058 1.00 . A A . 83 ASN C    1 1 
        1  1326 1 1 86 ASN CA   C  -7.791  -4.305   1.250 1.00 . A A . 83 ASN CA   1 1 
        1  1327 1 1 86 ASN CB   C  -9.225  -3.976   1.767 1.00 . A A . 83 ASN CB   1 1 
        1  1328 1 1 86 ASN CG   C  -9.857  -5.051   2.649 1.00 . A A . 83 ASN CG   1 1 
        1  1329 1 1 86 ASN H    H  -6.379  -5.084   2.674 1.00 . A A . 83 ASN H    1 1 
        1  1330 1 1 86 ASN HA   H  -7.793  -5.319   0.895 1.00 . A A . 83 ASN HA   1 1 
        1  1331 1 1 86 ASN HB2  H  -9.203  -3.049   2.322 1.00 . A A . 83 ASN HB2  1 1 
        1  1332 1 1 86 ASN HB3  H  -9.867  -3.840   0.905 1.00 . A A . 83 ASN HB3  1 1 
        1  1333 1 1 86 ASN HD21 H  -8.102  -5.610   3.387 1.00 . A A . 83 ASN HD21 1 1 
        1  1334 1 1 86 ASN HD22 H  -9.471  -6.474   3.984 1.00 . A A . 83 ASN HD22 1 1 
        1  1335 1 1 86 ASN N    N  -6.765  -4.235   2.327 1.00 . A A . 83 ASN N    1 1 
        1  1336 1 1 86 ASN ND2  N  -9.062  -5.781   3.421 1.00 . A A . 83 ASN ND2  1 1 
        1  1337 1 1 86 ASN O    O  -8.260  -2.514  -0.287 1.00 . A A . 83 ASN O    1 1 
        1  1338 1 1 86 ASN OD1  O -11.078  -5.209   2.650 1.00 . A A . 83 ASN OD1  1 1 
        1  1339 1 1 87 ALA C    C  -5.348  -1.225  -1.192 1.00 . A A . 84 ALA C    1 1 
        1  1340 1 1 87 ALA CA   C  -5.673  -2.667  -1.623 1.00 . A A . 84 ALA CA   1 1 
        1  1341 1 1 87 ALA CB   C  -6.587  -2.633  -2.847 1.00 . A A . 84 ALA CB   1 1 
        1  1342 1 1 87 ALA H    H  -5.645  -4.244  -0.210 1.00 . A A . 84 ALA H    1 1 
        1  1343 1 1 87 ALA HA   H  -4.740  -3.120  -1.937 1.00 . A A . 84 ALA HA   1 1 
        1  1344 1 1 87 ALA HB1  H  -6.078  -2.135  -3.666 1.00 . A A . 84 ALA HB1  1 1 
        1  1345 1 1 87 ALA HB2  H  -7.480  -2.082  -2.599 1.00 . A A . 84 ALA HB2  1 1 
        1  1346 1 1 87 ALA HB3  H  -6.848  -3.639  -3.141 1.00 . A A . 84 ALA HB3  1 1 
        1  1347 1 1 87 ALA N    N  -6.218  -3.525  -0.526 1.00 . A A . 84 ALA N    1 1 
        1  1348 1 1 87 ALA O    O  -4.810  -0.462  -2.014 1.00 . A A . 84 ALA O    1 1 
        1  1349 1 1 88 ARG C    C  -6.733   1.331   0.212 1.00 . A A . 85 ARG C    1 1 
        1  1350 1 1 88 ARG CA   C  -5.563   0.454   0.692 1.00 . A A . 85 ARG CA   1 1 
        1  1351 1 1 88 ARG CB   C  -4.184   1.121   0.401 1.00 . A A . 85 ARG CB   1 1 
        1  1352 1 1 88 ARG CD   C  -4.015   3.627   0.010 1.00 . A A . 85 ARG CD   1 1 
        1  1353 1 1 88 ARG CG   C  -3.918   2.490   1.037 1.00 . A A . 85 ARG CG   1 1 
        1  1354 1 1 88 ARG CZ   C  -2.045   5.114  -0.266 1.00 . A A . 85 ARG CZ   1 1 
        1  1355 1 1 88 ARG H    H  -6.024  -1.623   0.657 1.00 . A A . 85 ARG H    1 1 
        1  1356 1 1 88 ARG HA   H  -5.673   0.312   1.767 1.00 . A A . 85 ARG HA   1 1 
        1  1357 1 1 88 ARG HB2  H  -3.405   0.444   0.717 1.00 . A A . 85 ARG HB2  1 1 
        1  1358 1 1 88 ARG HB3  H  -4.101   1.244  -0.672 1.00 . A A . 85 ARG HB3  1 1 
        1  1359 1 1 88 ARG HD2  H  -3.710   3.267  -0.963 1.00 . A A . 85 ARG HD2  1 1 
        1  1360 1 1 88 ARG HD3  H  -5.041   3.967  -0.043 1.00 . A A . 85 ARG HD3  1 1 
        1  1361 1 1 88 ARG HE   H  -3.482   5.331   1.125 1.00 . A A . 85 ARG HE   1 1 
        1  1362 1 1 88 ARG HG2  H  -4.640   2.662   1.821 1.00 . A A . 85 ARG HG2  1 1 
        1  1363 1 1 88 ARG HG3  H  -2.923   2.489   1.460 1.00 . A A . 85 ARG HG3  1 1 
        1  1364 1 1 88 ARG HH11 H  -2.107   3.616  -1.638 1.00 . A A . 85 ARG HH11 1 1 
        1  1365 1 1 88 ARG HH12 H  -0.755   4.684  -1.781 1.00 . A A . 85 ARG HH12 1 1 
        1  1366 1 1 88 ARG HH21 H  -1.680   6.699   0.936 1.00 . A A . 85 ARG HH21 1 1 
        1  1367 1 1 88 ARG HH22 H  -0.512   6.436  -0.318 1.00 . A A . 85 ARG HH22 1 1 
        1  1368 1 1 88 ARG N    N  -5.662  -0.902   0.090 1.00 . A A . 85 ARG N    1 1 
        1  1369 1 1 88 ARG NE   N  -3.171   4.769   0.371 1.00 . A A . 85 ARG NE   1 1 
        1  1370 1 1 88 ARG NH1  N  -1.600   4.413  -1.316 1.00 . A A . 85 ARG NH1  1 1 
        1  1371 1 1 88 ARG NH2  N  -1.357   6.166   0.149 1.00 . A A . 85 ARG NH2  1 1 
        1  1372 1 1 88 ARG O    O  -7.029   1.402  -0.986 1.00 . A A . 85 ARG O    1 1 
        1  1373 1 1 89 GLU C    C  -8.099   4.256   0.521 1.00 . A A . 86 GLU C    1 1 
        1  1374 1 1 89 GLU CA   C  -8.540   2.842   0.900 1.00 . A A . 86 GLU CA   1 1 
        1  1375 1 1 89 GLU CB   C  -9.453   2.877   2.151 1.00 . A A . 86 GLU CB   1 1 
        1  1376 1 1 89 GLU CD   C -11.206   1.069   1.682 1.00 . A A . 86 GLU CD   1 1 
        1  1377 1 1 89 GLU CG   C -10.939   2.555   1.887 1.00 . A A . 86 GLU CG   1 1 
        1  1378 1 1 89 GLU H    H  -6.997   2.030   2.062 1.00 . A A . 86 GLU H    1 1 
        1  1379 1 1 89 GLU HA   H  -9.076   2.403   0.072 1.00 . A A . 86 GLU HA   1 1 
        1  1380 1 1 89 GLU HB2  H  -9.080   2.159   2.873 1.00 . A A . 86 GLU HB2  1 1 
        1  1381 1 1 89 GLU HB3  H  -9.392   3.865   2.589 1.00 . A A . 86 GLU HB3  1 1 
        1  1382 1 1 89 GLU HG2  H -11.531   2.885   2.733 1.00 . A A . 86 GLU HG2  1 1 
        1  1383 1 1 89 GLU HG3  H -11.264   3.087   0.999 1.00 . A A . 86 GLU HG3  1 1 
        1  1384 1 1 89 GLU N    N  -7.358   2.029   1.163 1.00 . A A . 86 GLU N    1 1 
        1  1385 1 1 89 GLU O    O  -8.114   4.590  -0.683 1.00 . A A . 86 GLU O    1 1 
        1  1386 1 1 89 GLU OXT  O  -7.685   5.001   1.432 1.00 . A A . 86 GLU OXT  1 1 
        1  1387 1 1 89 GLU OE1  O -11.369   0.348   2.698 1.00 . A A . 86 GLU OE1  1 1 
        1  1388 1 1 89 GLU OE2  O -11.282   0.624   0.516 1.00 . A A . 86 GLU OE2  1 1 
        2  1389 1 1  1 GLY C    C -11.421   0.118   1.072 1.00 . A A . -2 GLY C    1 1 
        2  1390 1 1  1 GLY CA   C -12.662  -0.558   1.610 1.00 . A A . -2 GLY CA   1 1 
        2  1391 1 1  1 GLY H1   H -13.294  -2.445   2.237 1.00 . A A . -2 GLY H1   1 1 
        2  1392 1 1  1 GLY H2   H -11.648  -2.151   2.485 1.00 . A A . -2 GLY H2   1 1 
        2  1393 1 1  1 GLY H3   H -12.223  -2.474   0.931 1.00 . A A . -2 GLY H3   1 1 
        2  1394 1 1  1 GLY HA2  H -13.462  -0.435   0.898 1.00 . A A . -2 GLY HA2  1 1 
        2  1395 1 1  1 GLY HA3  H -12.943  -0.093   2.543 1.00 . A A . -2 GLY HA3  1 1 
        2  1396 1 1  1 GLY N    N -12.442  -2.008   1.834 1.00 . A A . -2 GLY N    1 1 
        2  1397 1 1  1 GLY O    O -10.499  -0.564   0.623 1.00 . A A . -2 GLY O    1 1 
        2  1398 1 1  2 SER C    C -10.242   3.609   1.361 1.00 . A A . -1 SER C    1 1 
        2  1399 1 1  2 SER CA   C -10.237   2.229   0.681 1.00 . A A . -1 SER CA   1 1 
        2  1400 1 1  2 SER CB   C -10.227   2.387  -0.852 1.00 . A A . -1 SER CB   1 1 
        2  1401 1 1  2 SER H    H -12.200   1.934   1.411 1.00 . A A . -1 SER H    1 1 
        2  1402 1 1  2 SER HA   H  -9.355   1.690   0.988 1.00 . A A . -1 SER HA   1 1 
        2  1403 1 1  2 SER HB2  H -10.430   1.430  -1.312 1.00 . A A . -1 SER HB2  1 1 
        2  1404 1 1  2 SER HB3  H -10.990   3.093  -1.143 1.00 . A A . -1 SER HB3  1 1 
        2  1405 1 1  2 SER HG   H  -8.876   2.649  -2.251 1.00 . A A . -1 SER HG   1 1 
        2  1406 1 1  2 SER N    N -11.403   1.454   1.106 1.00 . A A . -1 SER N    1 1 
        2  1407 1 1  2 SER O    O -11.307   4.178   1.623 1.00 . A A . -1 SER O    1 1 
        2  1408 1 1  2 SER OG   O  -8.972   2.856  -1.315 1.00 . A A . -1 SER OG   1 1 
        2  1409 1 1  3 HIS C    C  -7.677   6.126   1.591 1.00 . A A .  0 HIS C    1 1 
        2  1410 1 1  3 HIS CA   C  -8.856   5.443   2.275 1.00 . A A .  0 HIS CA   1 1 
        2  1411 1 1  3 HIS CB   C  -8.583   5.381   3.800 1.00 . A A .  0 HIS CB   1 1 
        2  1412 1 1  3 HIS CD2  C  -9.700   3.671   5.399 1.00 . A A .  0 HIS CD2  1 1 
        2  1413 1 1  3 HIS CE1  C -11.706   4.537   5.466 1.00 . A A .  0 HIS CE1  1 1 
        2  1414 1 1  3 HIS CG   C  -9.686   4.780   4.625 1.00 . A A .  0 HIS CG   1 1 
        2  1415 1 1  3 HIS H    H  -8.245   3.588   1.458 1.00 . A A .  0 HIS H    1 1 
        2  1416 1 1  3 HIS HA   H  -9.751   6.023   2.095 1.00 . A A .  0 HIS HA   1 1 
        2  1417 1 1  3 HIS HB2  H  -7.694   4.795   3.968 1.00 . A A .  0 HIS HB2  1 1 
        2  1418 1 1  3 HIS HB3  H  -8.411   6.384   4.163 1.00 . A A .  0 HIS HB3  1 1 
        2  1419 1 1  3 HIS HD1  H -11.279   6.116   4.237 1.00 . A A .  0 HIS HD1  1 1 
        2  1420 1 1  3 HIS HD2  H  -8.868   3.000   5.567 1.00 . A A .  0 HIS HD2  1 1 
        2  1421 1 1  3 HIS HE1  H -12.751   4.685   5.681 1.00 . A A .  0 HIS HE1  1 1 
        2  1422 1 1  3 HIS HE2  H -11.206   2.960   6.668 1.00 . A A .  0 HIS HE2  1 1 
        2  1423 1 1  3 HIS N    N  -9.044   4.114   1.674 1.00 . A A .  0 HIS N    1 1 
        2  1424 1 1  3 HIS ND1  N -10.962   5.304   4.693 1.00 . A A .  0 HIS ND1  1 1 
        2  1425 1 1  3 HIS NE2  N -10.965   3.539   5.910 1.00 . A A .  0 HIS NE2  1 1 
        2  1426 1 1  3 HIS O    O  -6.837   5.456   1.000 1.00 . A A .  0 HIS O    1 1 
        2  1427 1 1  4 MET C    C  -5.976   9.208   2.161 1.00 . A A .  1 MET C    1 1 
        2  1428 1 1  4 MET CA   C  -6.499   8.219   1.111 1.00 . A A .  1 MET CA   1 1 
        2  1429 1 1  4 MET CB   C  -6.850   8.978  -0.186 1.00 . A A .  1 MET CB   1 1 
        2  1430 1 1  4 MET CE   C  -9.629   8.742  -2.071 1.00 . A A .  1 MET CE   1 1 
        2  1431 1 1  4 MET CG   C  -6.993   8.099  -1.435 1.00 . A A .  1 MET CG   1 1 
        2  1432 1 1  4 MET H    H  -8.398   7.940   2.017 1.00 . A A .  1 MET H    1 1 
        2  1433 1 1  4 MET HA   H  -5.712   7.513   0.894 1.00 . A A .  1 MET HA   1 1 
        2  1434 1 1  4 MET HB2  H  -7.780   9.502  -0.037 1.00 . A A .  1 MET HB2  1 1 
        2  1435 1 1  4 MET HB3  H  -6.072   9.703  -0.374 1.00 . A A .  1 MET HB3  1 1 
        2  1436 1 1  4 MET HE1  H  -9.599   9.475  -1.279 1.00 . A A .  1 MET HE1  1 1 
        2  1437 1 1  4 MET HE2  H -10.649   8.420  -2.225 1.00 . A A .  1 MET HE2  1 1 
        2  1438 1 1  4 MET HE3  H  -9.250   9.180  -2.982 1.00 . A A .  1 MET HE3  1 1 
        2  1439 1 1  4 MET HG2  H  -6.807   8.707  -2.305 1.00 . A A .  1 MET HG2  1 1 
        2  1440 1 1  4 MET HG3  H  -6.249   7.317  -1.387 1.00 . A A .  1 MET HG3  1 1 
        2  1441 1 1  4 MET N    N  -7.640   7.457   1.634 1.00 . A A .  1 MET N    1 1 
        2  1442 1 1  4 MET O    O  -5.182  10.098   1.857 1.00 . A A .  1 MET O    1 1 
        2  1443 1 1  4 MET SD   S  -8.621   7.332  -1.620 1.00 . A A .  1 MET SD   1 1 
        2  1444 1 1  5 VAL C    C  -5.392   9.071   5.629 1.00 . A A .  2 VAL C    1 1 
        2  1445 1 1  5 VAL CA   C  -6.042   9.899   4.514 1.00 . A A .  2 VAL CA   1 1 
        2  1446 1 1  5 VAL CB   C  -7.270  10.693   5.072 1.00 . A A .  2 VAL CB   1 1 
        2  1447 1 1  5 VAL CG1  C  -7.722  11.770   4.088 1.00 . A A .  2 VAL CG1  1 1 
        2  1448 1 1  5 VAL CG2  C  -8.441   9.764   5.395 1.00 . A A .  2 VAL CG2  1 1 
        2  1449 1 1  5 VAL H    H  -6.955   8.229   3.599 1.00 . A A .  2 VAL H    1 1 
        2  1450 1 1  5 VAL HA   H  -5.319  10.607   4.139 1.00 . A A .  2 VAL HA   1 1 
        2  1451 1 1  5 VAL HB   H  -6.966  11.182   5.988 1.00 . A A .  2 VAL HB   1 1 
        2  1452 1 1  5 VAL HG11 H  -8.579  12.295   4.489 1.00 . A A .  2 VAL HG11 1 1 
        2  1453 1 1  5 VAL HG12 H  -7.988  11.309   3.151 1.00 . A A .  2 VAL HG12 1 1 
        2  1454 1 1  5 VAL HG13 H  -6.915  12.471   3.928 1.00 . A A .  2 VAL HG13 1 1 
        2  1455 1 1  5 VAL HG21 H  -8.737   9.235   4.500 1.00 . A A .  2 VAL HG21 1 1 
        2  1456 1 1  5 VAL HG22 H  -9.272  10.347   5.764 1.00 . A A .  2 VAL HG22 1 1 
        2  1457 1 1  5 VAL HG23 H  -8.139   9.054   6.148 1.00 . A A .  2 VAL HG23 1 1 
        2  1458 1 1  5 VAL N    N  -6.409   9.016   3.406 1.00 . A A .  2 VAL N    1 1 
        2  1459 1 1  5 VAL O    O  -5.172   7.876   5.434 1.00 . A A .  2 VAL O    1 1 
        2  1460 1 1  6 ILE C    C  -3.067   8.687   7.704 1.00 . A A .  3 ILE C    1 1 
        2  1461 1 1  6 ILE CA   C  -4.529   9.078   7.983 1.00 . A A .  3 ILE CA   1 1 
        2  1462 1 1  6 ILE CB   C  -5.424   7.866   8.487 1.00 . A A .  3 ILE CB   1 1 
        2  1463 1 1  6 ILE CD1  C  -7.883   7.258   8.871 1.00 . A A .  3 ILE CD1  1 1 
        2  1464 1 1  6 ILE CG1  C  -6.849   8.370   8.809 1.00 . A A .  3 ILE CG1  1 1 
        2  1465 1 1  6 ILE CG2  C  -4.854   7.118   9.719 1.00 . A A .  3 ILE CG2  1 1 
        2  1466 1 1  6 ILE H    H  -5.298  10.673   6.825 1.00 . A A .  3 ILE H    1 1 
        2  1467 1 1  6 ILE HA   H  -4.517   9.827   8.762 1.00 . A A .  3 ILE HA   1 1 
        2  1468 1 1  6 ILE HB   H  -5.491   7.154   7.682 1.00 . A A .  3 ILE HB   1 1 
        2  1469 1 1  6 ILE HD11 H  -7.598   6.538   9.625 1.00 . A A .  3 ILE HD11 1 1 
        2  1470 1 1  6 ILE HD12 H  -7.938   6.767   7.909 1.00 . A A .  3 ILE HD12 1 1 
        2  1471 1 1  6 ILE HD13 H  -8.848   7.676   9.117 1.00 . A A .  3 ILE HD13 1 1 
        2  1472 1 1  6 ILE HG12 H  -6.841   8.869   9.767 1.00 . A A .  3 ILE HG12 1 1 
        2  1473 1 1  6 ILE HG13 H  -7.163   9.077   8.047 1.00 . A A .  3 ILE HG13 1 1 
        2  1474 1 1  6 ILE HG21 H  -5.532   6.318   9.991 1.00 . A A .  3 ILE HG21 1 1 
        2  1475 1 1  6 ILE HG22 H  -4.755   7.793  10.557 1.00 . A A .  3 ILE HG22 1 1 
        2  1476 1 1  6 ILE HG23 H  -3.890   6.691   9.478 1.00 . A A .  3 ILE HG23 1 1 
        2  1477 1 1  6 ILE N    N  -5.110   9.723   6.782 1.00 . A A .  3 ILE N    1 1 
        2  1478 1 1  6 ILE O    O  -2.764   7.549   7.358 1.00 . A A .  3 ILE O    1 1 
        2  1479 1 1  7 ARG C    C  -0.091   8.990   8.884 1.00 . A A .  4 ARG C    1 1 
        2  1480 1 1  7 ARG CA   C  -0.733   9.468   7.568 1.00 . A A .  4 ARG CA   1 1 
        2  1481 1 1  7 ARG CB   C  -0.019  10.742   7.067 1.00 . A A .  4 ARG CB   1 1 
        2  1482 1 1  7 ARG CD   C  -1.481  12.611   6.192 1.00 . A A .  4 ARG CD   1 1 
        2  1483 1 1  7 ARG CG   C  -0.671  11.369   5.830 1.00 . A A .  4 ARG CG   1 1 
        2  1484 1 1  7 ARG CZ   C  -3.042  13.340   4.394 1.00 . A A .  4 ARG CZ   1 1 
        2  1485 1 1  7 ARG H    H  -2.485  10.624   7.871 1.00 . A A .  4 ARG H    1 1 
        2  1486 1 1  7 ARG HA   H  -0.623   8.701   6.809 1.00 . A A .  4 ARG HA   1 1 
        2  1487 1 1  7 ARG HB2  H  -0.016  11.475   7.863 1.00 . A A .  4 ARG HB2  1 1 
        2  1488 1 1  7 ARG HB3  H   1.006  10.483   6.831 1.00 . A A .  4 ARG HB3  1 1 
        2  1489 1 1  7 ARG HD2  H  -1.653  12.616   7.260 1.00 . A A .  4 ARG HD2  1 1 
        2  1490 1 1  7 ARG HD3  H  -0.916  13.490   5.920 1.00 . A A .  4 ARG HD3  1 1 
        2  1491 1 1  7 ARG HE   H  -3.494  12.107   5.904 1.00 . A A .  4 ARG HE   1 1 
        2  1492 1 1  7 ARG HG2  H   0.087  11.646   5.099 1.00 . A A .  4 ARG HG2  1 1 
        2  1493 1 1  7 ARG HG3  H  -1.337  10.642   5.391 1.00 . A A .  4 ARG HG3  1 1 
        2  1494 1 1  7 ARG HH11 H  -1.178  14.111   4.177 1.00 . A A .  4 ARG HH11 1 1 
        2  1495 1 1  7 ARG HH12 H  -2.317  14.588   2.963 1.00 . A A .  4 ARG HH12 1 1 
        2  1496 1 1  7 ARG HH21 H  -4.987  12.776   4.318 1.00 . A A .  4 ARG HH21 1 1 
        2  1497 1 1  7 ARG HH22 H  -4.477  13.829   3.043 1.00 . A A .  4 ARG HH22 1 1 
        2  1498 1 1  7 ARG N    N  -2.171   9.700   7.755 1.00 . A A .  4 ARG N    1 1 
        2  1499 1 1  7 ARG NE   N  -2.777  12.645   5.508 1.00 . A A .  4 ARG NE   1 1 
        2  1500 1 1  7 ARG NH1  N  -2.103  14.072   3.796 1.00 . A A .  4 ARG NH1  1 1 
        2  1501 1 1  7 ARG NH2  N  -4.269  13.312   3.877 1.00 . A A .  4 ARG NH2  1 1 
        2  1502 1 1  7 ARG O    O   0.395   9.823   9.665 1.00 . A A .  4 ARG O    1 1 
        2  1503 1 1  8 GLU C    C   0.099   5.502  10.286 1.00 . A A .  5 GLU C    1 1 
        2  1504 1 1  8 GLU CA   C   0.338   7.021  10.384 1.00 . A A .  5 GLU CA   1 1 
        2  1505 1 1  8 GLU CB   C  -0.353   7.641  11.666 1.00 . A A .  5 GLU CB   1 1 
        2  1506 1 1  8 GLU CD   C  -2.300   7.931  13.252 1.00 . A A .  5 GLU CD   1 1 
        2  1507 1 1  8 GLU CG   C  -1.841   7.306  11.950 1.00 . A A .  5 GLU CG   1 1 
        2  1508 1 1  8 GLU H    H  -0.326   7.048   8.353 1.00 . A A .  5 GLU H    1 1 
        2  1509 1 1  8 GLU HA   H   1.411   7.183  10.461 1.00 . A A .  5 GLU HA   1 1 
        2  1510 1 1  8 GLU HB2  H   0.218   7.348  12.538 1.00 . A A .  5 GLU HB2  1 1 
        2  1511 1 1  8 GLU HB3  H  -0.278   8.722  11.580 1.00 . A A .  5 GLU HB3  1 1 
        2  1512 1 1  8 GLU HG2  H  -2.472   7.693  11.161 1.00 . A A .  5 GLU HG2  1 1 
        2  1513 1 1  8 GLU HG3  H  -1.976   6.231  12.027 1.00 . A A .  5 GLU HG3  1 1 
        2  1514 1 1  8 GLU N    N  -0.090   7.654   9.110 1.00 . A A .  5 GLU N    1 1 
        2  1515 1 1  8 GLU O    O  -0.453   5.044   9.285 1.00 . A A .  5 GLU O    1 1 
        2  1516 1 1  8 GLU OE1  O  -2.541   9.159  13.273 1.00 . A A .  5 GLU OE1  1 1 
        2  1517 1 1  8 GLU OE2  O  -2.412   7.198  14.260 1.00 . A A .  5 GLU OE2  1 1 
        2  1518 1 1  9 SER C    C   1.459   2.599  10.407 1.00 . A A .  6 SER C    1 1 
        2  1519 1 1  9 SER CA   C   0.443   3.258  11.363 1.00 . A A .  6 SER CA   1 1 
        2  1520 1 1  9 SER CB   C  -1.009   2.754  11.122 1.00 . A A .  6 SER CB   1 1 
        2  1521 1 1  9 SER H    H   1.044   5.176  12.037 1.00 . A A .  6 SER H    1 1 
        2  1522 1 1  9 SER HA   H   0.726   2.976  12.365 1.00 . A A .  6 SER HA   1 1 
        2  1523 1 1  9 SER HB2  H  -1.321   2.977  10.106 1.00 . A A .  6 SER HB2  1 1 
        2  1524 1 1  9 SER HB3  H  -1.046   1.681  11.275 1.00 . A A .  6 SER HB3  1 1 
        2  1525 1 1  9 SER HG   H  -2.265   4.165  11.611 1.00 . A A .  6 SER HG   1 1 
        2  1526 1 1  9 SER N    N   0.562   4.735  11.305 1.00 . A A .  6 SER N    1 1 
        2  1527 1 1  9 SER O    O   2.492   3.202  10.089 1.00 . A A .  6 SER O    1 1 
        2  1528 1 1  9 SER OG   O  -1.912   3.371  12.026 1.00 . A A .  6 SER OG   1 1 
        2  1529 1 1 10 VAL C    C   1.414  -0.428   8.306 1.00 . A A .  7 VAL C    1 1 
        2  1530 1 1 10 VAL CA   C   2.159   0.612   9.162 1.00 . A A .  7 VAL CA   1 1 
        2  1531 1 1 10 VAL CB   C   3.314  -0.022  10.047 1.00 . A A .  7 VAL CB   1 1 
        2  1532 1 1 10 VAL CG1  C   2.812  -1.109  10.998 1.00 . A A .  7 VAL CG1  1 1 
        2  1533 1 1 10 VAL CG2  C   4.489  -0.557   9.218 1.00 . A A .  7 VAL CG2  1 1 
        2  1534 1 1 10 VAL H    H   0.333   0.949  10.206 1.00 . A A .  7 VAL H    1 1 
        2  1535 1 1 10 VAL HA   H   2.606   1.328   8.488 1.00 . A A .  7 VAL HA   1 1 
        2  1536 1 1 10 VAL HB   H   3.701   0.778  10.667 1.00 . A A .  7 VAL HB   1 1 
        2  1537 1 1 10 VAL HG11 H   2.372  -1.914  10.427 1.00 . A A .  7 VAL HG11 1 1 
        2  1538 1 1 10 VAL HG12 H   2.075  -0.697  11.670 1.00 . A A .  7 VAL HG12 1 1 
        2  1539 1 1 10 VAL HG13 H   3.646  -1.490  11.568 1.00 . A A .  7 VAL HG13 1 1 
        2  1540 1 1 10 VAL HG21 H   5.246  -0.951   9.885 1.00 . A A .  7 VAL HG21 1 1 
        2  1541 1 1 10 VAL HG22 H   4.922   0.239   8.629 1.00 . A A .  7 VAL HG22 1 1 
        2  1542 1 1 10 VAL HG23 H   4.149  -1.347   8.567 1.00 . A A .  7 VAL HG23 1 1 
        2  1543 1 1 10 VAL N    N   1.200   1.357   9.991 1.00 . A A .  7 VAL N    1 1 
        2  1544 1 1 10 VAL O    O   0.476  -1.080   8.772 1.00 . A A .  7 VAL O    1 1 
        2  1545 1 1 11 SER C    C   1.830  -2.834   6.233 1.00 . A A .  8 SER C    1 1 
        2  1546 1 1 11 SER CA   C   1.165  -1.445   6.093 1.00 . A A .  8 SER CA   1 1 
        2  1547 1 1 11 SER CB   C   1.239  -0.865   4.646 1.00 . A A .  8 SER CB   1 1 
        2  1548 1 1 11 SER H    H   2.512   0.080   6.716 1.00 . A A .  8 SER H    1 1 
        2  1549 1 1 11 SER HA   H   0.125  -1.540   6.373 1.00 . A A .  8 SER HA   1 1 
        2  1550 1 1 11 SER HB2  H   0.241  -0.592   4.315 1.00 . A A .  8 SER HB2  1 1 
        2  1551 1 1 11 SER HB3  H   1.861   0.020   4.644 1.00 . A A .  8 SER HB3  1 1 
        2  1552 1 1 11 SER HG   H   2.722  -1.652   3.641 1.00 . A A .  8 SER HG   1 1 
        2  1553 1 1 11 SER N    N   1.785  -0.505   7.031 1.00 . A A .  8 SER N    1 1 
        2  1554 1 1 11 SER O    O   3.051  -2.938   6.220 1.00 . A A .  8 SER O    1 1 
        2  1555 1 1 11 SER OG   O   1.769  -1.784   3.707 1.00 . A A .  8 SER OG   1 1 
        2  1556 1 1 12 ARG C    C   0.752  -6.354   5.857 1.00 . A A .  9 ARG C    1 1 
        2  1557 1 1 12 ARG CA   C   1.592  -5.273   6.591 1.00 . A A .  9 ARG CA   1 1 
        2  1558 1 1 12 ARG CB   C   1.751  -5.664   8.095 1.00 . A A .  9 ARG CB   1 1 
        2  1559 1 1 12 ARG CD   C   0.505  -4.952  10.218 1.00 . A A .  9 ARG CD   1 1 
        2  1560 1 1 12 ARG CG   C   0.444  -5.731   8.909 1.00 . A A .  9 ARG CG   1 1 
        2  1561 1 1 12 ARG CZ   C  -1.458  -3.426  10.430 1.00 . A A .  9 ARG CZ   1 1 
        2  1562 1 1 12 ARG H    H   0.034  -3.750   6.399 1.00 . A A .  9 ARG H    1 1 
        2  1563 1 1 12 ARG HA   H   2.578  -5.239   6.144 1.00 . A A .  9 ARG HA   1 1 
        2  1564 1 1 12 ARG HB2  H   2.209  -6.648   8.139 1.00 . A A .  9 ARG HB2  1 1 
        2  1565 1 1 12 ARG HB3  H   2.423  -4.961   8.574 1.00 . A A .  9 ARG HB3  1 1 
        2  1566 1 1 12 ARG HD2  H   0.020  -5.534  10.991 1.00 . A A .  9 ARG HD2  1 1 
        2  1567 1 1 12 ARG HD3  H   1.536  -4.793  10.491 1.00 . A A .  9 ARG HD3  1 1 
        2  1568 1 1 12 ARG HE   H   0.377  -2.897   9.788 1.00 . A A .  9 ARG HE   1 1 
        2  1569 1 1 12 ARG HG2  H  -0.360  -5.327   8.317 1.00 . A A .  9 ARG HG2  1 1 
        2  1570 1 1 12 ARG HG3  H   0.222  -6.765   9.146 1.00 . A A .  9 ARG HG3  1 1 
        2  1571 1 1 12 ARG HH11 H  -1.879  -5.339  10.970 1.00 . A A .  9 ARG HH11 1 1 
        2  1572 1 1 12 ARG HH12 H  -3.204  -4.229  11.096 1.00 . A A .  9 ARG HH12 1 1 
        2  1573 1 1 12 ARG HH21 H  -1.390  -1.454   9.963 1.00 . A A .  9 ARG HH21 1 1 
        2  1574 1 1 12 ARG HH22 H  -2.928  -2.024  10.525 1.00 . A A .  9 ARG HH22 1 1 
        2  1575 1 1 12 ARG N    N   1.023  -3.895   6.419 1.00 . A A .  9 ARG N    1 1 
        2  1576 1 1 12 ARG NE   N  -0.170  -3.654  10.113 1.00 . A A .  9 ARG NE   1 1 
        2  1577 1 1 12 ARG NH1  N  -2.245  -4.413  10.867 1.00 . A A .  9 ARG NH1  1 1 
        2  1578 1 1 12 ARG NH2  N  -1.967  -2.204  10.294 1.00 . A A .  9 ARG NH2  1 1 
        2  1579 1 1 12 ARG O    O  -0.420  -6.107   5.590 1.00 . A A .  9 ARG O    1 1 
        2  1580 1 1 13 ILE C    C   0.500  -9.767   6.096 1.00 . A A . 10 ILE C    1 1 
        2  1581 1 1 13 ILE CA   C   0.489  -8.671   5.050 1.00 . A A . 10 ILE CA   1 1 
        2  1582 1 1 13 ILE CB   C   0.980  -9.270   3.649 1.00 . A A . 10 ILE CB   1 1 
        2  1583 1 1 13 ILE CD1  C   0.632  -8.926   1.062 1.00 . A A . 10 ILE CD1  1 1 
        2  1584 1 1 13 ILE CG1  C   0.551  -8.350   2.478 1.00 . A A . 10 ILE CG1  1 1 
        2  1585 1 1 13 ILE CG2  C   0.568 -10.765   3.380 1.00 . A A . 10 ILE CG2  1 1 
        2  1586 1 1 13 ILE H    H   2.298  -7.720   5.656 1.00 . A A . 10 ILE H    1 1 
        2  1587 1 1 13 ILE HA   H  -0.520  -8.282   4.955 1.00 . A A . 10 ILE HA   1 1 
        2  1588 1 1 13 ILE HB   H   2.055  -9.262   3.709 1.00 . A A . 10 ILE HB   1 1 
        2  1589 1 1 13 ILE HD11 H   0.131  -9.884   1.018 1.00 . A A . 10 ILE HD11 1 1 
        2  1590 1 1 13 ILE HD12 H   1.645  -9.037   0.767 1.00 . A A . 10 ILE HD12 1 1 
        2  1591 1 1 13 ILE HD13 H   0.150  -8.245   0.374 1.00 . A A . 10 ILE HD13 1 1 
        2  1592 1 1 13 ILE HG12 H  -0.462  -8.046   2.634 1.00 . A A . 10 ILE HG12 1 1 
        2  1593 1 1 13 ILE HG13 H   1.174  -7.475   2.487 1.00 . A A . 10 ILE HG13 1 1 
        2  1594 1 1 13 ILE HG21 H   0.794 -11.370   4.251 1.00 . A A . 10 ILE HG21 1 1 
        2  1595 1 1 13 ILE HG22 H   1.141 -11.149   2.542 1.00 . A A . 10 ILE HG22 1 1 
        2  1596 1 1 13 ILE HG23 H  -0.485 -10.845   3.143 1.00 . A A . 10 ILE HG23 1 1 
        2  1597 1 1 13 ILE N    N   1.314  -7.566   5.552 1.00 . A A . 10 ILE N    1 1 
        2  1598 1 1 13 ILE O    O   1.558  -9.999   6.748 1.00 . A A . 10 ILE O    1 1 
        2  1599 1 1 14 TYR C    C  -1.023 -12.811   6.238 1.00 . A A . 11 TYR C    1 1 
        2  1600 1 1 14 TYR CA   C  -0.871 -11.547   7.142 1.00 . A A . 11 TYR CA   1 1 
        2  1601 1 1 14 TYR CB   C  -2.129 -11.365   8.028 1.00 . A A . 11 TYR CB   1 1 
        2  1602 1 1 14 TYR CD1  C  -2.758 -13.526   9.226 1.00 . A A . 11 TYR CD1  1 1 
        2  1603 1 1 14 TYR CD2  C  -1.685 -11.799  10.473 1.00 . A A . 11 TYR CD2  1 1 
        2  1604 1 1 14 TYR CE1  C  -2.823 -14.308  10.367 1.00 . A A . 11 TYR CE1  1 1 
        2  1605 1 1 14 TYR CE2  C  -1.744 -12.577  11.612 1.00 . A A . 11 TYR CE2  1 1 
        2  1606 1 1 14 TYR CG   C  -2.187 -12.253   9.259 1.00 . A A . 11 TYR CG   1 1 
        2  1607 1 1 14 TYR CZ   C  -2.314 -13.832  11.554 1.00 . A A . 11 TYR CZ   1 1 
        2  1608 1 1 14 TYR H    H  -1.505  -9.963   5.842 1.00 . A A . 11 TYR H    1 1 
        2  1609 1 1 14 TYR HA   H  -0.002 -11.626   7.778 1.00 . A A . 11 TYR HA   1 1 
        2  1610 1 1 14 TYR HB2  H  -2.169 -10.341   8.374 1.00 . A A . 11 TYR HB2  1 1 
        2  1611 1 1 14 TYR HB3  H  -3.017 -11.566   7.436 1.00 . A A . 11 TYR HB3  1 1 
        2  1612 1 1 14 TYR HD1  H  -3.155 -13.902   8.294 1.00 . A A . 11 TYR HD1  1 1 
        2  1613 1 1 14 TYR HD2  H  -1.238 -10.815  10.517 1.00 . A A . 11 TYR HD2  1 1 
        2  1614 1 1 14 TYR HE1  H  -3.274 -15.287  10.325 1.00 . A A . 11 TYR HE1  1 1 
        2  1615 1 1 14 TYR HE2  H  -1.347 -12.202  12.546 1.00 . A A . 11 TYR HE2  1 1 
        2  1616 1 1 14 TYR HH   H  -2.075 -15.500  12.480 1.00 . A A . 11 TYR HH   1 1 
        2  1617 1 1 14 TYR N    N  -0.701 -10.359   6.295 1.00 . A A . 11 TYR N    1 1 
        2  1618 1 1 14 TYR O    O  -2.015 -12.897   5.490 1.00 . A A . 11 TYR O    1 1 
        2  1619 1 1 14 TYR OH   O  -2.374 -14.611  12.687 1.00 . A A . 11 TYR OH   1 1 
        2  1620 1 1 15 VAL C    C  -0.155 -16.272   6.241 1.00 . A A . 12 VAL C    1 1 
        2  1621 1 1 15 VAL CA   C  -0.241 -14.976   5.378 1.00 . A A . 12 VAL CA   1 1 
        2  1622 1 1 15 VAL CB   C   0.779 -14.940   4.119 1.00 . A A . 12 VAL CB   1 1 
        2  1623 1 1 15 VAL CG1  C   2.178 -14.579   4.556 1.00 . A A . 12 VAL CG1  1 1 
        2  1624 1 1 15 VAL CG2  C   0.863 -16.250   3.310 1.00 . A A . 12 VAL CG2  1 1 
        2  1625 1 1 15 VAL H    H   0.708 -13.773   6.883 1.00 . A A . 12 VAL H    1 1 
        2  1626 1 1 15 VAL HA   H  -1.254 -14.911   4.998 1.00 . A A . 12 VAL HA   1 1 
        2  1627 1 1 15 VAL HB   H   0.464 -14.148   3.420 1.00 . A A . 12 VAL HB   1 1 
        2  1628 1 1 15 VAL HG11 H   2.849 -14.657   3.715 1.00 . A A . 12 VAL HG11 1 1 
        2  1629 1 1 15 VAL HG12 H   2.490 -15.258   5.333 1.00 . A A . 12 VAL HG12 1 1 
        2  1630 1 1 15 VAL HG13 H   2.196 -13.565   4.935 1.00 . A A . 12 VAL HG13 1 1 
        2  1631 1 1 15 VAL HG21 H   1.255 -17.044   3.930 1.00 . A A . 12 VAL HG21 1 1 
        2  1632 1 1 15 VAL HG22 H   1.535 -16.099   2.475 1.00 . A A . 12 VAL HG22 1 1 
        2  1633 1 1 15 VAL HG23 H  -0.098 -16.535   2.927 1.00 . A A . 12 VAL HG23 1 1 
        2  1634 1 1 15 VAL N    N  -0.071 -13.796   6.250 1.00 . A A . 12 VAL N    1 1 
        2  1635 1 1 15 VAL O    O   0.915 -16.642   6.714 1.00 . A A . 12 VAL O    1 1 
        2  1636 1 1 16 GLY C    C  -1.737 -19.385   6.450 1.00 . A A . 13 GLY C    1 1 
        2  1637 1 1 16 GLY CA   C  -1.305 -18.173   7.273 1.00 . A A . 13 GLY CA   1 1 
        2  1638 1 1 16 GLY H    H  -2.185 -16.587   6.126 1.00 . A A . 13 GLY H    1 1 
        2  1639 1 1 16 GLY HA2  H  -0.307 -18.340   7.655 1.00 . A A . 13 GLY HA2  1 1 
        2  1640 1 1 16 GLY HA3  H  -1.982 -18.058   8.107 1.00 . A A . 13 GLY HA3  1 1 
        2  1641 1 1 16 GLY N    N  -1.308 -16.938   6.486 1.00 . A A . 13 GLY N    1 1 
        2  1642 1 1 16 GLY O    O  -2.250 -19.214   5.343 1.00 . A A . 13 GLY O    1 1 
        2  1643 1 1 17 ASN C    C  -1.252 -22.000   4.836 1.00 . A A . 14 ASN C    1 1 
        2  1644 1 1 17 ASN CA   C  -1.859 -21.893   6.276 1.00 . A A . 14 ASN CA   1 1 
        2  1645 1 1 17 ASN CB   C  -3.393 -22.098   6.214 1.00 . A A . 14 ASN CB   1 1 
        2  1646 1 1 17 ASN CG   C  -4.074 -22.033   7.572 1.00 . A A . 14 ASN CG   1 1 
        2  1647 1 1 17 ASN H    H  -1.236 -20.677   7.945 1.00 . A A . 14 ASN H    1 1 
        2  1648 1 1 17 ASN HA   H  -1.442 -22.702   6.865 1.00 . A A . 14 ASN HA   1 1 
        2  1649 1 1 17 ASN HB2  H  -3.826 -21.337   5.587 1.00 . A A . 14 ASN HB2  1 1 
        2  1650 1 1 17 ASN HB3  H  -3.591 -23.067   5.784 1.00 . A A . 14 ASN HB3  1 1 
        2  1651 1 1 17 ASN HD21 H  -3.728 -23.966   7.897 1.00 . A A . 14 ASN HD21 1 1 
        2  1652 1 1 17 ASN HD22 H  -4.570 -23.126   9.154 1.00 . A A . 14 ASN HD22 1 1 
        2  1653 1 1 17 ASN N    N  -1.543 -20.614   6.994 1.00 . A A . 14 ASN N    1 1 
        2  1654 1 1 17 ASN ND2  N  -4.129 -23.158   8.279 1.00 . A A . 14 ASN ND2  1 1 
        2  1655 1 1 17 ASN O    O  -1.759 -22.752   4.010 1.00 . A A . 14 ASN O    1 1 
        2  1656 1 1 17 ASN OD1  O  -4.550 -20.975   7.990 1.00 . A A . 14 ASN OD1  1 1 
        2  1657 1 1 18 LEU C    C   1.356 -22.589   3.122 1.00 . A A . 15 LEU C    1 1 
        2  1658 1 1 18 LEU CA   C   0.535 -21.298   3.275 1.00 . A A . 15 LEU CA   1 1 
        2  1659 1 1 18 LEU CB   C   1.448 -20.036   3.100 1.00 . A A . 15 LEU CB   1 1 
        2  1660 1 1 18 LEU CD1  C   3.796 -19.055   3.249 1.00 . A A . 15 LEU CD1  1 1 
        2  1661 1 1 18 LEU CD2  C   2.500 -19.447   5.354 1.00 . A A . 15 LEU CD2  1 1 
        2  1662 1 1 18 LEU CG   C   2.761 -19.956   3.934 1.00 . A A . 15 LEU CG   1 1 
        2  1663 1 1 18 LEU H    H   0.178 -20.676   5.243 1.00 . A A . 15 LEU H    1 1 
        2  1664 1 1 18 LEU HA   H  -0.222 -21.288   2.504 1.00 . A A . 15 LEU HA   1 1 
        2  1665 1 1 18 LEU HB2  H   1.718 -19.969   2.060 1.00 . A A . 15 LEU HB2  1 1 
        2  1666 1 1 18 LEU HB3  H   0.853 -19.163   3.347 1.00 . A A . 15 LEU HB3  1 1 
        2  1667 1 1 18 LEU HD11 H   4.152 -19.535   2.345 1.00 . A A . 15 LEU HD11 1 1 
        2  1668 1 1 18 LEU HD12 H   4.631 -18.891   3.918 1.00 . A A . 15 LEU HD12 1 1 
        2  1669 1 1 18 LEU HD13 H   3.352 -18.103   2.996 1.00 . A A . 15 LEU HD13 1 1 
        2  1670 1 1 18 LEU HD21 H   3.439 -19.172   5.815 1.00 . A A . 15 LEU HD21 1 1 
        2  1671 1 1 18 LEU HD22 H   2.035 -20.232   5.934 1.00 . A A . 15 LEU HD22 1 1 
        2  1672 1 1 18 LEU HD23 H   1.846 -18.588   5.323 1.00 . A A . 15 LEU HD23 1 1 
        2  1673 1 1 18 LEU HG   H   3.188 -20.946   4.011 1.00 . A A . 15 LEU HG   1 1 
        2  1674 1 1 18 LEU N    N  -0.154 -21.272   4.569 1.00 . A A . 15 LEU N    1 1 
        2  1675 1 1 18 LEU O    O   1.998 -23.031   4.085 1.00 . A A . 15 LEU O    1 1 
        2  1676 1 1 19 PRO C    C   3.632 -24.036   1.456 1.00 . A A . 16 PRO C    1 1 
        2  1677 1 1 19 PRO CA   C   2.146 -24.428   1.682 1.00 . A A . 16 PRO CA   1 1 
        2  1678 1 1 19 PRO CB   C   1.560 -25.024   0.392 1.00 . A A . 16 PRO CB   1 1 
        2  1679 1 1 19 PRO CD   C   0.414 -22.934   0.794 1.00 . A A . 16 PRO CD   1 1 
        2  1680 1 1 19 PRO CG   C   0.787 -23.933  -0.269 1.00 . A A . 16 PRO CG   1 1 
        2  1681 1 1 19 PRO HA   H   2.046 -25.144   2.486 1.00 . A A . 16 PRO HA   1 1 
        2  1682 1 1 19 PRO HB2  H   2.366 -25.358  -0.249 1.00 . A A . 16 PRO HB2  1 1 
        2  1683 1 1 19 PRO HB3  H   0.910 -25.850   0.628 1.00 . A A . 16 PRO HB3  1 1 
        2  1684 1 1 19 PRO HD2  H   0.598 -21.937   0.427 1.00 . A A . 16 PRO HD2  1 1 
        2  1685 1 1 19 PRO HD3  H  -0.626 -23.043   1.073 1.00 . A A . 16 PRO HD3  1 1 
        2  1686 1 1 19 PRO HG2  H   1.407 -23.458  -1.019 1.00 . A A . 16 PRO HG2  1 1 
        2  1687 1 1 19 PRO HG3  H  -0.104 -24.339  -0.725 1.00 . A A . 16 PRO HG3  1 1 
        2  1688 1 1 19 PRO N    N   1.308 -23.252   1.935 1.00 . A A . 16 PRO N    1 1 
        2  1689 1 1 19 PRO O    O   3.902 -23.217   0.571 1.00 . A A . 16 PRO O    1 1 
        2  1690 1 1 20 SER C    C   6.250 -22.825   2.612 1.00 . A A . 17 SER C    1 1 
        2  1691 1 1 20 SER CA   C   6.030 -24.298   2.205 1.00 . A A . 17 SER CA   1 1 
        2  1692 1 1 20 SER CB   C   6.725 -24.597   0.845 1.00 . A A . 17 SER CB   1 1 
        2  1693 1 1 20 SER H    H   4.303 -25.350   2.862 1.00 . A A . 17 SER H    1 1 
        2  1694 1 1 20 SER HA   H   6.501 -24.912   2.959 1.00 . A A . 17 SER HA   1 1 
        2  1695 1 1 20 SER HB2  H   6.537 -25.620   0.547 1.00 . A A . 17 SER HB2  1 1 
        2  1696 1 1 20 SER HB3  H   6.340 -23.925   0.088 1.00 . A A . 17 SER HB3  1 1 
        2  1697 1 1 20 SER HG   H   8.346 -23.487   0.760 1.00 . A A . 17 SER HG   1 1 
        2  1698 1 1 20 SER N    N   4.582 -24.651   2.227 1.00 . A A . 17 SER N    1 1 
        2  1699 1 1 20 SER O    O   6.075 -21.903   1.804 1.00 . A A . 17 SER O    1 1 
        2  1700 1 1 20 SER OG   O   8.130 -24.409   0.945 1.00 . A A . 17 SER OG   1 1 
        2  1701 1 1 21 HIS C    C   7.973 -20.514   3.717 1.00 . A A . 18 HIS C    1 1 
        2  1702 1 1 21 HIS CA   C   6.824 -21.258   4.420 1.00 . A A . 18 HIS CA   1 1 
        2  1703 1 1 21 HIS CB   C   6.996 -21.267   5.971 1.00 . A A . 18 HIS CB   1 1 
        2  1704 1 1 21 HIS CD2  C   9.380 -21.968   6.742 1.00 . A A . 18 HIS CD2  1 1 
        2  1705 1 1 21 HIS CE1  C   8.929 -24.025   7.351 1.00 . A A . 18 HIS CE1  1 1 
        2  1706 1 1 21 HIS CG   C   8.062 -22.178   6.518 1.00 . A A . 18 HIS CG   1 1 
        2  1707 1 1 21 HIS H    H   6.808 -23.387   4.450 1.00 . A A . 18 HIS H    1 1 
        2  1708 1 1 21 HIS HA   H   5.916 -20.715   4.193 1.00 . A A . 18 HIS HA   1 1 
        2  1709 1 1 21 HIS HB2  H   7.238 -20.268   6.296 1.00 . A A . 18 HIS HB2  1 1 
        2  1710 1 1 21 HIS HB3  H   6.056 -21.555   6.423 1.00 . A A . 18 HIS HB3  1 1 
        2  1711 1 1 21 HIS HD1  H   6.936 -23.929   6.891 1.00 . A A . 18 HIS HD1  1 1 
        2  1712 1 1 21 HIS HD2  H   9.922 -21.052   6.546 1.00 . A A . 18 HIS HD2  1 1 
        2  1713 1 1 21 HIS HE1  H   9.035 -25.037   7.713 1.00 . A A . 18 HIS HE1  1 1 
        2  1714 1 1 21 HIS HE2  H  10.842 -23.296   7.445 1.00 . A A . 18 HIS HE2  1 1 
        2  1715 1 1 21 HIS N    N   6.638 -22.615   3.877 1.00 . A A . 18 HIS N    1 1 
        2  1716 1 1 21 HIS ND1  N   7.811 -23.477   6.911 1.00 . A A . 18 HIS ND1  1 1 
        2  1717 1 1 21 HIS NE2  N   9.895 -23.129   7.258 1.00 . A A . 18 HIS NE2  1 1 
        2  1718 1 1 21 HIS O    O   9.050 -21.076   3.486 1.00 . A A . 18 HIS O    1 1 
        2  1719 1 1 22 VAL C    C   9.849 -18.051   3.494 1.00 . A A . 19 VAL C    1 1 
        2  1720 1 1 22 VAL CA   C   8.603 -18.394   2.595 1.00 . A A . 19 VAL CA   1 1 
        2  1721 1 1 22 VAL CB   C   7.803 -17.109   2.072 1.00 . A A . 19 VAL CB   1 1 
        2  1722 1 1 22 VAL CG1  C   6.814 -17.490   0.960 1.00 . A A . 19 VAL CG1  1 1 
        2  1723 1 1 22 VAL CG2  C   7.026 -16.402   3.188 1.00 . A A . 19 VAL CG2  1 1 
        2  1724 1 1 22 VAL H    H   6.799 -18.908   3.585 1.00 . A A . 19 VAL H    1 1 
        2  1725 1 1 22 VAL HA   H   8.935 -18.949   1.726 1.00 . A A . 19 VAL HA   1 1 
        2  1726 1 1 22 VAL HB   H   8.484 -16.392   1.651 1.00 . A A . 19 VAL HB   1 1 
        2  1727 1 1 22 VAL HG11 H   7.349 -17.763   0.062 1.00 . A A . 19 VAL HG11 1 1 
        2  1728 1 1 22 VAL HG12 H   6.167 -16.651   0.748 1.00 . A A . 19 VAL HG12 1 1 
        2  1729 1 1 22 VAL HG13 H   6.209 -18.326   1.282 1.00 . A A . 19 VAL HG13 1 1 
        2  1730 1 1 22 VAL HG21 H   6.551 -15.509   2.792 1.00 . A A . 19 VAL HG21 1 1 
        2  1731 1 1 22 VAL HG22 H   7.702 -16.126   3.980 1.00 . A A . 19 VAL HG22 1 1 
        2  1732 1 1 22 VAL HG23 H   6.268 -17.066   3.573 1.00 . A A . 19 VAL HG23 1 1 
        2  1733 1 1 22 VAL N    N   7.679 -19.266   3.342 1.00 . A A . 19 VAL N    1 1 
        2  1734 1 1 22 VAL O    O   9.670 -17.556   4.614 1.00 . A A . 19 VAL O    1 1 
        2  1735 1 1 23 SER C    C  12.752 -16.672   3.807 1.00 . A A . 20 SER C    1 1 
        2  1736 1 1 23 SER CA   C  12.316 -18.149   3.890 1.00 . A A . 20 SER CA   1 1 
        2  1737 1 1 23 SER CB   C  13.464 -19.133   3.463 1.00 . A A . 20 SER CB   1 1 
        2  1738 1 1 23 SER H    H  11.234 -18.858   2.189 1.00 . A A . 20 SER H    1 1 
        2  1739 1 1 23 SER HA   H  12.042 -18.361   4.907 1.00 . A A . 20 SER HA   1 1 
        2  1740 1 1 23 SER HB2  H  14.351 -18.601   3.113 1.00 . A A . 20 SER HB2  1 1 
        2  1741 1 1 23 SER HB3  H  13.738 -19.744   4.310 1.00 . A A . 20 SER HB3  1 1 
        2  1742 1 1 23 SER HG   H  13.127 -19.532   1.572 1.00 . A A . 20 SER HG   1 1 
        2  1743 1 1 23 SER N    N  11.109 -18.386   3.052 1.00 . A A . 20 SER N    1 1 
        2  1744 1 1 23 SER O    O  12.428 -16.012   2.815 1.00 . A A . 20 SER O    1 1 
        2  1745 1 1 23 SER OG   O  13.033 -19.991   2.422 1.00 . A A . 20 SER OG   1 1 
        2  1746 1 1 24 SER C    C  14.456 -14.083   3.730 1.00 . A A . 21 SER C    1 1 
        2  1747 1 1 24 SER CA   C  13.826 -14.731   4.992 1.00 . A A . 21 SER CA   1 1 
        2  1748 1 1 24 SER CB   C  14.789 -14.552   6.180 1.00 . A A . 21 SER CB   1 1 
        2  1749 1 1 24 SER H    H  13.645 -16.727   5.658 1.00 . A A . 21 SER H    1 1 
        2  1750 1 1 24 SER HA   H  12.916 -14.210   5.234 1.00 . A A . 21 SER HA   1 1 
        2  1751 1 1 24 SER HB2  H  15.200 -13.557   6.149 1.00 . A A . 21 SER HB2  1 1 
        2  1752 1 1 24 SER HB3  H  14.254 -14.692   7.104 1.00 . A A . 21 SER HB3  1 1 
        2  1753 1 1 24 SER HG   H  16.593 -15.158   6.688 1.00 . A A . 21 SER HG   1 1 
        2  1754 1 1 24 SER N    N  13.453 -16.157   4.872 1.00 . A A . 21 SER N    1 1 
        2  1755 1 1 24 SER O    O  14.061 -12.967   3.361 1.00 . A A . 21 SER O    1 1 
        2  1756 1 1 24 SER OG   O  15.868 -15.479   6.134 1.00 . A A . 21 SER OG   1 1 
        2  1757 1 1 25 ARG C    C  14.996 -13.996   0.662 1.00 . A A . 22 ARG C    1 1 
        2  1758 1 1 25 ARG CA   C  16.051 -14.238   1.828 1.00 . A A . 22 ARG CA   1 1 
        2  1759 1 1 25 ARG CB   C  17.305 -15.100   1.381 1.00 . A A . 22 ARG CB   1 1 
        2  1760 1 1 25 ARG CD   C  16.900 -16.472  -0.747 1.00 . A A . 22 ARG CD   1 1 
        2  1761 1 1 25 ARG CG   C  17.579 -15.245  -0.130 1.00 . A A . 22 ARG CG   1 1 
        2  1762 1 1 25 ARG CZ   C  18.540 -17.318  -2.418 1.00 . A A . 22 ARG CZ   1 1 
        2  1763 1 1 25 ARG H    H  15.860 -15.530   3.579 1.00 . A A . 22 ARG H    1 1 
        2  1764 1 1 25 ARG HA   H  16.432 -13.268   2.107 1.00 . A A . 22 ARG HA   1 1 
        2  1765 1 1 25 ARG HB2  H  18.174 -14.618   1.787 1.00 . A A . 22 ARG HB2  1 1 
        2  1766 1 1 25 ARG HB3  H  17.262 -16.094   1.809 1.00 . A A . 22 ARG HB3  1 1 
        2  1767 1 1 25 ARG HD2  H  16.290 -16.960   0.004 1.00 . A A . 22 ARG HD2  1 1 
        2  1768 1 1 25 ARG HD3  H  16.273 -16.152  -1.565 1.00 . A A . 22 ARG HD3  1 1 
        2  1769 1 1 25 ARG HE   H  18.065 -18.217  -0.688 1.00 . A A . 22 ARG HE   1 1 
        2  1770 1 1 25 ARG HG2  H  17.239 -14.362  -0.653 1.00 . A A . 22 ARG HG2  1 1 
        2  1771 1 1 25 ARG HG3  H  18.648 -15.341  -0.271 1.00 . A A . 22 ARG HG3  1 1 
        2  1772 1 1 25 ARG HH11 H  17.665 -15.566  -2.967 1.00 . A A . 22 ARG HH11 1 1 
        2  1773 1 1 25 ARG HH12 H  18.815 -16.192  -4.099 1.00 . A A . 22 ARG HH12 1 1 
        2  1774 1 1 25 ARG HH21 H  19.601 -19.019  -2.148 1.00 . A A . 22 ARG HH21 1 1 
        2  1775 1 1 25 ARG HH22 H  19.926 -18.180  -3.617 1.00 . A A . 22 ARG HH22 1 1 
        2  1776 1 1 25 ARG N    N  15.455 -14.744   3.108 1.00 . A A . 22 ARG N    1 1 
        2  1777 1 1 25 ARG NE   N  17.886 -17.432  -1.251 1.00 . A A . 22 ARG NE   1 1 
        2  1778 1 1 25 ARG NH1  N  18.326 -16.272  -3.227 1.00 . A A . 22 ARG NH1  1 1 
        2  1779 1 1 25 ARG NH2  N  19.428 -18.248  -2.758 1.00 . A A . 22 ARG NH2  1 1 
        2  1780 1 1 25 ARG O    O  15.007 -12.903  -0.013 1.00 . A A . 22 ARG O    1 1 
        2  1781 1 1 26 ASP C    C  12.058 -13.738  -0.254 1.00 . A A . 23 ASP C    1 1 
        2  1782 1 1 26 ASP CA   C  13.023 -14.885  -0.595 1.00 . A A . 23 ASP CA   1 1 
        2  1783 1 1 26 ASP CB   C  12.255 -16.233  -0.820 1.00 . A A . 23 ASP CB   1 1 
        2  1784 1 1 26 ASP CG   C  13.193 -17.428  -0.779 1.00 . A A . 23 ASP CG   1 1 
        2  1785 1 1 26 ASP H    H  14.114 -15.813   0.967 1.00 . A A . 23 ASP H    1 1 
        2  1786 1 1 26 ASP HA   H  13.520 -14.630  -1.523 1.00 . A A . 23 ASP HA   1 1 
        2  1787 1 1 26 ASP HB2  H  11.490 -16.359  -0.078 1.00 . A A . 23 ASP HB2  1 1 
        2  1788 1 1 26 ASP HB3  H  11.772 -16.237  -1.803 1.00 . A A . 23 ASP HB3  1 1 
        2  1789 1 1 26 ASP N    N  14.076 -14.988   0.437 1.00 . A A . 23 ASP N    1 1 
        2  1790 1 1 26 ASP O    O  11.636 -13.030  -1.190 1.00 . A A . 23 ASP O    1 1 
        2  1791 1 1 26 ASP OD1  O  13.836 -17.714  -1.810 1.00 . A A . 23 ASP OD1  1 1 
        2  1792 1 1 26 ASP OD2  O  13.307 -18.062   0.287 1.00 . A A . 23 ASP OD2  1 1 
        2  1793 1 1 27 VAL C    C  11.698 -11.053   1.138 1.00 . A A . 24 VAL C    1 1 
        2  1794 1 1 27 VAL CA   C  10.957 -12.350   1.436 1.00 . A A . 24 VAL CA   1 1 
        2  1795 1 1 27 VAL CB   C  10.398 -12.320   2.918 1.00 . A A . 24 VAL CB   1 1 
        2  1796 1 1 27 VAL CG1  C   9.105 -11.586   2.964 1.00 . A A . 24 VAL CG1  1 1 
        2  1797 1 1 27 VAL CG2  C  10.165 -13.662   3.619 1.00 . A A . 24 VAL CG2  1 1 
        2  1798 1 1 27 VAL H    H  12.062 -14.078   1.797 1.00 . A A . 24 VAL H    1 1 
        2  1799 1 1 27 VAL HA   H  10.130 -12.352   0.764 1.00 . A A . 24 VAL HA   1 1 
        2  1800 1 1 27 VAL HB   H  11.066 -11.753   3.505 1.00 . A A . 24 VAL HB   1 1 
        2  1801 1 1 27 VAL HG11 H   9.223 -10.615   2.516 1.00 . A A . 24 VAL HG11 1 1 
        2  1802 1 1 27 VAL HG12 H   8.801 -11.475   3.994 1.00 . A A . 24 VAL HG12 1 1 
        2  1803 1 1 27 VAL HG13 H   8.360 -12.151   2.429 1.00 . A A . 24 VAL HG13 1 1 
        2  1804 1 1 27 VAL HG21 H  10.510 -14.490   3.019 1.00 . A A . 24 VAL HG21 1 1 
        2  1805 1 1 27 VAL HG22 H   9.097 -13.761   3.812 1.00 . A A . 24 VAL HG22 1 1 
        2  1806 1 1 27 VAL HG23 H  10.683 -13.657   4.565 1.00 . A A . 24 VAL HG23 1 1 
        2  1807 1 1 27 VAL N    N  11.758 -13.488   1.075 1.00 . A A . 24 VAL N    1 1 
        2  1808 1 1 27 VAL O    O  11.065 -10.182   0.533 1.00 . A A . 24 VAL O    1 1 
        2  1809 1 1 28 GLU C    C  13.603  -9.394  -0.375 1.00 . A A . 25 GLU C    1 1 
        2  1810 1 1 28 GLU CA   C  13.707  -9.677   1.132 1.00 . A A . 25 GLU CA   1 1 
        2  1811 1 1 28 GLU CB   C  15.193  -9.637   1.530 1.00 . A A . 25 GLU CB   1 1 
        2  1812 1 1 28 GLU CD   C  17.117  -8.006   1.373 1.00 . A A . 25 GLU CD   1 1 
        2  1813 1 1 28 GLU CG   C  15.718  -8.237   1.891 1.00 . A A . 25 GLU CG   1 1 
        2  1814 1 1 28 GLU H    H  13.496 -11.584   1.976 1.00 . A A . 25 GLU H    1 1 
        2  1815 1 1 28 GLU HA   H  13.179  -8.895   1.661 1.00 . A A . 25 GLU HA   1 1 
        2  1816 1 1 28 GLU HB2  H  15.376 -10.294   2.366 1.00 . A A . 25 GLU HB2  1 1 
        2  1817 1 1 28 GLU HB3  H  15.762  -9.977   0.684 1.00 . A A . 25 GLU HB3  1 1 
        2  1818 1 1 28 GLU HG2  H  15.070  -7.481   1.469 1.00 . A A . 25 GLU HG2  1 1 
        2  1819 1 1 28 GLU HG3  H  15.735  -8.136   2.968 1.00 . A A . 25 GLU HG3  1 1 
        2  1820 1 1 28 GLU N    N  13.022 -10.911   1.472 1.00 . A A . 25 GLU N    1 1 
        2  1821 1 1 28 GLU O    O  13.033  -8.373  -0.705 1.00 . A A . 25 GLU O    1 1 
        2  1822 1 1 28 GLU OE1  O  17.255  -7.568   0.213 1.00 . A A . 25 GLU OE1  1 1 
        2  1823 1 1 28 GLU OE2  O  18.078  -8.243   2.129 1.00 . A A . 25 GLU OE2  1 1 
        2  1824 1 1 29 ASN C    C  12.531  -9.979  -3.407 1.00 . A A . 26 ASN C    1 1 
        2  1825 1 1 29 ASN CA   C  13.929  -9.850  -2.735 1.00 . A A . 26 ASN CA   1 1 
        2  1826 1 1 29 ASN CB   C  15.015 -10.450  -3.631 1.00 . A A . 26 ASN CB   1 1 
        2  1827 1 1 29 ASN CG   C  16.260  -9.591  -3.600 1.00 . A A . 26 ASN CG   1 1 
        2  1828 1 1 29 ASN H    H  14.391 -11.173  -1.072 1.00 . A A . 26 ASN H    1 1 
        2  1829 1 1 29 ASN HA   H  14.137  -8.801  -2.687 1.00 . A A . 26 ASN HA   1 1 
        2  1830 1 1 29 ASN HB2  H  15.271 -11.449  -3.321 1.00 . A A . 26 ASN HB2  1 1 
        2  1831 1 1 29 ASN HB3  H  14.650 -10.472  -4.646 1.00 . A A . 26 ASN HB3  1 1 
        2  1832 1 1 29 ASN HD21 H  16.909 -10.529  -1.979 1.00 . A A . 26 ASN HD21 1 1 
        2  1833 1 1 29 ASN HD22 H  17.926  -9.265  -2.572 1.00 . A A . 26 ASN HD22 1 1 
        2  1834 1 1 29 ASN N    N  14.024 -10.292  -1.314 1.00 . A A . 26 ASN N    1 1 
        2  1835 1 1 29 ASN ND2  N  17.120  -9.822  -2.622 1.00 . A A . 26 ASN ND2  1 1 
        2  1836 1 1 29 ASN O    O  11.915  -8.933  -3.855 1.00 . A A . 26 ASN O    1 1 
        2  1837 1 1 29 ASN OD1  O  16.426  -8.698  -4.432 1.00 . A A . 26 ASN OD1  1 1 
        2  1838 1 1 30 GLU C    C   9.554 -10.663  -3.393 1.00 . A A . 27 GLU C    1 1 
        2  1839 1 1 30 GLU CA   C  10.701 -11.393  -4.116 1.00 . A A . 27 GLU CA   1 1 
        2  1840 1 1 30 GLU CB   C  10.416 -12.897  -4.285 1.00 . A A . 27 GLU CB   1 1 
        2  1841 1 1 30 GLU CD   C   9.872 -12.701  -6.765 1.00 . A A . 27 GLU CD   1 1 
        2  1842 1 1 30 GLU CG   C   9.453 -13.282  -5.421 1.00 . A A . 27 GLU CG   1 1 
        2  1843 1 1 30 GLU H    H  12.407 -12.010  -3.028 1.00 . A A . 27 GLU H    1 1 
        2  1844 1 1 30 GLU HA   H  10.818 -10.952  -5.099 1.00 . A A . 27 GLU HA   1 1 
        2  1845 1 1 30 GLU HB2  H  11.354 -13.388  -4.475 1.00 . A A . 27 GLU HB2  1 1 
        2  1846 1 1 30 GLU HB3  H  10.010 -13.269  -3.362 1.00 . A A . 27 GLU HB3  1 1 
        2  1847 1 1 30 GLU HG2  H   9.442 -14.366  -5.509 1.00 . A A . 27 GLU HG2  1 1 
        2  1848 1 1 30 GLU HG3  H   8.449 -12.942  -5.187 1.00 . A A . 27 GLU HG3  1 1 
        2  1849 1 1 30 GLU N    N  11.957 -11.205  -3.427 1.00 . A A . 27 GLU N    1 1 
        2  1850 1 1 30 GLU O    O   8.578 -10.280  -4.041 1.00 . A A . 27 GLU O    1 1 
        2  1851 1 1 30 GLU OE1  O  10.720 -13.316  -7.447 1.00 . A A . 27 GLU OE1  1 1 
        2  1852 1 1 30 GLU OE2  O   9.362 -11.622  -7.137 1.00 . A A . 27 GLU OE2  1 1 
        2  1853 1 1 31 PHE C    C   8.945  -8.114  -1.366 1.00 . A A . 28 PHE C    1 1 
        2  1854 1 1 31 PHE CA   C   8.616  -9.643  -1.426 1.00 . A A . 28 PHE CA   1 1 
        2  1855 1 1 31 PHE CB   C   8.180 -10.202  -0.079 1.00 . A A . 28 PHE CB   1 1 
        2  1856 1 1 31 PHE CD1  C   5.809 -11.030  -0.158 1.00 . A A . 28 PHE CD1  1 1 
        2  1857 1 1 31 PHE CD2  C   7.525 -12.684  -0.148 1.00 . A A . 28 PHE CD2  1 1 
        2  1858 1 1 31 PHE CE1  C   4.852 -12.026  -0.179 1.00 . A A . 28 PHE CE1  1 1 
        2  1859 1 1 31 PHE CE2  C   6.563 -13.679  -0.189 1.00 . A A . 28 PHE CE2  1 1 
        2  1860 1 1 31 PHE CG   C   7.158 -11.333  -0.140 1.00 . A A . 28 PHE CG   1 1 
        2  1861 1 1 31 PHE CZ   C   5.229 -13.350  -0.205 1.00 . A A . 28 PHE CZ   1 1 
        2  1862 1 1 31 PHE H    H  10.401 -10.772  -1.503 1.00 . A A . 28 PHE H    1 1 
        2  1863 1 1 31 PHE HA   H   7.784  -9.754  -2.103 1.00 . A A . 28 PHE HA   1 1 
        2  1864 1 1 31 PHE HB2  H   9.061 -10.580   0.431 1.00 . A A . 28 PHE HB2  1 1 
        2  1865 1 1 31 PHE HB3  H   7.760  -9.403   0.505 1.00 . A A . 28 PHE HB3  1 1 
        2  1866 1 1 31 PHE HD1  H   5.500  -9.999  -0.167 1.00 . A A . 28 PHE HD1  1 1 
        2  1867 1 1 31 PHE HD2  H   8.566 -12.964  -0.115 1.00 . A A . 28 PHE HD2  1 1 
        2  1868 1 1 31 PHE HE1  H   3.806 -11.763  -0.194 1.00 . A A . 28 PHE HE1  1 1 
        2  1869 1 1 31 PHE HE2  H   6.853 -14.719  -0.234 1.00 . A A . 28 PHE HE2  1 1 
        2  1870 1 1 31 PHE HZ   H   4.475 -14.129  -0.212 1.00 . A A . 28 PHE HZ   1 1 
        2  1871 1 1 31 PHE N    N   9.637 -10.443  -2.052 1.00 . A A . 28 PHE N    1 1 
        2  1872 1 1 31 PHE O    O   8.016  -7.321  -1.156 1.00 . A A . 28 PHE O    1 1 
        2  1873 1 1 32 ARG C    C   9.884  -5.766  -3.031 1.00 . A A . 29 ARG C    1 1 
        2  1874 1 1 32 ARG CA   C  10.561  -6.240  -1.745 1.00 . A A . 29 ARG CA   1 1 
        2  1875 1 1 32 ARG CB   C  12.083  -5.781  -1.762 1.00 . A A . 29 ARG CB   1 1 
        2  1876 1 1 32 ARG CD   C  12.816  -5.180  -4.196 1.00 . A A . 29 ARG CD   1 1 
        2  1877 1 1 32 ARG CG   C  12.971  -6.148  -3.002 1.00 . A A . 29 ARG CG   1 1 
        2  1878 1 1 32 ARG CZ   C  13.880  -4.797  -6.405 1.00 . A A . 29 ARG CZ   1 1 
        2  1879 1 1 32 ARG H    H  10.974  -8.264  -1.124 1.00 . A A . 29 ARG H    1 1 
        2  1880 1 1 32 ARG HA   H  10.089  -5.697  -0.931 1.00 . A A . 29 ARG HA   1 1 
        2  1881 1 1 32 ARG HB2  H  12.090  -4.703  -1.695 1.00 . A A . 29 ARG HB2  1 1 
        2  1882 1 1 32 ARG HB3  H  12.574  -6.170  -0.865 1.00 . A A . 29 ARG HB3  1 1 
        2  1883 1 1 32 ARG HD2  H  11.771  -5.138  -4.495 1.00 . A A . 29 ARG HD2  1 1 
        2  1884 1 1 32 ARG HD3  H  13.133  -4.190  -3.893 1.00 . A A . 29 ARG HD3  1 1 
        2  1885 1 1 32 ARG HE   H  13.978  -6.498  -5.344 1.00 . A A . 29 ARG HE   1 1 
        2  1886 1 1 32 ARG HG2  H  14.015  -6.117  -2.694 1.00 . A A . 29 ARG HG2  1 1 
        2  1887 1 1 32 ARG HG3  H  12.732  -7.167  -3.326 1.00 . A A . 29 ARG HG3  1 1 
        2  1888 1 1 32 ARG HH11 H  12.864  -3.192  -5.696 1.00 . A A . 29 ARG HH11 1 1 
        2  1889 1 1 32 ARG HH12 H  13.617  -2.961  -7.237 1.00 . A A . 29 ARG HH12 1 1 
        2  1890 1 1 32 ARG HH21 H  14.966  -6.195  -7.397 1.00 . A A . 29 ARG HH21 1 1 
        2  1891 1 1 32 ARG HH22 H  14.816  -4.673  -8.208 1.00 . A A . 29 ARG HH22 1 1 
        2  1892 1 1 32 ARG N    N  10.260  -7.681  -1.440 1.00 . A A . 29 ARG N    1 1 
        2  1893 1 1 32 ARG NE   N  13.613  -5.584  -5.355 1.00 . A A . 29 ARG NE   1 1 
        2  1894 1 1 32 ARG NH1  N  13.416  -3.548  -6.449 1.00 . A A . 29 ARG NH1  1 1 
        2  1895 1 1 32 ARG NH2  N  14.614  -5.260  -7.416 1.00 . A A . 29 ARG NH2  1 1 
        2  1896 1 1 32 ARG O    O   9.646  -4.559  -3.144 1.00 . A A . 29 ARG O    1 1 
        2  1897 1 1 33 LYS C    C   7.360  -5.643  -4.710 1.00 . A A . 30 LYS C    1 1 
        2  1898 1 1 33 LYS CA   C   8.719  -6.241  -5.175 1.00 . A A . 30 LYS CA   1 1 
        2  1899 1 1 33 LYS CB   C   8.593  -7.367  -6.317 1.00 . A A . 30 LYS CB   1 1 
        2  1900 1 1 33 LYS CD   C   6.524  -6.537  -7.705 1.00 . A A . 30 LYS CD   1 1 
        2  1901 1 1 33 LYS CE   C   5.084  -6.846  -8.082 1.00 . A A . 30 LYS CE   1 1 
        2  1902 1 1 33 LYS CG   C   7.215  -7.710  -7.006 1.00 . A A . 30 LYS CG   1 1 
        2  1903 1 1 33 LYS H    H  10.120  -7.557  -4.063 1.00 . A A . 30 LYS H    1 1 
        2  1904 1 1 33 LYS HA   H   9.231  -5.402  -5.617 1.00 . A A . 30 LYS HA   1 1 
        2  1905 1 1 33 LYS HB2  H   9.235  -7.066  -7.133 1.00 . A A . 30 LYS HB2  1 1 
        2  1906 1 1 33 LYS HB3  H   8.983  -8.292  -5.916 1.00 . A A . 30 LYS HB3  1 1 
        2  1907 1 1 33 LYS HD2  H   6.529  -5.688  -7.040 1.00 . A A . 30 LYS HD2  1 1 
        2  1908 1 1 33 LYS HD3  H   7.071  -6.293  -8.601 1.00 . A A . 30 LYS HD3  1 1 
        2  1909 1 1 33 LYS HE2  H   4.595  -7.326  -7.235 1.00 . A A . 30 LYS HE2  1 1 
        2  1910 1 1 33 LYS HE3  H   4.579  -5.915  -8.295 1.00 . A A . 30 LYS HE3  1 1 
        2  1911 1 1 33 LYS HG2  H   7.426  -8.446  -7.761 1.00 . A A . 30 LYS HG2  1 1 
        2  1912 1 1 33 LYS HG3  H   6.533  -8.154  -6.300 1.00 . A A . 30 LYS HG3  1 1 
        2  1913 1 1 33 LYS HZ1  H   5.509  -7.307 -10.070 1.00 . A A . 30 LYS HZ1  1 1 
        2  1914 1 1 33 LYS HZ2  H   4.015  -7.885  -9.535 1.00 . A A . 30 LYS HZ2  1 1 
        2  1915 1 1 33 LYS HZ3  H   5.441  -8.652  -9.049 1.00 . A A . 30 LYS HZ3  1 1 
        2  1916 1 1 33 LYS N    N   9.621  -6.670  -4.032 1.00 . A A . 30 LYS N    1 1 
        2  1917 1 1 33 LYS NZ   N   5.004  -7.736  -9.265 1.00 . A A . 30 LYS NZ   1 1 
        2  1918 1 1 33 LYS O    O   6.892  -4.698  -5.354 1.00 . A A . 30 LYS O    1 1 
        2  1919 1 1 34 TYR C    C   5.268  -4.271  -2.734 1.00 . A A . 31 TYR C    1 1 
        2  1920 1 1 34 TYR CA   C   5.425  -5.724  -3.240 1.00 . A A . 31 TYR CA   1 1 
        2  1921 1 1 34 TYR CB   C   4.908  -6.707  -2.189 1.00 . A A . 31 TYR CB   1 1 
        2  1922 1 1 34 TYR CD1  C   5.409  -8.911  -3.430 1.00 . A A . 31 TYR CD1  1 1 
        2  1923 1 1 34 TYR CD2  C   3.412  -8.743  -2.127 1.00 . A A . 31 TYR CD2  1 1 
        2  1924 1 1 34 TYR CE1  C   5.112 -10.221  -3.719 1.00 . A A . 31 TYR CE1  1 1 
        2  1925 1 1 34 TYR CE2  C   3.106 -10.059  -2.442 1.00 . A A . 31 TYR CE2  1 1 
        2  1926 1 1 34 TYR CG   C   4.564  -8.134  -2.622 1.00 . A A . 31 TYR CG   1 1 
        2  1927 1 1 34 TYR CZ   C   3.972 -10.785  -3.237 1.00 . A A . 31 TYR CZ   1 1 
        2  1928 1 1 34 TYR H    H   7.378  -6.452  -2.855 1.00 . A A . 31 TYR H    1 1 
        2  1929 1 1 34 TYR HA   H   4.836  -5.833  -4.145 1.00 . A A . 31 TYR HA   1 1 
        2  1930 1 1 34 TYR HB2  H   5.651  -6.802  -1.445 1.00 . A A . 31 TYR HB2  1 1 
        2  1931 1 1 34 TYR HB3  H   4.041  -6.281  -1.736 1.00 . A A . 31 TYR HB3  1 1 
        2  1932 1 1 34 TYR HD1  H   6.300  -8.476  -3.842 1.00 . A A . 31 TYR HD1  1 1 
        2  1933 1 1 34 TYR HD2  H   2.744  -8.167  -1.498 1.00 . A A . 31 TYR HD2  1 1 
        2  1934 1 1 34 TYR HE1  H   5.771 -10.806  -4.336 1.00 . A A . 31 TYR HE1  1 1 
        2  1935 1 1 34 TYR HE2  H   2.195 -10.519  -2.069 1.00 . A A . 31 TYR HE2  1 1 
        2  1936 1 1 34 TYR HH   H   4.563 -12.577  -3.515 1.00 . A A . 31 TYR HH   1 1 
        2  1937 1 1 34 TYR N    N   6.817  -6.035  -3.549 1.00 . A A . 31 TYR N    1 1 
        2  1938 1 1 34 TYR O    O   4.383  -3.569  -3.206 1.00 . A A . 31 TYR O    1 1 
        2  1939 1 1 34 TYR OH   O   3.726 -12.100  -3.510 1.00 . A A . 31 TYR OH   1 1 
        2  1940 1 1 35 GLY C    C   7.382  -1.870  -0.853 1.00 . A A . 32 GLY C    1 1 
        2  1941 1 1 35 GLY CA   C   6.216  -2.348  -1.684 1.00 . A A . 32 GLY CA   1 1 
        2  1942 1 1 35 GLY H    H   6.589  -4.373  -1.195 1.00 . A A . 32 GLY H    1 1 
        2  1943 1 1 35 GLY HA2  H   6.300  -1.916  -2.659 1.00 . A A . 32 GLY HA2  1 1 
        2  1944 1 1 35 GLY HA3  H   5.297  -2.002  -1.234 1.00 . A A . 32 GLY HA3  1 1 
        2  1945 1 1 35 GLY N    N   6.138  -3.785  -1.836 1.00 . A A . 32 GLY N    1 1 
        2  1946 1 1 35 GLY O    O   7.183  -0.981  -0.039 1.00 . A A . 32 GLY O    1 1 
        2  1947 1 1 36 ASN C    C   9.631  -2.412   1.158 1.00 . A A . 33 ASN C    1 1 
        2  1948 1 1 36 ASN CA   C   9.824  -2.106  -0.342 1.00 . A A . 33 ASN CA   1 1 
        2  1949 1 1 36 ASN CB   C  10.264  -0.645  -0.553 1.00 . A A . 33 ASN CB   1 1 
        2  1950 1 1 36 ASN CG   C  11.766  -0.438  -0.413 1.00 . A A . 33 ASN CG   1 1 
        2  1951 1 1 36 ASN H    H   8.668  -3.130  -1.790 1.00 . A A . 33 ASN H    1 1 
        2  1952 1 1 36 ASN HA   H  10.604  -2.747  -0.738 1.00 . A A . 33 ASN HA   1 1 
        2  1953 1 1 36 ASN HB2  H   9.969  -0.325  -1.535 1.00 . A A . 33 ASN HB2  1 1 
        2  1954 1 1 36 ASN HB3  H   9.776  -0.028   0.170 1.00 . A A . 33 ASN HB3  1 1 
        2  1955 1 1 36 ASN HD21 H  11.970  -0.543  -2.382 1.00 . A A . 33 ASN HD21 1 1 
        2  1956 1 1 36 ASN HD22 H  13.425  -0.278  -1.493 1.00 . A A . 33 ASN HD22 1 1 
        2  1957 1 1 36 ASN N    N   8.592  -2.443  -1.087 1.00 . A A . 33 ASN N    1 1 
        2  1958 1 1 36 ASN ND2  N  12.458  -0.424  -1.543 1.00 . A A . 33 ASN ND2  1 1 
        2  1959 1 1 36 ASN O    O   9.185  -1.566   1.943 1.00 . A A . 33 ASN O    1 1 
        2  1960 1 1 36 ASN OD1  O  12.295  -0.256   0.687 1.00 . A A . 33 ASN OD1  1 1 
        2  1961 1 1 37 ILE C    C  10.756  -3.436   3.907 1.00 . A A . 34 ILE C    1 1 
        2  1962 1 1 37 ILE CA   C   9.751  -4.123   2.923 1.00 . A A . 34 ILE CA   1 1 
        2  1963 1 1 37 ILE CB   C   9.801  -5.730   3.045 1.00 . A A . 34 ILE CB   1 1 
        2  1964 1 1 37 ILE CD1  C  12.016  -6.463   4.282 1.00 . A A . 34 ILE CD1  1 1 
        2  1965 1 1 37 ILE CG1  C  10.495  -6.267   4.344 1.00 . A A . 34 ILE CG1  1 1 
        2  1966 1 1 37 ILE CG2  C  10.411  -6.381   1.810 1.00 . A A . 34 ILE CG2  1 1 
        2  1967 1 1 37 ILE H    H  10.117  -4.295   0.800 1.00 . A A . 34 ILE H    1 1 
        2  1968 1 1 37 ILE HA   H   8.759  -3.825   3.191 1.00 . A A . 34 ILE HA   1 1 
        2  1969 1 1 37 ILE HB   H   8.768  -6.065   3.077 1.00 . A A . 34 ILE HB   1 1 
        2  1970 1 1 37 ILE HD11 H  12.245  -7.186   3.529 1.00 . A A . 34 ILE HD11 1 1 
        2  1971 1 1 37 ILE HD12 H  12.381  -6.807   5.230 1.00 . A A . 34 ILE HD12 1 1 
        2  1972 1 1 37 ILE HD13 H  12.494  -5.526   4.041 1.00 . A A . 34 ILE HD13 1 1 
        2  1973 1 1 37 ILE HG12 H  10.299  -5.572   5.147 1.00 . A A . 34 ILE HG12 1 1 
        2  1974 1 1 37 ILE HG13 H  10.052  -7.221   4.596 1.00 . A A . 34 ILE HG13 1 1 
        2  1975 1 1 37 ILE HG21 H  10.644  -7.412   2.021 1.00 . A A . 34 ILE HG21 1 1 
        2  1976 1 1 37 ILE HG22 H  11.312  -5.852   1.529 1.00 . A A . 34 ILE HG22 1 1 
        2  1977 1 1 37 ILE HG23 H   9.705  -6.340   0.997 1.00 . A A . 34 ILE HG23 1 1 
        2  1978 1 1 37 ILE N    N   9.919  -3.654   1.517 1.00 . A A . 34 ILE N    1 1 
        2  1979 1 1 37 ILE O    O  11.918  -3.221   3.554 1.00 . A A . 34 ILE O    1 1 
        2  1980 1 1 38 LEU C    C  11.458  -3.614   7.238 1.00 . A A . 35 LEU C    1 1 
        2  1981 1 1 38 LEU CA   C  11.212  -2.522   6.170 1.00 . A A . 35 LEU CA   1 1 
        2  1982 1 1 38 LEU CB   C  10.788  -1.179   6.905 1.00 . A A . 35 LEU CB   1 1 
        2  1983 1 1 38 LEU CD1  C  10.082   0.230   4.850 1.00 . A A . 35 LEU CD1  1 1 
        2  1984 1 1 38 LEU CD2  C   8.323  -0.770   6.351 1.00 . A A . 35 LEU CD2  1 1 
        2  1985 1 1 38 LEU CG   C   9.738  -0.206   6.275 1.00 . A A . 35 LEU CG   1 1 
        2  1986 1 1 38 LEU H    H   9.332  -3.120   5.337 1.00 . A A . 35 LEU H    1 1 
        2  1987 1 1 38 LEU HA   H  12.158  -2.339   5.670 1.00 . A A . 35 LEU HA   1 1 
        2  1988 1 1 38 LEU HB2  H  10.438  -1.425   7.902 1.00 . A A . 35 LEU HB2  1 1 
        2  1989 1 1 38 LEU HB3  H  11.704  -0.608   7.041 1.00 . A A . 35 LEU HB3  1 1 
        2  1990 1 1 38 LEU HD11 H   9.276   0.837   4.464 1.00 . A A . 35 LEU HD11 1 1 
        2  1991 1 1 38 LEU HD12 H  10.210  -0.637   4.220 1.00 . A A . 35 LEU HD12 1 1 
        2  1992 1 1 38 LEU HD13 H  10.993   0.810   4.854 1.00 . A A . 35 LEU HD13 1 1 
        2  1993 1 1 38 LEU HD21 H   8.195  -1.303   7.283 1.00 . A A . 35 LEU HD21 1 1 
        2  1994 1 1 38 LEU HD22 H   8.147  -1.436   5.520 1.00 . A A . 35 LEU HD22 1 1 
        2  1995 1 1 38 LEU HD23 H   7.620   0.044   6.314 1.00 . A A . 35 LEU HD23 1 1 
        2  1996 1 1 38 LEU HG   H   9.740   0.697   6.872 1.00 . A A . 35 LEU HG   1 1 
        2  1997 1 1 38 LEU N    N  10.285  -3.041   5.129 1.00 . A A . 35 LEU N    1 1 
        2  1998 1 1 38 LEU O    O  12.509  -3.631   7.886 1.00 . A A . 35 LEU O    1 1 
        2  1999 1 1 39 LYS C    C   9.772  -6.843   7.992 1.00 . A A . 36 LYS C    1 1 
        2  2000 1 1 39 LYS CA   C  10.511  -5.554   8.471 1.00 . A A . 36 LYS CA   1 1 
        2  2001 1 1 39 LYS CB   C   9.829  -4.997   9.739 1.00 . A A . 36 LYS CB   1 1 
        2  2002 1 1 39 LYS CD   C   9.458  -5.470  12.209 1.00 . A A . 36 LYS CD   1 1 
        2  2003 1 1 39 LYS CE   C   8.991  -6.852  12.688 1.00 . A A . 36 LYS CE   1 1 
        2  2004 1 1 39 LYS CG   C  10.425  -5.550  11.029 1.00 . A A . 36 LYS CG   1 1 
        2  2005 1 1 39 LYS H    H   9.732  -4.538   6.774 1.00 . A A . 36 LYS H    1 1 
        2  2006 1 1 39 LYS HA   H  11.545  -5.777   8.700 1.00 . A A . 36 LYS HA   1 1 
        2  2007 1 1 39 LYS HB2  H   9.950  -3.922   9.745 1.00 . A A . 36 LYS HB2  1 1 
        2  2008 1 1 39 LYS HB3  H   8.767  -5.224   9.717 1.00 . A A . 36 LYS HB3  1 1 
        2  2009 1 1 39 LYS HD2  H   9.954  -4.971  13.026 1.00 . A A . 36 LYS HD2  1 1 
        2  2010 1 1 39 LYS HD3  H   8.594  -4.895  11.909 1.00 . A A . 36 LYS HD3  1 1 
        2  2011 1 1 39 LYS HE2  H   8.336  -6.723  13.535 1.00 . A A . 36 LYS HE2  1 1 
        2  2012 1 1 39 LYS HE3  H   8.444  -7.336  11.898 1.00 . A A . 36 LYS HE3  1 1 
        2  2013 1 1 39 LYS HG2  H  10.707  -6.574  10.870 1.00 . A A . 36 LYS HG2  1 1 
        2  2014 1 1 39 LYS HG3  H  11.309  -4.977  11.267 1.00 . A A . 36 LYS HG3  1 1 
        2  2015 1 1 39 LYS HZ1  H  10.636  -7.298  13.897 1.00 . A A . 36 LYS HZ1  1 1 
        2  2016 1 1 39 LYS HZ2  H  10.787  -7.848  12.308 1.00 . A A . 36 LYS HZ2  1 1 
        2  2017 1 1 39 LYS HZ3  H   9.774  -8.664  13.387 1.00 . A A . 36 LYS HZ3  1 1 
        2  2018 1 1 39 LYS N    N  10.482  -4.532   7.404 1.00 . A A . 36 LYS N    1 1 
        2  2019 1 1 39 LYS NZ   N  10.126  -7.726  13.099 1.00 . A A . 36 LYS NZ   1 1 
        2  2020 1 1 39 LYS O    O   8.726  -6.725   7.354 1.00 . A A . 36 LYS O    1 1 
        2  2021 1 1 40 CYS C    C   9.825 -10.332   9.002 1.00 . A A . 37 CYS C    1 1 
        2  2022 1 1 40 CYS CA   C   9.629  -9.320   7.897 1.00 . A A . 37 CYS CA   1 1 
        2  2023 1 1 40 CYS CB   C  10.160  -9.890   6.560 1.00 . A A . 37 CYS CB   1 1 
        2  2024 1 1 40 CYS H    H  11.175  -8.150   8.741 1.00 . A A . 37 CYS H    1 1 
        2  2025 1 1 40 CYS HA   H   8.562  -9.122   7.807 1.00 . A A . 37 CYS HA   1 1 
        2  2026 1 1 40 CYS HB2  H  10.052 -10.969   6.570 1.00 . A A . 37 CYS HB2  1 1 
        2  2027 1 1 40 CYS HB3  H   9.582  -9.487   5.744 1.00 . A A . 37 CYS HB3  1 1 
        2  2028 1 1 40 CYS HG   H  12.130  -8.286   6.538 1.00 . A A . 37 CYS HG   1 1 
        2  2029 1 1 40 CYS N    N  10.312  -8.067   8.259 1.00 . A A . 37 CYS N    1 1 
        2  2030 1 1 40 CYS O    O  10.950 -10.791   9.234 1.00 . A A . 37 CYS O    1 1 
        2  2031 1 1 40 CYS SG   S  11.905  -9.551   6.235 1.00 . A A . 37 CYS SG   1 1 
        2  2032 1 1 41 ASP C    C   8.229 -13.021  10.434 1.00 . A A . 38 ASP C    1 1 
        2  2033 1 1 41 ASP CA   C   8.938 -11.697  10.785 1.00 . A A . 38 ASP CA   1 1 
        2  2034 1 1 41 ASP CB   C   8.504 -11.196  12.175 1.00 . A A . 38 ASP CB   1 1 
        2  2035 1 1 41 ASP CG   C   9.374 -11.726  13.298 1.00 . A A . 38 ASP CG   1 1 
        2  2036 1 1 41 ASP H    H   7.890 -10.143   9.612 1.00 . A A . 38 ASP H    1 1 
        2  2037 1 1 41 ASP HA   H  10.011 -11.912  10.832 1.00 . A A . 38 ASP HA   1 1 
        2  2038 1 1 41 ASP HB2  H   8.597 -10.127  12.203 1.00 . A A . 38 ASP HB2  1 1 
        2  2039 1 1 41 ASP HB3  H   7.475 -11.484  12.366 1.00 . A A . 38 ASP HB3  1 1 
        2  2040 1 1 41 ASP N    N   8.766 -10.652   9.735 1.00 . A A . 38 ASP N    1 1 
        2  2041 1 1 41 ASP O    O   7.173 -13.025   9.794 1.00 . A A . 38 ASP O    1 1 
        2  2042 1 1 41 ASP OD1  O   9.340 -12.936  13.594 1.00 . A A . 38 ASP OD1  1 1 
        2  2043 1 1 41 ASP OD2  O  10.091 -10.907  13.908 1.00 . A A . 38 ASP OD2  1 1 
        2  2044 1 1 42 VAL C    C   7.928 -16.007  12.070 1.00 . A A . 39 VAL C    1 1 
        2  2045 1 1 42 VAL CA   C   8.249 -15.487  10.681 1.00 . A A . 39 VAL CA   1 1 
        2  2046 1 1 42 VAL CB   C   9.225 -16.567   9.936 1.00 . A A . 39 VAL CB   1 1 
        2  2047 1 1 42 VAL CG1  C   8.797 -18.058   9.998 1.00 . A A . 39 VAL CG1  1 1 
        2  2048 1 1 42 VAL CG2  C   9.503 -16.288   8.465 1.00 . A A . 39 VAL CG2  1 1 
        2  2049 1 1 42 VAL H    H   9.626 -14.051  11.433 1.00 . A A . 39 VAL H    1 1 
        2  2050 1 1 42 VAL HA   H   7.317 -15.330  10.147 1.00 . A A . 39 VAL HA   1 1 
        2  2051 1 1 42 VAL HB   H  10.182 -16.529  10.437 1.00 . A A . 39 VAL HB   1 1 
        2  2052 1 1 42 VAL HG11 H   7.896 -18.235   9.428 1.00 . A A . 39 VAL HG11 1 1 
        2  2053 1 1 42 VAL HG12 H   8.662 -18.375  11.023 1.00 . A A . 39 VAL HG12 1 1 
        2  2054 1 1 42 VAL HG13 H   9.593 -18.647   9.561 1.00 . A A . 39 VAL HG13 1 1 
        2  2055 1 1 42 VAL HG21 H   8.650 -15.875   7.988 1.00 . A A . 39 VAL HG21 1 1 
        2  2056 1 1 42 VAL HG22 H   9.728 -17.236   7.993 1.00 . A A . 39 VAL HG22 1 1 
        2  2057 1 1 42 VAL HG23 H  10.348 -15.627   8.363 1.00 . A A . 39 VAL HG23 1 1 
        2  2058 1 1 42 VAL N    N   8.836 -14.144  10.866 1.00 . A A . 39 VAL N    1 1 
        2  2059 1 1 42 VAL O    O   8.842 -16.290  12.860 1.00 . A A . 39 VAL O    1 1 
        2  2060 1 1 43 LYS C    C   5.349 -17.885  13.532 1.00 . A A . 40 LYS C    1 1 
        2  2061 1 1 43 LYS CA   C   6.247 -16.616  13.690 1.00 . A A . 40 LYS CA   1 1 
        2  2062 1 1 43 LYS CB   C   5.560 -15.451  14.428 1.00 . A A . 40 LYS CB   1 1 
        2  2063 1 1 43 LYS CD   C   5.999 -13.495  15.945 1.00 . A A . 40 LYS CD   1 1 
        2  2064 1 1 43 LYS CE   C   6.792 -12.209  16.213 1.00 . A A . 40 LYS CE   1 1 
        2  2065 1 1 43 LYS CG   C   6.532 -14.311  14.778 1.00 . A A . 40 LYS CG   1 1 
        2  2066 1 1 43 LYS H    H   5.943 -15.776  11.761 1.00 . A A . 40 LYS H    1 1 
        2  2067 1 1 43 LYS HA   H   7.157 -16.868  14.213 1.00 . A A . 40 LYS HA   1 1 
        2  2068 1 1 43 LYS HB2  H   4.793 -15.037  13.776 1.00 . A A . 40 LYS HB2  1 1 
        2  2069 1 1 43 LYS HB3  H   5.105 -15.798  15.341 1.00 . A A . 40 LYS HB3  1 1 
        2  2070 1 1 43 LYS HD2  H   4.980 -13.230  15.721 1.00 . A A . 40 LYS HD2  1 1 
        2  2071 1 1 43 LYS HD3  H   6.022 -14.109  16.834 1.00 . A A . 40 LYS HD3  1 1 
        2  2072 1 1 43 LYS HE2  H   6.585 -11.495  15.426 1.00 . A A . 40 LYS HE2  1 1 
        2  2073 1 1 43 LYS HE3  H   6.451 -11.794  17.155 1.00 . A A . 40 LYS HE3  1 1 
        2  2074 1 1 43 LYS HG2  H   7.501 -14.730  15.029 1.00 . A A . 40 LYS HG2  1 1 
        2  2075 1 1 43 LYS HG3  H   6.648 -13.672  13.916 1.00 . A A . 40 LYS HG3  1 1 
        2  2076 1 1 43 LYS HZ1  H   8.630 -12.778  15.379 1.00 . A A . 40 LYS HZ1  1 1 
        2  2077 1 1 43 LYS HZ2  H   8.494 -13.120  17.035 1.00 . A A . 40 LYS HZ2  1 1 
        2  2078 1 1 43 LYS HZ3  H   8.747 -11.531  16.517 1.00 . A A . 40 LYS HZ3  1 1 
        2  2079 1 1 43 LYS N    N   6.644 -16.114  12.386 1.00 . A A . 40 LYS N    1 1 
        2  2080 1 1 43 LYS NZ   N   8.267 -12.427  16.296 1.00 . A A . 40 LYS NZ   1 1 
        2  2081 1 1 43 LYS O    O   4.474 -17.892  12.662 1.00 . A A . 40 LYS O    1 1 
        2  2082 1 1 44 LYS C    C   4.051 -20.707  15.272 1.00 . A A . 41 LYS C    1 1 
        2  2083 1 1 44 LYS CA   C   4.857 -20.251  14.018 1.00 . A A . 41 LYS CA   1 1 
        2  2084 1 1 44 LYS CB   C   5.884 -21.360  13.443 1.00 . A A . 41 LYS CB   1 1 
        2  2085 1 1 44 LYS CD   C   7.372 -21.574  15.537 1.00 . A A . 41 LYS CD   1 1 
        2  2086 1 1 44 LYS CE   C   8.396 -20.570  14.993 1.00 . A A . 41 LYS CE   1 1 
        2  2087 1 1 44 LYS CG   C   6.587 -22.307  14.446 1.00 . A A . 41 LYS CG   1 1 
        2  2088 1 1 44 LYS H    H   6.021 -18.893  15.223 1.00 . A A . 41 LYS H    1 1 
        2  2089 1 1 44 LYS HA   H   4.160 -19.995  13.253 1.00 . A A . 41 LYS HA   1 1 
        2  2090 1 1 44 LYS HB2  H   5.359 -21.989  12.742 1.00 . A A . 41 LYS HB2  1 1 
        2  2091 1 1 44 LYS HB3  H   6.681 -20.871  12.880 1.00 . A A . 41 LYS HB3  1 1 
        2  2092 1 1 44 LYS HD2  H   6.654 -21.035  16.141 1.00 . A A . 41 LYS HD2  1 1 
        2  2093 1 1 44 LYS HD3  H   7.878 -22.305  16.148 1.00 . A A . 41 LYS HD3  1 1 
        2  2094 1 1 44 LYS HE2  H   8.968 -21.033  14.207 1.00 . A A . 41 LYS HE2  1 1 
        2  2095 1 1 44 LYS HE3  H   7.857 -19.715  14.584 1.00 . A A . 41 LYS HE3  1 1 
        2  2096 1 1 44 LYS HG2  H   5.840 -22.936  14.919 1.00 . A A . 41 LYS HG2  1 1 
        2  2097 1 1 44 LYS HG3  H   7.273 -22.944  13.894 1.00 . A A . 41 LYS HG3  1 1 
        2  2098 1 1 44 LYS HZ1  H  10.010 -19.420  15.655 1.00 . A A . 41 LYS HZ1  1 1 
        2  2099 1 1 44 LYS HZ2  H   9.828 -20.883  16.482 1.00 . A A . 41 LYS HZ2  1 1 
        2  2100 1 1 44 LYS HZ3  H   8.781 -19.593  16.804 1.00 . A A . 41 LYS HZ3  1 1 
        2  2101 1 1 44 LYS N    N   5.535 -18.973  14.345 1.00 . A A . 41 LYS N    1 1 
        2  2102 1 1 44 LYS NZ   N   9.318 -20.084  16.057 1.00 . A A . 41 LYS NZ   1 1 
        2  2103 1 1 44 LYS O    O   4.494 -20.427  16.390 1.00 . A A . 41 LYS O    1 1 
        2  2104 1 1 45 THR C    C   2.303 -23.231  16.638 1.00 . A A . 42 THR C    1 1 
        2  2105 1 1 45 THR CA   C   2.111 -21.715  16.332 1.00 . A A . 42 THR CA   1 1 
        2  2106 1 1 45 THR CB   C   0.586 -21.340  16.248 1.00 . A A . 42 THR CB   1 1 
        2  2107 1 1 45 THR CG2  C  -0.206 -22.241  15.291 1.00 . A A . 42 THR CG2  1 1 
        2  2108 1 1 45 THR H    H   2.453 -21.513  14.256 1.00 . A A . 42 THR H    1 1 
        2  2109 1 1 45 THR HA   H   2.562 -21.133  17.130 1.00 . A A . 42 THR HA   1 1 
        2  2110 1 1 45 THR HB   H   0.509 -20.326  15.901 1.00 . A A . 42 THR HB   1 1 
        2  2111 1 1 45 THR HG1  H  -0.938 -21.684  17.457 1.00 . A A . 42 THR HG1  1 1 
        2  2112 1 1 45 THR HG21 H   0.145 -23.255  15.385 1.00 . A A . 42 THR HG21 1 1 
        2  2113 1 1 45 THR HG22 H  -0.086 -21.913  14.273 1.00 . A A . 42 THR HG22 1 1 
        2  2114 1 1 45 THR HG23 H  -1.252 -22.204  15.554 1.00 . A A . 42 THR HG23 1 1 
        2  2115 1 1 45 THR N    N   2.847 -21.328  15.136 1.00 . A A . 42 THR N    1 1 
        2  2116 1 1 45 THR O    O   2.871 -23.956  15.813 1.00 . A A . 42 THR O    1 1 
        2  2117 1 1 45 THR OG1  O  -0.019 -21.410  17.545 1.00 . A A . 42 THR OG1  1 1 
        2  2118 1 1 46 VAL C    C   0.951 -26.047  17.480 1.00 . A A . 43 VAL C    1 1 
        2  2119 1 1 46 VAL CA   C   1.935 -25.114  18.244 1.00 . A A . 43 VAL CA   1 1 
        2  2120 1 1 46 VAL CB   C   1.743 -25.273  19.812 1.00 . A A . 43 VAL CB   1 1 
        2  2121 1 1 46 VAL CG1  C   2.454 -26.514  20.327 1.00 . A A . 43 VAL CG1  1 1 
        2  2122 1 1 46 VAL CG2  C   2.220 -24.039  20.608 1.00 . A A . 43 VAL CG2  1 1 
        2  2123 1 1 46 VAL H    H   1.356 -23.077  18.421 1.00 . A A . 43 VAL H    1 1 
        2  2124 1 1 46 VAL HA   H   2.939 -25.442  17.992 1.00 . A A . 43 VAL HA   1 1 
        2  2125 1 1 46 VAL HB   H   0.689 -25.415  20.025 1.00 . A A . 43 VAL HB   1 1 
        2  2126 1 1 46 VAL HG11 H   3.513 -26.432  20.128 1.00 . A A . 43 VAL HG11 1 1 
        2  2127 1 1 46 VAL HG12 H   2.060 -27.388  19.828 1.00 . A A . 43 VAL HG12 1 1 
        2  2128 1 1 46 VAL HG13 H   2.292 -26.602  21.389 1.00 . A A . 43 VAL HG13 1 1 
        2  2129 1 1 46 VAL HG21 H   2.116 -24.240  21.666 1.00 . A A . 43 VAL HG21 1 1 
        2  2130 1 1 46 VAL HG22 H   1.617 -23.178  20.355 1.00 . A A . 43 VAL HG22 1 1 
        2  2131 1 1 46 VAL HG23 H   3.257 -23.829  20.389 1.00 . A A . 43 VAL HG23 1 1 
        2  2132 1 1 46 VAL N    N   1.811 -23.703  17.814 1.00 . A A . 43 VAL N    1 1 
        2  2133 1 1 46 VAL O    O   1.084 -27.271  17.526 1.00 . A A . 43 VAL O    1 1 
        2  2134 1 1 47 SER C    C  -0.505 -26.640  14.585 1.00 . A A . 44 SER C    1 1 
        2  2135 1 1 47 SER CA   C  -1.021 -26.255  15.991 1.00 . A A . 44 SER CA   1 1 
        2  2136 1 1 47 SER CB   C  -2.383 -25.473  15.861 1.00 . A A . 44 SER CB   1 1 
        2  2137 1 1 47 SER H    H   0.027 -24.495  16.600 1.00 . A A . 44 SER H    1 1 
        2  2138 1 1 47 SER HA   H  -1.173 -27.169  16.561 1.00 . A A . 44 SER HA   1 1 
        2  2139 1 1 47 SER HB2  H  -2.481 -25.056  14.861 1.00 . A A . 44 SER HB2  1 1 
        2  2140 1 1 47 SER HB3  H  -3.229 -26.145  16.029 1.00 . A A . 44 SER HB3  1 1 
        2  2141 1 1 47 SER HG   H  -3.379 -24.325  17.111 1.00 . A A . 44 SER HG   1 1 
        2  2142 1 1 47 SER N    N   0.004 -25.464  16.715 1.00 . A A . 44 SER N    1 1 
        2  2143 1 1 47 SER O    O  -1.252 -27.183  13.765 1.00 . A A . 44 SER O    1 1 
        2  2144 1 1 47 SER OG   O  -2.465 -24.415  16.812 1.00 . A A . 44 SER OG   1 1 
        2  2145 1 1 48 GLY C    C   1.173 -25.690  11.891 1.00 . A A . 45 GLY C    1 1 
        2  2146 1 1 48 GLY CA   C   1.411 -26.688  13.035 1.00 . A A . 45 GLY CA   1 1 
        2  2147 1 1 48 GLY H    H   1.343 -25.970  15.044 1.00 . A A . 45 GLY H    1 1 
        2  2148 1 1 48 GLY HA2  H   2.478 -26.765  13.193 1.00 . A A . 45 GLY HA2  1 1 
        2  2149 1 1 48 GLY HA3  H   1.046 -27.657  12.725 1.00 . A A . 45 GLY HA3  1 1 
        2  2150 1 1 48 GLY N    N   0.785 -26.353  14.321 1.00 . A A . 45 GLY N    1 1 
        2  2151 1 1 48 GLY O    O   1.741 -25.864  10.810 1.00 . A A . 45 GLY O    1 1 
        2  2152 1 1 49 ALA C    C   1.224 -22.511  11.236 1.00 . A A . 46 ALA C    1 1 
        2  2153 1 1 49 ALA CA   C   0.141 -23.614  11.094 1.00 . A A . 46 ALA CA   1 1 
        2  2154 1 1 49 ALA CB   C  -1.302 -23.043  11.181 1.00 . A A . 46 ALA CB   1 1 
        2  2155 1 1 49 ALA H    H  -0.122 -24.608  12.950 1.00 . A A . 46 ALA H    1 1 
        2  2156 1 1 49 ALA HA   H   0.246 -24.089  10.126 1.00 . A A . 46 ALA HA   1 1 
        2  2157 1 1 49 ALA HB1  H  -1.478 -22.576  12.142 1.00 . A A . 46 ALA HB1  1 1 
        2  2158 1 1 49 ALA HB2  H  -2.013 -23.847  11.044 1.00 . A A . 46 ALA HB2  1 1 
        2  2159 1 1 49 ALA HB3  H  -1.456 -22.312  10.403 1.00 . A A . 46 ALA HB3  1 1 
        2  2160 1 1 49 ALA N    N   0.353 -24.657  12.108 1.00 . A A . 46 ALA N    1 1 
        2  2161 1 1 49 ALA O    O   1.486 -22.039  12.348 1.00 . A A . 46 ALA O    1 1 
        2  2162 1 1 50 ALA C    C   2.362 -19.779   9.627 1.00 . A A . 47 ALA C    1 1 
        2  2163 1 1 50 ALA CA   C   2.925 -21.082  10.171 1.00 . A A . 47 ALA CA   1 1 
        2  2164 1 1 50 ALA CB   C   4.240 -21.490   9.430 1.00 . A A . 47 ALA CB   1 1 
        2  2165 1 1 50 ALA H    H   1.576 -22.467   9.252 1.00 . A A . 47 ALA H    1 1 
        2  2166 1 1 50 ALA HA   H   3.164 -20.943  11.198 1.00 . A A . 47 ALA HA   1 1 
        2  2167 1 1 50 ALA HB1  H   5.021 -20.759   9.633 1.00 . A A . 47 ALA HB1  1 1 
        2  2168 1 1 50 ALA HB2  H   4.087 -21.527   8.362 1.00 . A A . 47 ALA HB2  1 1 
        2  2169 1 1 50 ALA HB3  H   4.574 -22.459   9.780 1.00 . A A . 47 ALA HB3  1 1 
        2  2170 1 1 50 ALA N    N   1.863 -22.113  10.121 1.00 . A A . 47 ALA N    1 1 
        2  2171 1 1 50 ALA O    O   1.509 -19.822   8.733 1.00 . A A . 47 ALA O    1 1 
        2  2172 1 1 51 PHE C    C   3.454 -16.481   9.222 1.00 . A A . 48 PHE C    1 1 
        2  2173 1 1 51 PHE CA   C   2.283 -17.365   9.608 1.00 . A A . 48 PHE CA   1 1 
        2  2174 1 1 51 PHE CB   C   1.491 -16.615  10.701 1.00 . A A . 48 PHE CB   1 1 
        2  2175 1 1 51 PHE CD1  C  -0.633 -17.887  10.971 1.00 . A A . 48 PHE CD1  1 1 
        2  2176 1 1 51 PHE CD2  C   0.943 -17.898  12.748 1.00 . A A . 48 PHE CD2  1 1 
        2  2177 1 1 51 PHE CE1  C  -1.462 -18.704  11.695 1.00 . A A . 48 PHE CE1  1 1 
        2  2178 1 1 51 PHE CE2  C   0.125 -18.699  13.479 1.00 . A A . 48 PHE CE2  1 1 
        2  2179 1 1 51 PHE CG   C   0.575 -17.482  11.490 1.00 . A A . 48 PHE CG   1 1 
        2  2180 1 1 51 PHE CZ   C  -1.088 -19.111  12.964 1.00 . A A . 48 PHE CZ   1 1 
        2  2181 1 1 51 PHE H    H   3.377 -18.573  10.966 1.00 . A A . 48 PHE H    1 1 
        2  2182 1 1 51 PHE HA   H   1.636 -17.583   8.763 1.00 . A A . 48 PHE HA   1 1 
        2  2183 1 1 51 PHE HB2  H   2.189 -16.167  11.399 1.00 . A A . 48 PHE HB2  1 1 
        2  2184 1 1 51 PHE HB3  H   0.897 -15.838  10.248 1.00 . A A . 48 PHE HB3  1 1 
        2  2185 1 1 51 PHE HD1  H  -0.923 -17.559   9.984 1.00 . A A . 48 PHE HD1  1 1 
        2  2186 1 1 51 PHE HD2  H   1.895 -17.597  13.163 1.00 . A A . 48 PHE HD2  1 1 
        2  2187 1 1 51 PHE HE1  H  -2.393 -19.016  11.274 1.00 . A A . 48 PHE HE1  1 1 
        2  2188 1 1 51 PHE HE2  H   0.433 -18.993  14.454 1.00 . A A . 48 PHE HE2  1 1 
        2  2189 1 1 51 PHE HZ   H  -1.733 -19.757  13.544 1.00 . A A . 48 PHE HZ   1 1 
        2  2190 1 1 51 PHE N    N   2.801 -18.611  10.140 1.00 . A A . 48 PHE N    1 1 
        2  2191 1 1 51 PHE O    O   4.506 -16.527   9.869 1.00 . A A . 48 PHE O    1 1 
        2  2192 1 1 52 ALA C    C   3.708 -13.286   7.874 1.00 . A A . 49 ALA C    1 1 
        2  2193 1 1 52 ALA CA   C   4.307 -14.698   7.859 1.00 . A A . 49 ALA CA   1 1 
        2  2194 1 1 52 ALA CB   C   5.079 -15.080   6.563 1.00 . A A . 49 ALA CB   1 1 
        2  2195 1 1 52 ALA H    H   2.488 -15.758   7.608 1.00 . A A . 49 ALA H    1 1 
        2  2196 1 1 52 ALA HA   H   5.000 -14.740   8.668 1.00 . A A . 49 ALA HA   1 1 
        2  2197 1 1 52 ALA HB1  H   5.412 -16.109   6.638 1.00 . A A . 49 ALA HB1  1 1 
        2  2198 1 1 52 ALA HB2  H   5.941 -14.449   6.434 1.00 . A A . 49 ALA HB2  1 1 
        2  2199 1 1 52 ALA HB3  H   4.443 -14.984   5.702 1.00 . A A . 49 ALA HB3  1 1 
        2  2200 1 1 52 ALA N    N   3.288 -15.680   8.175 1.00 . A A . 49 ALA N    1 1 
        2  2201 1 1 52 ALA O    O   2.563 -13.071   7.438 1.00 . A A . 49 ALA O    1 1 
        2  2202 1 1 53 PHE C    C   4.935 -10.019   8.087 1.00 . A A . 50 PHE C    1 1 
        2  2203 1 1 53 PHE CA   C   4.002 -11.028   8.779 1.00 . A A . 50 PHE CA   1 1 
        2  2204 1 1 53 PHE CB   C   4.103 -10.901  10.309 1.00 . A A . 50 PHE CB   1 1 
        2  2205 1 1 53 PHE CD1  C   1.885 -10.019  11.057 1.00 . A A . 50 PHE CD1  1 1 
        2  2206 1 1 53 PHE CD2  C   3.820  -8.676  11.412 1.00 . A A . 50 PHE CD2  1 1 
        2  2207 1 1 53 PHE CE1  C   1.101  -9.060  11.667 1.00 . A A . 50 PHE CE1  1 1 
        2  2208 1 1 53 PHE CE2  C   3.043  -7.710  12.016 1.00 . A A . 50 PHE CE2  1 1 
        2  2209 1 1 53 PHE CG   C   3.250  -9.835  10.925 1.00 . A A . 50 PHE CG   1 1 
        2  2210 1 1 53 PHE CZ   C   1.681  -7.905  12.146 1.00 . A A . 50 PHE CZ   1 1 
        2  2211 1 1 53 PHE H    H   5.424 -12.529   8.602 1.00 . A A . 50 PHE H    1 1 
        2  2212 1 1 53 PHE HA   H   2.974 -10.937   8.465 1.00 . A A . 50 PHE HA   1 1 
        2  2213 1 1 53 PHE HB2  H   3.812 -11.841  10.759 1.00 . A A . 50 PHE HB2  1 1 
        2  2214 1 1 53 PHE HB3  H   5.139 -10.688  10.569 1.00 . A A . 50 PHE HB3  1 1 
        2  2215 1 1 53 PHE HD1  H   1.432 -10.923  10.678 1.00 . A A . 50 PHE HD1  1 1 
        2  2216 1 1 53 PHE HD2  H   4.884  -8.523  11.308 1.00 . A A . 50 PHE HD2  1 1 
        2  2217 1 1 53 PHE HE1  H   0.036  -9.214  11.767 1.00 . A A . 50 PHE HE1  1 1 
        2  2218 1 1 53 PHE HE2  H   3.499  -6.805  12.389 1.00 . A A . 50 PHE HE2  1 1 
        2  2219 1 1 53 PHE HZ   H   1.073  -7.153  12.625 1.00 . A A . 50 PHE HZ   1 1 
        2  2220 1 1 53 PHE N    N   4.481 -12.344   8.436 1.00 . A A . 50 PHE N    1 1 
        2  2221 1 1 53 PHE O    O   6.157 -10.007   8.407 1.00 . A A . 50 PHE O    1 1 
        2  2222 1 1 54 ILE C    C   5.033  -7.001   6.008 1.00 . A A . 51 ILE C    1 1 
        2  2223 1 1 54 ILE CA   C   5.344  -8.480   6.214 1.00 . A A . 51 ILE CA   1 1 
        2  2224 1 1 54 ILE CB   C   5.477  -9.177   4.827 1.00 . A A . 51 ILE CB   1 1 
        2  2225 1 1 54 ILE CD1  C   4.128 -10.620   3.151 1.00 . A A . 51 ILE CD1  1 1 
        2  2226 1 1 54 ILE CG1  C   4.406 -10.263   4.596 1.00 . A A . 51 ILE CG1  1 1 
        2  2227 1 1 54 ILE CG2  C   6.850  -9.765   4.723 1.00 . A A . 51 ILE CG2  1 1 
        2  2228 1 1 54 ILE H    H   3.428  -8.973   7.109 1.00 . A A . 51 ILE H    1 1 
        2  2229 1 1 54 ILE HA   H   6.326  -8.529   6.675 1.00 . A A . 51 ILE HA   1 1 
        2  2230 1 1 54 ILE HB   H   5.405  -8.429   4.060 1.00 . A A . 51 ILE HB   1 1 
        2  2231 1 1 54 ILE HD11 H   4.969 -11.148   2.736 1.00 . A A . 51 ILE HD11 1 1 
        2  2232 1 1 54 ILE HD12 H   3.929  -9.717   2.583 1.00 . A A . 51 ILE HD12 1 1 
        2  2233 1 1 54 ILE HD13 H   3.255 -11.250   3.101 1.00 . A A . 51 ILE HD13 1 1 
        2  2234 1 1 54 ILE HG12 H   4.737 -11.174   5.077 1.00 . A A . 51 ILE HG12 1 1 
        2  2235 1 1 54 ILE HG13 H   3.480  -9.934   5.045 1.00 . A A . 51 ILE HG13 1 1 
        2  2236 1 1 54 ILE HG21 H   7.582  -8.976   4.774 1.00 . A A . 51 ILE HG21 1 1 
        2  2237 1 1 54 ILE HG22 H   6.944 -10.287   3.781 1.00 . A A . 51 ILE HG22 1 1 
        2  2238 1 1 54 ILE HG23 H   7.005 -10.458   5.536 1.00 . A A . 51 ILE HG23 1 1 
        2  2239 1 1 54 ILE N    N   4.414  -9.179   7.141 1.00 . A A . 51 ILE N    1 1 
        2  2240 1 1 54 ILE O    O   4.063  -6.645   5.343 1.00 . A A . 51 ILE O    1 1 
        2  2241 1 1 55 GLU C    C   6.224  -3.971   5.282 1.00 . A A . 52 GLU C    1 1 
        2  2242 1 1 55 GLU CA   C   5.738  -4.699   6.558 1.00 . A A . 52 GLU CA   1 1 
        2  2243 1 1 55 GLU CB   C   6.477  -4.092   7.768 1.00 . A A . 52 GLU CB   1 1 
        2  2244 1 1 55 GLU CD   C   5.653  -5.644   9.634 1.00 . A A . 52 GLU CD   1 1 
        2  2245 1 1 55 GLU CG   C   5.780  -4.217   9.126 1.00 . A A . 52 GLU CG   1 1 
        2  2246 1 1 55 GLU H    H   6.771  -6.549   6.835 1.00 . A A . 52 GLU H    1 1 
        2  2247 1 1 55 GLU HA   H   4.681  -4.529   6.693 1.00 . A A . 52 GLU HA   1 1 
        2  2248 1 1 55 GLU HB2  H   7.435  -4.577   7.852 1.00 . A A . 52 GLU HB2  1 1 
        2  2249 1 1 55 GLU HB3  H   6.641  -3.041   7.571 1.00 . A A . 52 GLU HB3  1 1 
        2  2250 1 1 55 GLU HG2  H   6.354  -3.658   9.850 1.00 . A A . 52 GLU HG2  1 1 
        2  2251 1 1 55 GLU HG3  H   4.794  -3.779   9.052 1.00 . A A . 52 GLU HG3  1 1 
        2  2252 1 1 55 GLU N    N   5.944  -6.163   6.491 1.00 . A A . 52 GLU N    1 1 
        2  2253 1 1 55 GLU O    O   7.440  -3.882   5.049 1.00 . A A . 52 GLU O    1 1 
        2  2254 1 1 55 GLU OE1  O   6.574  -6.112  10.333 1.00 . A A . 52 GLU OE1  1 1 
        2  2255 1 1 55 GLU OE2  O   4.633  -6.292   9.340 1.00 . A A . 52 GLU OE2  1 1 
        2  2256 1 1 56 PHE C    C   5.360  -1.202   3.352 1.00 . A A . 53 PHE C    1 1 
        2  2257 1 1 56 PHE CA   C   5.651  -2.711   3.222 1.00 . A A . 53 PHE CA   1 1 
        2  2258 1 1 56 PHE CB   C   4.922  -3.273   1.989 1.00 . A A . 53 PHE CB   1 1 
        2  2259 1 1 56 PHE CD1  C   6.227  -5.432   2.014 1.00 . A A . 53 PHE CD1  1 1 
        2  2260 1 1 56 PHE CD2  C   3.894  -5.516   1.571 1.00 . A A . 53 PHE CD2  1 1 
        2  2261 1 1 56 PHE CE1  C   6.301  -6.799   1.910 1.00 . A A . 53 PHE CE1  1 1 
        2  2262 1 1 56 PHE CE2  C   3.957  -6.887   1.460 1.00 . A A . 53 PHE CE2  1 1 
        2  2263 1 1 56 PHE CG   C   5.021  -4.772   1.841 1.00 . A A . 53 PHE CG   1 1 
        2  2264 1 1 56 PHE CZ   C   5.164  -7.531   1.641 1.00 . A A . 53 PHE CZ   1 1 
        2  2265 1 1 56 PHE H    H   4.319  -3.587   4.673 1.00 . A A . 53 PHE H    1 1 
        2  2266 1 1 56 PHE HA   H   6.704  -2.840   3.081 1.00 . A A . 53 PHE HA   1 1 
        2  2267 1 1 56 PHE HB2  H   3.878  -3.013   2.054 1.00 . A A . 53 PHE HB2  1 1 
        2  2268 1 1 56 PHE HB3  H   5.344  -2.826   1.100 1.00 . A A . 53 PHE HB3  1 1 
        2  2269 1 1 56 PHE HD1  H   7.118  -4.857   2.221 1.00 . A A . 53 PHE HD1  1 1 
        2  2270 1 1 56 PHE HD2  H   2.960  -5.006   1.420 1.00 . A A . 53 PHE HD2  1 1 
        2  2271 1 1 56 PHE HE1  H   7.244  -7.298   2.063 1.00 . A A . 53 PHE HE1  1 1 
        2  2272 1 1 56 PHE HE2  H   3.059  -7.462   1.258 1.00 . A A . 53 PHE HE2  1 1 
        2  2273 1 1 56 PHE HZ   H   5.222  -8.604   1.559 1.00 . A A . 53 PHE HZ   1 1 
        2  2274 1 1 56 PHE N    N   5.285  -3.460   4.452 1.00 . A A . 53 PHE N    1 1 
        2  2275 1 1 56 PHE O    O   4.527  -0.802   4.171 1.00 . A A . 53 PHE O    1 1 
        2  2276 1 1 57 GLU C    C   4.588   1.455   1.572 1.00 . A A . 54 GLU C    1 1 
        2  2277 1 1 57 GLU CA   C   5.757   1.104   2.517 1.00 . A A . 54 GLU CA   1 1 
        2  2278 1 1 57 GLU CB   C   6.994   2.010   2.228 1.00 . A A . 54 GLU CB   1 1 
        2  2279 1 1 57 GLU CD   C   8.618   3.052   0.577 1.00 . A A . 54 GLU CD   1 1 
        2  2280 1 1 57 GLU CG   C   7.312   2.306   0.746 1.00 . A A . 54 GLU CG   1 1 
        2  2281 1 1 57 GLU H    H   6.839  -0.725   2.048 1.00 . A A . 54 GLU H    1 1 
        2  2282 1 1 57 GLU HA   H   5.406   1.359   3.500 1.00 . A A . 54 GLU HA   1 1 
        2  2283 1 1 57 GLU HB2  H   6.828   2.960   2.721 1.00 . A A . 54 GLU HB2  1 1 
        2  2284 1 1 57 GLU HB3  H   7.866   1.563   2.672 1.00 . A A . 54 GLU HB3  1 1 
        2  2285 1 1 57 GLU HG2  H   7.371   1.380   0.197 1.00 . A A . 54 GLU HG2  1 1 
        2  2286 1 1 57 GLU HG3  H   6.517   2.923   0.324 1.00 . A A . 54 GLU HG3  1 1 
        2  2287 1 1 57 GLU N    N   6.073  -0.358   2.570 1.00 . A A . 54 GLU N    1 1 
        2  2288 1 1 57 GLU O    O   3.914   2.463   1.797 1.00 . A A . 54 GLU O    1 1 
        2  2289 1 1 57 GLU OE1  O   8.775   4.125   1.200 1.00 . A A . 54 GLU OE1  1 1 
        2  2290 1 1 57 GLU OE2  O   9.489   2.576  -0.174 1.00 . A A . 54 GLU OE2  1 1 
        2  2291 1 1 58 ASP C    C   2.172  -0.117  -0.338 1.00 . A A . 55 ASP C    1 1 
        2  2292 1 1 58 ASP CA   C   3.246   0.970  -0.378 1.00 . A A . 55 ASP CA   1 1 
        2  2293 1 1 58 ASP CB   C   3.826   1.073  -1.792 1.00 . A A . 55 ASP CB   1 1 
        2  2294 1 1 58 ASP CG   C   3.609   2.445  -2.390 1.00 . A A . 55 ASP CG   1 1 
        2  2295 1 1 58 ASP H    H   4.866  -0.133   0.369 1.00 . A A . 55 ASP H    1 1 
        2  2296 1 1 58 ASP HA   H   2.837   1.929  -0.101 1.00 . A A . 55 ASP HA   1 1 
        2  2297 1 1 58 ASP HB2  H   4.881   0.884  -1.746 1.00 . A A . 55 ASP HB2  1 1 
        2  2298 1 1 58 ASP HB3  H   3.374   0.329  -2.427 1.00 . A A . 55 ASP HB3  1 1 
        2  2299 1 1 58 ASP N    N   4.320   0.650   0.539 1.00 . A A . 55 ASP N    1 1 
        2  2300 1 1 58 ASP O    O   2.477  -1.290  -0.586 1.00 . A A . 55 ASP O    1 1 
        2  2301 1 1 58 ASP OD1  O   2.442   2.794  -2.662 1.00 . A A . 55 ASP OD1  1 1 
        2  2302 1 1 58 ASP OD2  O   4.601   3.177  -2.584 1.00 . A A . 55 ASP OD2  1 1 
        2  2303 1 1 59 ALA C    C  -0.688  -0.977  -1.545 1.00 . A A . 56 ALA C    1 1 
        2  2304 1 1 59 ALA CA   C  -0.185  -0.718  -0.100 1.00 . A A . 56 ALA CA   1 1 
        2  2305 1 1 59 ALA CB   C  -1.366  -0.379   0.833 1.00 . A A . 56 ALA CB   1 1 
        2  2306 1 1 59 ALA H    H   0.763   1.130   0.442 1.00 . A A . 56 ALA H    1 1 
        2  2307 1 1 59 ALA HA   H   0.220  -1.655   0.260 1.00 . A A . 56 ALA HA   1 1 
        2  2308 1 1 59 ALA HB1  H  -1.785   0.596   0.612 1.00 . A A . 56 ALA HB1  1 1 
        2  2309 1 1 59 ALA HB2  H  -1.035  -0.400   1.865 1.00 . A A . 56 ALA HB2  1 1 
        2  2310 1 1 59 ALA HB3  H  -2.137  -1.127   0.707 1.00 . A A . 56 ALA HB3  1 1 
        2  2311 1 1 59 ALA N    N   0.918   0.245   0.004 1.00 . A A . 56 ALA N    1 1 
        2  2312 1 1 59 ALA O    O  -1.062  -2.121  -1.835 1.00 . A A . 56 ALA O    1 1 
        2  2313 1 1 60 ARG C    C  -0.671  -1.010  -4.788 1.00 . A A . 57 ARG C    1 1 
        2  2314 1 1 60 ARG CA   C  -1.473  -0.191  -3.724 1.00 . A A . 57 ARG CA   1 1 
        2  2315 1 1 60 ARG CB   C  -2.155   1.080  -4.341 1.00 . A A . 57 ARG CB   1 1 
        2  2316 1 1 60 ARG CD   C  -0.060   2.640  -4.587 1.00 . A A . 57 ARG CD   1 1 
        2  2317 1 1 60 ARG CG   C  -1.307   2.019  -5.244 1.00 . A A . 57 ARG CG   1 1 
        2  2318 1 1 60 ARG CZ   C   1.420   4.083  -5.975 1.00 . A A . 57 ARG CZ   1 1 
        2  2319 1 1 60 ARG H    H  -0.178   0.851  -2.353 1.00 . A A . 57 ARG H    1 1 
        2  2320 1 1 60 ARG HA   H  -2.302  -0.833  -3.413 1.00 . A A . 57 ARG HA   1 1 
        2  2321 1 1 60 ARG HB2  H  -2.964   0.705  -4.964 1.00 . A A . 57 ARG HB2  1 1 
        2  2322 1 1 60 ARG HB3  H  -2.625   1.667  -3.549 1.00 . A A . 57 ARG HB3  1 1 
        2  2323 1 1 60 ARG HD2  H  -0.238   2.835  -3.542 1.00 . A A . 57 ARG HD2  1 1 
        2  2324 1 1 60 ARG HD3  H   0.758   1.951  -4.691 1.00 . A A . 57 ARG HD3  1 1 
        2  2325 1 1 60 ARG HE   H  -0.247   4.671  -5.039 1.00 . A A . 57 ARG HE   1 1 
        2  2326 1 1 60 ARG HG2  H  -0.981   1.441  -6.101 1.00 . A A . 57 ARG HG2  1 1 
        2  2327 1 1 60 ARG HG3  H  -1.943   2.820  -5.597 1.00 . A A . 57 ARG HG3  1 1 
        2  2328 1 1 60 ARG HH11 H   2.089   2.164  -5.875 1.00 . A A . 57 ARG HH11 1 1 
        2  2329 1 1 60 ARG HH12 H   3.069   3.234  -6.813 1.00 . A A . 57 ARG HH12 1 1 
        2  2330 1 1 60 ARG HH21 H   1.071   6.064  -6.222 1.00 . A A . 57 ARG HH21 1 1 
        2  2331 1 1 60 ARG HH22 H   2.488   5.462  -7.008 1.00 . A A . 57 ARG HH22 1 1 
        2  2332 1 1 60 ARG N    N  -0.724   0.033  -2.466 1.00 . A A . 57 ARG N    1 1 
        2  2333 1 1 60 ARG NE   N   0.332   3.901  -5.213 1.00 . A A . 57 ARG NE   1 1 
        2  2334 1 1 60 ARG NH1  N   2.260   3.078  -6.240 1.00 . A A . 57 ARG NH1  1 1 
        2  2335 1 1 60 ARG NH2  N   1.680   5.301  -6.438 1.00 . A A . 57 ARG NH2  1 1 
        2  2336 1 1 60 ARG O    O  -1.291  -1.695  -5.597 1.00 . A A . 57 ARG O    1 1 
        2  2337 1 1 61 ASP C    C   1.399  -3.273  -5.458 1.00 . A A . 58 ASP C    1 1 
        2  2338 1 1 61 ASP CA   C   1.540  -1.740  -5.731 1.00 . A A . 58 ASP CA   1 1 
        2  2339 1 1 61 ASP CB   C   3.039  -1.306  -5.641 1.00 . A A . 58 ASP CB   1 1 
        2  2340 1 1 61 ASP CG   C   3.909  -1.821  -6.785 1.00 . A A . 58 ASP CG   1 1 
        2  2341 1 1 61 ASP H    H   1.138  -0.219  -4.252 1.00 . A A . 58 ASP H    1 1 
        2  2342 1 1 61 ASP HA   H   1.194  -1.547  -6.735 1.00 . A A . 58 ASP HA   1 1 
        2  2343 1 1 61 ASP HB2  H   3.099  -0.227  -5.649 1.00 . A A . 58 ASP HB2  1 1 
        2  2344 1 1 61 ASP HB3  H   3.466  -1.677  -4.718 1.00 . A A . 58 ASP HB3  1 1 
        2  2345 1 1 61 ASP N    N   0.696  -0.911  -4.806 1.00 . A A . 58 ASP N    1 1 
        2  2346 1 1 61 ASP O    O   1.127  -4.052  -6.378 1.00 . A A . 58 ASP O    1 1 
        2  2347 1 1 61 ASP OD1  O   3.373  -2.441  -7.722 1.00 . A A . 58 ASP OD1  1 1 
        2  2348 1 1 61 ASP OD2  O   5.138  -1.579  -6.749 1.00 . A A . 58 ASP OD2  1 1 
        2  2349 1 1 62 ALA C    C   0.057  -5.786  -4.091 1.00 . A A . 59 ALA C    1 1 
        2  2350 1 1 62 ALA CA   C   1.407  -5.073  -3.727 1.00 . A A . 59 ALA CA   1 1 
        2  2351 1 1 62 ALA CB   C   1.704  -5.163  -2.230 1.00 . A A . 59 ALA CB   1 1 
        2  2352 1 1 62 ALA H    H   1.888  -3.043  -3.533 1.00 . A A . 59 ALA H    1 1 
        2  2353 1 1 62 ALA HA   H   2.207  -5.610  -4.213 1.00 . A A . 59 ALA HA   1 1 
        2  2354 1 1 62 ALA HB1  H   1.036  -4.543  -1.667 1.00 . A A . 59 ALA HB1  1 1 
        2  2355 1 1 62 ALA HB2  H   2.722  -4.822  -2.061 1.00 . A A . 59 ALA HB2  1 1 
        2  2356 1 1 62 ALA HB3  H   1.614  -6.191  -1.906 1.00 . A A . 59 ALA HB3  1 1 
        2  2357 1 1 62 ALA N    N   1.555  -3.681  -4.183 1.00 . A A . 59 ALA N    1 1 
        2  2358 1 1 62 ALA O    O   0.029  -7.007  -4.123 1.00 . A A . 59 ALA O    1 1 
        2  2359 1 1 63 ALA C    C  -2.388  -6.499  -5.939 1.00 . A A . 60 ALA C    1 1 
        2  2360 1 1 63 ALA CA   C  -2.397  -5.529  -4.690 1.00 . A A . 60 ALA CA   1 1 
        2  2361 1 1 63 ALA CB   C  -3.405  -4.329  -4.855 1.00 . A A . 60 ALA CB   1 1 
        2  2362 1 1 63 ALA H    H  -0.951  -4.088  -4.147 1.00 . A A . 60 ALA H    1 1 
        2  2363 1 1 63 ALA HA   H  -2.759  -6.105  -3.855 1.00 . A A . 60 ALA HA   1 1 
        2  2364 1 1 63 ALA HB1  H  -3.630  -3.906  -3.878 1.00 . A A . 60 ALA HB1  1 1 
        2  2365 1 1 63 ALA HB2  H  -4.330  -4.674  -5.288 1.00 . A A . 60 ALA HB2  1 1 
        2  2366 1 1 63 ALA HB3  H  -2.994  -3.538  -5.487 1.00 . A A . 60 ALA HB3  1 1 
        2  2367 1 1 63 ALA N    N  -1.042  -5.020  -4.296 1.00 . A A . 60 ALA N    1 1 
        2  2368 1 1 63 ALA O    O  -3.087  -7.529  -5.888 1.00 . A A . 60 ALA O    1 1 
        2  2369 1 1 64 ASP C    C  -0.826  -8.536  -7.706 1.00 . A A . 61 ASP C    1 1 
        2  2370 1 1 64 ASP CA   C  -1.366  -7.171  -8.170 1.00 . A A . 61 ASP CA   1 1 
        2  2371 1 1 64 ASP CB   C  -0.412  -6.629  -9.252 1.00 . A A . 61 ASP CB   1 1 
        2  2372 1 1 64 ASP CG   C  -0.979  -5.402  -9.934 1.00 . A A . 61 ASP CG   1 1 
        2  2373 1 1 64 ASP H    H  -1.275  -5.263  -7.134 1.00 . A A . 61 ASP H    1 1 
        2  2374 1 1 64 ASP HA   H  -2.310  -7.338  -8.666 1.00 . A A . 61 ASP HA   1 1 
        2  2375 1 1 64 ASP HB2  H   0.571  -6.405  -8.844 1.00 . A A . 61 ASP HB2  1 1 
        2  2376 1 1 64 ASP HB3  H  -0.297  -7.394 -10.005 1.00 . A A . 61 ASP HB3  1 1 
        2  2377 1 1 64 ASP N    N  -1.610  -6.192  -7.036 1.00 . A A . 61 ASP N    1 1 
        2  2378 1 1 64 ASP O    O  -1.310  -9.615  -8.112 1.00 . A A . 61 ASP O    1 1 
        2  2379 1 1 64 ASP OD1  O  -2.128  -5.481 -10.434 1.00 . A A . 61 ASP OD1  1 1 
        2  2380 1 1 64 ASP OD2  O  -0.278  -4.381 -10.003 1.00 . A A . 61 ASP OD2  1 1 
        2  2381 1 1 65 ALA C    C  -0.239 -10.456  -5.374 1.00 . A A . 62 ALA C    1 1 
        2  2382 1 1 65 ALA CA   C   0.718  -9.772  -6.379 1.00 . A A . 62 ALA CA   1 1 
        2  2383 1 1 65 ALA CB   C   2.163  -9.629  -5.865 1.00 . A A . 62 ALA CB   1 1 
        2  2384 1 1 65 ALA H    H   0.563  -7.685  -6.595 1.00 . A A . 62 ALA H    1 1 
        2  2385 1 1 65 ALA HA   H   0.760 -10.412  -7.242 1.00 . A A . 62 ALA HA   1 1 
        2  2386 1 1 65 ALA HB1  H   2.206  -9.034  -4.954 1.00 . A A . 62 ALA HB1  1 1 
        2  2387 1 1 65 ALA HB2  H   2.785  -9.169  -6.623 1.00 . A A . 62 ALA HB2  1 1 
        2  2388 1 1 65 ALA HB3  H   2.556 -10.612  -5.647 1.00 . A A . 62 ALA HB3  1 1 
        2  2389 1 1 65 ALA N    N   0.180  -8.526  -6.867 1.00 . A A . 62 ALA N    1 1 
        2  2390 1 1 65 ALA O    O  -0.372 -11.687  -5.382 1.00 . A A . 62 ALA O    1 1 
        2  2391 1 1 66 ILE C    C  -3.081 -10.957  -4.231 1.00 . A A . 63 ILE C    1 1 
        2  2392 1 1 66 ILE CA   C  -1.847 -10.290  -3.596 1.00 . A A . 63 ILE CA   1 1 
        2  2393 1 1 66 ILE CB   C  -2.169  -9.332  -2.388 1.00 . A A . 63 ILE CB   1 1 
        2  2394 1 1 66 ILE CD1  C  -3.035 -10.346  -0.122 1.00 . A A . 63 ILE CD1  1 1 
        2  2395 1 1 66 ILE CG1  C  -1.867 -10.059  -1.049 1.00 . A A . 63 ILE CG1  1 1 
        2  2396 1 1 66 ILE CG2  C  -3.580  -8.723  -2.411 1.00 . A A . 63 ILE CG2  1 1 
        2  2397 1 1 66 ILE H    H  -0.965  -8.712  -4.671 1.00 . A A . 63 ILE H    1 1 
        2  2398 1 1 66 ILE HA   H  -1.257 -11.104  -3.201 1.00 . A A . 63 ILE HA   1 1 
        2  2399 1 1 66 ILE HB   H  -1.485  -8.504  -2.452 1.00 . A A . 63 ILE HB   1 1 
        2  2400 1 1 66 ILE HD11 H  -3.660  -9.463  -0.040 1.00 . A A . 63 ILE HD11 1 1 
        2  2401 1 1 66 ILE HD12 H  -2.651 -10.597   0.853 1.00 . A A . 63 ILE HD12 1 1 
        2  2402 1 1 66 ILE HD13 H  -3.598 -11.154  -0.491 1.00 . A A . 63 ILE HD13 1 1 
        2  2403 1 1 66 ILE HG12 H  -1.391 -11.002  -1.259 1.00 . A A . 63 ILE HG12 1 1 
        2  2404 1 1 66 ILE HG13 H  -1.175  -9.454  -0.498 1.00 . A A . 63 ILE HG13 1 1 
        2  2405 1 1 66 ILE HG21 H  -3.642  -7.964  -1.650 1.00 . A A . 63 ILE HG21 1 1 
        2  2406 1 1 66 ILE HG22 H  -4.316  -9.494  -2.201 1.00 . A A . 63 ILE HG22 1 1 
        2  2407 1 1 66 ILE HG23 H  -3.773  -8.290  -3.372 1.00 . A A . 63 ILE HG23 1 1 
        2  2408 1 1 66 ILE N    N  -0.989  -9.681  -4.584 1.00 . A A . 63 ILE N    1 1 
        2  2409 1 1 66 ILE O    O  -3.437 -12.016  -3.769 1.00 . A A . 63 ILE O    1 1 
        2  2410 1 1 67 LYS C    C  -3.954 -12.303  -6.880 1.00 . A A . 64 LYS C    1 1 
        2  2411 1 1 67 LYS CA   C  -4.646 -11.123  -6.137 1.00 . A A . 64 LYS CA   1 1 
        2  2412 1 1 67 LYS CB   C  -5.420 -10.223  -7.163 1.00 . A A . 64 LYS CB   1 1 
        2  2413 1 1 67 LYS CD   C  -4.000 -10.071  -9.342 1.00 . A A . 64 LYS CD   1 1 
        2  2414 1 1 67 LYS CE   C  -3.549  -9.101 -10.419 1.00 . A A . 64 LYS CE   1 1 
        2  2415 1 1 67 LYS CG   C  -4.564  -9.337  -8.114 1.00 . A A . 64 LYS CG   1 1 
        2  2416 1 1 67 LYS H    H  -3.785  -9.384  -5.280 1.00 . A A . 64 LYS H    1 1 
        2  2417 1 1 67 LYS HA   H  -5.387 -11.567  -5.469 1.00 . A A . 64 LYS HA   1 1 
        2  2418 1 1 67 LYS HB2  H  -6.029 -10.871  -7.774 1.00 . A A . 64 LYS HB2  1 1 
        2  2419 1 1 67 LYS HB3  H  -6.095  -9.572  -6.617 1.00 . A A . 64 LYS HB3  1 1 
        2  2420 1 1 67 LYS HD2  H  -3.116 -10.643  -9.022 1.00 . A A . 64 LYS HD2  1 1 
        2  2421 1 1 67 LYS HD3  H  -4.741 -10.740  -9.744 1.00 . A A . 64 LYS HD3  1 1 
        2  2422 1 1 67 LYS HE2  H  -3.511  -8.114  -9.997 1.00 . A A . 64 LYS HE2  1 1 
        2  2423 1 1 67 LYS HE3  H  -2.556  -9.390 -10.740 1.00 . A A . 64 LYS HE3  1 1 
        2  2424 1 1 67 LYS HG2  H  -5.158  -8.509  -8.461 1.00 . A A . 64 LYS HG2  1 1 
        2  2425 1 1 67 LYS HG3  H  -3.712  -8.950  -7.549 1.00 . A A . 64 LYS HG3  1 1 
        2  2426 1 1 67 LYS HZ1  H  -5.433  -8.892 -11.297 1.00 . A A . 64 LYS HZ1  1 1 
        2  2427 1 1 67 LYS HZ2  H  -4.410  -9.980 -12.101 1.00 . A A . 64 LYS HZ2  1 1 
        2  2428 1 1 67 LYS HZ3  H  -4.158  -8.315 -12.246 1.00 . A A . 64 LYS HZ3  1 1 
        2  2429 1 1 67 LYS N    N  -3.746 -10.350  -5.250 1.00 . A A . 64 LYS N    1 1 
        2  2430 1 1 67 LYS NZ   N  -4.452  -9.073 -11.597 1.00 . A A . 64 LYS NZ   1 1 
        2  2431 1 1 67 LYS O    O  -4.622 -13.301  -7.140 1.00 . A A . 64 LYS O    1 1 
        2  2432 1 1 68 GLU C    C  -1.853 -14.601  -6.890 1.00 . A A . 65 GLU C    1 1 
        2  2433 1 1 68 GLU CA   C  -2.004 -13.411  -7.898 1.00 . A A . 65 GLU CA   1 1 
        2  2434 1 1 68 GLU CB   C  -0.676 -13.049  -8.636 1.00 . A A . 65 GLU CB   1 1 
        2  2435 1 1 68 GLU CD   C   1.493 -14.330  -8.295 1.00 . A A . 65 GLU CD   1 1 
        2  2436 1 1 68 GLU CG   C   0.600 -13.181  -7.824 1.00 . A A . 65 GLU CG   1 1 
        2  2437 1 1 68 GLU H    H  -2.182 -11.337  -7.269 1.00 . A A . 65 GLU H    1 1 
        2  2438 1 1 68 GLU HA   H  -2.699 -13.772  -8.648 1.00 . A A . 65 GLU HA   1 1 
        2  2439 1 1 68 GLU HB2  H  -0.579 -13.698  -9.494 1.00 . A A . 65 GLU HB2  1 1 
        2  2440 1 1 68 GLU HB3  H  -0.748 -12.034  -8.985 1.00 . A A . 65 GLU HB3  1 1 
        2  2441 1 1 68 GLU HG2  H   1.148 -12.261  -7.853 1.00 . A A . 65 GLU HG2  1 1 
        2  2442 1 1 68 GLU HG3  H   0.312 -13.343  -6.816 1.00 . A A . 65 GLU HG3  1 1 
        2  2443 1 1 68 GLU N    N  -2.652 -12.209  -7.283 1.00 . A A . 65 GLU N    1 1 
        2  2444 1 1 68 GLU O    O  -1.765 -15.753  -7.329 1.00 . A A . 65 GLU O    1 1 
        2  2445 1 1 68 GLU OE1  O   2.019 -14.250  -9.428 1.00 . A A . 65 GLU OE1  1 1 
        2  2446 1 1 68 GLU OE2  O   1.657 -15.320  -7.550 1.00 . A A . 65 GLU OE2  1 1 
        2  2447 1 1 69 LYS C    C  -3.478 -15.384  -3.773 1.00 . A A . 66 LYS C    1 1 
        2  2448 1 1 69 LYS CA   C  -2.120 -15.470  -4.583 1.00 . A A . 66 LYS CA   1 1 
        2  2449 1 1 69 LYS CB   C  -0.888 -15.843  -3.663 1.00 . A A . 66 LYS CB   1 1 
        2  2450 1 1 69 LYS CD   C   0.680 -13.748  -3.553 1.00 . A A . 66 LYS CD   1 1 
        2  2451 1 1 69 LYS CE   C   1.783 -14.384  -4.428 1.00 . A A . 66 LYS CE   1 1 
        2  2452 1 1 69 LYS CG   C  -0.229 -14.732  -2.790 1.00 . A A . 66 LYS CG   1 1 
        2  2453 1 1 69 LYS H    H  -1.487 -13.470  -5.224 1.00 . A A . 66 LYS H    1 1 
        2  2454 1 1 69 LYS HA   H  -2.273 -16.332  -5.225 1.00 . A A . 66 LYS HA   1 1 
        2  2455 1 1 69 LYS HB2  H  -1.210 -16.623  -2.983 1.00 . A A . 66 LYS HB2  1 1 
        2  2456 1 1 69 LYS HB3  H  -0.113 -16.276  -4.297 1.00 . A A . 66 LYS HB3  1 1 
        2  2457 1 1 69 LYS HD2  H   0.064 -13.127  -4.192 1.00 . A A . 66 LYS HD2  1 1 
        2  2458 1 1 69 LYS HD3  H   1.158 -13.104  -2.820 1.00 . A A . 66 LYS HD3  1 1 
        2  2459 1 1 69 LYS HE2  H   1.340 -14.932  -5.252 1.00 . A A . 66 LYS HE2  1 1 
        2  2460 1 1 69 LYS HE3  H   2.386 -13.579  -4.849 1.00 . A A . 66 LYS HE3  1 1 
        2  2461 1 1 69 LYS HG2  H  -1.010 -14.159  -2.310 1.00 . A A . 66 LYS HG2  1 1 
        2  2462 1 1 69 LYS HG3  H   0.365 -15.208  -2.012 1.00 . A A . 66 LYS HG3  1 1 
        2  2463 1 1 69 LYS HZ1  H   3.432 -15.640  -4.273 1.00 . A A . 66 LYS HZ1  1 1 
        2  2464 1 1 69 LYS HZ2  H   2.144 -16.090  -3.274 1.00 . A A . 66 LYS HZ2  1 1 
        2  2465 1 1 69 LYS HZ3  H   3.111 -14.762  -2.865 1.00 . A A . 66 LYS HZ3  1 1 
        2  2466 1 1 69 LYS N    N  -1.822 -14.345  -5.551 1.00 . A A . 66 LYS N    1 1 
        2  2467 1 1 69 LYS NZ   N   2.681 -15.283  -3.653 1.00 . A A . 66 LYS NZ   1 1 
        2  2468 1 1 69 LYS O    O  -3.628 -16.107  -2.782 1.00 . A A . 66 LYS O    1 1 
        2  2469 1 1 70 ASP C    C  -6.739 -15.472  -3.629 1.00 . A A . 67 ASP C    1 1 
        2  2470 1 1 70 ASP CA   C  -5.734 -14.370  -3.416 1.00 . A A . 67 ASP CA   1 1 
        2  2471 1 1 70 ASP CB   C  -6.375 -12.972  -3.358 1.00 . A A . 67 ASP CB   1 1 
        2  2472 1 1 70 ASP CG   C  -7.496 -12.709  -4.355 1.00 . A A . 67 ASP CG   1 1 
        2  2473 1 1 70 ASP H    H  -4.413 -14.145  -5.090 1.00 . A A . 67 ASP H    1 1 
        2  2474 1 1 70 ASP HA   H  -5.418 -14.554  -2.428 1.00 . A A . 67 ASP HA   1 1 
        2  2475 1 1 70 ASP HB2  H  -6.787 -12.878  -2.356 1.00 . A A . 67 ASP HB2  1 1 
        2  2476 1 1 70 ASP HB3  H  -5.615 -12.223  -3.471 1.00 . A A . 67 ASP HB3  1 1 
        2  2477 1 1 70 ASP N    N  -4.465 -14.548  -4.188 1.00 . A A . 67 ASP N    1 1 
        2  2478 1 1 70 ASP O    O  -6.668 -16.201  -4.620 1.00 . A A . 67 ASP O    1 1 
        2  2479 1 1 70 ASP OD1  O  -7.241 -12.731  -5.567 1.00 . A A . 67 ASP OD1  1 1 
        2  2480 1 1 70 ASP OD2  O  -8.636 -12.458  -3.905 1.00 . A A . 67 ASP OD2  1 1 
        2  2481 1 1 71 GLY C    C  -8.147 -17.567  -1.239 1.00 . A A . 68 GLY C    1 1 
        2  2482 1 1 71 GLY CA   C  -8.369 -16.861  -2.565 1.00 . A A . 68 GLY CA   1 1 
        2  2483 1 1 71 GLY H    H  -7.932 -14.838  -2.145 1.00 . A A . 68 GLY H    1 1 
        2  2484 1 1 71 GLY HA2  H  -9.426 -16.677  -2.662 1.00 . A A . 68 GLY HA2  1 1 
        2  2485 1 1 71 GLY HA3  H  -8.057 -17.510  -3.370 1.00 . A A . 68 GLY HA3  1 1 
        2  2486 1 1 71 GLY N    N  -7.688 -15.605  -2.694 1.00 . A A . 68 GLY N    1 1 
        2  2487 1 1 71 GLY O    O  -8.115 -18.799  -1.227 1.00 . A A . 68 GLY O    1 1 
        2  2488 1 1 72 CYS C    C  -8.735 -18.344   1.579 1.00 . A A . 69 CYS C    1 1 
        2  2489 1 1 72 CYS CA   C  -7.638 -17.358   1.175 1.00 . A A . 69 CYS CA   1 1 
        2  2490 1 1 72 CYS CB   C  -7.592 -16.200   2.214 1.00 . A A . 69 CYS CB   1 1 
        2  2491 1 1 72 CYS H    H  -7.879 -15.811  -0.233 1.00 . A A . 69 CYS H    1 1 
        2  2492 1 1 72 CYS HA   H  -6.677 -17.847   1.153 1.00 . A A . 69 CYS HA   1 1 
        2  2493 1 1 72 CYS HB2  H  -8.044 -16.520   3.144 1.00 . A A . 69 CYS HB2  1 1 
        2  2494 1 1 72 CYS HB3  H  -6.571 -15.924   2.401 1.00 . A A . 69 CYS HB3  1 1 
        2  2495 1 1 72 CYS HG   H  -9.543 -15.103   1.018 1.00 . A A . 69 CYS HG   1 1 
        2  2496 1 1 72 CYS N    N  -7.904 -16.782  -0.143 1.00 . A A . 69 CYS N    1 1 
        2  2497 1 1 72 CYS O    O  -9.923 -17.998   1.609 1.00 . A A . 69 CYS O    1 1 
        2  2498 1 1 72 CYS SG   S  -8.476 -14.712   1.703 1.00 . A A . 69 CYS SG   1 1 
        2  2499 1 1 73 ASP C    C  -8.933 -21.355   3.531 1.00 . A A . 70 ASP C    1 1 
        2  2500 1 1 73 ASP CA   C  -9.254 -20.630   2.209 1.00 . A A . 70 ASP CA   1 1 
        2  2501 1 1 73 ASP CB   C  -9.310 -21.627   1.046 1.00 . A A . 70 ASP CB   1 1 
        2  2502 1 1 73 ASP CG   C -10.697 -22.220   0.869 1.00 . A A . 70 ASP CG   1 1 
        2  2503 1 1 73 ASP H    H  -7.352 -19.796   1.918 1.00 . A A . 70 ASP H    1 1 
        2  2504 1 1 73 ASP HA   H -10.218 -20.141   2.293 1.00 . A A . 70 ASP HA   1 1 
        2  2505 1 1 73 ASP HB2  H  -9.027 -21.126   0.122 1.00 . A A . 70 ASP HB2  1 1 
        2  2506 1 1 73 ASP HB3  H  -8.614 -22.432   1.241 1.00 . A A . 70 ASP HB3  1 1 
        2  2507 1 1 73 ASP N    N  -8.312 -19.577   1.928 1.00 . A A . 70 ASP N    1 1 
        2  2508 1 1 73 ASP O    O  -7.739 -21.469   3.915 1.00 . A A . 70 ASP O    1 1 
        2  2509 1 1 73 ASP OD1  O -11.049 -23.169   1.600 1.00 . A A . 70 ASP OD1  1 1 
        2  2510 1 1 73 ASP OD2  O -11.444 -21.731  -0.006 1.00 . A A . 70 ASP OD2  1 1 
        2  2511 1 1 74 PHE C    C -11.134 -23.532   5.523 1.00 . A A . 71 PHE C    1 1 
        2  2512 1 1 74 PHE CA   C -10.094 -22.395   5.522 1.00 . A A . 71 PHE CA   1 1 
        2  2513 1 1 74 PHE CB   C -10.431 -21.304   6.575 1.00 . A A . 71 PHE CB   1 1 
        2  2514 1 1 74 PHE CD1  C -12.768 -20.535   6.001 1.00 . A A . 71 PHE CD1  1 1 
        2  2515 1 1 74 PHE CD2  C -10.990 -18.951   5.878 1.00 . A A . 71 PHE CD2  1 1 
        2  2516 1 1 74 PHE CE1  C -13.664 -19.560   5.615 1.00 . A A . 71 PHE CE1  1 1 
        2  2517 1 1 74 PHE CE2  C -11.882 -17.976   5.491 1.00 . A A . 71 PHE CE2  1 1 
        2  2518 1 1 74 PHE CG   C -11.419 -20.247   6.137 1.00 . A A . 71 PHE CG   1 1 
        2  2519 1 1 74 PHE CZ   C -13.221 -18.280   5.356 1.00 . A A . 71 PHE CZ   1 1 
        2  2520 1 1 74 PHE H    H -10.832 -22.020   3.637 1.00 . A A . 71 PHE H    1 1 
        2  2521 1 1 74 PHE HA   H  -9.121 -22.822   5.752 1.00 . A A . 71 PHE HA   1 1 
        2  2522 1 1 74 PHE HB2  H -10.853 -21.783   7.447 1.00 . A A . 71 PHE HB2  1 1 
        2  2523 1 1 74 PHE HB3  H  -9.518 -20.803   6.866 1.00 . A A . 71 PHE HB3  1 1 
        2  2524 1 1 74 PHE HD1  H -13.114 -21.541   6.200 1.00 . A A . 71 PHE HD1  1 1 
        2  2525 1 1 74 PHE HD2  H  -9.943 -18.706   5.989 1.00 . A A . 71 PHE HD2  1 1 
        2  2526 1 1 74 PHE HE1  H -14.715 -19.802   5.511 1.00 . A A . 71 PHE HE1  1 1 
        2  2527 1 1 74 PHE HE2  H -11.535 -16.977   5.290 1.00 . A A . 71 PHE HE2  1 1 
        2  2528 1 1 74 PHE HZ   H -13.922 -17.513   5.056 1.00 . A A . 71 PHE HZ   1 1 
        2  2529 1 1 74 PHE N    N -10.017 -21.873   4.165 1.00 . A A . 71 PHE N    1 1 
        2  2530 1 1 74 PHE O    O -12.062 -23.471   4.715 1.00 . A A . 71 PHE O    1 1 
        2  2531 1 1 75 GLU C    C -11.678 -26.693   5.151 1.00 . A A . 72 GLU C    1 1 
        2  2532 1 1 75 GLU CA   C -11.850 -25.767   6.386 1.00 . A A . 72 GLU CA   1 1 
        2  2533 1 1 75 GLU CB   C -13.374 -25.427   6.580 1.00 . A A . 72 GLU CB   1 1 
        2  2534 1 1 75 GLU CD   C -13.196 -25.137   9.133 1.00 . A A . 72 GLU CD   1 1 
        2  2535 1 1 75 GLU CG   C -13.783 -24.621   7.829 1.00 . A A . 72 GLU CG   1 1 
        2  2536 1 1 75 GLU H    H -10.181 -24.547   6.972 1.00 . A A . 72 GLU H    1 1 
        2  2537 1 1 75 GLU HA   H -11.537 -26.338   7.248 1.00 . A A . 72 GLU HA   1 1 
        2  2538 1 1 75 GLU HB2  H -13.703 -24.865   5.722 1.00 . A A . 72 GLU HB2  1 1 
        2  2539 1 1 75 GLU HB3  H -13.923 -26.362   6.600 1.00 . A A . 72 GLU HB3  1 1 
        2  2540 1 1 75 GLU HG2  H -13.511 -23.586   7.702 1.00 . A A . 72 GLU HG2  1 1 
        2  2541 1 1 75 GLU HG3  H -14.853 -24.678   7.907 1.00 . A A . 72 GLU HG3  1 1 
        2  2542 1 1 75 GLU N    N -10.944 -24.576   6.350 1.00 . A A . 72 GLU N    1 1 
        2  2543 1 1 75 GLU O    O -12.590 -26.877   4.340 1.00 . A A . 72 GLU O    1 1 
        2  2544 1 1 75 GLU OE1  O -13.843 -25.985   9.778 1.00 . A A . 72 GLU OE1  1 1 
        2  2545 1 1 75 GLU OE2  O -12.106 -24.669   9.527 1.00 . A A . 72 GLU OE2  1 1 
        2  2546 1 1 76 GLY C    C  -9.503 -27.911   2.750 1.00 . A A . 73 GLY C    1 1 
        2  2547 1 1 76 GLY CA   C -10.177 -28.316   4.063 1.00 . A A . 73 GLY CA   1 1 
        2  2548 1 1 76 GLY H    H  -9.753 -26.931   5.620 1.00 . A A . 73 GLY H    1 1 
        2  2549 1 1 76 GLY HA2  H  -9.545 -29.036   4.553 1.00 . A A . 73 GLY HA2  1 1 
        2  2550 1 1 76 GLY HA3  H -11.111 -28.806   3.820 1.00 . A A . 73 GLY HA3  1 1 
        2  2551 1 1 76 GLY N    N -10.469 -27.244   5.026 1.00 . A A . 73 GLY N    1 1 
        2  2552 1 1 76 GLY O    O  -9.008 -28.787   2.031 1.00 . A A . 73 GLY O    1 1 
        2  2553 1 1 77 ASN C    C  -7.515 -25.205   2.387 1.00 . A A . 74 ASN C    1 1 
        2  2554 1 1 77 ASN CA   C  -8.393 -26.122   1.543 1.00 . A A . 74 ASN CA   1 1 
        2  2555 1 1 77 ASN CB   C  -8.935 -25.413   0.254 1.00 . A A . 74 ASN CB   1 1 
        2  2556 1 1 77 ASN CG   C  -9.738 -26.344  -0.645 1.00 . A A . 74 ASN CG   1 1 
        2  2557 1 1 77 ASN H    H -10.176 -26.030   2.726 1.00 . A A . 74 ASN H    1 1 
        2  2558 1 1 77 ASN HA   H  -7.789 -26.971   1.250 1.00 . A A . 74 ASN HA   1 1 
        2  2559 1 1 77 ASN HB2  H  -9.566 -24.557   0.502 1.00 . A A . 74 ASN HB2  1 1 
        2  2560 1 1 77 ASN HB3  H  -8.103 -25.051  -0.320 1.00 . A A . 74 ASN HB3  1 1 
        2  2561 1 1 77 ASN HD21 H  -8.100 -26.817  -1.670 1.00 . A A . 74 ASN HD21 1 1 
        2  2562 1 1 77 ASN HD22 H  -9.565 -27.554  -2.208 1.00 . A A . 74 ASN HD22 1 1 
        2  2563 1 1 77 ASN N    N  -9.456 -26.629   2.425 1.00 . A A . 74 ASN N    1 1 
        2  2564 1 1 77 ASN ND2  N  -9.065 -26.975  -1.597 1.00 . A A . 74 ASN ND2  1 1 
        2  2565 1 1 77 ASN O    O  -8.026 -24.286   3.016 1.00 . A A . 74 ASN O    1 1 
        2  2566 1 1 77 ASN OD1  O -10.950 -26.494  -0.487 1.00 . A A . 74 ASN OD1  1 1 
        2  2567 1 1 78 LYS C    C  -4.662 -23.564   2.550 1.00 . A A . 75 LYS C    1 1 
        2  2568 1 1 78 LYS CA   C  -5.337 -24.676   3.373 1.00 . A A . 75 LYS CA   1 1 
        2  2569 1 1 78 LYS CB   C  -4.241 -25.469   4.179 1.00 . A A . 75 LYS CB   1 1 
        2  2570 1 1 78 LYS CD   C  -5.654 -26.855   5.892 1.00 . A A . 75 LYS CD   1 1 
        2  2571 1 1 78 LYS CE   C  -6.755 -26.435   6.867 1.00 . A A . 75 LYS CE   1 1 
        2  2572 1 1 78 LYS CG   C  -4.592 -25.753   5.660 1.00 . A A . 75 LYS CG   1 1 
        2  2573 1 1 78 LYS H    H  -5.803 -26.184   1.858 1.00 . A A . 75 LYS H    1 1 
        2  2574 1 1 78 LYS HA   H  -5.998 -24.211   4.095 1.00 . A A . 75 LYS HA   1 1 
        2  2575 1 1 78 LYS HB2  H  -3.999 -26.407   3.698 1.00 . A A . 75 LYS HB2  1 1 
        2  2576 1 1 78 LYS HB3  H  -3.346 -24.861   4.174 1.00 . A A . 75 LYS HB3  1 1 
        2  2577 1 1 78 LYS HD2  H  -6.105 -27.137   4.973 1.00 . A A . 75 LYS HD2  1 1 
        2  2578 1 1 78 LYS HD3  H  -5.155 -27.721   6.311 1.00 . A A . 75 LYS HD3  1 1 
        2  2579 1 1 78 LYS HE2  H  -7.199 -25.507   6.533 1.00 . A A . 75 LYS HE2  1 1 
        2  2580 1 1 78 LYS HE3  H  -7.517 -27.201   6.877 1.00 . A A . 75 LYS HE3  1 1 
        2  2581 1 1 78 LYS HG2  H  -3.684 -26.055   6.164 1.00 . A A . 75 LYS HG2  1 1 
        2  2582 1 1 78 LYS HG3  H  -4.939 -24.834   6.112 1.00 . A A . 75 LYS HG3  1 1 
        2  2583 1 1 78 LYS HZ1  H  -5.525 -25.509   8.267 1.00 . A A . 75 LYS HZ1  1 1 
        2  2584 1 1 78 LYS HZ2  H  -5.828 -27.137   8.603 1.00 . A A . 75 LYS HZ2  1 1 
        2  2585 1 1 78 LYS HZ3  H  -7.026 -25.976   8.881 1.00 . A A . 75 LYS HZ3  1 1 
        2  2586 1 1 78 LYS N    N  -6.205 -25.497   2.480 1.00 . A A . 75 LYS N    1 1 
        2  2587 1 1 78 LYS NZ   N  -6.248 -26.251   8.247 1.00 . A A . 75 LYS NZ   1 1 
        2  2588 1 1 78 LYS O    O  -3.705 -23.879   1.834 1.00 . A A . 75 LYS O    1 1 
        2  2589 1 1 79 LEU C    C  -4.826 -19.793   2.230 1.00 . A A . 76 LEU C    1 1 
        2  2590 1 1 79 LEU CA   C  -4.450 -21.232   1.789 1.00 . A A . 76 LEU CA   1 1 
        2  2591 1 1 79 LEU CB   C  -4.816 -21.408   0.265 1.00 . A A . 76 LEU CB   1 1 
        2  2592 1 1 79 LEU CD1  C  -2.633 -21.116  -0.940 1.00 . A A . 76 LEU CD1  1 1 
        2  2593 1 1 79 LEU CD2  C  -4.772 -20.312  -2.006 1.00 . A A . 76 LEU CD2  1 1 
        2  2594 1 1 79 LEU CG   C  -4.015 -20.537  -0.699 1.00 . A A . 76 LEU CG   1 1 
        2  2595 1 1 79 LEU H    H  -5.851 -22.014   3.228 1.00 . A A . 76 LEU H    1 1 
        2  2596 1 1 79 LEU HA   H  -3.381 -21.368   1.882 1.00 . A A . 76 LEU HA   1 1 
        2  2597 1 1 79 LEU HB2  H  -4.665 -22.440  -0.018 1.00 . A A . 76 LEU HB2  1 1 
        2  2598 1 1 79 LEU HB3  H  -5.859 -21.163   0.124 1.00 . A A . 76 LEU HB3  1 1 
        2  2599 1 1 79 LEU HD11 H  -2.727 -22.103  -1.367 1.00 . A A . 76 LEU HD11 1 1 
        2  2600 1 1 79 LEU HD12 H  -2.105 -21.177   0.000 1.00 . A A . 76 LEU HD12 1 1 
        2  2601 1 1 79 LEU HD13 H  -2.091 -20.478  -1.619 1.00 . A A . 76 LEU HD13 1 1 
        2  2602 1 1 79 LEU HD21 H  -4.975 -21.262  -2.477 1.00 . A A . 76 LEU HD21 1 1 
        2  2603 1 1 79 LEU HD22 H  -4.176 -19.702  -2.668 1.00 . A A . 76 LEU HD22 1 1 
        2  2604 1 1 79 LEU HD23 H  -5.706 -19.808  -1.796 1.00 . A A . 76 LEU HD23 1 1 
        2  2605 1 1 79 LEU HG   H  -3.886 -19.579  -0.224 1.00 . A A . 76 LEU HG   1 1 
        2  2606 1 1 79 LEU N    N  -5.111 -22.273   2.621 1.00 . A A . 76 LEU N    1 1 
        2  2607 1 1 79 LEU O    O  -5.458 -19.111   1.462 1.00 . A A . 76 LEU O    1 1 
        2  2608 1 1 80 ARG C    C  -3.915 -16.847   3.477 1.00 . A A . 77 ARG C    1 1 
        2  2609 1 1 80 ARG CA   C  -4.960 -17.962   3.834 1.00 . A A . 77 ARG CA   1 1 
        2  2610 1 1 80 ARG CB   C  -5.323 -18.041   5.355 1.00 . A A . 77 ARG CB   1 1 
        2  2611 1 1 80 ARG CD   C  -6.021 -15.611   5.986 1.00 . A A . 77 ARG CD   1 1 
        2  2612 1 1 80 ARG CG   C  -5.066 -16.786   6.232 1.00 . A A . 77 ARG CG   1 1 
        2  2613 1 1 80 ARG CZ   C  -8.440 -15.112   6.015 1.00 . A A . 77 ARG CZ   1 1 
        2  2614 1 1 80 ARG H    H  -3.792 -19.728   4.009 1.00 . A A . 77 ARG H    1 1 
        2  2615 1 1 80 ARG HA   H  -5.881 -17.795   3.285 1.00 . A A . 77 ARG HA   1 1 
        2  2616 1 1 80 ARG HB2  H  -6.378 -18.292   5.438 1.00 . A A . 77 ARG HB2  1 1 
        2  2617 1 1 80 ARG HB3  H  -4.761 -18.863   5.780 1.00 . A A . 77 ARG HB3  1 1 
        2  2618 1 1 80 ARG HD2  H  -5.802 -14.848   6.716 1.00 . A A . 77 ARG HD2  1 1 
        2  2619 1 1 80 ARG HD3  H  -5.847 -15.199   5.006 1.00 . A A . 77 ARG HD3  1 1 
        2  2620 1 1 80 ARG HE   H  -7.641 -16.928   6.287 1.00 . A A . 77 ARG HE   1 1 
        2  2621 1 1 80 ARG HG2  H  -5.144 -17.069   7.273 1.00 . A A . 77 ARG HG2  1 1 
        2  2622 1 1 80 ARG HG3  H  -4.056 -16.450   6.041 1.00 . A A . 77 ARG HG3  1 1 
        2  2623 1 1 80 ARG HH11 H  -7.257 -13.519   5.698 1.00 . A A . 77 ARG HH11 1 1 
        2  2624 1 1 80 ARG HH12 H  -8.949 -13.173   5.717 1.00 . A A . 77 ARG HH12 1 1 
        2  2625 1 1 80 ARG HH21 H  -9.886 -16.482   6.345 1.00 . A A . 77 ARG HH21 1 1 
        2  2626 1 1 80 ARG HH22 H -10.450 -14.865   6.081 1.00 . A A . 77 ARG HH22 1 1 
        2  2627 1 1 80 ARG N    N  -4.446 -19.272   3.423 1.00 . A A . 77 ARG N    1 1 
        2  2628 1 1 80 ARG NE   N  -7.436 -15.986   6.105 1.00 . A A . 77 ARG NE   1 1 
        2  2629 1 1 80 ARG NH1  N  -8.194 -13.837   5.798 1.00 . A A . 77 ARG NH1  1 1 
        2  2630 1 1 80 ARG NH2  N  -9.691 -15.520   6.159 1.00 . A A . 77 ARG NH2  1 1 
        2  2631 1 1 80 ARG O    O  -2.835 -16.786   4.068 1.00 . A A . 77 ARG O    1 1 
        2  2632 1 1 81 VAL C    C  -4.287 -13.535   2.360 1.00 . A A . 78 VAL C    1 1 
        2  2633 1 1 81 VAL CA   C  -3.380 -14.783   2.259 1.00 . A A . 78 VAL CA   1 1 
        2  2634 1 1 81 VAL CB   C  -2.663 -14.804   0.836 1.00 . A A . 78 VAL CB   1 1 
        2  2635 1 1 81 VAL CG1  C  -1.675 -13.651   0.730 1.00 . A A . 78 VAL CG1  1 1 
        2  2636 1 1 81 VAL CG2  C  -1.898 -16.108   0.567 1.00 . A A . 78 VAL CG2  1 1 
        2  2637 1 1 81 VAL H    H  -4.992 -16.102   1.899 1.00 . A A . 78 VAL H    1 1 
        2  2638 1 1 81 VAL HA   H  -2.620 -14.764   3.034 1.00 . A A . 78 VAL HA   1 1 
        2  2639 1 1 81 VAL HB   H  -3.417 -14.671   0.027 1.00 . A A . 78 VAL HB   1 1 
        2  2640 1 1 81 VAL HG11 H  -2.208 -12.717   0.806 1.00 . A A . 78 VAL HG11 1 1 
        2  2641 1 1 81 VAL HG12 H  -1.168 -13.702  -0.221 1.00 . A A . 78 VAL HG12 1 1 
        2  2642 1 1 81 VAL HG13 H  -0.953 -13.718   1.529 1.00 . A A . 78 VAL HG13 1 1 
        2  2643 1 1 81 VAL HG21 H  -1.461 -16.472   1.476 1.00 . A A . 78 VAL HG21 1 1 
        2  2644 1 1 81 VAL HG22 H  -1.108 -15.904  -0.141 1.00 . A A . 78 VAL HG22 1 1 
        2  2645 1 1 81 VAL HG23 H  -2.556 -16.854   0.162 1.00 . A A . 78 VAL HG23 1 1 
        2  2646 1 1 81 VAL N    N  -4.214 -15.962   2.491 1.00 . A A . 78 VAL N    1 1 
        2  2647 1 1 81 VAL O    O  -5.199 -13.404   1.537 1.00 . A A . 78 VAL O    1 1 
        2  2648 1 1 82 GLU C    C  -4.072 -10.198   3.734 1.00 . A A . 79 GLU C    1 1 
        2  2649 1 1 82 GLU CA   C  -4.906 -11.417   3.379 1.00 . A A . 79 GLU CA   1 1 
        2  2650 1 1 82 GLU CB   C  -6.064 -11.553   4.374 1.00 . A A . 79 GLU CB   1 1 
        2  2651 1 1 82 GLU CD   C  -8.248 -10.507   5.145 1.00 . A A . 79 GLU CD   1 1 
        2  2652 1 1 82 GLU CG   C  -7.327 -10.782   3.975 1.00 . A A . 79 GLU CG   1 1 
        2  2653 1 1 82 GLU H    H  -3.453 -12.761   4.064 1.00 . A A . 79 GLU H    1 1 
        2  2654 1 1 82 GLU HA   H  -5.321 -11.278   2.394 1.00 . A A . 79 GLU HA   1 1 
        2  2655 1 1 82 GLU HB2  H  -6.321 -12.599   4.455 1.00 . A A . 79 GLU HB2  1 1 
        2  2656 1 1 82 GLU HB3  H  -5.734 -11.197   5.340 1.00 . A A . 79 GLU HB3  1 1 
        2  2657 1 1 82 GLU HG2  H  -7.050  -9.837   3.534 1.00 . A A . 79 GLU HG2  1 1 
        2  2658 1 1 82 GLU HG3  H  -7.868 -11.369   3.245 1.00 . A A . 79 GLU HG3  1 1 
        2  2659 1 1 82 GLU N    N  -4.095 -12.619   3.345 1.00 . A A . 79 GLU N    1 1 
        2  2660 1 1 82 GLU O    O  -3.106 -10.268   4.530 1.00 . A A . 79 GLU O    1 1 
        2  2661 1 1 82 GLU OE1  O  -7.958  -9.574   5.914 1.00 . A A . 79 GLU OE1  1 1 
        2  2662 1 1 82 GLU OE2  O  -9.263 -11.226   5.295 1.00 . A A . 79 GLU OE2  1 1 
        2  2663 1 1 83 VAL C    C  -4.780  -7.150   4.571 1.00 . A A . 80 VAL C    1 1 
        2  2664 1 1 83 VAL CA   C  -3.904  -7.803   3.484 1.00 . A A . 80 VAL CA   1 1 
        2  2665 1 1 83 VAL CB   C  -3.780  -6.849   2.263 1.00 . A A . 80 VAL CB   1 1 
        2  2666 1 1 83 VAL CG1  C  -2.626  -7.266   1.392 1.00 . A A . 80 VAL CG1  1 1 
        2  2667 1 1 83 VAL CG2  C  -5.042  -6.819   1.413 1.00 . A A . 80 VAL CG2  1 1 
        2  2668 1 1 83 VAL H    H  -5.019  -9.146   2.328 1.00 . A A . 80 VAL H    1 1 
        2  2669 1 1 83 VAL HA   H  -2.915  -7.963   3.878 1.00 . A A . 80 VAL HA   1 1 
        2  2670 1 1 83 VAL HB   H  -3.586  -5.849   2.625 1.00 . A A . 80 VAL HB   1 1 
        2  2671 1 1 83 VAL HG11 H  -1.720  -6.789   1.737 1.00 . A A . 80 VAL HG11 1 1 
        2  2672 1 1 83 VAL HG12 H  -2.820  -6.977   0.373 1.00 . A A . 80 VAL HG12 1 1 
        2  2673 1 1 83 VAL HG13 H  -2.504  -8.340   1.445 1.00 . A A . 80 VAL HG13 1 1 
        2  2674 1 1 83 VAL HG21 H  -5.172  -7.773   0.932 1.00 . A A . 80 VAL HG21 1 1 
        2  2675 1 1 83 VAL HG22 H  -4.949  -6.044   0.667 1.00 . A A . 80 VAL HG22 1 1 
        2  2676 1 1 83 VAL HG23 H  -5.889  -6.614   2.048 1.00 . A A . 80 VAL HG23 1 1 
        2  2677 1 1 83 VAL N    N  -4.418  -9.088   3.098 1.00 . A A . 80 VAL N    1 1 
        2  2678 1 1 83 VAL O    O  -5.983  -6.943   4.390 1.00 . A A . 80 VAL O    1 1 
        2  2679 1 1 84 PRO C    C  -4.188  -4.431   6.362 1.00 . A A . 81 PRO C    1 1 
        2  2680 1 1 84 PRO CA   C  -4.736  -5.834   6.649 1.00 . A A . 81 PRO CA   1 1 
        2  2681 1 1 84 PRO CB   C  -4.277  -6.348   8.021 1.00 . A A . 81 PRO CB   1 1 
        2  2682 1 1 84 PRO CD   C  -3.011  -7.499   6.308 1.00 . A A . 81 PRO CD   1 1 
        2  2683 1 1 84 PRO CG   C  -3.020  -7.108   7.766 1.00 . A A . 81 PRO CG   1 1 
        2  2684 1 1 84 PRO HA   H  -5.816  -5.807   6.607 1.00 . A A . 81 PRO HA   1 1 
        2  2685 1 1 84 PRO HB2  H  -4.096  -5.512   8.687 1.00 . A A . 81 PRO HB2  1 1 
        2  2686 1 1 84 PRO HB3  H  -5.026  -7.002   8.442 1.00 . A A . 81 PRO HB3  1 1 
        2  2687 1 1 84 PRO HD2  H  -2.103  -7.151   5.836 1.00 . A A . 81 PRO HD2  1 1 
        2  2688 1 1 84 PRO HD3  H  -3.102  -8.570   6.203 1.00 . A A . 81 PRO HD3  1 1 
        2  2689 1 1 84 PRO HG2  H  -2.171  -6.476   7.986 1.00 . A A . 81 PRO HG2  1 1 
        2  2690 1 1 84 PRO HG3  H  -2.991  -7.993   8.382 1.00 . A A . 81 PRO HG3  1 1 
        2  2691 1 1 84 PRO N    N  -4.182  -6.821   5.730 1.00 . A A . 81 PRO N    1 1 
        2  2692 1 1 84 PRO O    O  -4.030  -3.613   7.276 1.00 . A A . 81 PRO O    1 1 
        2  2693 1 1 85 PHE C    C  -4.188  -2.229   3.530 1.00 . A A . 82 PHE C    1 1 
        2  2694 1 1 85 PHE CA   C  -3.409  -2.842   4.695 1.00 . A A . 82 PHE CA   1 1 
        2  2695 1 1 85 PHE CB   C  -1.871  -2.844   4.390 1.00 . A A . 82 PHE CB   1 1 
        2  2696 1 1 85 PHE CD1  C  -1.881  -3.562   1.889 1.00 . A A . 82 PHE CD1  1 1 
        2  2697 1 1 85 PHE CD2  C  -0.105  -4.281   3.282 1.00 . A A . 82 PHE CD2  1 1 
        2  2698 1 1 85 PHE CE1  C  -1.272  -4.163   0.809 1.00 . A A . 82 PHE CE1  1 1 
        2  2699 1 1 85 PHE CE2  C   0.485  -4.883   2.226 1.00 . A A . 82 PHE CE2  1 1 
        2  2700 1 1 85 PHE CG   C  -1.308  -3.606   3.165 1.00 . A A . 82 PHE CG   1 1 
        2  2701 1 1 85 PHE CZ   C  -0.082  -4.830   0.980 1.00 . A A . 82 PHE CZ   1 1 
        2  2702 1 1 85 PHE H    H  -4.093  -4.832   4.388 1.00 . A A . 82 PHE H    1 1 
        2  2703 1 1 85 PHE HA   H  -3.569  -2.204   5.552 1.00 . A A . 82 PHE HA   1 1 
        2  2704 1 1 85 PHE HB2  H  -1.577  -1.815   4.253 1.00 . A A . 82 PHE HB2  1 1 
        2  2705 1 1 85 PHE HB3  H  -1.350  -3.212   5.271 1.00 . A A . 82 PHE HB3  1 1 
        2  2706 1 1 85 PHE HD1  H  -2.826  -3.047   1.747 1.00 . A A . 82 PHE HD1  1 1 
        2  2707 1 1 85 PHE HD2  H   0.378  -4.366   4.252 1.00 . A A . 82 PHE HD2  1 1 
        2  2708 1 1 85 PHE HE1  H  -1.732  -4.117  -0.174 1.00 . A A . 82 PHE HE1  1 1 
        2  2709 1 1 85 PHE HE2  H   1.409  -5.400   2.378 1.00 . A A . 82 PHE HE2  1 1 
        2  2710 1 1 85 PHE HZ   H   0.403  -5.304   0.144 1.00 . A A . 82 PHE HZ   1 1 
        2  2711 1 1 85 PHE N    N  -3.917  -4.150   5.080 1.00 . A A . 82 PHE N    1 1 
        2  2712 1 1 85 PHE O    O  -3.754  -1.214   2.984 1.00 . A A . 82 PHE O    1 1 
        2  2713 1 1 86 ASN C    C  -6.824  -1.164   2.016 1.00 . A A . 83 ASN C    1 1 
        2  2714 1 1 86 ASN CA   C  -6.017  -2.477   1.883 1.00 . A A . 83 ASN CA   1 1 
        2  2715 1 1 86 ASN CB   C  -6.951  -3.608   1.353 1.00 . A A . 83 ASN CB   1 1 
        2  2716 1 1 86 ASN CG   C  -7.132  -3.567  -0.162 1.00 . A A . 83 ASN CG   1 1 
        2  2717 1 1 86 ASN H    H  -5.726  -3.491   3.776 1.00 . A A . 83 ASN H    1 1 
        2  2718 1 1 86 ASN HA   H  -5.240  -2.328   1.149 1.00 . A A . 83 ASN HA   1 1 
        2  2719 1 1 86 ASN HB2  H  -6.546  -4.575   1.610 1.00 . A A . 83 ASN HB2  1 1 
        2  2720 1 1 86 ASN HB3  H  -7.934  -3.499   1.799 1.00 . A A . 83 ASN HB3  1 1 
        2  2721 1 1 86 ASN HD21 H  -8.726  -2.390   0.023 1.00 . A A . 83 ASN HD21 1 1 
        2  2722 1 1 86 ASN HD22 H  -8.299  -2.827  -1.593 1.00 . A A . 83 ASN HD22 1 1 
        2  2723 1 1 86 ASN N    N  -5.333  -2.829   3.163 1.00 . A A . 83 ASN N    1 1 
        2  2724 1 1 86 ASN ND2  N  -8.156  -2.856  -0.624 1.00 . A A . 83 ASN ND2  1 1 
        2  2725 1 1 86 ASN O    O  -8.056  -1.196   2.053 1.00 . A A . 83 ASN O    1 1 
        2  2726 1 1 86 ASN OD1  O  -6.370  -4.177  -0.908 1.00 . A A . 83 ASN OD1  1 1 
        2  2727 1 1 87 ALA C    C  -5.581   2.388   2.121 1.00 . A A . 84 ALA C    1 1 
        2  2728 1 1 87 ALA CA   C  -6.694   1.314   2.231 1.00 . A A . 84 ALA CA   1 1 
        2  2729 1 1 87 ALA CB   C  -7.510   1.475   3.530 1.00 . A A . 84 ALA CB   1 1 
        2  2730 1 1 87 ALA H    H  -5.118  -0.091   2.200 1.00 . A A . 84 ALA H    1 1 
        2  2731 1 1 87 ALA HA   H  -7.369   1.429   1.397 1.00 . A A . 84 ALA HA   1 1 
        2  2732 1 1 87 ALA HB1  H  -7.956   2.460   3.555 1.00 . A A . 84 ALA HB1  1 1 
        2  2733 1 1 87 ALA HB2  H  -6.876   1.342   4.390 1.00 . A A . 84 ALA HB2  1 1 
        2  2734 1 1 87 ALA HB3  H  -8.300   0.731   3.551 1.00 . A A . 84 ALA HB3  1 1 
        2  2735 1 1 87 ALA N    N  -6.103  -0.024   2.140 1.00 . A A . 84 ALA N    1 1 
        2  2736 1 1 87 ALA O    O  -5.631   3.411   2.804 1.00 . A A . 84 ALA O    1 1 
        2  2737 1 1 88 ARG C    C  -2.402   3.068   2.092 1.00 . A A . 85 ARG C    1 1 
        2  2738 1 1 88 ARG CA   C  -3.420   2.983   0.916 1.00 . A A . 85 ARG CA   1 1 
        2  2739 1 1 88 ARG CB   C  -3.817   4.389   0.427 1.00 . A A . 85 ARG CB   1 1 
        2  2740 1 1 88 ARG CD   C  -2.556   6.587   0.267 1.00 . A A . 85 ARG CD   1 1 
        2  2741 1 1 88 ARG CG   C  -2.681   5.158  -0.244 1.00 . A A . 85 ARG CG   1 1 
        2  2742 1 1 88 ARG CZ   C  -0.276   7.350  -0.475 1.00 . A A . 85 ARG CZ   1 1 
        2  2743 1 1 88 ARG H    H  -4.711   1.304   0.670 1.00 . A A . 85 ARG H    1 1 
        2  2744 1 1 88 ARG HA   H  -2.912   2.489   0.101 1.00 . A A . 85 ARG HA   1 1 
        2  2745 1 1 88 ARG HB2  H  -4.633   4.298  -0.289 1.00 . A A . 85 ARG HB2  1 1 
        2  2746 1 1 88 ARG HB3  H  -4.154   4.953   1.274 1.00 . A A . 85 ARG HB3  1 1 
        2  2747 1 1 88 ARG HD2  H  -3.530   7.055   0.237 1.00 . A A . 85 ARG HD2  1 1 
        2  2748 1 1 88 ARG HD3  H  -2.195   6.569   1.284 1.00 . A A . 85 ARG HD3  1 1 
        2  2749 1 1 88 ARG HE   H  -2.034   7.998  -1.200 1.00 . A A . 85 ARG HE   1 1 
        2  2750 1 1 88 ARG HG2  H  -1.750   4.645  -0.048 1.00 . A A . 85 ARG HG2  1 1 
        2  2751 1 1 88 ARG HG3  H  -2.859   5.184  -1.309 1.00 . A A . 85 ARG HG3  1 1 
        2  2752 1 1 88 ARG HH11 H  -0.168   5.968   1.018 1.00 . A A . 85 ARG HH11 1 1 
        2  2753 1 1 88 ARG HH12 H   1.358   6.549   0.442 1.00 . A A . 85 ARG HH12 1 1 
        2  2754 1 1 88 ARG HH21 H  -0.014   8.718  -1.951 1.00 . A A . 85 ARG HH21 1 1 
        2  2755 1 1 88 ARG HH22 H   1.443   8.116  -1.245 1.00 . A A . 85 ARG HH22 1 1 
        2  2756 1 1 88 ARG N    N  -4.611   2.122   1.206 1.00 . A A . 85 ARG N    1 1 
        2  2757 1 1 88 ARG NE   N  -1.626   7.384  -0.553 1.00 . A A . 85 ARG NE   1 1 
        2  2758 1 1 88 ARG NH1  N   0.355   6.560   0.401 1.00 . A A . 85 ARG NH1  1 1 
        2  2759 1 1 88 ARG NH2  N   0.443   8.125  -1.289 1.00 . A A . 85 ARG NH2  1 1 
        2  2760 1 1 88 ARG O    O  -1.308   2.505   1.989 1.00 . A A . 85 ARG O    1 1 
        2  2761 1 1 89 GLU C    C  -2.839   3.742   5.579 1.00 . A A . 86 GLU C    1 1 
        2  2762 1 1 89 GLU CA   C  -1.902   3.813   4.367 1.00 . A A . 86 GLU CA   1 1 
        2  2763 1 1 89 GLU CB   C  -0.986   5.047   4.421 1.00 . A A . 86 GLU CB   1 1 
        2  2764 1 1 89 GLU CD   C   1.085   6.126   5.414 1.00 . A A . 86 GLU CD   1 1 
        2  2765 1 1 89 GLU CG   C   0.066   5.007   5.536 1.00 . A A . 86 GLU CG   1 1 
        2  2766 1 1 89 GLU H    H  -3.478   4.424   3.123 1.00 . A A . 86 GLU H    1 1 
        2  2767 1 1 89 GLU HA   H  -1.298   2.921   4.348 1.00 . A A . 86 GLU HA   1 1 
        2  2768 1 1 89 GLU HB2  H  -0.469   5.133   3.473 1.00 . A A . 86 GLU HB2  1 1 
        2  2769 1 1 89 GLU HB3  H  -1.597   5.927   4.558 1.00 . A A . 86 GLU HB3  1 1 
        2  2770 1 1 89 GLU HG2  H  -0.433   5.098   6.495 1.00 . A A . 86 GLU HG2  1 1 
        2  2771 1 1 89 GLU HG3  H   0.587   4.059   5.497 1.00 . A A . 86 GLU HG3  1 1 
        2  2772 1 1 89 GLU N    N  -2.708   3.826   3.153 1.00 . A A . 86 GLU N    1 1 
        2  2773 1 1 89 GLU O    O  -3.607   4.705   5.794 1.00 . A A . 86 GLU O    1 1 
        2  2774 1 1 89 GLU OXT  O  -2.834   2.701   6.277 1.00 . A A . 86 GLU OXT  1 1 
        2  2775 1 1 89 GLU OE1  O   0.809   7.244   5.889 1.00 . A A . 86 GLU OE1  1 1 
        2  2776 1 1 89 GLU OE2  O   2.169   5.892   4.831 1.00 . A A . 86 GLU OE2  1 1 
        3  2777 1 1  1 GLY C    C  -6.420  -1.281  -6.507 1.00 . A A . -2 GLY C    1 1 
        3  2778 1 1  1 GLY CA   C  -7.482  -2.364  -6.438 1.00 . A A . -2 GLY CA   1 1 
        3  2779 1 1  1 GLY H1   H  -6.258  -3.901  -7.124 1.00 . A A . -2 GLY H1   1 1 
        3  2780 1 1  1 GLY H2   H  -7.164  -3.156  -8.341 1.00 . A A . -2 GLY H2   1 1 
        3  2781 1 1  1 GLY H3   H  -7.909  -4.232  -7.267 1.00 . A A . -2 GLY H3   1 1 
        3  2782 1 1  1 GLY HA2  H  -8.439  -1.938  -6.705 1.00 . A A . -2 GLY HA2  1 1 
        3  2783 1 1  1 GLY HA3  H  -7.535  -2.744  -5.427 1.00 . A A . -2 GLY HA3  1 1 
        3  2784 1 1  1 GLY N    N  -7.185  -3.492  -7.357 1.00 . A A . -2 GLY N    1 1 
        3  2785 1 1  1 GLY O    O  -5.226  -1.586  -6.552 1.00 . A A . -2 GLY O    1 1 
        3  2786 1 1  2 SER C    C  -6.440   2.312  -5.797 1.00 . A A . -1 SER C    1 1 
        3  2787 1 1  2 SER CA   C  -5.949   1.127  -6.637 1.00 . A A . -1 SER CA   1 1 
        3  2788 1 1  2 SER CB   C  -5.836   1.533  -8.117 1.00 . A A . -1 SER CB   1 1 
        3  2789 1 1  2 SER H    H  -7.820   0.156  -6.446 1.00 . A A . -1 SER H    1 1 
        3  2790 1 1  2 SER HA   H  -4.977   0.820  -6.279 1.00 . A A . -1 SER HA   1 1 
        3  2791 1 1  2 SER HB2  H  -5.447   0.702  -8.687 1.00 . A A . -1 SER HB2  1 1 
        3  2792 1 1  2 SER HB3  H  -6.818   1.789  -8.485 1.00 . A A . -1 SER HB3  1 1 
        3  2793 1 1  2 SER HG   H  -5.372   3.241  -8.955 1.00 . A A . -1 SER HG   1 1 
        3  2794 1 1  2 SER N    N  -6.856  -0.015  -6.515 1.00 . A A . -1 SER N    1 1 
        3  2795 1 1  2 SER O    O  -7.580   2.761  -5.950 1.00 . A A . -1 SER O    1 1 
        3  2796 1 1  2 SER OG   O  -4.979   2.648  -8.303 1.00 . A A . -1 SER OG   1 1 
        3  2797 1 1  3 HIS C    C  -4.545   4.689  -3.671 1.00 . A A .  0 HIS C    1 1 
        3  2798 1 1  3 HIS CA   C  -5.852   3.974  -4.056 1.00 . A A .  0 HIS CA   1 1 
        3  2799 1 1  3 HIS CB   C  -6.603   3.570  -2.775 1.00 . A A .  0 HIS CB   1 1 
        3  2800 1 1  3 HIS CD2  C  -9.161   3.138  -2.863 1.00 . A A .  0 HIS CD2  1 1 
        3  2801 1 1  3 HIS CE1  C  -9.841   5.206  -2.642 1.00 . A A .  0 HIS CE1  1 1 
        3  2802 1 1  3 HIS CG   C  -8.061   3.919  -2.762 1.00 . A A .  0 HIS CG   1 1 
        3  2803 1 1  3 HIS H    H  -4.697   2.367  -4.815 1.00 . A A .  0 HIS H    1 1 
        3  2804 1 1  3 HIS HA   H  -6.466   4.657  -4.625 1.00 . A A .  0 HIS HA   1 1 
        3  2805 1 1  3 HIS HB2  H  -6.520   2.503  -2.647 1.00 . A A .  0 HIS HB2  1 1 
        3  2806 1 1  3 HIS HB3  H  -6.141   4.060  -1.929 1.00 . A A .  0 HIS HB3  1 1 
        3  2807 1 1  3 HIS HD1  H  -7.967   6.013  -2.523 1.00 . A A .  0 HIS HD1  1 1 
        3  2808 1 1  3 HIS HD2  H  -9.173   2.064  -2.985 1.00 . A A .  0 HIS HD2  1 1 
        3  2809 1 1  3 HIS HE1  H -10.472   6.074  -2.559 1.00 . A A .  0 HIS HE1  1 1 
        3  2810 1 1  3 HIS HE2  H -11.174   3.657  -2.614 1.00 . A A .  0 HIS HE2  1 1 
        3  2811 1 1  3 HIS N    N  -5.570   2.801  -4.903 1.00 . A A .  0 HIS N    1 1 
        3  2812 1 1  3 HIS ND1  N  -8.523   5.210  -2.628 1.00 . A A .  0 HIS ND1  1 1 
        3  2813 1 1  3 HIS NE2  N -10.257   3.960  -2.785 1.00 . A A .  0 HIS NE2  1 1 
        3  2814 1 1  3 HIS O    O  -3.484   4.056  -3.612 1.00 . A A .  0 HIS O    1 1 
        3  2815 1 1  4 MET C    C  -3.977   8.066  -2.169 1.00 . A A .  1 MET C    1 1 
        3  2816 1 1  4 MET CA   C  -3.498   6.835  -2.975 1.00 . A A .  1 MET CA   1 1 
        3  2817 1 1  4 MET CB   C  -2.582   7.286  -4.150 1.00 . A A .  1 MET CB   1 1 
        3  2818 1 1  4 MET CE   C  -0.886   8.239  -6.722 1.00 . A A .  1 MET CE   1 1 
        3  2819 1 1  4 MET CG   C  -3.316   7.817  -5.388 1.00 . A A .  1 MET CG   1 1 
        3  2820 1 1  4 MET H    H  -5.494   6.456  -3.597 1.00 . A A .  1 MET H    1 1 
        3  2821 1 1  4 MET HA   H  -2.913   6.212  -2.310 1.00 . A A .  1 MET HA   1 1 
        3  2822 1 1  4 MET HB2  H  -1.926   8.068  -3.796 1.00 . A A .  1 MET HB2  1 1 
        3  2823 1 1  4 MET HB3  H  -1.978   6.443  -4.457 1.00 . A A .  1 MET HB3  1 1 
        3  2824 1 1  4 MET HE1  H  -0.241   8.910  -7.265 1.00 . A A .  1 MET HE1  1 1 
        3  2825 1 1  4 MET HE2  H  -1.125   7.387  -7.341 1.00 . A A .  1 MET HE2  1 1 
        3  2826 1 1  4 MET HE3  H  -0.386   7.904  -5.825 1.00 . A A .  1 MET HE3  1 1 
        3  2827 1 1  4 MET HG2  H  -3.490   6.992  -6.064 1.00 . A A .  1 MET HG2  1 1 
        3  2828 1 1  4 MET HG3  H  -4.266   8.227  -5.077 1.00 . A A .  1 MET HG3  1 1 
        3  2829 1 1  4 MET N    N  -4.637   6.012  -3.443 1.00 . A A .  1 MET N    1 1 
        3  2830 1 1  4 MET O    O  -4.350   9.099  -2.737 1.00 . A A .  1 MET O    1 1 
        3  2831 1 1  4 MET SD   S  -2.395   9.096  -6.277 1.00 . A A .  1 MET SD   1 1 
        3  2832 1 1  5 VAL C    C  -3.330   9.181   1.176 1.00 . A A .  2 VAL C    1 1 
        3  2833 1 1  5 VAL CA   C  -4.388   9.054   0.060 1.00 . A A .  2 VAL CA   1 1 
        3  2834 1 1  5 VAL CB   C  -5.819   8.857   0.693 1.00 . A A .  2 VAL CB   1 1 
        3  2835 1 1  5 VAL CG1  C  -6.276  10.056   1.527 1.00 . A A .  2 VAL CG1  1 1 
        3  2836 1 1  5 VAL CG2  C  -6.865   8.565  -0.371 1.00 . A A .  2 VAL CG2  1 1 
        3  2837 1 1  5 VAL H    H  -3.798   7.067  -0.433 1.00 . A A .  2 VAL H    1 1 
        3  2838 1 1  5 VAL HA   H  -4.391   9.964  -0.525 1.00 . A A .  2 VAL HA   1 1 
        3  2839 1 1  5 VAL HB   H  -5.771   8.000   1.350 1.00 . A A .  2 VAL HB   1 1 
        3  2840 1 1  5 VAL HG11 H  -5.551  10.244   2.302 1.00 . A A .  2 VAL HG11 1 1 
        3  2841 1 1  5 VAL HG12 H  -7.234   9.840   1.976 1.00 . A A .  2 VAL HG12 1 1 
        3  2842 1 1  5 VAL HG13 H  -6.362  10.928   0.893 1.00 . A A .  2 VAL HG13 1 1 
        3  2843 1 1  5 VAL HG21 H  -7.825   8.431   0.097 1.00 . A A .  2 VAL HG21 1 1 
        3  2844 1 1  5 VAL HG22 H  -6.587   7.665  -0.895 1.00 . A A .  2 VAL HG22 1 1 
        3  2845 1 1  5 VAL HG23 H  -6.915   9.388  -1.070 1.00 . A A .  2 VAL HG23 1 1 
        3  2846 1 1  5 VAL N    N  -4.016   7.936  -0.836 1.00 . A A .  2 VAL N    1 1 
        3  2847 1 1  5 VAL O    O  -2.683   8.190   1.528 1.00 . A A .  2 VAL O    1 1 
        3  2848 1 1  6 ILE C    C  -2.809  10.084   4.143 1.00 . A A .  3 ILE C    1 1 
        3  2849 1 1  6 ILE CA   C  -2.241  10.663   2.817 1.00 . A A .  3 ILE CA   1 1 
        3  2850 1 1  6 ILE CB   C  -1.880  12.208   2.940 1.00 . A A .  3 ILE CB   1 1 
        3  2851 1 1  6 ILE CD1  C  -0.636  13.915   4.430 1.00 . A A .  3 ILE CD1  1 1 
        3  2852 1 1  6 ILE CG1  C  -1.095  12.481   4.249 1.00 . A A .  3 ILE CG1  1 1 
        3  2853 1 1  6 ILE CG2  C  -3.114  13.154   2.799 1.00 . A A .  3 ILE CG2  1 1 
        3  2854 1 1  6 ILE H    H  -3.634  11.157   1.312 1.00 . A A .  3 ILE H    1 1 
        3  2855 1 1  6 ILE HA   H  -1.323  10.133   2.605 1.00 . A A .  3 ILE HA   1 1 
        3  2856 1 1  6 ILE HB   H  -1.225  12.437   2.111 1.00 . A A .  3 ILE HB   1 1 
        3  2857 1 1  6 ILE HD11 H  -0.076  13.995   5.347 1.00 . A A .  3 ILE HD11 1 1 
        3  2858 1 1  6 ILE HD12 H  -1.500  14.562   4.474 1.00 . A A .  3 ILE HD12 1 1 
        3  2859 1 1  6 ILE HD13 H  -0.014  14.200   3.599 1.00 . A A .  3 ILE HD13 1 1 
        3  2860 1 1  6 ILE HG12 H  -1.727  12.237   5.090 1.00 . A A .  3 ILE HG12 1 1 
        3  2861 1 1  6 ILE HG13 H  -0.216  11.847   4.274 1.00 . A A .  3 ILE HG13 1 1 
        3  2862 1 1  6 ILE HG21 H  -3.589  13.003   1.839 1.00 . A A .  3 ILE HG21 1 1 
        3  2863 1 1  6 ILE HG22 H  -2.787  14.185   2.869 1.00 . A A .  3 ILE HG22 1 1 
        3  2864 1 1  6 ILE HG23 H  -3.827  12.961   3.591 1.00 . A A .  3 ILE HG23 1 1 
        3  2865 1 1  6 ILE N    N  -3.140  10.406   1.693 1.00 . A A .  3 ILE N    1 1 
        3  2866 1 1  6 ILE O    O  -3.715  10.654   4.765 1.00 . A A .  3 ILE O    1 1 
        3  2867 1 1  7 ARG C    C  -1.234   7.774   6.392 1.00 . A A .  4 ARG C    1 1 
        3  2868 1 1  7 ARG CA   C  -2.546   8.357   5.853 1.00 . A A .  4 ARG CA   1 1 
        3  2869 1 1  7 ARG CB   C  -3.664   7.306   5.834 1.00 . A A .  4 ARG CB   1 1 
        3  2870 1 1  7 ARG CD   C  -6.074   6.794   6.472 1.00 . A A .  4 ARG CD   1 1 
        3  2871 1 1  7 ARG CG   C  -4.883   7.730   6.656 1.00 . A A .  4 ARG CG   1 1 
        3  2872 1 1  7 ARG CZ   C  -7.644   7.742   4.775 1.00 . A A .  4 ARG CZ   1 1 
        3  2873 1 1  7 ARG H    H  -1.827   8.332   3.862 1.00 . A A .  4 ARG H    1 1 
        3  2874 1 1  7 ARG HA   H  -2.848   9.188   6.476 1.00 . A A .  4 ARG HA   1 1 
        3  2875 1 1  7 ARG HB2  H  -3.980   7.150   4.807 1.00 . A A .  4 ARG HB2  1 1 
        3  2876 1 1  7 ARG HB3  H  -3.280   6.375   6.228 1.00 . A A .  4 ARG HB3  1 1 
        3  2877 1 1  7 ARG HD2  H  -5.742   5.778   6.628 1.00 . A A .  4 ARG HD2  1 1 
        3  2878 1 1  7 ARG HD3  H  -6.833   7.038   7.201 1.00 . A A .  4 ARG HD3  1 1 
        3  2879 1 1  7 ARG HE   H  -6.289   6.287   4.431 1.00 . A A .  4 ARG HE   1 1 
        3  2880 1 1  7 ARG HG2  H  -4.613   7.753   7.704 1.00 . A A .  4 ARG HG2  1 1 
        3  2881 1 1  7 ARG HG3  H  -5.174   8.723   6.347 1.00 . A A .  4 ARG HG3  1 1 
        3  2882 1 1  7 ARG HH11 H  -7.844   8.581   6.602 1.00 . A A .  4 ARG HH11 1 1 
        3  2883 1 1  7 ARG HH12 H  -8.911   9.193   5.384 1.00 . A A .  4 ARG HH12 1 1 
        3  2884 1 1  7 ARG HH21 H  -7.703   7.097   2.846 1.00 . A A .  4 ARG HH21 1 1 
        3  2885 1 1  7 ARG HH22 H  -8.831   8.354   3.261 1.00 . A A .  4 ARG HH22 1 1 
        3  2886 1 1  7 ARG N    N  -2.323   8.891   4.518 1.00 . A A .  4 ARG N    1 1 
        3  2887 1 1  7 ARG NE   N  -6.657   6.898   5.125 1.00 . A A .  4 ARG NE   1 1 
        3  2888 1 1  7 ARG NH1  N  -8.180   8.572   5.660 1.00 . A A .  4 ARG NH1  1 1 
        3  2889 1 1  7 ARG NH2  N  -8.101   7.732   3.531 1.00 . A A .  4 ARG NH2  1 1 
        3  2890 1 1  7 ARG O    O  -0.392   7.321   5.607 1.00 . A A .  4 ARG O    1 1 
        3  2891 1 1  8 GLU C    C   0.167   6.082   9.081 1.00 . A A .  5 GLU C    1 1 
        3  2892 1 1  8 GLU CA   C   0.245   7.423   8.304 1.00 . A A .  5 GLU CA   1 1 
        3  2893 1 1  8 GLU CB   C   0.805   8.594   9.184 1.00 . A A .  5 GLU CB   1 1 
        3  2894 1 1  8 GLU CD   C   0.441  10.445  10.915 1.00 . A A .  5 GLU CD   1 1 
        3  2895 1 1  8 GLU CG   C  -0.195   9.292  10.153 1.00 . A A .  5 GLU CG   1 1 
        3  2896 1 1  8 GLU H    H  -1.823   7.936   8.309 1.00 . A A .  5 GLU H    1 1 
        3  2897 1 1  8 GLU HA   H   0.922   7.293   7.464 1.00 . A A .  5 GLU HA   1 1 
        3  2898 1 1  8 GLU HB2  H   1.620   8.203   9.782 1.00 . A A .  5 GLU HB2  1 1 
        3  2899 1 1  8 GLU HB3  H   1.219   9.354   8.519 1.00 . A A .  5 GLU HB3  1 1 
        3  2900 1 1  8 GLU HG2  H  -1.032   9.693   9.588 1.00 . A A .  5 GLU HG2  1 1 
        3  2901 1 1  8 GLU HG3  H  -0.572   8.575  10.878 1.00 . A A .  5 GLU HG3  1 1 
        3  2902 1 1  8 GLU N    N  -1.056   7.767   7.717 1.00 . A A .  5 GLU N    1 1 
        3  2903 1 1  8 GLU O    O  -0.326   6.047  10.214 1.00 . A A .  5 GLU O    1 1 
        3  2904 1 1  8 GLU OE1  O   1.496  10.240  11.557 1.00 . A A .  5 GLU OE1  1 1 
        3  2905 1 1  8 GLU OE2  O  -0.132  11.557  10.888 1.00 . A A .  5 GLU OE2  1 1 
        3  2906 1 1  9 SER C    C   1.637   2.721   8.522 1.00 . A A .  6 SER C    1 1 
        3  2907 1 1  9 SER CA   C   0.500   3.635   9.064 1.00 . A A .  6 SER CA   1 1 
        3  2908 1 1  9 SER CB   C  -0.909   3.054   8.752 1.00 . A A .  6 SER CB   1 1 
        3  2909 1 1  9 SER H    H   1.105   5.030   7.591 1.00 . A A .  6 SER H    1 1 
        3  2910 1 1  9 SER HA   H   0.606   3.756  10.131 1.00 . A A .  6 SER HA   1 1 
        3  2911 1 1  9 SER HB2  H  -1.659   3.803   8.970 1.00 . A A .  6 SER HB2  1 1 
        3  2912 1 1  9 SER HB3  H  -0.968   2.784   7.706 1.00 . A A .  6 SER HB3  1 1 
        3  2913 1 1  9 SER HG   H  -1.961   1.441   9.152 1.00 . A A .  6 SER HG   1 1 
        3  2914 1 1  9 SER N    N   0.629   4.963   8.459 1.00 . A A .  6 SER N    1 1 
        3  2915 1 1  9 SER O    O   2.547   3.208   7.848 1.00 . A A .  6 SER O    1 1 
        3  2916 1 1  9 SER OG   O  -1.202   1.899   9.529 1.00 . A A .  6 SER OG   1 1 
        3  2917 1 1 10 VAL C    C   1.695  -0.752   7.808 1.00 . A A .  7 VAL C    1 1 
        3  2918 1 1 10 VAL CA   C   2.508   0.419   8.281 1.00 . A A .  7 VAL CA   1 1 
        3  2919 1 1 10 VAL CB   C   3.626  -0.107   9.253 1.00 . A A .  7 VAL CB   1 1 
        3  2920 1 1 10 VAL CG1  C   4.905   0.687   9.082 1.00 . A A .  7 VAL CG1  1 1 
        3  2921 1 1 10 VAL CG2  C   3.211  -0.162  10.732 1.00 . A A .  7 VAL CG2  1 1 
        3  2922 1 1 10 VAL H    H   0.801   1.078   9.306 1.00 . A A .  7 VAL H    1 1 
        3  2923 1 1 10 VAL HA   H   2.992   0.865   7.403 1.00 . A A .  7 VAL HA   1 1 
        3  2924 1 1 10 VAL HB   H   3.851  -1.122   8.957 1.00 . A A .  7 VAL HB   1 1 
        3  2925 1 1 10 VAL HG11 H   5.317   0.491   8.102 1.00 . A A .  7 VAL HG11 1 1 
        3  2926 1 1 10 VAL HG12 H   5.617   0.393   9.839 1.00 . A A .  7 VAL HG12 1 1 
        3  2927 1 1 10 VAL HG13 H   4.690   1.741   9.177 1.00 . A A .  7 VAL HG13 1 1 
        3  2928 1 1 10 VAL HG21 H   3.967  -0.701  11.287 1.00 . A A .  7 VAL HG21 1 1 
        3  2929 1 1 10 VAL HG22 H   2.266  -0.686  10.830 1.00 . A A .  7 VAL HG22 1 1 
        3  2930 1 1 10 VAL HG23 H   3.124   0.836  11.133 1.00 . A A .  7 VAL HG23 1 1 
        3  2931 1 1 10 VAL N    N   1.570   1.410   8.806 1.00 . A A .  7 VAL N    1 1 
        3  2932 1 1 10 VAL O    O   0.999  -1.421   8.587 1.00 . A A .  7 VAL O    1 1 
        3  2933 1 1 11 SER C    C   1.600  -3.337   5.986 1.00 . A A .  8 SER C    1 1 
        3  2934 1 1 11 SER CA   C   0.922  -1.958   5.878 1.00 . A A .  8 SER CA   1 1 
        3  2935 1 1 11 SER CB   C   0.643  -1.517   4.423 1.00 . A A .  8 SER CB   1 1 
        3  2936 1 1 11 SER H    H   2.401  -0.431   5.993 1.00 . A A .  8 SER H    1 1 
        3  2937 1 1 11 SER HA   H  -0.016  -1.995   6.418 1.00 . A A .  8 SER HA   1 1 
        3  2938 1 1 11 SER HB2  H   0.507  -2.379   3.816 1.00 . A A .  8 SER HB2  1 1 
        3  2939 1 1 11 SER HB3  H  -0.266  -0.911   4.379 1.00 . A A .  8 SER HB3  1 1 
        3  2940 1 1 11 SER HG   H   2.569  -1.153   4.172 1.00 . A A .  8 SER HG   1 1 
        3  2941 1 1 11 SER N    N   1.748  -0.954   6.524 1.00 . A A .  8 SER N    1 1 
        3  2942 1 1 11 SER O    O   2.751  -3.493   5.573 1.00 . A A .  8 SER O    1 1 
        3  2943 1 1 11 SER OG   O   1.727  -0.766   3.884 1.00 . A A .  8 SER OG   1 1 
        3  2944 1 1 12 ARG C    C   0.802  -6.827   6.226 1.00 . A A .  9 ARG C    1 1 
        3  2945 1 1 12 ARG CA   C   1.546  -5.629   6.875 1.00 . A A .  9 ARG CA   1 1 
        3  2946 1 1 12 ARG CB   C   1.695  -5.842   8.408 1.00 . A A .  9 ARG CB   1 1 
        3  2947 1 1 12 ARG CD   C   0.385  -4.921  10.376 1.00 . A A .  9 ARG CD   1 1 
        3  2948 1 1 12 ARG CG   C   0.375  -5.855   9.183 1.00 . A A .  9 ARG CG   1 1 
        3  2949 1 1 12 ARG CZ   C  -1.171  -4.427  12.239 1.00 . A A .  9 ARG CZ   1 1 
        3  2950 1 1 12 ARG H    H  -0.086  -4.219   6.717 1.00 . A A .  9 ARG H    1 1 
        3  2951 1 1 12 ARG HA   H   2.527  -5.549   6.453 1.00 . A A .  9 ARG HA   1 1 
        3  2952 1 1 12 ARG HB2  H   2.176  -6.802   8.568 1.00 . A A .  9 ARG HB2  1 1 
        3  2953 1 1 12 ARG HB3  H   2.341  -5.069   8.821 1.00 . A A .  9 ARG HB3  1 1 
        3  2954 1 1 12 ARG HD2  H   1.316  -5.037  10.916 1.00 . A A .  9 ARG HD2  1 1 
        3  2955 1 1 12 ARG HD3  H   0.287  -3.902  10.032 1.00 . A A .  9 ARG HD3  1 1 
        3  2956 1 1 12 ARG HE   H  -1.167  -6.096  11.143 1.00 . A A .  9 ARG HE   1 1 
        3  2957 1 1 12 ARG HG2  H  -0.426  -5.562   8.523 1.00 . A A .  9 ARG HG2  1 1 
        3  2958 1 1 12 ARG HG3  H   0.189  -6.860   9.540 1.00 . A A .  9 ARG HG3  1 1 
        3  2959 1 1 12 ARG HH11 H   0.167  -2.947  11.877 1.00 . A A .  9 ARG HH11 1 1 
        3  2960 1 1 12 ARG HH12 H  -0.936  -2.647  13.180 1.00 . A A .  9 ARG HH12 1 1 
        3  2961 1 1 12 ARG HH21 H  -2.601  -5.725  12.860 1.00 . A A .  9 ARG HH21 1 1 
        3  2962 1 1 12 ARG HH22 H  -2.520  -4.235  13.745 1.00 . A A .  9 ARG HH22 1 1 
        3  2963 1 1 12 ARG N    N   0.891  -4.338   6.555 1.00 . A A .  9 ARG N    1 1 
        3  2964 1 1 12 ARG NE   N  -0.724  -5.229  11.276 1.00 . A A .  9 ARG NE   1 1 
        3  2965 1 1 12 ARG NH1  N  -0.603  -3.243  12.449 1.00 . A A .  9 ARG NH1  1 1 
        3  2966 1 1 12 ARG NH2  N  -2.176  -4.832  13.013 1.00 . A A .  9 ARG NH2  1 1 
        3  2967 1 1 12 ARG O    O  -0.392  -6.749   6.051 1.00 . A A .  9 ARG O    1 1 
        3  2968 1 1 13 ILE C    C   0.869 -10.298   6.079 1.00 . A A . 10 ILE C    1 1 
        3  2969 1 1 13 ILE CA   C   0.838  -9.073   5.186 1.00 . A A . 10 ILE CA   1 1 
        3  2970 1 1 13 ILE CB   C   1.583  -9.444   3.838 1.00 . A A . 10 ILE CB   1 1 
        3  2971 1 1 13 ILE CD1  C   2.894  -8.090   2.021 1.00 . A A . 10 ILE CD1  1 1 
        3  2972 1 1 13 ILE CG1  C   1.592  -8.272   2.820 1.00 . A A . 10 ILE CG1  1 1 
        3  2973 1 1 13 ILE CG2  C   0.965 -10.711   3.196 1.00 . A A . 10 ILE CG2  1 1 
        3  2974 1 1 13 ILE H    H   2.459  -8.036   6.115 1.00 . A A . 10 ILE H    1 1 
        3  2975 1 1 13 ILE HA   H  -0.194  -8.804   4.985 1.00 . A A . 10 ILE HA   1 1 
        3  2976 1 1 13 ILE HB   H   2.599  -9.682   4.102 1.00 . A A . 10 ILE HB   1 1 
        3  2977 1 1 13 ILE HD11 H   3.391  -9.035   1.862 1.00 . A A . 10 ILE HD11 1 1 
        3  2978 1 1 13 ILE HD12 H   3.561  -7.415   2.540 1.00 . A A . 10 ILE HD12 1 1 
        3  2979 1 1 13 ILE HD13 H   2.653  -7.654   1.062 1.00 . A A . 10 ILE HD13 1 1 
        3  2980 1 1 13 ILE HG12 H   0.805  -8.427   2.106 1.00 . A A . 10 ILE HG12 1 1 
        3  2981 1 1 13 ILE HG13 H   1.404  -7.355   3.345 1.00 . A A . 10 ILE HG13 1 1 
        3  2982 1 1 13 ILE HG21 H   1.405 -10.913   2.231 1.00 . A A . 10 ILE HG21 1 1 
        3  2983 1 1 13 ILE HG22 H  -0.100 -10.574   3.066 1.00 . A A . 10 ILE HG22 1 1 
        3  2984 1 1 13 ILE HG23 H   1.136 -11.563   3.844 1.00 . A A . 10 ILE HG23 1 1 
        3  2985 1 1 13 ILE N    N   1.486  -7.952   5.892 1.00 . A A . 10 ILE N    1 1 
        3  2986 1 1 13 ILE O    O   1.930 -10.552   6.707 1.00 . A A . 10 ILE O    1 1 
        3  2987 1 1 14 TYR C    C  -0.361 -13.529   5.903 1.00 . A A . 11 TYR C    1 1 
        3  2988 1 1 14 TYR CA   C  -0.364 -12.296   6.881 1.00 . A A . 11 TYR CA   1 1 
        3  2989 1 1 14 TYR CB   C  -1.649 -12.284   7.756 1.00 . A A . 11 TYR CB   1 1 
        3  2990 1 1 14 TYR CD1  C  -1.009 -12.795  10.141 1.00 . A A . 11 TYR CD1  1 1 
        3  2991 1 1 14 TYR CD2  C  -2.172 -14.475   8.913 1.00 . A A . 11 TYR CD2  1 1 
        3  2992 1 1 14 TYR CE1  C  -0.978 -13.617  11.250 1.00 . A A . 11 TYR CE1  1 1 
        3  2993 1 1 14 TYR CE2  C  -2.152 -15.301  10.020 1.00 . A A . 11 TYR CE2  1 1 
        3  2994 1 1 14 TYR CG   C  -1.603 -13.210   8.953 1.00 . A A . 11 TYR CG   1 1 
        3  2995 1 1 14 TYR CZ   C  -1.555 -14.866  11.186 1.00 . A A . 11 TYR CZ   1 1 
        3  2996 1 1 14 TYR H    H  -1.092 -10.710   5.613 1.00 . A A . 11 TYR H    1 1 
        3  2997 1 1 14 TYR HA   H   0.493 -12.329   7.530 1.00 . A A . 11 TYR HA   1 1 
        3  2998 1 1 14 TYR HB2  H  -1.810 -11.283   8.139 1.00 . A A . 11 TYR HB2  1 1 
        3  2999 1 1 14 TYR HB3  H  -2.506 -12.568   7.153 1.00 . A A . 11 TYR HB3  1 1 
        3  3000 1 1 14 TYR HD1  H  -0.558 -11.814  10.189 1.00 . A A . 11 TYR HD1  1 1 
        3  3001 1 1 14 TYR HD2  H  -2.636 -14.814   7.999 1.00 . A A . 11 TYR HD2  1 1 
        3  3002 1 1 14 TYR HE1  H  -0.513 -13.279  12.164 1.00 . A A . 11 TYR HE1  1 1 
        3  3003 1 1 14 TYR HE2  H  -2.599 -16.281   9.970 1.00 . A A . 11 TYR HE2  1 1 
        3  3004 1 1 14 TYR HH   H  -1.294 -16.573  12.033 1.00 . A A . 11 TYR HH   1 1 
        3  3005 1 1 14 TYR N    N  -0.286 -11.037   6.119 1.00 . A A . 11 TYR N    1 1 
        3  3006 1 1 14 TYR O    O  -1.321 -13.687   5.128 1.00 . A A . 11 TYR O    1 1 
        3  3007 1 1 14 TYR OH   O  -1.540 -15.681  12.293 1.00 . A A . 11 TYR OH   1 1 
        3  3008 1 1 15 VAL C    C   0.928 -16.869   5.876 1.00 . A A . 12 VAL C    1 1 
        3  3009 1 1 15 VAL CA   C   0.677 -15.592   5.014 1.00 . A A . 12 VAL CA   1 1 
        3  3010 1 1 15 VAL CB   C   1.707 -15.429   3.764 1.00 . A A . 12 VAL CB   1 1 
        3  3011 1 1 15 VAL CG1  C   3.009 -14.779   4.191 1.00 . A A . 12 VAL CG1  1 1 
        3  3012 1 1 15 VAL CG2  C   2.061 -16.744   3.023 1.00 . A A . 12 VAL CG2  1 1 
        3  3013 1 1 15 VAL H    H   1.463 -14.300   6.520 1.00 . A A . 12 VAL H    1 1 
        3  3014 1 1 15 VAL HA   H  -0.334 -15.650   4.621 1.00 . A A . 12 VAL HA   1 1 
        3  3015 1 1 15 VAL HB   H   1.262 -14.750   3.022 1.00 . A A . 12 VAL HB   1 1 
        3  3016 1 1 15 VAL HG11 H   3.441 -15.346   4.999 1.00 . A A . 12 VAL HG11 1 1 
        3  3017 1 1 15 VAL HG12 H   2.817 -13.767   4.516 1.00 . A A . 12 VAL HG12 1 1 
        3  3018 1 1 15 VAL HG13 H   3.697 -14.762   3.357 1.00 . A A . 12 VAL HG13 1 1 
        3  3019 1 1 15 VAL HG21 H   2.429 -17.485   3.721 1.00 . A A . 12 VAL HG21 1 1 
        3  3020 1 1 15 VAL HG22 H   2.838 -16.542   2.295 1.00 . A A . 12 VAL HG22 1 1 
        3  3021 1 1 15 VAL HG23 H   1.201 -17.131   2.502 1.00 . A A . 12 VAL HG23 1 1 
        3  3022 1 1 15 VAL N    N   0.699 -14.404   5.897 1.00 . A A . 12 VAL N    1 1 
        3  3023 1 1 15 VAL O    O   2.054 -17.136   6.295 1.00 . A A . 12 VAL O    1 1 
        3  3024 1 1 16 GLY C    C  -0.374 -20.146   6.159 1.00 . A A . 13 GLY C    1 1 
        3  3025 1 1 16 GLY CA   C   0.026 -18.888   6.933 1.00 . A A . 13 GLY CA   1 1 
        3  3026 1 1 16 GLY H    H  -1.056 -17.382   5.849 1.00 . A A . 13 GLY H    1 1 
        3  3027 1 1 16 GLY HA2  H   1.065 -18.976   7.231 1.00 . A A . 13 GLY HA2  1 1 
        3  3028 1 1 16 GLY HA3  H  -0.581 -18.821   7.821 1.00 . A A . 13 GLY HA3  1 1 
        3  3029 1 1 16 GLY N    N  -0.138 -17.652   6.159 1.00 . A A . 13 GLY N    1 1 
        3  3030 1 1 16 GLY O    O  -0.869 -20.040   5.030 1.00 . A A . 13 GLY O    1 1 
        3  3031 1 1 17 ASN C    C   0.008 -22.905   4.726 1.00 . A A . 14 ASN C    1 1 
        3  3032 1 1 17 ASN CA   C  -0.508 -22.665   6.170 1.00 . A A . 14 ASN CA   1 1 
        3  3033 1 1 17 ASN CB   C  -2.036 -22.848   6.197 1.00 . A A . 14 ASN CB   1 1 
        3  3034 1 1 17 ASN CG   C  -2.557 -23.245   7.565 1.00 . A A . 14 ASN CG   1 1 
        3  3035 1 1 17 ASN H    H   0.233 -21.348   7.701 1.00 . A A . 14 ASN H    1 1 
        3  3036 1 1 17 ASN HA   H  -0.084 -23.435   6.797 1.00 . A A . 14 ASN HA   1 1 
        3  3037 1 1 17 ASN HB2  H  -2.502 -21.917   5.917 1.00 . A A . 14 ASN HB2  1 1 
        3  3038 1 1 17 ASN HB3  H  -2.312 -23.614   5.486 1.00 . A A . 14 ASN HB3  1 1 
        3  3039 1 1 17 ASN HD21 H  -2.907 -21.344   8.025 1.00 . A A . 14 ASN HD21 1 1 
        3  3040 1 1 17 ASN HD22 H  -3.313 -22.497   9.243 1.00 . A A . 14 ASN HD22 1 1 
        3  3041 1 1 17 ASN N    N  -0.150 -21.344   6.776 1.00 . A A . 14 ASN N    1 1 
        3  3042 1 1 17 ASN ND2  N  -2.965 -22.262   8.357 1.00 . A A . 14 ASN ND2  1 1 
        3  3043 1 1 17 ASN O    O  -0.611 -23.654   3.992 1.00 . A A . 14 ASN O    1 1 
        3  3044 1 1 17 ASN OD1  O  -2.606 -24.429   7.901 1.00 . A A . 14 ASN OD1  1 1 
        3  3045 1 1 18 LEU C    C   2.580 -23.759   2.933 1.00 . A A . 15 LEU C    1 1 
        3  3046 1 1 18 LEU CA   C   1.666 -22.502   2.981 1.00 . A A . 15 LEU CA   1 1 
        3  3047 1 1 18 LEU CB   C   2.370 -21.180   2.463 1.00 . A A . 15 LEU CB   1 1 
        3  3048 1 1 18 LEU CD1  C   4.004 -20.974   4.461 1.00 . A A . 15 LEU CD1  1 1 
        3  3049 1 1 18 LEU CD2  C   4.886 -21.445   2.147 1.00 . A A . 15 LEU CD2  1 1 
        3  3050 1 1 18 LEU CG   C   3.795 -20.767   2.965 1.00 . A A . 15 LEU CG   1 1 
        3  3051 1 1 18 LEU H    H   1.616 -21.732   4.942 1.00 . A A . 15 LEU H    1 1 
        3  3052 1 1 18 LEU HA   H   0.816 -22.700   2.344 1.00 . A A . 15 LEU HA   1 1 
        3  3053 1 1 18 LEU HB2  H   2.430 -21.260   1.390 1.00 . A A . 15 LEU HB2  1 1 
        3  3054 1 1 18 LEU HB3  H   1.711 -20.345   2.685 1.00 . A A . 15 LEU HB3  1 1 
        3  3055 1 1 18 LEU HD11 H   5.024 -20.762   4.717 1.00 . A A . 15 LEU HD11 1 1 
        3  3056 1 1 18 LEU HD12 H   3.775 -21.999   4.711 1.00 . A A . 15 LEU HD12 1 1 
        3  3057 1 1 18 LEU HD13 H   3.348 -20.315   5.014 1.00 . A A . 15 LEU HD13 1 1 
        3  3058 1 1 18 LEU HD21 H   5.854 -21.230   2.580 1.00 . A A . 15 LEU HD21 1 1 
        3  3059 1 1 18 LEU HD22 H   4.856 -21.075   1.130 1.00 . A A . 15 LEU HD22 1 1 
        3  3060 1 1 18 LEU HD23 H   4.717 -22.512   2.146 1.00 . A A . 15 LEU HD23 1 1 
        3  3061 1 1 18 LEU HG   H   3.902 -19.703   2.797 1.00 . A A . 15 LEU HG   1 1 
        3  3062 1 1 18 LEU N    N   1.132 -22.311   4.329 1.00 . A A . 15 LEU N    1 1 
        3  3063 1 1 18 LEU O    O   3.184 -24.124   3.953 1.00 . A A . 15 LEU O    1 1 
        3  3064 1 1 19 PRO C    C   5.072 -25.187   1.389 1.00 . A A . 16 PRO C    1 1 
        3  3065 1 1 19 PRO CA   C   3.590 -25.606   1.678 1.00 . A A . 16 PRO CA   1 1 
        3  3066 1 1 19 PRO CB   C   2.996 -26.400   0.509 1.00 . A A . 16 PRO CB   1 1 
        3  3067 1 1 19 PRO CD   C   1.971 -24.194   0.510 1.00 . A A . 16 PRO CD   1 1 
        3  3068 1 1 19 PRO CG   C   2.220 -25.424  -0.321 1.00 . A A . 16 PRO CG   1 1 
        3  3069 1 1 19 PRO HA   H   3.529 -26.199   2.574 1.00 . A A . 16 PRO HA   1 1 
        3  3070 1 1 19 PRO HB2  H   3.797 -26.833  -0.071 1.00 . A A . 16 PRO HB2  1 1 
        3  3071 1 1 19 PRO HB3  H   2.342 -27.180   0.881 1.00 . A A . 16 PRO HB3  1 1 
        3  3072 1 1 19 PRO HD2  H   2.379 -23.326   0.016 1.00 . A A . 16 PRO HD2  1 1 
        3  3073 1 1 19 PRO HD3  H   0.911 -24.066   0.686 1.00 . A A . 16 PRO HD3  1 1 
        3  3074 1 1 19 PRO HG2  H   2.805 -25.163  -1.188 1.00 . A A . 16 PRO HG2  1 1 
        3  3075 1 1 19 PRO HG3  H   1.280 -25.861  -0.623 1.00 . A A . 16 PRO HG3  1 1 
        3  3076 1 1 19 PRO N    N   2.692 -24.455   1.776 1.00 . A A . 16 PRO N    1 1 
        3  3077 1 1 19 PRO O    O   5.287 -24.415   0.450 1.00 . A A . 16 PRO O    1 1 
        3  3078 1 1 20 SER C    C   8.013 -24.733   3.432 1.00 . A A . 17 SER C    1 1 
        3  3079 1 1 20 SER CA   C   7.541 -25.493   2.189 1.00 . A A . 17 SER CA   1 1 
        3  3080 1 1 20 SER CB   C   8.126 -24.781   0.936 1.00 . A A . 17 SER CB   1 1 
        3  3081 1 1 20 SER H    H   5.743 -26.294   2.939 1.00 . A A . 17 SER H    1 1 
        3  3082 1 1 20 SER HA   H   7.985 -26.481   2.240 1.00 . A A . 17 SER HA   1 1 
        3  3083 1 1 20 SER HB2  H   9.193 -24.940   0.908 1.00 . A A . 17 SER HB2  1 1 
        3  3084 1 1 20 SER HB3  H   7.679 -25.192   0.042 1.00 . A A . 17 SER HB3  1 1 
        3  3085 1 1 20 SER HG   H   8.632 -22.927   0.556 1.00 . A A . 17 SER HG   1 1 
        3  3086 1 1 20 SER N    N   6.046 -25.714   2.223 1.00 . A A . 17 SER N    1 1 
        3  3087 1 1 20 SER O    O   9.142 -24.955   3.886 1.00 . A A . 17 SER O    1 1 
        3  3088 1 1 20 SER OG   O   7.888 -23.379   0.955 1.00 . A A . 17 SER OG   1 1 
        3  3089 1 1 21 HIS C    C   8.310 -21.754   4.402 1.00 . A A . 18 HIS C    1 1 
        3  3090 1 1 21 HIS CA   C   7.437 -22.866   5.014 1.00 . A A . 18 HIS CA   1 1 
        3  3091 1 1 21 HIS CB   C   8.043 -23.481   6.303 1.00 . A A . 18 HIS CB   1 1 
        3  3092 1 1 21 HIS CD2  C   7.996 -21.445   7.944 1.00 . A A . 18 HIS CD2  1 1 
        3  3093 1 1 21 HIS CE1  C  10.086 -21.516   8.595 1.00 . A A . 18 HIS CE1  1 1 
        3  3094 1 1 21 HIS CG   C   8.587 -22.487   7.310 1.00 . A A . 18 HIS CG   1 1 
        3  3095 1 1 21 HIS H    H   6.186 -23.941   3.683 1.00 . A A . 18 HIS H    1 1 
        3  3096 1 1 21 HIS HA   H   6.500 -22.415   5.287 1.00 . A A . 18 HIS HA   1 1 
        3  3097 1 1 21 HIS HB2  H   7.282 -24.064   6.800 1.00 . A A . 18 HIS HB2  1 1 
        3  3098 1 1 21 HIS HB3  H   8.842 -24.131   6.013 1.00 . A A . 18 HIS HB3  1 1 
        3  3099 1 1 21 HIS HD1  H  10.579 -23.155   7.468 1.00 . A A . 18 HIS HD1  1 1 
        3  3100 1 1 21 HIS HD2  H   6.966 -21.131   7.841 1.00 . A A . 18 HIS HD2  1 1 
        3  3101 1 1 21 HIS HE1  H  11.010 -21.293   9.100 1.00 . A A . 18 HIS HE1  1 1 
        3  3102 1 1 21 HIS HE2  H   8.873 -19.974   9.152 1.00 . A A . 18 HIS HE2  1 1 
        3  3103 1 1 21 HIS N    N   7.114 -23.884   3.993 1.00 . A A . 18 HIS N    1 1 
        3  3104 1 1 21 HIS ND1  N   9.891 -22.507   7.746 1.00 . A A . 18 HIS ND1  1 1 
        3  3105 1 1 21 HIS NE2  N   8.950 -20.862   8.739 1.00 . A A . 18 HIS NE2  1 1 
        3  3106 1 1 21 HIS O    O   9.507 -21.929   4.155 1.00 . A A . 18 HIS O    1 1 
        3  3107 1 1 22 VAL C    C   9.213 -18.772   4.721 1.00 . A A . 19 VAL C    1 1 
        3  3108 1 1 22 VAL CA   C   8.355 -19.446   3.608 1.00 . A A . 19 VAL CA   1 1 
        3  3109 1 1 22 VAL CB   C   7.287 -18.490   2.911 1.00 . A A . 19 VAL CB   1 1 
        3  3110 1 1 22 VAL CG1  C   6.149 -18.027   3.825 1.00 . A A . 19 VAL CG1  1 1 
        3  3111 1 1 22 VAL CG2  C   7.859 -17.273   2.232 1.00 . A A . 19 VAL CG2  1 1 
        3  3112 1 1 22 VAL H    H   6.723 -20.545   4.391 1.00 . A A . 19 VAL H    1 1 
        3  3113 1 1 22 VAL HA   H   9.008 -19.823   2.835 1.00 . A A . 19 VAL HA   1 1 
        3  3114 1 1 22 VAL HB   H   6.844 -19.073   2.116 1.00 . A A . 19 VAL HB   1 1 
        3  3115 1 1 22 VAL HG11 H   6.547 -17.450   4.648 1.00 . A A . 19 VAL HG11 1 1 
        3  3116 1 1 22 VAL HG12 H   5.617 -18.876   4.209 1.00 . A A . 19 VAL HG12 1 1 
        3  3117 1 1 22 VAL HG13 H   5.466 -17.409   3.255 1.00 . A A . 19 VAL HG13 1 1 
        3  3118 1 1 22 VAL HG21 H   8.367 -16.641   2.946 1.00 . A A . 19 VAL HG21 1 1 
        3  3119 1 1 22 VAL HG22 H   7.028 -16.716   1.798 1.00 . A A . 19 VAL HG22 1 1 
        3  3120 1 1 22 VAL HG23 H   8.531 -17.577   1.448 1.00 . A A . 19 VAL HG23 1 1 
        3  3121 1 1 22 VAL N    N   7.676 -20.608   4.172 1.00 . A A . 19 VAL N    1 1 
        3  3122 1 1 22 VAL O    O   8.682 -18.374   5.767 1.00 . A A . 19 VAL O    1 1 
        3  3123 1 1 23 SER C    C  11.436 -16.541   5.221 1.00 . A A . 20 SER C    1 1 
        3  3124 1 1 23 SER CA   C  11.445 -18.077   5.487 1.00 . A A . 20 SER CA   1 1 
        3  3125 1 1 23 SER CB   C  12.852 -18.700   5.322 1.00 . A A . 20 SER CB   1 1 
        3  3126 1 1 23 SER H    H  10.966 -19.163   3.735 1.00 . A A . 20 SER H    1 1 
        3  3127 1 1 23 SER HA   H  11.065 -18.302   6.470 1.00 . A A . 20 SER HA   1 1 
        3  3128 1 1 23 SER HB2  H  13.308 -18.350   4.409 1.00 . A A . 20 SER HB2  1 1 
        3  3129 1 1 23 SER HB3  H  13.488 -18.441   6.157 1.00 . A A . 20 SER HB3  1 1 
        3  3130 1 1 23 SER HG   H  12.173 -20.369   4.560 1.00 . A A . 20 SER HG   1 1 
        3  3131 1 1 23 SER N    N  10.550 -18.718   4.526 1.00 . A A . 20 SER N    1 1 
        3  3132 1 1 23 SER O    O  11.006 -16.149   4.133 1.00 . A A . 20 SER O    1 1 
        3  3133 1 1 23 SER OG   O  12.759 -20.113   5.273 1.00 . A A . 20 SER OG   1 1 
        3  3134 1 1 24 SER C    C  12.534 -13.693   4.730 1.00 . A A . 21 SER C    1 1 
        3  3135 1 1 24 SER CA   C  11.842 -14.197   6.015 1.00 . A A . 21 SER CA   1 1 
        3  3136 1 1 24 SER CB   C  12.453 -13.506   7.249 1.00 . A A . 21 SER CB   1 1 
        3  3137 1 1 24 SER H    H  12.100 -15.986   7.097 1.00 . A A . 21 SER H    1 1 
        3  3138 1 1 24 SER HA   H  10.801 -13.894   5.958 1.00 . A A . 21 SER HA   1 1 
        3  3139 1 1 24 SER HB2  H  12.712 -12.491   6.994 1.00 . A A . 21 SER HB2  1 1 
        3  3140 1 1 24 SER HB3  H  11.732 -13.500   8.051 1.00 . A A . 21 SER HB3  1 1 
        3  3141 1 1 24 SER HG   H  13.848 -13.874   8.585 1.00 . A A . 21 SER HG   1 1 
        3  3142 1 1 24 SER N    N  11.846 -15.663   6.201 1.00 . A A . 21 SER N    1 1 
        3  3143 1 1 24 SER O    O  12.029 -12.762   4.121 1.00 . A A . 21 SER O    1 1 
        3  3144 1 1 24 SER OG   O  13.626 -14.169   7.695 1.00 . A A . 21 SER OG   1 1 
        3  3145 1 1 25 ARG C    C  13.504 -14.063   1.748 1.00 . A A . 22 ARG C    1 1 
        3  3146 1 1 25 ARG CA   C  14.349 -13.868   3.064 1.00 . A A . 22 ARG CA   1 1 
        3  3147 1 1 25 ARG CB   C  15.814 -14.441   2.962 1.00 . A A . 22 ARG CB   1 1 
        3  3148 1 1 25 ARG CD   C  16.192 -16.165   1.116 1.00 . A A . 22 ARG CD   1 1 
        3  3149 1 1 25 ARG CG   C  16.377 -14.710   1.551 1.00 . A A . 22 ARG CG   1 1 
        3  3150 1 1 25 ARG CZ   C  17.932 -17.902   1.527 1.00 . A A . 22 ARG CZ   1 1 
        3  3151 1 1 25 ARG H    H  14.110 -14.936   4.925 1.00 . A A . 22 ARG H    1 1 
        3  3152 1 1 25 ARG HA   H  14.457 -12.793   3.181 1.00 . A A . 22 ARG HA   1 1 
        3  3153 1 1 25 ARG HB2  H  16.451 -13.706   3.401 1.00 . A A . 22 ARG HB2  1 1 
        3  3154 1 1 25 ARG HB3  H  15.922 -15.347   3.545 1.00 . A A . 22 ARG HB3  1 1 
        3  3155 1 1 25 ARG HD2  H  15.677 -16.701   1.892 1.00 . A A . 22 ARG HD2  1 1 
        3  3156 1 1 25 ARG HD3  H  15.602 -16.187   0.210 1.00 . A A . 22 ARG HD3  1 1 
        3  3157 1 1 25 ARG HE   H  18.028 -16.459   0.139 1.00 . A A . 22 ARG HE   1 1 
        3  3158 1 1 25 ARG HG2  H  15.873 -14.071   0.838 1.00 . A A . 22 ARG HG2  1 1 
        3  3159 1 1 25 ARG HG3  H  17.435 -14.481   1.553 1.00 . A A . 22 ARG HG3  1 1 
        3  3160 1 1 25 ARG HH11 H  16.339 -18.064   2.780 1.00 . A A . 22 ARG HH11 1 1 
        3  3161 1 1 25 ARG HH12 H  17.582 -19.243   3.011 1.00 . A A . 22 ARG HH12 1 1 
        3  3162 1 1 25 ARG HH21 H  19.643 -18.030   0.449 1.00 . A A . 22 ARG HH21 1 1 
        3  3163 1 1 25 ARG HH22 H  19.458 -19.226   1.689 1.00 . A A . 22 ARG HH22 1 1 
        3  3164 1 1 25 ARG N    N  13.676 -14.284   4.326 1.00 . A A . 22 ARG N    1 1 
        3  3165 1 1 25 ARG NE   N  17.474 -16.831   0.859 1.00 . A A . 22 ARG NE   1 1 
        3  3166 1 1 25 ARG NH1  N  17.226 -18.448   2.520 1.00 . A A . 22 ARG NH1  1 1 
        3  3167 1 1 25 ARG NH2  N  19.105 -18.425   1.196 1.00 . A A . 22 ARG NH2  1 1 
        3  3168 1 1 25 ARG O    O  13.645 -13.254   0.830 1.00 . A A . 22 ARG O    1 1 
        3  3169 1 1 26 ASP C    C  10.696 -14.226   0.321 1.00 . A A . 23 ASP C    1 1 
        3  3170 1 1 26 ASP CA   C  11.776 -15.327   0.452 1.00 . A A . 23 ASP CA   1 1 
        3  3171 1 1 26 ASP CB   C  11.086 -16.717   0.535 1.00 . A A . 23 ASP CB   1 1 
        3  3172 1 1 26 ASP CG   C  12.079 -17.833   0.810 1.00 . A A . 23 ASP CG   1 1 
        3  3173 1 1 26 ASP H    H  12.599 -15.745   2.365 1.00 . A A . 23 ASP H    1 1 
        3  3174 1 1 26 ASP HA   H  12.418 -15.304  -0.419 1.00 . A A . 23 ASP HA   1 1 
        3  3175 1 1 26 ASP HB2  H  10.355 -16.701   1.328 1.00 . A A . 23 ASP HB2  1 1 
        3  3176 1 1 26 ASP HB3  H  10.561 -16.945  -0.392 1.00 . A A . 23 ASP HB3  1 1 
        3  3177 1 1 26 ASP N    N  12.638 -15.102   1.653 1.00 . A A . 23 ASP N    1 1 
        3  3178 1 1 26 ASP O    O  10.608 -13.525  -0.750 1.00 . A A . 23 ASP O    1 1 
        3  3179 1 1 26 ASP OD1  O  12.882 -18.154  -0.090 1.00 . A A . 23 ASP OD1  1 1 
        3  3180 1 1 26 ASP OD2  O  12.074 -18.371   1.941 1.00 . A A . 23 ASP OD2  1 1 
        3  3181 1 1 27 VAL C    C   9.485 -11.588   1.308 1.00 . A A . 24 VAL C    1 1 
        3  3182 1 1 27 VAL CA   C   8.882 -13.003   1.528 1.00 . A A . 24 VAL CA   1 1 
        3  3183 1 1 27 VAL CB   C   8.046 -13.098   2.858 1.00 . A A . 24 VAL CB   1 1 
        3  3184 1 1 27 VAL CG1  C   6.843 -14.009   2.685 1.00 . A A . 24 VAL CG1  1 1 
        3  3185 1 1 27 VAL CG2  C   8.859 -13.609   4.028 1.00 . A A . 24 VAL CG2  1 1 
        3  3186 1 1 27 VAL H    H  10.041 -14.660   2.206 1.00 . A A . 24 VAL H    1 1 
        3  3187 1 1 27 VAL HA   H   8.189 -13.184   0.737 1.00 . A A . 24 VAL HA   1 1 
        3  3188 1 1 27 VAL HB   H   7.681 -12.118   3.106 1.00 . A A . 24 VAL HB   1 1 
        3  3189 1 1 27 VAL HG11 H   6.025 -13.489   2.222 1.00 . A A . 24 VAL HG11 1 1 
        3  3190 1 1 27 VAL HG12 H   6.535 -14.370   3.654 1.00 . A A . 24 VAL HG12 1 1 
        3  3191 1 1 27 VAL HG13 H   7.120 -14.837   2.067 1.00 . A A . 24 VAL HG13 1 1 
        3  3192 1 1 27 VAL HG21 H   9.693 -12.946   4.200 1.00 . A A . 24 VAL HG21 1 1 
        3  3193 1 1 27 VAL HG22 H   9.227 -14.597   3.809 1.00 . A A . 24 VAL HG22 1 1 
        3  3194 1 1 27 VAL HG23 H   8.243 -13.647   4.912 1.00 . A A . 24 VAL HG23 1 1 
        3  3195 1 1 27 VAL N    N   9.916 -14.049   1.431 1.00 . A A . 24 VAL N    1 1 
        3  3196 1 1 27 VAL O    O   9.030 -10.848   0.417 1.00 . A A . 24 VAL O    1 1 
        3  3197 1 1 28 GLU C    C  11.849  -9.838   0.404 1.00 . A A . 25 GLU C    1 1 
        3  3198 1 1 28 GLU CA   C  11.342 -10.035   1.872 1.00 . A A . 25 GLU CA   1 1 
        3  3199 1 1 28 GLU CB   C  12.483  -9.953   2.954 1.00 . A A . 25 GLU CB   1 1 
        3  3200 1 1 28 GLU CD   C  14.657  -8.802   2.200 1.00 . A A . 25 GLU CD   1 1 
        3  3201 1 1 28 GLU CG   C  13.961 -10.127   2.496 1.00 . A A . 25 GLU CG   1 1 
        3  3202 1 1 28 GLU H    H  10.698 -11.757   2.891 1.00 . A A . 25 GLU H    1 1 
        3  3203 1 1 28 GLU HA   H  10.672  -9.209   2.067 1.00 . A A . 25 GLU HA   1 1 
        3  3204 1 1 28 GLU HB2  H  12.410  -8.998   3.416 1.00 . A A . 25 GLU HB2  1 1 
        3  3205 1 1 28 GLU HB3  H  12.275 -10.697   3.722 1.00 . A A . 25 GLU HB3  1 1 
        3  3206 1 1 28 GLU HG2  H  14.523 -10.639   3.273 1.00 . A A . 25 GLU HG2  1 1 
        3  3207 1 1 28 GLU HG3  H  13.982 -10.725   1.596 1.00 . A A . 25 GLU HG3  1 1 
        3  3208 1 1 28 GLU N    N  10.529 -11.241   2.088 1.00 . A A . 25 GLU N    1 1 
        3  3209 1 1 28 GLU O    O  11.705  -8.747  -0.080 1.00 . A A . 25 GLU O    1 1 
        3  3210 1 1 28 GLU OE1  O  15.193  -8.188   3.142 1.00 . A A . 25 GLU OE1  1 1 
        3  3211 1 1 28 GLU OE2  O  14.668  -8.375   1.026 1.00 . A A . 25 GLU OE2  1 1 
        3  3212 1 1 29 ASN C    C  11.764 -10.355  -2.733 1.00 . A A . 26 ASN C    1 1 
        3  3213 1 1 29 ASN CA   C  12.924 -10.579  -1.690 1.00 . A A . 26 ASN CA   1 1 
        3  3214 1 1 29 ASN CB   C  13.914 -11.689  -2.210 1.00 . A A . 26 ASN CB   1 1 
        3  3215 1 1 29 ASN CG   C  14.584 -11.320  -3.528 1.00 . A A . 26 ASN CG   1 1 
        3  3216 1 1 29 ASN H    H  12.544 -11.693   0.094 1.00 . A A . 26 ASN H    1 1 
        3  3217 1 1 29 ASN HA   H  13.482  -9.669  -1.614 1.00 . A A . 26 ASN HA   1 1 
        3  3218 1 1 29 ASN HB2  H  14.727 -11.850  -1.491 1.00 . A A . 26 ASN HB2  1 1 
        3  3219 1 1 29 ASN HB3  H  13.380 -12.619  -2.366 1.00 . A A . 26 ASN HB3  1 1 
        3  3220 1 1 29 ASN HD21 H  16.190 -10.672  -2.554 1.00 . A A . 26 ASN HD21 1 1 
        3  3221 1 1 29 ASN HD22 H  16.274 -10.588  -4.278 1.00 . A A . 26 ASN HD22 1 1 
        3  3222 1 1 29 ASN N    N  12.415 -10.841  -0.313 1.00 . A A . 26 ASN N    1 1 
        3  3223 1 1 29 ASN ND2  N  15.801 -10.796  -3.443 1.00 . A A . 26 ASN ND2  1 1 
        3  3224 1 1 29 ASN O    O  11.712  -9.236  -3.383 1.00 . A A . 26 ASN O    1 1 
        3  3225 1 1 29 ASN OD1  O  14.042 -11.539  -4.606 1.00 . A A . 26 ASN OD1  1 1 
        3  3226 1 1 30 GLU C    C   8.850  -9.922  -3.534 1.00 . A A . 27 GLU C    1 1 
        3  3227 1 1 30 GLU CA   C   9.668 -11.200  -3.817 1.00 . A A . 27 GLU CA   1 1 
        3  3228 1 1 30 GLU CB   C   8.707 -12.431  -3.826 1.00 . A A . 27 GLU CB   1 1 
        3  3229 1 1 30 GLU CD   C   8.821 -13.434  -6.165 1.00 . A A . 27 GLU CD   1 1 
        3  3230 1 1 30 GLU CG   C   7.948 -12.748  -5.138 1.00 . A A . 27 GLU CG   1 1 
        3  3231 1 1 30 GLU H    H  10.908 -12.221  -2.403 1.00 . A A . 27 GLU H    1 1 
        3  3232 1 1 30 GLU HA   H  10.127 -11.098  -4.797 1.00 . A A . 27 GLU HA   1 1 
        3  3233 1 1 30 GLU HB2  H   9.272 -13.309  -3.573 1.00 . A A . 27 GLU HB2  1 1 
        3  3234 1 1 30 GLU HB3  H   7.962 -12.273  -3.069 1.00 . A A . 27 GLU HB3  1 1 
        3  3235 1 1 30 GLU HG2  H   7.135 -13.429  -4.903 1.00 . A A . 27 GLU HG2  1 1 
        3  3236 1 1 30 GLU HG3  H   7.526 -11.849  -5.576 1.00 . A A . 27 GLU HG3  1 1 
        3  3237 1 1 30 GLU N    N  10.795 -11.352  -2.856 1.00 . A A . 27 GLU N    1 1 
        3  3238 1 1 30 GLU O    O   8.459  -9.240  -4.485 1.00 . A A . 27 GLU O    1 1 
        3  3239 1 1 30 GLU OE1  O   9.519 -12.739  -6.933 1.00 . A A . 27 GLU OE1  1 1 
        3  3240 1 1 30 GLU OE2  O   8.802 -14.690  -6.191 1.00 . A A . 27 GLU OE2  1 1 
        3  3241 1 1 31 PHE C    C   8.626  -7.047  -2.078 1.00 . A A . 28 PHE C    1 1 
        3  3242 1 1 31 PHE CA   C   7.808  -8.350  -2.011 1.00 . A A . 28 PHE CA   1 1 
        3  3243 1 1 31 PHE CB   C   6.954  -8.423  -0.728 1.00 . A A . 28 PHE CB   1 1 
        3  3244 1 1 31 PHE CD1  C   4.597  -9.162  -1.279 1.00 . A A . 28 PHE CD1  1 1 
        3  3245 1 1 31 PHE CD2  C   6.078 -10.735  -0.282 1.00 . A A . 28 PHE CD2  1 1 
        3  3246 1 1 31 PHE CE1  C   3.601 -10.116  -1.299 1.00 . A A . 28 PHE CE1  1 1 
        3  3247 1 1 31 PHE CE2  C   5.082 -11.693  -0.298 1.00 . A A . 28 PHE CE2  1 1 
        3  3248 1 1 31 PHE CG   C   5.857  -9.460  -0.764 1.00 . A A . 28 PHE CG   1 1 
        3  3249 1 1 31 PHE CZ   C   3.844 -11.382  -0.808 1.00 . A A . 28 PHE CZ   1 1 
        3  3250 1 1 31 PHE H    H   8.962 -10.063  -1.493 1.00 . A A . 28 PHE H    1 1 
        3  3251 1 1 31 PHE HA   H   7.143  -8.318  -2.853 1.00 . A A . 28 PHE HA   1 1 
        3  3252 1 1 31 PHE HB2  H   7.588  -8.644   0.110 1.00 . A A . 28 PHE HB2  1 1 
        3  3253 1 1 31 PHE HB3  H   6.488  -7.459  -0.565 1.00 . A A . 28 PHE HB3  1 1 
        3  3254 1 1 31 PHE HD1  H   4.392  -8.178  -1.678 1.00 . A A . 28 PHE HD1  1 1 
        3  3255 1 1 31 PHE HD2  H   7.049 -10.978   0.117 1.00 . A A . 28 PHE HD2  1 1 
        3  3256 1 1 31 PHE HE1  H   2.630  -9.870  -1.706 1.00 . A A . 28 PHE HE1  1 1 
        3  3257 1 1 31 PHE HE2  H   5.279 -12.688   0.079 1.00 . A A . 28 PHE HE2  1 1 
        3  3258 1 1 31 PHE HZ   H   3.063 -12.128  -0.824 1.00 . A A . 28 PHE HZ   1 1 
        3  3259 1 1 31 PHE N    N   8.609  -9.547  -2.250 1.00 . A A . 28 PHE N    1 1 
        3  3260 1 1 31 PHE O    O   8.082  -6.051  -2.546 1.00 . A A . 28 PHE O    1 1 
        3  3261 1 1 32 ARG C    C  10.923  -5.463  -3.281 1.00 . A A . 29 ARG C    1 1 
        3  3262 1 1 32 ARG CA   C  10.846  -5.885  -1.821 1.00 . A A . 29 ARG CA   1 1 
        3  3263 1 1 32 ARG CB   C  12.348  -6.062  -1.326 1.00 . A A . 29 ARG CB   1 1 
        3  3264 1 1 32 ARG CD   C  14.725  -6.907  -1.873 1.00 . A A . 29 ARG CD   1 1 
        3  3265 1 1 32 ARG CG   C  13.339  -6.578  -2.389 1.00 . A A . 29 ARG CG   1 1 
        3  3266 1 1 32 ARG CZ   C  16.143  -7.052  -3.931 1.00 . A A . 29 ARG CZ   1 1 
        3  3267 1 1 32 ARG H    H  10.184  -7.780  -1.043 1.00 . A A . 29 ARG H    1 1 
        3  3268 1 1 32 ARG HA   H  10.425  -5.057  -1.267 1.00 . A A . 29 ARG HA   1 1 
        3  3269 1 1 32 ARG HB2  H  12.703  -5.092  -1.010 1.00 . A A . 29 ARG HB2  1 1 
        3  3270 1 1 32 ARG HB3  H  12.384  -6.722  -0.458 1.00 . A A . 29 ARG HB3  1 1 
        3  3271 1 1 32 ARG HD2  H  15.235  -5.990  -1.623 1.00 . A A . 29 ARG HD2  1 1 
        3  3272 1 1 32 ARG HD3  H  14.648  -7.535  -1.001 1.00 . A A . 29 ARG HD3  1 1 
        3  3273 1 1 32 ARG HE   H  15.485  -8.604  -2.842 1.00 . A A . 29 ARG HE   1 1 
        3  3274 1 1 32 ARG HG2  H  12.945  -7.459  -2.860 1.00 . A A . 29 ARG HG2  1 1 
        3  3275 1 1 32 ARG HG3  H  13.438  -5.798  -3.141 1.00 . A A . 29 ARG HG3  1 1 
        3  3276 1 1 32 ARG HH11 H  15.709  -5.143  -3.419 1.00 . A A . 29 ARG HH11 1 1 
        3  3277 1 1 32 ARG HH12 H  16.679  -5.321  -4.840 1.00 . A A . 29 ARG HH12 1 1 
        3  3278 1 1 32 ARG HH21 H  16.721  -8.809  -4.749 1.00 . A A . 29 ARG HH21 1 1 
        3  3279 1 1 32 ARG HH22 H  17.253  -7.393  -5.589 1.00 . A A . 29 ARG HH22 1 1 
        3  3280 1 1 32 ARG N    N   9.912  -7.050  -1.616 1.00 . A A . 29 ARG N    1 1 
        3  3281 1 1 32 ARG NE   N  15.479  -7.629  -2.907 1.00 . A A . 29 ARG NE   1 1 
        3  3282 1 1 32 ARG NH1  N  16.183  -5.731  -4.074 1.00 . A A . 29 ARG NH1  1 1 
        3  3283 1 1 32 ARG NH2  N  16.752  -7.811  -4.831 1.00 . A A . 29 ARG NH2  1 1 
        3  3284 1 1 32 ARG O    O  11.045  -4.252  -3.531 1.00 . A A . 29 ARG O    1 1 
        3  3285 1 1 33 LYS C    C   9.945  -5.170  -6.197 1.00 . A A . 30 LYS C    1 1 
        3  3286 1 1 33 LYS CA   C  11.108  -5.972  -5.642 1.00 . A A . 30 LYS CA   1 1 
        3  3287 1 1 33 LYS CB   C  11.605  -7.043  -6.693 1.00 . A A . 30 LYS CB   1 1 
        3  3288 1 1 33 LYS CD   C  10.086  -8.267  -8.379 1.00 . A A . 30 LYS CD   1 1 
        3  3289 1 1 33 LYS CE   C   9.170  -7.079  -8.663 1.00 . A A . 30 LYS CE   1 1 
        3  3290 1 1 33 LYS CG   C  10.697  -8.276  -6.975 1.00 . A A . 30 LYS CG   1 1 
        3  3291 1 1 33 LYS H    H  10.699  -7.385  -4.019 1.00 . A A . 30 LYS H    1 1 
        3  3292 1 1 33 LYS HA   H  11.868  -5.246  -5.514 1.00 . A A . 30 LYS HA   1 1 
        3  3293 1 1 33 LYS HB2  H  11.718  -6.524  -7.632 1.00 . A A . 30 LYS HB2  1 1 
        3  3294 1 1 33 LYS HB3  H  12.584  -7.399  -6.404 1.00 . A A . 30 LYS HB3  1 1 
        3  3295 1 1 33 LYS HD2  H  10.882  -8.262  -9.103 1.00 . A A . 30 LYS HD2  1 1 
        3  3296 1 1 33 LYS HD3  H   9.509  -9.177  -8.502 1.00 . A A . 30 LYS HD3  1 1 
        3  3297 1 1 33 LYS HE2  H   8.262  -7.158  -8.033 1.00 . A A . 30 LYS HE2  1 1 
        3  3298 1 1 33 LYS HE3  H   9.689  -6.171  -8.395 1.00 . A A . 30 LYS HE3  1 1 
        3  3299 1 1 33 LYS HG2  H  11.293  -9.184  -6.893 1.00 . A A . 30 LYS HG2  1 1 
        3  3300 1 1 33 LYS HG3  H   9.897  -8.309  -6.258 1.00 . A A . 30 LYS HG3  1 1 
        3  3301 1 1 33 LYS HZ1  H   9.643  -6.946 -10.685 1.00 . A A . 30 LYS HZ1  1 1 
        3  3302 1 1 33 LYS HZ2  H   8.183  -6.198 -10.281 1.00 . A A . 30 LYS HZ2  1 1 
        3  3303 1 1 33 LYS HZ3  H   8.273  -7.888 -10.364 1.00 . A A . 30 LYS HZ3  1 1 
        3  3304 1 1 33 LYS N    N  10.876  -6.429  -4.257 1.00 . A A . 30 LYS N    1 1 
        3  3305 1 1 33 LYS NZ   N   8.787  -7.023 -10.095 1.00 . A A . 30 LYS NZ   1 1 
        3  3306 1 1 33 LYS O    O  10.141  -4.271  -7.018 1.00 . A A . 30 LYS O    1 1 
        3  3307 1 1 34 TYR C    C   7.379  -3.443  -5.358 1.00 . A A . 31 TYR C    1 1 
        3  3308 1 1 34 TYR CA   C   7.583  -4.757  -6.172 1.00 . A A . 31 TYR CA   1 1 
        3  3309 1 1 34 TYR CB   C   6.345  -5.653  -5.988 1.00 . A A . 31 TYR CB   1 1 
        3  3310 1 1 34 TYR CD1  C   5.658  -6.575  -8.307 1.00 . A A . 31 TYR CD1  1 1 
        3  3311 1 1 34 TYR CD2  C   6.332  -8.135  -6.607 1.00 . A A . 31 TYR CD2  1 1 
        3  3312 1 1 34 TYR CE1  C   5.461  -7.632  -9.191 1.00 . A A . 31 TYR CE1  1 1 
        3  3313 1 1 34 TYR CE2  C   6.147  -9.192  -7.508 1.00 . A A . 31 TYR CE2  1 1 
        3  3314 1 1 34 TYR CG   C   6.102  -6.801  -6.991 1.00 . A A . 31 TYR CG   1 1 
        3  3315 1 1 34 TYR CZ   C   5.715  -8.928  -8.788 1.00 . A A . 31 TYR CZ   1 1 
        3  3316 1 1 34 TYR H    H   8.683  -6.233  -5.161 1.00 . A A . 31 TYR H    1 1 
        3  3317 1 1 34 TYR HA   H   7.712  -4.508  -7.219 1.00 . A A . 31 TYR HA   1 1 
        3  3318 1 1 34 TYR HB2  H   6.438  -6.118  -5.028 1.00 . A A . 31 TYR HB2  1 1 
        3  3319 1 1 34 TYR HB3  H   5.481  -5.019  -5.953 1.00 . A A . 31 TYR HB3  1 1 
        3  3320 1 1 34 TYR HD1  H   5.435  -5.569  -8.641 1.00 . A A . 31 TYR HD1  1 1 
        3  3321 1 1 34 TYR HD2  H   6.653  -8.347  -5.583 1.00 . A A . 31 TYR HD2  1 1 
        3  3322 1 1 34 TYR HE1  H   5.111  -7.436 -10.200 1.00 . A A . 31 TYR HE1  1 1 
        3  3323 1 1 34 TYR HE2  H   6.321 -10.231  -7.195 1.00 . A A . 31 TYR HE2  1 1 
        3  3324 1 1 34 TYR HH   H   5.107 -10.709  -9.246 1.00 . A A . 31 TYR HH   1 1 
        3  3325 1 1 34 TYR N    N   8.760  -5.484  -5.749 1.00 . A A . 31 TYR N    1 1 
        3  3326 1 1 34 TYR O    O   7.200  -2.395  -5.954 1.00 . A A . 31 TYR O    1 1 
        3  3327 1 1 34 TYR OH   O   5.545  -9.955  -9.680 1.00 . A A . 31 TYR OH   1 1 
        3  3328 1 1 35 GLY C    C   8.369  -2.448  -1.963 1.00 . A A . 32 GLY C    1 1 
        3  3329 1 1 35 GLY CA   C   7.555  -2.269  -3.223 1.00 . A A . 32 GLY CA   1 1 
        3  3330 1 1 35 GLY H    H   7.461  -4.348  -3.555 1.00 . A A . 32 GLY H    1 1 
        3  3331 1 1 35 GLY HA2  H   8.021  -1.505  -3.812 1.00 . A A . 32 GLY HA2  1 1 
        3  3332 1 1 35 GLY HA3  H   6.551  -1.965  -2.966 1.00 . A A . 32 GLY HA3  1 1 
        3  3333 1 1 35 GLY N    N   7.499  -3.488  -4.021 1.00 . A A . 32 GLY N    1 1 
        3  3334 1 1 35 GLY O    O   8.308  -3.510  -1.345 1.00 . A A . 32 GLY O    1 1 
        3  3335 1 1 36 ASN C    C   9.643  -1.916   0.842 1.00 . A A . 33 ASN C    1 1 
        3  3336 1 1 36 ASN CA   C  10.170  -1.500  -0.544 1.00 . A A . 33 ASN CA   1 1 
        3  3337 1 1 36 ASN CB   C  10.995  -0.195  -0.421 1.00 . A A . 33 ASN CB   1 1 
        3  3338 1 1 36 ASN CG   C  11.637   0.210  -1.741 1.00 . A A . 33 ASN CG   1 1 
        3  3339 1 1 36 ASN H    H   8.927  -0.515  -1.983 1.00 . A A . 33 ASN H    1 1 
        3  3340 1 1 36 ASN HA   H  10.841  -2.261  -0.902 1.00 . A A . 33 ASN HA   1 1 
        3  3341 1 1 36 ASN HB2  H  10.377   0.615  -0.079 1.00 . A A . 33 ASN HB2  1 1 
        3  3342 1 1 36 ASN HB3  H  11.780  -0.345   0.303 1.00 . A A . 33 ASN HB3  1 1 
        3  3343 1 1 36 ASN HD21 H  13.242  -0.903  -1.364 1.00 . A A . 33 ASN HD21 1 1 
        3  3344 1 1 36 ASN HD22 H  13.250  -0.055  -2.868 1.00 . A A . 33 ASN HD22 1 1 
        3  3345 1 1 36 ASN N    N   9.105  -1.393  -1.569 1.00 . A A . 33 ASN N    1 1 
        3  3346 1 1 36 ASN ND2  N  12.832  -0.301  -2.015 1.00 . A A . 33 ASN ND2  1 1 
        3  3347 1 1 36 ASN O    O   8.822  -1.213   1.442 1.00 . A A . 33 ASN O    1 1 
        3  3348 1 1 36 ASN OD1  O  11.056   0.966  -2.516 1.00 . A A . 33 ASN OD1  1 1 
        3  3349 1 1 37 ILE C    C  10.530  -2.726   3.782 1.00 . A A . 34 ILE C    1 1 
        3  3350 1 1 37 ILE CA   C   9.808  -3.577   2.694 1.00 . A A . 34 ILE CA   1 1 
        3  3351 1 1 37 ILE CB   C  10.088  -5.159   2.908 1.00 . A A . 34 ILE CB   1 1 
        3  3352 1 1 37 ILE CD1  C  12.295  -5.406   4.394 1.00 . A A . 34 ILE CD1  1 1 
        3  3353 1 1 37 ILE CG1  C  10.760  -5.567   4.277 1.00 . A A . 34 ILE CG1  1 1 
        3  3354 1 1 37 ILE CG2  C  10.877  -5.759   1.767 1.00 . A A . 34 ILE CG2  1 1 
        3  3355 1 1 37 ILE H    H  10.589  -3.664   0.683 1.00 . A A . 34 ILE H    1 1 
        3  3356 1 1 37 ILE HA   H   8.753  -3.432   2.785 1.00 . A A . 34 ILE HA   1 1 
        3  3357 1 1 37 ILE HB   H   9.111  -5.642   2.877 1.00 . A A . 34 ILE HB   1 1 
        3  3358 1 1 37 ILE HD11 H  12.792  -5.960   3.621 1.00 . A A . 34 ILE HD11 1 1 
        3  3359 1 1 37 ILE HD12 H  12.625  -5.761   5.350 1.00 . A A . 34 ILE HD12 1 1 
        3  3360 1 1 37 ILE HD13 H  12.555  -4.362   4.307 1.00 . A A . 34 ILE HD13 1 1 
        3  3361 1 1 37 ILE HG12 H  10.325  -4.963   5.058 1.00 . A A . 34 ILE HG12 1 1 
        3  3362 1 1 37 ILE HG13 H  10.529  -6.604   4.478 1.00 . A A . 34 ILE HG13 1 1 
        3  3363 1 1 37 ILE HG21 H  11.789  -5.197   1.633 1.00 . A A . 34 ILE HG21 1 1 
        3  3364 1 1 37 ILE HG22 H  10.290  -5.719   0.867 1.00 . A A . 34 ILE HG22 1 1 
        3  3365 1 1 37 ILE HG23 H  11.117  -6.788   1.996 1.00 . A A . 34 ILE HG23 1 1 
        3  3366 1 1 37 ILE N    N  10.116  -3.082   1.316 1.00 . A A . 34 ILE N    1 1 
        3  3367 1 1 37 ILE O    O  11.672  -2.292   3.567 1.00 . A A . 34 ILE O    1 1 
        3  3368 1 1 38 LEU C    C  10.912  -2.818   7.201 1.00 . A A . 35 LEU C    1 1 
        3  3369 1 1 38 LEU CA   C  10.589  -1.815   6.061 1.00 . A A . 35 LEU CA   1 1 
        3  3370 1 1 38 LEU CB   C   9.897  -0.521   6.578 1.00 . A A . 35 LEU CB   1 1 
        3  3371 1 1 38 LEU CD1  C  10.487   0.916   4.535 1.00 . A A . 35 LEU CD1  1 1 
        3  3372 1 1 38 LEU CD2  C   9.823   2.007   6.663 1.00 . A A . 35 LEU CD2  1 1 
        3  3373 1 1 38 LEU CG   C  10.519   0.803   6.056 1.00 . A A . 35 LEU CG   1 1 
        3  3374 1 1 38 LEU H    H   8.892  -2.639   5.015 1.00 . A A . 35 LEU H    1 1 
        3  3375 1 1 38 LEU HA   H  11.547  -1.515   5.650 1.00 . A A . 35 LEU HA   1 1 
        3  3376 1 1 38 LEU HB2  H   8.851  -0.537   6.299 1.00 . A A . 35 LEU HB2  1 1 
        3  3377 1 1 38 LEU HB3  H   9.961  -0.511   7.660 1.00 . A A . 35 LEU HB3  1 1 
        3  3378 1 1 38 LEU HD11 H   9.470   0.832   4.190 1.00 . A A . 35 LEU HD11 1 1 
        3  3379 1 1 38 LEU HD12 H  11.086   0.128   4.097 1.00 . A A . 35 LEU HD12 1 1 
        3  3380 1 1 38 LEU HD13 H  10.887   1.875   4.240 1.00 . A A . 35 LEU HD13 1 1 
        3  3381 1 1 38 LEU HD21 H   8.782   2.000   6.391 1.00 . A A . 35 LEU HD21 1 1 
        3  3382 1 1 38 LEU HD22 H  10.285   2.909   6.289 1.00 . A A . 35 LEU HD22 1 1 
        3  3383 1 1 38 LEU HD23 H   9.914   1.974   7.737 1.00 . A A . 35 LEU HD23 1 1 
        3  3384 1 1 38 LEU HG   H  11.554   0.841   6.361 1.00 . A A . 35 LEU HG   1 1 
        3  3385 1 1 38 LEU N    N   9.863  -2.441   4.930 1.00 . A A . 35 LEU N    1 1 
        3  3386 1 1 38 LEU O    O  11.871  -2.614   7.950 1.00 . A A . 35 LEU O    1 1 
        3  3387 1 1 39 LYS C    C   9.678  -6.254   7.890 1.00 . A A . 36 LYS C    1 1 
        3  3388 1 1 39 LYS CA   C  10.247  -4.905   8.393 1.00 . A A . 36 LYS CA   1 1 
        3  3389 1 1 39 LYS CB   C   9.450  -4.386   9.621 1.00 . A A . 36 LYS CB   1 1 
        3  3390 1 1 39 LYS CD   C   8.615  -6.301  11.101 1.00 . A A . 36 LYS CD   1 1 
        3  3391 1 1 39 LYS CE   C   8.117  -6.431  12.529 1.00 . A A . 36 LYS CE   1 1 
        3  3392 1 1 39 LYS CG   C   9.614  -5.152  10.946 1.00 . A A . 36 LYS CG   1 1 
        3  3393 1 1 39 LYS H    H   9.451  -4.062   6.611 1.00 . A A . 36 LYS H    1 1 
        3  3394 1 1 39 LYS HA   H  11.285  -5.009   8.658 1.00 . A A . 36 LYS HA   1 1 
        3  3395 1 1 39 LYS HB2  H   9.744  -3.363   9.800 1.00 . A A . 36 LYS HB2  1 1 
        3  3396 1 1 39 LYS HB3  H   8.403  -4.394   9.364 1.00 . A A . 36 LYS HB3  1 1 
        3  3397 1 1 39 LYS HD2  H   7.767  -6.123  10.460 1.00 . A A . 36 LYS HD2  1 1 
        3  3398 1 1 39 LYS HD3  H   9.099  -7.223  10.818 1.00 . A A . 36 LYS HD3  1 1 
        3  3399 1 1 39 LYS HE2  H   7.513  -7.326  12.617 1.00 . A A . 36 LYS HE2  1 1 
        3  3400 1 1 39 LYS HE3  H   8.969  -6.505  13.194 1.00 . A A . 36 LYS HE3  1 1 
        3  3401 1 1 39 LYS HG2  H  10.612  -5.559  10.995 1.00 . A A . 36 LYS HG2  1 1 
        3  3402 1 1 39 LYS HG3  H   9.475  -4.462  11.765 1.00 . A A . 36 LYS HG3  1 1 
        3  3403 1 1 39 LYS HZ1  H   6.540  -5.100  12.230 1.00 . A A . 36 LYS HZ1  1 1 
        3  3404 1 1 39 LYS HZ2  H   7.892  -4.407  12.970 1.00 . A A . 36 LYS HZ2  1 1 
        3  3405 1 1 39 LYS HZ3  H   6.878  -5.422  13.853 1.00 . A A . 36 LYS HZ3  1 1 
        3  3406 1 1 39 LYS N    N  10.127  -3.906   7.306 1.00 . A A . 36 LYS N    1 1 
        3  3407 1 1 39 LYS NZ   N   7.301  -5.260  12.923 1.00 . A A . 36 LYS NZ   1 1 
        3  3408 1 1 39 LYS O    O   8.647  -6.246   7.244 1.00 . A A . 36 LYS O    1 1 
        3  3409 1 1 40 CYS C    C  10.146  -9.771   8.741 1.00 . A A . 37 CYS C    1 1 
        3  3410 1 1 40 CYS CA   C   9.753  -8.714   7.753 1.00 . A A . 37 CYS CA   1 1 
        3  3411 1 1 40 CYS CB   C  10.025  -9.186   6.298 1.00 . A A . 37 CYS CB   1 1 
        3  3412 1 1 40 CYS H    H  11.183  -7.398   8.677 1.00 . A A . 37 CYS H    1 1 
        3  3413 1 1 40 CYS HA   H   8.685  -8.600   7.864 1.00 . A A . 37 CYS HA   1 1 
        3  3414 1 1 40 CYS HB2  H   9.646  -8.444   5.619 1.00 . A A . 37 CYS HB2  1 1 
        3  3415 1 1 40 CYS HB3  H  11.085  -9.341   6.120 1.00 . A A . 37 CYS HB3  1 1 
        3  3416 1 1 40 CYS HG   H   7.938 -10.650   6.350 1.00 . A A . 37 CYS HG   1 1 
        3  3417 1 1 40 CYS N    N  10.348  -7.406   8.130 1.00 . A A . 37 CYS N    1 1 
        3  3418 1 1 40 CYS O    O  11.330 -10.100   8.881 1.00 . A A . 37 CYS O    1 1 
        3  3419 1 1 40 CYS SG   S   9.186 -10.728   5.891 1.00 . A A . 37 CYS SG   1 1 
        3  3420 1 1 41 ASP C    C   8.582 -12.547  10.351 1.00 . A A . 38 ASP C    1 1 
        3  3421 1 1 41 ASP CA   C   9.449 -11.266  10.493 1.00 . A A . 38 ASP CA   1 1 
        3  3422 1 1 41 ASP CB   C   9.338 -10.609  11.892 1.00 . A A . 38 ASP CB   1 1 
        3  3423 1 1 41 ASP CG   C   7.942 -10.620  12.501 1.00 . A A . 38 ASP CG   1 1 
        3  3424 1 1 41 ASP H    H   8.218  -9.988   9.270 1.00 . A A . 38 ASP H    1 1 
        3  3425 1 1 41 ASP HA   H  10.489 -11.555  10.346 1.00 . A A . 38 ASP HA   1 1 
        3  3426 1 1 41 ASP HB2  H   9.994 -11.110  12.549 1.00 . A A . 38 ASP HB2  1 1 
        3  3427 1 1 41 ASP HB3  H   9.669  -9.581  11.824 1.00 . A A . 38 ASP HB3  1 1 
        3  3428 1 1 41 ASP N    N   9.156 -10.288   9.444 1.00 . A A . 38 ASP N    1 1 
        3  3429 1 1 41 ASP O    O   7.498 -12.500   9.797 1.00 . A A . 38 ASP O    1 1 
        3  3430 1 1 41 ASP OD1  O   7.164  -9.680  12.243 1.00 . A A . 38 ASP OD1  1 1 
        3  3431 1 1 41 ASP OD2  O   7.633 -11.559  13.257 1.00 . A A . 38 ASP OD2  1 1 
        3  3432 1 1 42 VAL C    C   8.066 -15.576  12.083 1.00 . A A . 39 VAL C    1 1 
        3  3433 1 1 42 VAL CA   C   8.386 -14.992  10.667 1.00 . A A . 39 VAL CA   1 1 
        3  3434 1 1 42 VAL CB   C   9.139 -16.011   9.644 1.00 . A A . 39 VAL CB   1 1 
        3  3435 1 1 42 VAL CG1  C  10.646 -15.937   9.782 1.00 . A A . 39 VAL CG1  1 1 
        3  3436 1 1 42 VAL CG2  C   8.795 -17.521   9.730 1.00 . A A . 39 VAL CG2  1 1 
        3  3437 1 1 42 VAL H    H   9.949 -13.678  11.240 1.00 . A A . 39 VAL H    1 1 
        3  3438 1 1 42 VAL HA   H   7.439 -14.710  10.234 1.00 . A A . 39 VAL HA   1 1 
        3  3439 1 1 42 VAL HB   H   8.903 -15.683   8.630 1.00 . A A . 39 VAL HB   1 1 
        3  3440 1 1 42 VAL HG11 H  11.086 -16.779   9.267 1.00 . A A . 39 VAL HG11 1 1 
        3  3441 1 1 42 VAL HG12 H  10.918 -15.978  10.825 1.00 . A A . 39 VAL HG12 1 1 
        3  3442 1 1 42 VAL HG13 H  11.005 -15.026   9.338 1.00 . A A . 39 VAL HG13 1 1 
        3  3443 1 1 42 VAL HG21 H   9.309 -18.038   8.920 1.00 . A A . 39 VAL HG21 1 1 
        3  3444 1 1 42 VAL HG22 H   7.742 -17.707   9.635 1.00 . A A . 39 VAL HG22 1 1 
        3  3445 1 1 42 VAL HG23 H   9.153 -17.920  10.657 1.00 . A A . 39 VAL HG23 1 1 
        3  3446 1 1 42 VAL N    N   9.104 -13.702  10.786 1.00 . A A . 39 VAL N    1 1 
        3  3447 1 1 42 VAL O    O   8.968 -15.870  12.880 1.00 . A A . 39 VAL O    1 1 
        3  3448 1 1 43 LYS C    C   5.608 -17.489  13.631 1.00 . A A . 40 LYS C    1 1 
        3  3449 1 1 43 LYS CA   C   6.176 -16.033  13.709 1.00 . A A . 40 LYS CA   1 1 
        3  3450 1 1 43 LYS CB   C   5.022 -15.012  13.996 1.00 . A A . 40 LYS CB   1 1 
        3  3451 1 1 43 LYS CD   C   4.393 -12.544  14.252 1.00 . A A . 40 LYS CD   1 1 
        3  3452 1 1 43 LYS CE   C   4.428 -11.313  15.162 1.00 . A A . 40 LYS CE   1 1 
        3  3453 1 1 43 LYS CG   C   5.416 -13.665  14.640 1.00 . A A . 40 LYS CG   1 1 
        3  3454 1 1 43 LYS H    H   6.100 -15.592  11.637 1.00 . A A . 40 LYS H    1 1 
        3  3455 1 1 43 LYS HA   H   6.945 -15.950  14.464 1.00 . A A . 40 LYS HA   1 1 
        3  3456 1 1 43 LYS HB2  H   4.535 -14.800  13.053 1.00 . A A . 40 LYS HB2  1 1 
        3  3457 1 1 43 LYS HB3  H   4.298 -15.467  14.652 1.00 . A A . 40 LYS HB3  1 1 
        3  3458 1 1 43 LYS HD2  H   4.600 -12.200  13.244 1.00 . A A . 40 LYS HD2  1 1 
        3  3459 1 1 43 LYS HD3  H   3.386 -12.956  14.281 1.00 . A A . 40 LYS HD3  1 1 
        3  3460 1 1 43 LYS HE2  H   3.736 -10.583  14.765 1.00 . A A . 40 LYS HE2  1 1 
        3  3461 1 1 43 LYS HE3  H   4.106 -11.595  16.157 1.00 . A A . 40 LYS HE3  1 1 
        3  3462 1 1 43 LYS HG2  H   5.405 -13.797  15.718 1.00 . A A . 40 LYS HG2  1 1 
        3  3463 1 1 43 LYS HG3  H   6.426 -13.383  14.341 1.00 . A A . 40 LYS HG3  1 1 
        3  3464 1 1 43 LYS HZ1  H   6.407 -11.277  15.804 1.00 . A A . 40 LYS HZ1  1 1 
        3  3465 1 1 43 LYS HZ2  H   5.701  -9.745  15.674 1.00 . A A . 40 LYS HZ2  1 1 
        3  3466 1 1 43 LYS HZ3  H   6.169 -10.589  14.278 1.00 . A A . 40 LYS HZ3  1 1 
        3  3467 1 1 43 LYS N    N   6.744 -15.695  12.375 1.00 . A A . 40 LYS N    1 1 
        3  3468 1 1 43 LYS NZ   N   5.768 -10.686  15.240 1.00 . A A . 40 LYS NZ   1 1 
        3  3469 1 1 43 LYS O    O   5.056 -17.835  12.589 1.00 . A A . 40 LYS O    1 1 
        3  3470 1 1 44 LYS C    C   4.260 -20.136  15.675 1.00 . A A . 41 LYS C    1 1 
        3  3471 1 1 44 LYS CA   C   5.200 -19.754  14.477 1.00 . A A . 41 LYS CA   1 1 
        3  3472 1 1 44 LYS CB   C   6.387 -20.803  14.196 1.00 . A A . 41 LYS CB   1 1 
        3  3473 1 1 44 LYS CD   C   7.501 -20.673  16.513 1.00 . A A . 41 LYS CD   1 1 
        3  3474 1 1 44 LYS CE   C   8.586 -19.703  16.074 1.00 . A A . 41 LYS CE   1 1 
        3  3475 1 1 44 LYS CG   C   6.992 -21.576  15.393 1.00 . A A . 41 LYS CG   1 1 
        3  3476 1 1 44 LYS H    H   6.048 -18.091  15.572 1.00 . A A . 41 LYS H    1 1 
        3  3477 1 1 44 LYS HA   H   4.596 -19.687  13.590 1.00 . A A . 41 LYS HA   1 1 
        3  3478 1 1 44 LYS HB2  H   6.028 -21.546  13.503 1.00 . A A . 41 LYS HB2  1 1 
        3  3479 1 1 44 LYS HB3  H   7.211 -20.293  13.701 1.00 . A A . 41 LYS HB3  1 1 
        3  3480 1 1 44 LYS HD2  H   6.653 -20.096  16.859 1.00 . A A . 41 LYS HD2  1 1 
        3  3481 1 1 44 LYS HD3  H   7.870 -21.287  17.317 1.00 . A A . 41 LYS HD3  1 1 
        3  3482 1 1 44 LYS HE2  H   9.093 -20.110  15.223 1.00 . A A . 41 LYS HE2  1 1 
        3  3483 1 1 44 LYS HE3  H   8.107 -18.758  15.809 1.00 . A A . 41 LYS HE3  1 1 
        3  3484 1 1 44 LYS HG2  H   6.241 -22.238  15.803 1.00 . A A . 41 LYS HG2  1 1 
        3  3485 1 1 44 LYS HG3  H   7.821 -22.176  15.035 1.00 . A A . 41 LYS HG3  1 1 
        3  3486 1 1 44 LYS HZ1  H  10.327 -18.812  16.802 1.00 . A A . 41 LYS HZ1  1 1 
        3  3487 1 1 44 LYS HZ2  H  10.010 -20.337  17.460 1.00 . A A . 41 LYS HZ2  1 1 
        3  3488 1 1 44 LYS HZ3  H   9.116 -18.996  17.967 1.00 . A A . 41 LYS HZ3  1 1 
        3  3489 1 1 44 LYS N    N   5.715 -18.372  14.669 1.00 . A A . 41 LYS N    1 1 
        3  3490 1 1 44 LYS NZ   N   9.576 -19.444  17.151 1.00 . A A . 41 LYS NZ   1 1 
        3  3491 1 1 44 LYS O    O   4.516 -19.679  16.794 1.00 . A A . 41 LYS O    1 1 
        3  3492 1 1 45 THR C    C   2.605 -22.765  17.055 1.00 . A A . 42 THR C    1 1 
        3  3493 1 1 45 THR CA   C   2.319 -21.284  16.628 1.00 . A A . 42 THR CA   1 1 
        3  3494 1 1 45 THR CB   C   0.780 -21.028  16.398 1.00 . A A . 42 THR CB   1 1 
        3  3495 1 1 45 THR CG2  C   0.097 -22.051  15.475 1.00 . A A . 42 THR CG2  1 1 
        3  3496 1 1 45 THR H    H   2.847 -21.141  14.579 1.00 . A A . 42 THR H    1 1 
        3  3497 1 1 45 THR HA   H   2.648 -20.625  17.429 1.00 . A A . 42 THR HA   1 1 
        3  3498 1 1 45 THR HB   H   0.664 -20.053  15.959 1.00 . A A . 42 THR HB   1 1 
        3  3499 1 1 45 THR HG1  H  -0.692 -20.469  17.595 1.00 . A A . 42 THR HG1  1 1 
        3  3500 1 1 45 THR HG21 H   0.577 -23.008  15.585 1.00 . A A . 42 THR HG21 1 1 
        3  3501 1 1 45 THR HG22 H   0.149 -21.734  14.444 1.00 . A A . 42 THR HG22 1 1 
        3  3502 1 1 45 THR HG23 H  -0.941 -22.140  15.761 1.00 . A A . 42 THR HG23 1 1 
        3  3503 1 1 45 THR N    N   3.137 -20.887  15.475 1.00 . A A . 42 THR N    1 1 
        3  3504 1 1 45 THR O    O   3.401 -23.444  16.397 1.00 . A A . 42 THR O    1 1 
        3  3505 1 1 45 THR OG1  O   0.088 -21.033  17.652 1.00 . A A . 42 THR OG1  1 1 
        3  3506 1 1 46 VAL C    C   1.468 -25.732  17.895 1.00 . A A . 43 VAL C    1 1 
        3  3507 1 1 46 VAL CA   C   2.187 -24.614  18.719 1.00 . A A . 43 VAL CA   1 1 
        3  3508 1 1 46 VAL CB   C   1.769 -24.714  20.250 1.00 . A A . 43 VAL CB   1 1 
        3  3509 1 1 46 VAL CG1  C   2.595 -25.773  20.975 1.00 . A A . 43 VAL CG1  1 1 
        3  3510 1 1 46 VAL CG2  C   1.883 -23.371  21.000 1.00 . A A . 43 VAL CG2  1 1 
        3  3511 1 1 46 VAL H    H   1.300 -22.683  18.623 1.00 . A A . 43 VAL H    1 1 
        3  3512 1 1 46 VAL HA   H   3.253 -24.811  18.654 1.00 . A A . 43 VAL HA   1 1 
        3  3513 1 1 46 VAL HB   H   0.735 -25.037  20.306 1.00 . A A . 43 VAL HB   1 1 
        3  3514 1 1 46 VAL HG11 H   2.298 -25.813  22.015 1.00 . A A . 43 VAL HG11 1 1 
        3  3515 1 1 46 VAL HG12 H   3.641 -25.517  20.909 1.00 . A A . 43 VAL HG12 1 1 
        3  3516 1 1 46 VAL HG13 H   2.430 -26.735  20.516 1.00 . A A . 43 VAL HG13 1 1 
        3  3517 1 1 46 VAL HG21 H   1.612 -23.517  22.037 1.00 . A A . 43 VAL HG21 1 1 
        3  3518 1 1 46 VAL HG22 H   1.215 -22.645  20.560 1.00 . A A . 43 VAL HG22 1 1 
        3  3519 1 1 46 VAL HG23 H   2.898 -23.004  20.947 1.00 . A A . 43 VAL HG23 1 1 
        3  3520 1 1 46 VAL N    N   1.959 -23.256  18.163 1.00 . A A . 43 VAL N    1 1 
        3  3521 1 1 46 VAL O    O   1.737 -26.920  18.087 1.00 . A A . 43 VAL O    1 1 
        3  3522 1 1 47 SER C    C   0.480 -26.799  14.918 1.00 . A A . 44 SER C    1 1 
        3  3523 1 1 47 SER CA   C  -0.235 -26.318  16.202 1.00 . A A . 44 SER CA   1 1 
        3  3524 1 1 47 SER CB   C  -1.611 -25.683  15.856 1.00 . A A . 44 SER CB   1 1 
        3  3525 1 1 47 SER H    H   0.543 -24.415  16.694 1.00 . A A . 44 SER H    1 1 
        3  3526 1 1 47 SER HA   H  -0.388 -27.178  16.845 1.00 . A A . 44 SER HA   1 1 
        3  3527 1 1 47 SER HB2  H  -2.024 -25.180  16.723 1.00 . A A . 44 SER HB2  1 1 
        3  3528 1 1 47 SER HB3  H  -1.483 -24.961  15.056 1.00 . A A . 44 SER HB3  1 1 
        3  3529 1 1 47 SER HG   H  -2.086 -27.315  14.877 1.00 . A A . 44 SER HG   1 1 
        3  3530 1 1 47 SER N    N   0.597 -25.351  16.940 1.00 . A A . 44 SER N    1 1 
        3  3531 1 1 47 SER O    O  -0.078 -27.584  14.142 1.00 . A A . 44 SER O    1 1 
        3  3532 1 1 47 SER OG   O  -2.544 -26.662  15.422 1.00 . A A . 44 SER OG   1 1 
        3  3533 1 1 48 GLY C    C   2.212 -25.916  12.258 1.00 . A A . 45 GLY C    1 1 
        3  3534 1 1 48 GLY CA   C   2.508 -26.713  13.538 1.00 . A A . 45 GLY CA   1 1 
        3  3535 1 1 48 GLY H    H   2.127 -25.744  15.399 1.00 . A A . 45 GLY H    1 1 
        3  3536 1 1 48 GLY HA2  H   3.554 -26.584  13.780 1.00 . A A . 45 GLY HA2  1 1 
        3  3537 1 1 48 GLY HA3  H   2.337 -27.763  13.339 1.00 . A A . 45 GLY HA3  1 1 
        3  3538 1 1 48 GLY N    N   1.717 -26.327  14.710 1.00 . A A . 45 GLY N    1 1 
        3  3539 1 1 48 GLY O    O   2.919 -26.080  11.265 1.00 . A A . 45 GLY O    1 1 
        3  3540 1 1 49 ALA C    C   1.958 -22.888  11.443 1.00 . A A . 46 ALA C    1 1 
        3  3541 1 1 49 ALA CA   C   0.987 -24.071  11.209 1.00 . A A . 46 ALA CA   1 1 
        3  3542 1 1 49 ALA CB   C  -0.491 -23.615  11.104 1.00 . A A . 46 ALA CB   1 1 
        3  3543 1 1 49 ALA H    H   0.523 -25.138  12.988 1.00 . A A . 46 ALA H    1 1 
        3  3544 1 1 49 ALA HA   H   1.246 -24.565  10.280 1.00 . A A . 46 ALA HA   1 1 
        3  3545 1 1 49 ALA HB1  H  -1.124 -24.477  10.934 1.00 . A A . 46 ALA HB1  1 1 
        3  3546 1 1 49 ALA HB2  H  -0.607 -22.935  10.270 1.00 . A A . 46 ALA HB2  1 1 
        3  3547 1 1 49 ALA HB3  H  -0.803 -23.114  12.012 1.00 . A A . 46 ALA HB3  1 1 
        3  3548 1 1 49 ALA N    N   1.179 -25.062  12.276 1.00 . A A . 46 ALA N    1 1 
        3  3549 1 1 49 ALA O    O   2.083 -22.395  12.572 1.00 . A A . 46 ALA O    1 1 
        3  3550 1 1 50 ALA C    C   3.316 -20.206   9.700 1.00 . A A . 47 ALA C    1 1 
        3  3551 1 1 50 ALA CA   C   3.724 -21.449  10.515 1.00 . A A . 47 ALA CA   1 1 
        3  3552 1 1 50 ALA CB   C   5.081 -22.040  10.080 1.00 . A A . 47 ALA CB   1 1 
        3  3553 1 1 50 ALA H    H   2.444 -22.798   9.500 1.00 . A A . 47 ALA H    1 1 
        3  3554 1 1 50 ALA HA   H   3.804 -21.182  11.556 1.00 . A A . 47 ALA HA   1 1 
        3  3555 1 1 50 ALA HB1  H   5.883 -21.415  10.428 1.00 . A A . 47 ALA HB1  1 1 
        3  3556 1 1 50 ALA HB2  H   5.133 -22.110   9.005 1.00 . A A . 47 ALA HB2  1 1 
        3  3557 1 1 50 ALA HB3  H   5.199 -23.029  10.508 1.00 . A A . 47 ALA HB3  1 1 
        3  3558 1 1 50 ALA N    N   2.667 -22.462  10.392 1.00 . A A . 47 ALA N    1 1 
        3  3559 1 1 50 ALA O    O   2.672 -20.358   8.656 1.00 . A A . 47 ALA O    1 1 
        3  3560 1 1 51 PHE C    C   4.224 -16.782   9.177 1.00 . A A . 48 PHE C    1 1 
        3  3561 1 1 51 PHE CA   C   3.106 -17.760   9.560 1.00 . A A . 48 PHE CA   1 1 
        3  3562 1 1 51 PHE CB   C   2.213 -17.055  10.605 1.00 . A A . 48 PHE CB   1 1 
        3  3563 1 1 51 PHE CD1  C  -0.007 -18.164  10.589 1.00 . A A . 48 PHE CD1  1 1 
        3  3564 1 1 51 PHE CD2  C   1.482 -18.619  12.383 1.00 . A A . 48 PHE CD2  1 1 
        3  3565 1 1 51 PHE CE1  C  -0.930 -19.017  11.135 1.00 . A A . 48 PHE CE1  1 1 
        3  3566 1 1 51 PHE CE2  C   0.578 -19.461  12.929 1.00 . A A . 48 PHE CE2  1 1 
        3  3567 1 1 51 PHE CG   C   1.201 -17.957  11.210 1.00 . A A . 48 PHE CG   1 1 
        3  3568 1 1 51 PHE CZ   C  -0.639 -19.675  12.313 1.00 . A A . 48 PHE CZ   1 1 
        3  3569 1 1 51 PHE H    H   4.210 -18.891  10.979 1.00 . A A . 48 PHE H    1 1 
        3  3570 1 1 51 PHE HA   H   2.501 -18.035   8.713 1.00 . A A . 48 PHE HA   1 1 
        3  3571 1 1 51 PHE HB2  H   2.832 -16.674  11.411 1.00 . A A . 48 PHE HB2  1 1 
        3  3572 1 1 51 PHE HB3  H   1.690 -16.231  10.142 1.00 . A A . 48 PHE HB3  1 1 
        3  3573 1 1 51 PHE HD1  H  -0.229 -17.639   9.671 1.00 . A A . 48 PHE HD1  1 1 
        3  3574 1 1 51 PHE HD2  H   2.440 -18.477  12.869 1.00 . A A . 48 PHE HD2  1 1 
        3  3575 1 1 51 PHE HE1  H  -1.868 -19.170  10.639 1.00 . A A . 48 PHE HE1  1 1 
        3  3576 1 1 51 PHE HE2  H   0.827 -19.960  13.830 1.00 . A A . 48 PHE HE2  1 1 
        3  3577 1 1 51 PHE HZ   H  -1.356 -20.351  12.750 1.00 . A A . 48 PHE HZ   1 1 
        3  3578 1 1 51 PHE N    N   3.667 -18.984  10.156 1.00 . A A . 48 PHE N    1 1 
        3  3579 1 1 51 PHE O    O   5.285 -16.778   9.806 1.00 . A A . 48 PHE O    1 1 
        3  3580 1 1 52 ALA C    C   4.334 -13.566   7.611 1.00 . A A . 49 ALA C    1 1 
        3  3581 1 1 52 ALA CA   C   4.976 -14.940   7.766 1.00 . A A . 49 ALA CA   1 1 
        3  3582 1 1 52 ALA CB   C   5.891 -15.385   6.592 1.00 . A A . 49 ALA CB   1 1 
        3  3583 1 1 52 ALA H    H   3.157 -16.048   7.625 1.00 . A A . 49 ALA H    1 1 
        3  3584 1 1 52 ALA HA   H   5.590 -14.831   8.602 1.00 . A A . 49 ALA HA   1 1 
        3  3585 1 1 52 ALA HB1  H   5.947 -16.461   6.557 1.00 . A A . 49 ALA HB1  1 1 
        3  3586 1 1 52 ALA HB2  H   6.904 -15.010   6.749 1.00 . A A . 49 ALA HB2  1 1 
        3  3587 1 1 52 ALA HB3  H   5.502 -15.026   5.655 1.00 . A A . 49 ALA HB3  1 1 
        3  3588 1 1 52 ALA N    N   3.998 -15.965   8.137 1.00 . A A . 49 ALA N    1 1 
        3  3589 1 1 52 ALA O    O   3.168 -13.441   7.228 1.00 . A A . 49 ALA O    1 1 
        3  3590 1 1 53 PHE C    C   5.413 -10.213   7.543 1.00 . A A . 50 PHE C    1 1 
        3  3591 1 1 53 PHE CA   C   4.584 -11.241   8.312 1.00 . A A . 50 PHE CA   1 1 
        3  3592 1 1 53 PHE CB   C   4.702 -11.038   9.858 1.00 . A A . 50 PHE CB   1 1 
        3  3593 1 1 53 PHE CD1  C   2.534 -10.138  10.717 1.00 . A A . 50 PHE CD1  1 1 
        3  3594 1 1 53 PHE CD2  C   4.423  -8.680  10.687 1.00 . A A . 50 PHE CD2  1 1 
        3  3595 1 1 53 PHE CE1  C   1.761  -9.133  11.263 1.00 . A A . 50 PHE CE1  1 1 
        3  3596 1 1 53 PHE CE2  C   3.656  -7.673  11.240 1.00 . A A . 50 PHE CE2  1 1 
        3  3597 1 1 53 PHE CG   C   3.870  -9.923  10.419 1.00 . A A . 50 PHE CG   1 1 
        3  3598 1 1 53 PHE CZ   C   2.325  -7.901  11.529 1.00 . A A . 50 PHE CZ   1 1 
        3  3599 1 1 53 PHE H    H   6.080 -12.619   7.857 1.00 . A A . 50 PHE H    1 1 
        3  3600 1 1 53 PHE HA   H   3.545 -11.206   8.020 1.00 . A A . 50 PHE HA   1 1 
        3  3601 1 1 53 PHE HB2  H   4.385 -11.949  10.355 1.00 . A A . 50 PHE HB2  1 1 
        3  3602 1 1 53 PHE HB3  H   5.744 -10.845  10.132 1.00 . A A . 50 PHE HB3  1 1 
        3  3603 1 1 53 PHE HD1  H   2.092 -11.102  10.507 1.00 . A A . 50 PHE HD1  1 1 
        3  3604 1 1 53 PHE HD2  H   5.462  -8.501  10.459 1.00 . A A . 50 PHE HD2  1 1 
        3  3605 1 1 53 PHE HE1  H   0.722  -9.314  11.487 1.00 . A A . 50 PHE HE1  1 1 
        3  3606 1 1 53 PHE HE2  H   4.097  -6.707  11.443 1.00 . A A . 50 PHE HE2  1 1 
        3  3607 1 1 53 PHE HZ   H   1.725  -7.117  11.964 1.00 . A A . 50 PHE HZ   1 1 
        3  3608 1 1 53 PHE N    N   5.113 -12.539   7.960 1.00 . A A . 50 PHE N    1 1 
        3  3609 1 1 53 PHE O    O   6.631 -10.060   7.838 1.00 . A A . 50 PHE O    1 1 
        3  3610 1 1 54 ILE C    C   5.076  -7.166   5.807 1.00 . A A . 51 ILE C    1 1 
        3  3611 1 1 54 ILE CA   C   5.622  -8.564   5.721 1.00 . A A . 51 ILE CA   1 1 
        3  3612 1 1 54 ILE CB   C   5.779  -8.901   4.166 1.00 . A A . 51 ILE CB   1 1 
        3  3613 1 1 54 ILE CD1  C   4.827 -11.350   4.111 1.00 . A A . 51 ILE CD1  1 1 
        3  3614 1 1 54 ILE CG1  C   5.986 -10.390   3.817 1.00 . A A . 51 ILE CG1  1 1 
        3  3615 1 1 54 ILE CG2  C   7.008  -8.169   3.629 1.00 . A A . 51 ILE CG2  1 1 
        3  3616 1 1 54 ILE H    H   3.787  -9.541   6.475 1.00 . A A . 51 ILE H    1 1 
        3  3617 1 1 54 ILE HA   H   6.629  -8.543   6.149 1.00 . A A . 51 ILE HA   1 1 
        3  3618 1 1 54 ILE HB   H   4.937  -8.497   3.629 1.00 . A A . 51 ILE HB   1 1 
        3  3619 1 1 54 ILE HD11 H   5.114 -12.363   3.854 1.00 . A A . 51 ILE HD11 1 1 
        3  3620 1 1 54 ILE HD12 H   3.963 -11.072   3.523 1.00 . A A . 51 ILE HD12 1 1 
        3  3621 1 1 54 ILE HD13 H   4.574 -11.303   5.158 1.00 . A A . 51 ILE HD13 1 1 
        3  3622 1 1 54 ILE HG12 H   6.186 -10.472   2.762 1.00 . A A . 51 ILE HG12 1 1 
        3  3623 1 1 54 ILE HG13 H   6.870 -10.717   4.334 1.00 . A A . 51 ILE HG13 1 1 
        3  3624 1 1 54 ILE HG21 H   7.899  -8.603   4.058 1.00 . A A . 51 ILE HG21 1 1 
        3  3625 1 1 54 ILE HG22 H   6.952  -7.121   3.895 1.00 . A A . 51 ILE HG22 1 1 
        3  3626 1 1 54 ILE HG23 H   7.040  -8.266   2.549 1.00 . A A . 51 ILE HG23 1 1 
        3  3627 1 1 54 ILE N    N   4.789  -9.485   6.584 1.00 . A A . 51 ILE N    1 1 
        3  3628 1 1 54 ILE O    O   4.030  -6.853   5.254 1.00 . A A . 51 ILE O    1 1 
        3  3629 1 1 55 GLU C    C   6.235  -3.965   5.854 1.00 . A A . 52 GLU C    1 1 
        3  3630 1 1 55 GLU CA   C   5.423  -4.967   6.722 1.00 . A A . 52 GLU CA   1 1 
        3  3631 1 1 55 GLU CB   C   5.519  -4.762   8.248 1.00 . A A . 52 GLU CB   1 1 
        3  3632 1 1 55 GLU CD   C   5.066  -3.386  10.278 1.00 . A A . 52 GLU CD   1 1 
        3  3633 1 1 55 GLU CG   C   5.272  -3.363   8.772 1.00 . A A . 52 GLU CG   1 1 
        3  3634 1 1 55 GLU H    H   6.729  -6.627   6.718 1.00 . A A . 52 GLU H    1 1 
        3  3635 1 1 55 GLU HA   H   4.392  -4.905   6.448 1.00 . A A . 52 GLU HA   1 1 
        3  3636 1 1 55 GLU HB2  H   4.776  -5.401   8.708 1.00 . A A . 52 GLU HB2  1 1 
        3  3637 1 1 55 GLU HB3  H   6.485  -5.087   8.586 1.00 . A A . 52 GLU HB3  1 1 
        3  3638 1 1 55 GLU HG2  H   6.130  -2.747   8.544 1.00 . A A . 52 GLU HG2  1 1 
        3  3639 1 1 55 GLU HG3  H   4.390  -2.945   8.305 1.00 . A A . 52 GLU HG3  1 1 
        3  3640 1 1 55 GLU N    N   5.844  -6.324   6.443 1.00 . A A . 52 GLU N    1 1 
        3  3641 1 1 55 GLU O    O   7.428  -3.691   6.086 1.00 . A A . 52 GLU O    1 1 
        3  3642 1 1 55 GLU OE1  O   3.910  -3.574  10.721 1.00 . A A . 52 GLU OE1  1 1 
        3  3643 1 1 55 GLU OE2  O   6.060  -3.240  11.020 1.00 . A A . 52 GLU OE2  1 1 
        3  3644 1 1 56 PHE C    C   5.752  -1.128   3.847 1.00 . A A . 53 PHE C    1 1 
        3  3645 1 1 56 PHE CA   C   6.253  -2.597   3.812 1.00 . A A . 53 PHE CA   1 1 
        3  3646 1 1 56 PHE CB   C   6.206  -3.218   2.362 1.00 . A A . 53 PHE CB   1 1 
        3  3647 1 1 56 PHE CD1  C   3.664  -3.428   2.410 1.00 . A A . 53 PHE CD1  1 1 
        3  3648 1 1 56 PHE CD2  C   4.880  -4.652   0.750 1.00 . A A . 53 PHE CD2  1 1 
        3  3649 1 1 56 PHE CE1  C   2.490  -3.950   1.925 1.00 . A A . 53 PHE CE1  1 1 
        3  3650 1 1 56 PHE CE2  C   3.698  -5.172   0.271 1.00 . A A . 53 PHE CE2  1 1 
        3  3651 1 1 56 PHE CG   C   4.885  -3.767   1.840 1.00 . A A . 53 PHE CG   1 1 
        3  3652 1 1 56 PHE CZ   C   2.506  -4.824   0.856 1.00 . A A . 53 PHE CZ   1 1 
        3  3653 1 1 56 PHE H    H   4.620  -3.678   4.663 1.00 . A A . 53 PHE H    1 1 
        3  3654 1 1 56 PHE HA   H   7.286  -2.583   4.134 1.00 . A A . 53 PHE HA   1 1 
        3  3655 1 1 56 PHE HB2  H   6.524  -2.474   1.657 1.00 . A A . 53 PHE HB2  1 1 
        3  3656 1 1 56 PHE HB3  H   6.911  -4.037   2.330 1.00 . A A . 53 PHE HB3  1 1 
        3  3657 1 1 56 PHE HD1  H   3.644  -2.746   3.248 1.00 . A A . 53 PHE HD1  1 1 
        3  3658 1 1 56 PHE HD2  H   5.813  -4.933   0.257 1.00 . A A . 53 PHE HD2  1 1 
        3  3659 1 1 56 PHE HE1  H   1.549  -3.677   2.385 1.00 . A A . 53 PHE HE1  1 1 
        3  3660 1 1 56 PHE HE2  H   3.719  -5.854  -0.592 1.00 . A A . 53 PHE HE2  1 1 
        3  3661 1 1 56 PHE HZ   H   1.579  -5.230   0.478 1.00 . A A . 53 PHE HZ   1 1 
        3  3662 1 1 56 PHE N    N   5.581  -3.463   4.793 1.00 . A A . 53 PHE N    1 1 
        3  3663 1 1 56 PHE O    O   4.681  -0.861   4.408 1.00 . A A . 53 PHE O    1 1 
        3  3664 1 1 57 GLU C    C   5.002   1.399   2.078 1.00 . A A . 54 GLU C    1 1 
        3  3665 1 1 57 GLU CA   C   6.097   1.240   3.139 1.00 . A A . 54 GLU CA   1 1 
        3  3666 1 1 57 GLU CB   C   7.299   2.225   2.898 1.00 . A A . 54 GLU CB   1 1 
        3  3667 1 1 57 GLU CD   C   8.142   4.474   2.010 1.00 . A A . 54 GLU CD   1 1 
        3  3668 1 1 57 GLU CG   C   7.137   3.345   1.823 1.00 . A A . 54 GLU CG   1 1 
        3  3669 1 1 57 GLU H    H   7.463  -0.408   2.990 1.00 . A A . 54 GLU H    1 1 
        3  3670 1 1 57 GLU HA   H   5.640   1.485   4.098 1.00 . A A . 54 GLU HA   1 1 
        3  3671 1 1 57 GLU HB2  H   7.521   2.716   3.831 1.00 . A A . 54 GLU HB2  1 1 
        3  3672 1 1 57 GLU HB3  H   8.157   1.638   2.620 1.00 . A A . 54 GLU HB3  1 1 
        3  3673 1 1 57 GLU HG2  H   7.304   2.915   0.844 1.00 . A A . 54 GLU HG2  1 1 
        3  3674 1 1 57 GLU HG3  H   6.139   3.762   1.856 1.00 . A A . 54 GLU HG3  1 1 
        3  3675 1 1 57 GLU N    N   6.547  -0.171   3.278 1.00 . A A . 54 GLU N    1 1 
        3  3676 1 1 57 GLU O    O   4.008   2.089   2.331 1.00 . A A . 54 GLU O    1 1 
        3  3677 1 1 57 GLU OE1  O   9.324   4.290   1.641 1.00 . A A . 54 GLU OE1  1 1 
        3  3678 1 1 57 GLU OE2  O   7.768   5.531   2.564 1.00 . A A . 54 GLU OE2  1 1 
        3  3679 1 1 58 ASP C    C   3.339  -0.451  -0.236 1.00 . A A . 55 ASP C    1 1 
        3  3680 1 1 58 ASP CA   C   4.074   0.872  -0.066 1.00 . A A . 55 ASP CA   1 1 
        3  3681 1 1 58 ASP CB   C   4.669   1.304  -1.420 1.00 . A A . 55 ASP CB   1 1 
        3  3682 1 1 58 ASP CG   C   4.636   2.807  -1.610 1.00 . A A . 55 ASP CG   1 1 
        3  3683 1 1 58 ASP H    H   5.904   0.171   0.744 1.00 . A A . 55 ASP H    1 1 
        3  3684 1 1 58 ASP HA   H   3.404   1.646   0.274 1.00 . A A . 55 ASP HA   1 1 
        3  3685 1 1 58 ASP HB2  H   5.697   0.983  -1.471 1.00 . A A . 55 ASP HB2  1 1 
        3  3686 1 1 58 ASP HB3  H   4.115   0.845  -2.232 1.00 . A A . 55 ASP HB3  1 1 
        3  3687 1 1 58 ASP N    N   5.120   0.731   0.926 1.00 . A A . 55 ASP N    1 1 
        3  3688 1 1 58 ASP O    O   3.921  -1.446  -0.680 1.00 . A A . 55 ASP O    1 1 
        3  3689 1 1 58 ASP OD1  O   3.519   3.363  -1.722 1.00 . A A . 55 ASP OD1  1 1 
        3  3690 1 1 58 ASP OD2  O   5.713   3.436  -1.646 1.00 . A A . 55 ASP OD2  1 1 
        3  3691 1 1 59 ALA C    C   0.683  -1.665  -1.644 1.00 . A A . 56 ALA C    1 1 
        3  3692 1 1 59 ALA CA   C   1.173  -1.579  -0.178 1.00 . A A . 56 ALA CA   1 1 
        3  3693 1 1 59 ALA CB   C   0.002  -1.643   0.806 1.00 . A A . 56 ALA CB   1 1 
        3  3694 1 1 59 ALA H    H   1.724   0.239   0.774 1.00 . A A . 56 ALA H    1 1 
        3  3695 1 1 59 ALA HA   H   1.763  -2.466   0.003 1.00 . A A . 56 ALA HA   1 1 
        3  3696 1 1 59 ALA HB1  H  -0.583  -2.528   0.600 1.00 . A A . 56 ALA HB1  1 1 
        3  3697 1 1 59 ALA HB2  H  -0.621  -0.774   0.720 1.00 . A A . 56 ALA HB2  1 1 
        3  3698 1 1 59 ALA HB3  H   0.381  -1.709   1.817 1.00 . A A . 56 ALA HB3  1 1 
        3  3699 1 1 59 ALA N    N   2.051  -0.456   0.136 1.00 . A A . 56 ALA N    1 1 
        3  3700 1 1 59 ALA O    O   0.286  -2.752  -2.059 1.00 . A A . 56 ALA O    1 1 
        3  3701 1 1 60 ARG C    C   0.885  -1.385  -4.858 1.00 . A A . 57 ARG C    1 1 
        3  3702 1 1 60 ARG CA   C   0.040  -0.626  -3.779 1.00 . A A . 57 ARG CA   1 1 
        3  3703 1 1 60 ARG CB   C  -0.538   0.719  -4.349 1.00 . A A . 57 ARG CB   1 1 
        3  3704 1 1 60 ARG CD   C  -0.198   2.895  -5.628 1.00 . A A . 57 ARG CD   1 1 
        3  3705 1 1 60 ARG CG   C   0.472   1.667  -5.016 1.00 . A A . 57 ARG CG   1 1 
        3  3706 1 1 60 ARG CZ   C  -1.391   3.535  -7.703 1.00 . A A . 57 ARG CZ   1 1 
        3  3707 1 1 60 ARG H    H   1.110   0.266  -2.126 1.00 . A A . 57 ARG H    1 1 
        3  3708 1 1 60 ARG HA   H  -0.825  -1.251  -3.608 1.00 . A A . 57 ARG HA   1 1 
        3  3709 1 1 60 ARG HB2  H  -1.285   0.462  -5.101 1.00 . A A . 57 ARG HB2  1 1 
        3  3710 1 1 60 ARG HB3  H  -1.058   1.255  -3.554 1.00 . A A . 57 ARG HB3  1 1 
        3  3711 1 1 60 ARG HD2  H  -0.971   3.247  -4.961 1.00 . A A . 57 ARG HD2  1 1 
        3  3712 1 1 60 ARG HD3  H   0.546   3.668  -5.746 1.00 . A A . 57 ARG HD3  1 1 
        3  3713 1 1 60 ARG HE   H  -0.730   1.692  -7.267 1.00 . A A . 57 ARG HE   1 1 
        3  3714 1 1 60 ARG HG2  H   1.201   1.998  -4.302 1.00 . A A . 57 ARG HG2  1 1 
        3  3715 1 1 60 ARG HG3  H   0.969   1.118  -5.809 1.00 . A A . 57 ARG HG3  1 1 
        3  3716 1 1 60 ARG HH11 H  -1.121   5.070  -6.404 1.00 . A A . 57 ARG HH11 1 1 
        3  3717 1 1 60 ARG HH12 H  -1.945   5.482  -7.873 1.00 . A A . 57 ARG HH12 1 1 
        3  3718 1 1 60 ARG HH21 H  -1.756   2.249  -9.228 1.00 . A A . 57 ARG HH21 1 1 
        3  3719 1 1 60 ARG HH22 H  -2.306   3.874  -9.478 1.00 . A A . 57 ARG HH22 1 1 
        3  3720 1 1 60 ARG N    N   0.679  -0.556  -2.436 1.00 . A A . 57 ARG N    1 1 
        3  3721 1 1 60 ARG NE   N  -0.795   2.616  -6.934 1.00 . A A . 57 ARG NE   1 1 
        3  3722 1 1 60 ARG NH1  N  -1.494   4.802  -7.294 1.00 . A A . 57 ARG NH1  1 1 
        3  3723 1 1 60 ARG NH2  N  -1.854   3.193  -8.900 1.00 . A A . 57 ARG NH2  1 1 
        3  3724 1 1 60 ARG O    O   0.281  -2.117  -5.637 1.00 . A A . 57 ARG O    1 1 
        3  3725 1 1 61 ASP C    C   3.278  -3.556  -5.624 1.00 . A A . 58 ASP C    1 1 
        3  3726 1 1 61 ASP CA   C   2.994  -2.040  -5.977 1.00 . A A . 58 ASP CA   1 1 
        3  3727 1 1 61 ASP CB   C   4.277  -1.327  -6.480 1.00 . A A . 58 ASP CB   1 1 
        3  3728 1 1 61 ASP CG   C   3.982  -0.040  -7.221 1.00 . A A . 58 ASP CG   1 1 
        3  3729 1 1 61 ASP H    H   2.708  -0.477  -4.494 1.00 . A A . 58 ASP H    1 1 
        3  3730 1 1 61 ASP HA   H   2.323  -2.066  -6.824 1.00 . A A . 58 ASP HA   1 1 
        3  3731 1 1 61 ASP HB2  H   4.946  -1.093  -5.668 1.00 . A A . 58 ASP HB2  1 1 
        3  3732 1 1 61 ASP HB3  H   4.786  -1.995  -7.168 1.00 . A A . 58 ASP HB3  1 1 
        3  3733 1 1 61 ASP N    N   2.244  -1.229  -4.957 1.00 . A A . 58 ASP N    1 1 
        3  3734 1 1 61 ASP O    O   3.225  -4.397  -6.520 1.00 . A A . 58 ASP O    1 1 
        3  3735 1 1 61 ASP OD1  O   2.957   0.027  -7.945 1.00 . A A . 58 ASP OD1  1 1 
        3  3736 1 1 61 ASP OD2  O   4.779   0.913  -7.105 1.00 . A A . 58 ASP OD2  1 1 
        3  3737 1 1 62 ALA C    C   2.514  -6.191  -3.854 1.00 . A A . 59 ALA C    1 1 
        3  3738 1 1 62 ALA CA   C   3.832  -5.316  -3.924 1.00 . A A . 59 ALA CA   1 1 
        3  3739 1 1 62 ALA CB   C   4.786  -5.311  -2.731 1.00 . A A . 59 ALA CB   1 1 
        3  3740 1 1 62 ALA H    H   3.607  -3.263  -3.668 1.00 . A A . 59 ALA H    1 1 
        3  3741 1 1 62 ALA HA   H   4.415  -5.737  -4.712 1.00 . A A . 59 ALA HA   1 1 
        3  3742 1 1 62 ALA HB1  H   4.455  -4.594  -1.996 1.00 . A A . 59 ALA HB1  1 1 
        3  3743 1 1 62 ALA HB2  H   5.800  -5.030  -3.077 1.00 . A A . 59 ALA HB2  1 1 
        3  3744 1 1 62 ALA HB3  H   4.838  -6.281  -2.288 1.00 . A A . 59 ALA HB3  1 1 
        3  3745 1 1 62 ALA N    N   3.560  -3.927  -4.348 1.00 . A A . 59 ALA N    1 1 
        3  3746 1 1 62 ALA O    O   2.532  -7.443  -3.738 1.00 . A A . 59 ALA O    1 1 
        3  3747 1 1 63 ALA C    C   0.022  -6.980  -5.484 1.00 . A A . 60 ALA C    1 1 
        3  3748 1 1 63 ALA CA   C   0.029  -6.028  -4.219 1.00 . A A . 60 ALA CA   1 1 
        3  3749 1 1 63 ALA CB   C  -1.035  -4.875  -4.398 1.00 . A A . 60 ALA CB   1 1 
        3  3750 1 1 63 ALA H    H   1.416  -4.560  -3.592 1.00 . A A . 60 ALA H    1 1 
        3  3751 1 1 63 ALA HA   H  -0.269  -6.603  -3.376 1.00 . A A . 60 ALA HA   1 1 
        3  3752 1 1 63 ALA HB1  H  -1.248  -4.407  -3.442 1.00 . A A . 60 ALA HB1  1 1 
        3  3753 1 1 63 ALA HB2  H  -1.963  -5.265  -4.802 1.00 . A A . 60 ALA HB2  1 1 
        3  3754 1 1 63 ALA HB3  H  -0.665  -4.115  -5.080 1.00 . A A . 60 ALA HB3  1 1 
        3  3755 1 1 63 ALA N    N   1.368  -5.470  -3.881 1.00 . A A . 60 ALA N    1 1 
        3  3756 1 1 63 ALA O    O  -0.752  -7.947  -5.466 1.00 . A A . 60 ALA O    1 1 
        3  3757 1 1 64 ASP C    C   1.611  -9.122  -7.037 1.00 . A A . 61 ASP C    1 1 
        3  3758 1 1 64 ASP CA   C   1.108  -7.767  -7.620 1.00 . A A . 61 ASP CA   1 1 
        3  3759 1 1 64 ASP CB   C   2.083  -7.299  -8.712 1.00 . A A . 61 ASP CB   1 1 
        3  3760 1 1 64 ASP CG   C   1.564  -6.097  -9.474 1.00 . A A . 61 ASP CG   1 1 
        3  3761 1 1 64 ASP H    H   1.150  -5.811  -6.725 1.00 . A A . 61 ASP H    1 1 
        3  3762 1 1 64 ASP HA   H   0.174  -7.948  -8.126 1.00 . A A . 61 ASP HA   1 1 
        3  3763 1 1 64 ASP HB2  H   3.050  -7.069  -8.289 1.00 . A A . 61 ASP HB2  1 1 
        3  3764 1 1 64 ASP HB3  H   2.209  -8.109  -9.425 1.00 . A A . 61 ASP HB3  1 1 
        3  3765 1 1 64 ASP N    N   0.841  -6.726  -6.564 1.00 . A A . 61 ASP N    1 1 
        3  3766 1 1 64 ASP O    O   1.000 -10.155  -7.300 1.00 . A A . 61 ASP O    1 1 
        3  3767 1 1 64 ASP OD1  O   0.540  -6.245 -10.182 1.00 . A A . 61 ASP OD1  1 1 
        3  3768 1 1 64 ASP OD2  O   2.189  -5.025  -9.401 1.00 . A A . 61 ASP OD2  1 1 
        3  3769 1 1 65 ALA C    C   2.006 -10.972  -4.621 1.00 . A A . 62 ALA C    1 1 
        3  3770 1 1 65 ALA CA   C   3.097 -10.400  -5.514 1.00 . A A . 62 ALA CA   1 1 
        3  3771 1 1 65 ALA CB   C   4.391 -10.309  -4.675 1.00 . A A . 62 ALA CB   1 1 
        3  3772 1 1 65 ALA H    H   3.272  -8.353  -6.213 1.00 . A A . 62 ALA H    1 1 
        3  3773 1 1 65 ALA HA   H   3.281 -11.134  -6.290 1.00 . A A . 62 ALA HA   1 1 
        3  3774 1 1 65 ALA HB1  H   4.316  -9.538  -3.914 1.00 . A A . 62 ALA HB1  1 1 
        3  3775 1 1 65 ALA HB2  H   5.223 -10.112  -5.310 1.00 . A A . 62 ALA HB2  1 1 
        3  3776 1 1 65 ALA HB3  H   4.553 -11.261  -4.181 1.00 . A A . 62 ALA HB3  1 1 
        3  3777 1 1 65 ALA N    N   2.695  -9.139  -6.234 1.00 . A A . 62 ALA N    1 1 
        3  3778 1 1 65 ALA O    O   1.888 -12.198  -4.532 1.00 . A A . 62 ALA O    1 1 
        3  3779 1 1 66 ILE C    C  -1.029 -11.329  -3.799 1.00 . A A . 63 ILE C    1 1 
        3  3780 1 1 66 ILE CA   C   0.176 -10.668  -3.057 1.00 . A A . 63 ILE CA   1 1 
        3  3781 1 1 66 ILE CB   C  -0.208  -9.627  -1.939 1.00 . A A . 63 ILE CB   1 1 
        3  3782 1 1 66 ILE CD1  C  -0.739 -11.009   0.206 1.00 . A A . 63 ILE CD1  1 1 
        3  3783 1 1 66 ILE CG1  C   0.222 -10.107  -0.536 1.00 . A A . 63 ILE CG1  1 1 
        3  3784 1 1 66 ILE CG2  C  -1.687  -9.210  -1.935 1.00 . A A . 63 ILE CG2  1 1 
        3  3785 1 1 66 ILE H    H   1.288  -9.146  -4.084 1.00 . A A . 63 ILE H    1 1 
        3  3786 1 1 66 ILE HA   H   0.685 -11.485  -2.565 1.00 . A A . 63 ILE HA   1 1 
        3  3787 1 1 66 ILE HB   H   0.372  -8.755  -2.139 1.00 . A A . 63 ILE HB   1 1 
        3  3788 1 1 66 ILE HD11 H  -0.267 -11.964   0.401 1.00 . A A . 63 ILE HD11 1 1 
        3  3789 1 1 66 ILE HD12 H  -1.642 -11.144  -0.362 1.00 . A A . 63 ILE HD12 1 1 
        3  3790 1 1 66 ILE HD13 H  -0.980 -10.544   1.150 1.00 . A A . 63 ILE HD13 1 1 
        3  3791 1 1 66 ILE HG12 H   1.147 -10.647  -0.618 1.00 . A A . 63 ILE HG12 1 1 
        3  3792 1 1 66 ILE HG13 H   0.389  -9.236   0.085 1.00 . A A . 63 ILE HG13 1 1 
        3  3793 1 1 66 ILE HG21 H  -2.293 -10.050  -1.610 1.00 . A A . 63 ILE HG21 1 1 
        3  3794 1 1 66 ILE HG22 H  -1.990  -8.918  -2.925 1.00 . A A . 63 ILE HG22 1 1 
        3  3795 1 1 66 ILE HG23 H  -1.829  -8.384  -1.254 1.00 . A A . 63 ILE HG23 1 1 
        3  3796 1 1 66 ILE N    N   1.196 -10.125  -3.966 1.00 . A A . 63 ILE N    1 1 
        3  3797 1 1 66 ILE O    O  -1.446 -12.402  -3.382 1.00 . A A . 63 ILE O    1 1 
        3  3798 1 1 67 LYS C    C  -1.804 -12.657  -6.510 1.00 . A A . 64 LYS C    1 1 
        3  3799 1 1 67 LYS CA   C  -2.481 -11.431  -5.829 1.00 . A A . 64 LYS CA   1 1 
        3  3800 1 1 67 LYS CB   C  -3.098 -10.492  -6.927 1.00 . A A . 64 LYS CB   1 1 
        3  3801 1 1 67 LYS CD   C  -1.521 -10.521  -9.010 1.00 . A A . 64 LYS CD   1 1 
        3  3802 1 1 67 LYS CE   C  -0.859  -9.653 -10.076 1.00 . A A . 64 LYS CE   1 1 
        3  3803 1 1 67 LYS CG   C  -2.102  -9.705  -7.839 1.00 . A A . 64 LYS CG   1 1 
        3  3804 1 1 67 LYS H    H  -1.608  -9.740  -4.900 1.00 . A A . 64 LYS H    1 1 
        3  3805 1 1 67 LYS HA   H  -3.300 -11.814  -5.231 1.00 . A A . 64 LYS HA   1 1 
        3  3806 1 1 67 LYS HB2  H  -3.715 -11.107  -7.566 1.00 . A A . 64 LYS HB2  1 1 
        3  3807 1 1 67 LYS HB3  H  -3.753  -9.771  -6.441 1.00 . A A . 64 LYS HB3  1 1 
        3  3808 1 1 67 LYS HD2  H  -0.732 -11.180  -8.616 1.00 . A A . 64 LYS HD2  1 1 
        3  3809 1 1 67 LYS HD3  H  -2.295 -11.117  -9.454 1.00 . A A . 64 LYS HD3  1 1 
        3  3810 1 1 67 LYS HE2  H   0.085  -9.304  -9.694 1.00 . A A . 64 LYS HE2  1 1 
        3  3811 1 1 67 LYS HE3  H  -0.679 -10.266 -10.948 1.00 . A A . 64 LYS HE3  1 1 
        3  3812 1 1 67 LYS HG2  H  -2.611  -8.849  -8.250 1.00 . A A . 64 LYS HG2  1 1 
        3  3813 1 1 67 LYS HG3  H  -1.268  -9.367  -7.228 1.00 . A A . 64 LYS HG3  1 1 
        3  3814 1 1 67 LYS HZ1  H  -2.616  -8.783 -10.781 1.00 . A A . 64 LYS HZ1  1 1 
        3  3815 1 1 67 LYS HZ2  H  -1.211  -7.982 -11.262 1.00 . A A . 64 LYS HZ2  1 1 
        3  3816 1 1 67 LYS HZ3  H  -1.769  -7.822  -9.677 1.00 . A A . 64 LYS HZ3  1 1 
        3  3817 1 1 67 LYS N    N  -1.611 -10.702  -4.864 1.00 . A A . 64 LYS N    1 1 
        3  3818 1 1 67 LYS NZ   N  -1.674  -8.480 -10.474 1.00 . A A . 64 LYS NZ   1 1 
        3  3819 1 1 67 LYS O    O  -2.481 -13.604  -6.876 1.00 . A A . 64 LYS O    1 1 
        3  3820 1 1 68 GLU C    C   0.428 -14.944  -6.428 1.00 . A A . 65 GLU C    1 1 
        3  3821 1 1 68 GLU CA   C   0.187 -13.751  -7.388 1.00 . A A . 65 GLU CA   1 1 
        3  3822 1 1 68 GLU CB   C   1.437 -13.179  -8.092 1.00 . A A . 65 GLU CB   1 1 
        3  3823 1 1 68 GLU CD   C   3.926 -12.845  -8.061 1.00 . A A . 65 GLU CD   1 1 
        3  3824 1 1 68 GLU CG   C   2.753 -13.706  -7.636 1.00 . A A . 65 GLU CG   1 1 
        3  3825 1 1 68 GLU H    H   0.055 -11.860  -6.433 1.00 . A A . 65 GLU H    1 1 
        3  3826 1 1 68 GLU HA   H  -0.489 -14.131  -8.148 1.00 . A A . 65 GLU HA   1 1 
        3  3827 1 1 68 GLU HB2  H   1.361 -13.377  -9.148 1.00 . A A . 65 GLU HB2  1 1 
        3  3828 1 1 68 GLU HB3  H   1.447 -12.109  -7.944 1.00 . A A . 65 GLU HB3  1 1 
        3  3829 1 1 68 GLU HG2  H   2.733 -13.793  -6.560 1.00 . A A . 65 GLU HG2  1 1 
        3  3830 1 1 68 GLU HG3  H   2.862 -14.657  -8.079 1.00 . A A . 65 GLU HG3  1 1 
        3  3831 1 1 68 GLU N    N  -0.481 -12.639  -6.716 1.00 . A A . 65 GLU N    1 1 
        3  3832 1 1 68 GLU O    O   0.604 -16.087  -6.883 1.00 . A A . 65 GLU O    1 1 
        3  3833 1 1 68 GLU OE1  O   3.987 -12.472  -9.249 1.00 . A A . 65 GLU OE1  1 1 
        3  3834 1 1 68 GLU OE2  O   4.803 -12.572  -7.216 1.00 . A A . 65 GLU OE2  1 1 
        3  3835 1 1 69 LYS C    C  -1.240 -15.904  -3.612 1.00 . A A . 66 LYS C    1 1 
        3  3836 1 1 69 LYS CA   C   0.263 -15.760  -4.135 1.00 . A A . 66 LYS CA   1 1 
        3  3837 1 1 69 LYS CB   C   1.236 -15.517  -2.921 1.00 . A A . 66 LYS CB   1 1 
        3  3838 1 1 69 LYS CD   C   3.623 -15.887  -4.102 1.00 . A A . 66 LYS CD   1 1 
        3  3839 1 1 69 LYS CE   C   4.975 -15.191  -4.351 1.00 . A A . 66 LYS CE   1 1 
        3  3840 1 1 69 LYS CG   C   2.700 -15.013  -3.193 1.00 . A A . 66 LYS CG   1 1 
        3  3841 1 1 69 LYS H    H   0.602 -13.795  -4.803 1.00 . A A . 66 LYS H    1 1 
        3  3842 1 1 69 LYS HA   H   0.528 -16.682  -4.617 1.00 . A A . 66 LYS HA   1 1 
        3  3843 1 1 69 LYS HB2  H   0.785 -14.764  -2.291 1.00 . A A . 66 LYS HB2  1 1 
        3  3844 1 1 69 LYS HB3  H   1.290 -16.429  -2.348 1.00 . A A . 66 LYS HB3  1 1 
        3  3845 1 1 69 LYS HD2  H   3.823 -16.838  -3.628 1.00 . A A . 66 LYS HD2  1 1 
        3  3846 1 1 69 LYS HD3  H   3.147 -16.048  -5.060 1.00 . A A . 66 LYS HD3  1 1 
        3  3847 1 1 69 LYS HE2  H   4.814 -14.309  -4.959 1.00 . A A . 66 LYS HE2  1 1 
        3  3848 1 1 69 LYS HE3  H   5.399 -14.895  -3.402 1.00 . A A . 66 LYS HE3  1 1 
        3  3849 1 1 69 LYS HG2  H   2.638 -14.030  -3.624 1.00 . A A . 66 LYS HG2  1 1 
        3  3850 1 1 69 LYS HG3  H   3.184 -14.915  -2.230 1.00 . A A . 66 LYS HG3  1 1 
        3  3851 1 1 69 LYS HZ1  H   6.801 -15.514  -5.328 1.00 . A A . 66 LYS HZ1  1 1 
        3  3852 1 1 69 LYS HZ2  H   5.531 -16.470  -5.915 1.00 . A A . 66 LYS HZ2  1 1 
        3  3853 1 1 69 LYS HZ3  H   6.255 -16.845  -4.432 1.00 . A A . 66 LYS HZ3  1 1 
        3  3854 1 1 69 LYS N    N   0.414 -14.689  -5.115 1.00 . A A . 66 LYS N    1 1 
        3  3855 1 1 69 LYS NZ   N   5.957 -16.070  -5.056 1.00 . A A . 66 LYS NZ   1 1 
        3  3856 1 1 69 LYS O    O  -1.467 -16.658  -2.664 1.00 . A A . 66 LYS O    1 1 
        3  3857 1 1 70 ASP C    C  -4.512 -16.406  -4.024 1.00 . A A . 67 ASP C    1 1 
        3  3858 1 1 70 ASP CA   C  -3.685 -15.177  -3.688 1.00 . A A . 67 ASP CA   1 1 
        3  3859 1 1 70 ASP CB   C  -4.501 -13.879  -3.813 1.00 . A A . 67 ASP CB   1 1 
        3  3860 1 1 70 ASP CG   C  -5.548 -13.815  -4.937 1.00 . A A . 67 ASP CG   1 1 
        3  3861 1 1 70 ASP H    H  -2.115 -14.830  -5.120 1.00 . A A . 67 ASP H    1 1 
        3  3862 1 1 70 ASP HA   H  -3.531 -15.263  -2.651 1.00 . A A . 67 ASP HA   1 1 
        3  3863 1 1 70 ASP HB2  H  -5.034 -13.772  -2.861 1.00 . A A . 67 ASP HB2  1 1 
        3  3864 1 1 70 ASP HB3  H  -3.839 -13.054  -3.898 1.00 . A A . 67 ASP HB3  1 1 
        3  3865 1 1 70 ASP N    N  -2.267 -15.204  -4.224 1.00 . A A . 67 ASP N    1 1 
        3  3866 1 1 70 ASP O    O  -4.182 -17.143  -4.965 1.00 . A A . 67 ASP O    1 1 
        3  3867 1 1 70 ASP OD1  O  -5.185 -13.804  -6.127 1.00 . A A . 67 ASP OD1  1 1 
        3  3868 1 1 70 ASP OD2  O  -6.749 -13.724  -4.604 1.00 . A A . 67 ASP OD2  1 1 
        3  3869 1 1 71 GLY C    C  -6.176 -18.724  -2.029 1.00 . A A . 68 GLY C    1 1 
        3  3870 1 1 71 GLY CA   C  -6.208 -17.941  -3.322 1.00 . A A . 68 GLY CA   1 1 
        3  3871 1 1 71 GLY H    H  -6.002 -15.910  -2.754 1.00 . A A . 68 GLY H    1 1 
        3  3872 1 1 71 GLY HA2  H  -7.232 -17.814  -3.614 1.00 . A A . 68 GLY HA2  1 1 
        3  3873 1 1 71 GLY HA3  H  -5.700 -18.509  -4.086 1.00 . A A . 68 GLY HA3  1 1 
        3  3874 1 1 71 GLY N    N  -5.601 -16.637  -3.271 1.00 . A A . 68 GLY N    1 1 
        3  3875 1 1 71 GLY O    O  -6.063 -19.953  -2.096 1.00 . A A . 68 GLY O    1 1 
        3  3876 1 1 72 CYS C    C  -6.986 -19.819   0.656 1.00 . A A . 69 CYS C    1 1 
        3  3877 1 1 72 CYS CA   C  -6.049 -18.631   0.459 1.00 . A A . 69 CYS CA   1 1 
        3  3878 1 1 72 CYS CB   C  -6.400 -17.581   1.555 1.00 . A A . 69 CYS CB   1 1 
        3  3879 1 1 72 CYS H    H  -6.312 -17.034  -0.892 1.00 . A A . 69 CYS H    1 1 
        3  3880 1 1 72 CYS HA   H  -5.026 -18.947   0.580 1.00 . A A . 69 CYS HA   1 1 
        3  3881 1 1 72 CYS HB2  H  -6.949 -18.063   2.351 1.00 . A A . 69 CYS HB2  1 1 
        3  3882 1 1 72 CYS HB3  H  -5.499 -17.173   1.962 1.00 . A A . 69 CYS HB3  1 1 
        3  3883 1 1 72 CYS HG   H  -8.515 -16.719   0.427 1.00 . A A . 69 CYS HG   1 1 
        3  3884 1 1 72 CYS N    N  -6.208 -18.006  -0.860 1.00 . A A . 69 CYS N    1 1 
        3  3885 1 1 72 CYS O    O  -8.219 -19.699   0.548 1.00 . A A . 69 CYS O    1 1 
        3  3886 1 1 72 CYS SG   S  -7.430 -16.203   0.994 1.00 . A A . 69 CYS SG   1 1 
        3  3887 1 1 73 ASP C    C  -6.844 -22.957   2.413 1.00 . A A . 70 ASP C    1 1 
        3  3888 1 1 73 ASP CA   C  -7.179 -22.177   1.126 1.00 . A A . 70 ASP CA   1 1 
        3  3889 1 1 73 ASP CB   C  -7.018 -23.068  -0.108 1.00 . A A . 70 ASP CB   1 1 
        3  3890 1 1 73 ASP CG   C  -8.298 -23.814  -0.438 1.00 . A A . 70 ASP CG   1 1 
        3  3891 1 1 73 ASP H    H  -5.400 -21.042   1.074 1.00 . A A . 70 ASP H    1 1 
        3  3892 1 1 73 ASP HA   H  -8.206 -21.835   1.170 1.00 . A A . 70 ASP HA   1 1 
        3  3893 1 1 73 ASP HB2  H  -6.738 -22.459  -0.962 1.00 . A A . 70 ASP HB2  1 1 
        3  3894 1 1 73 ASP HB3  H  -6.239 -23.790   0.083 1.00 . A A . 70 ASP HB3  1 1 
        3  3895 1 1 73 ASP N    N  -6.391 -20.979   0.992 1.00 . A A . 70 ASP N    1 1 
        3  3896 1 1 73 ASP O    O  -5.680 -22.933   2.882 1.00 . A A . 70 ASP O    1 1 
        3  3897 1 1 73 ASP OD1  O  -8.507 -24.917   0.113 1.00 . A A . 70 ASP OD1  1 1 
        3  3898 1 1 73 ASP OD2  O  -9.100 -23.292  -1.244 1.00 . A A . 70 ASP OD2  1 1 
        3  3899 1 1 74 PHE C    C  -8.808 -25.582   4.024 1.00 . A A . 71 PHE C    1 1 
        3  3900 1 1 74 PHE CA   C  -7.936 -24.336   4.212 1.00 . A A . 71 PHE CA   1 1 
        3  3901 1 1 74 PHE CB   C  -8.464 -23.427   5.356 1.00 . A A . 71 PHE CB   1 1 
        3  3902 1 1 74 PHE CD1  C -10.890 -22.942   4.808 1.00 . A A . 71 PHE CD1  1 1 
        3  3903 1 1 74 PHE CD2  C  -9.353 -21.115   4.873 1.00 . A A . 71 PHE CD2  1 1 
        3  3904 1 1 74 PHE CE1  C -11.915 -22.067   4.498 1.00 . A A . 71 PHE CE1  1 1 
        3  3905 1 1 74 PHE CE2  C -10.374 -20.240   4.567 1.00 . A A . 71 PHE CE2  1 1 
        3  3906 1 1 74 PHE CG   C  -9.594 -22.479   4.995 1.00 . A A . 71 PHE CG   1 1 
        3  3907 1 1 74 PHE CZ   C -11.655 -20.714   4.384 1.00 . A A . 71 PHE CZ   1 1 
        3  3908 1 1 74 PHE H    H  -8.638 -23.871   2.333 1.00 . A A . 71 PHE H    1 1 
        3  3909 1 1 74 PHE HA   H  -6.931 -24.661   4.451 1.00 . A A . 71 PHE HA   1 1 
        3  3910 1 1 74 PHE HB2  H  -8.822 -24.055   6.155 1.00 . A A . 71 PHE HB2  1 1 
        3  3911 1 1 74 PHE HB3  H  -7.642 -22.830   5.727 1.00 . A A . 71 PHE HB3  1 1 
        3  3912 1 1 74 PHE HD1  H -11.092 -24.003   4.897 1.00 . A A . 71 PHE HD1  1 1 
        3  3913 1 1 74 PHE HD2  H  -8.355 -20.739   5.021 1.00 . A A . 71 PHE HD2  1 1 
        3  3914 1 1 74 PHE HE1  H -12.918 -22.441   4.352 1.00 . A A . 71 PHE HE1  1 1 
        3  3915 1 1 74 PHE HE2  H -10.173 -19.183   4.475 1.00 . A A . 71 PHE HE2  1 1 
        3  3916 1 1 74 PHE HZ   H -12.459 -20.031   4.151 1.00 . A A . 71 PHE HZ   1 1 
        3  3917 1 1 74 PHE N    N  -7.875 -23.674   2.920 1.00 . A A . 71 PHE N    1 1 
        3  3918 1 1 74 PHE O    O  -9.706 -25.534   3.180 1.00 . A A . 71 PHE O    1 1 
        3  3919 1 1 75 GLU C    C  -8.845 -28.730   3.254 1.00 . A A . 72 GLU C    1 1 
        3  3920 1 1 75 GLU CA   C  -9.226 -27.993   4.560 1.00 . A A . 72 GLU CA   1 1 
        3  3921 1 1 75 GLU CB   C -10.790 -27.886   4.654 1.00 . A A . 72 GLU CB   1 1 
        3  3922 1 1 75 GLU CD   C -10.862 -28.345   7.160 1.00 . A A . 72 GLU CD   1 1 
        3  3923 1 1 75 GLU CG   C -11.388 -27.508   6.011 1.00 . A A . 72 GLU CG   1 1 
        3  3924 1 1 75 GLU H    H  -7.783 -26.637   5.401 1.00 . A A . 72 GLU H    1 1 
        3  3925 1 1 75 GLU HA   H  -8.897 -28.622   5.376 1.00 . A A . 72 GLU HA   1 1 
        3  3926 1 1 75 GLU HB2  H -11.117 -27.142   3.946 1.00 . A A . 72 GLU HB2  1 1 
        3  3927 1 1 75 GLU HB3  H -11.209 -28.839   4.360 1.00 . A A . 72 GLU HB3  1 1 
        3  3928 1 1 75 GLU HG2  H -11.213 -26.464   6.219 1.00 . A A . 72 GLU HG2  1 1 
        3  3929 1 1 75 GLU HG3  H -12.449 -27.665   5.945 1.00 . A A . 72 GLU HG3  1 1 
        3  3930 1 1 75 GLU N    N  -8.507 -26.691   4.733 1.00 . A A . 72 GLU N    1 1 
        3  3931 1 1 75 GLU O    O  -9.661 -28.902   2.343 1.00 . A A . 72 GLU O    1 1 
        3  3932 1 1 75 GLU OE1  O -11.442 -29.419   7.429 1.00 . A A . 72 GLU OE1  1 1 
        3  3933 1 1 75 GLU OE2  O  -9.881 -27.915   7.810 1.00 . A A . 72 GLU OE2  1 1 
        3  3934 1 1 76 GLY C    C  -6.427 -29.412   0.904 1.00 . A A . 73 GLY C    1 1 
        3  3935 1 1 76 GLY CA   C  -7.089 -30.036   2.131 1.00 . A A . 73 GLY CA   1 1 
        3  3936 1 1 76 GLY H    H  -6.933 -28.776   3.845 1.00 . A A . 73 GLY H    1 1 
        3  3937 1 1 76 GLY HA2  H  -6.376 -30.707   2.584 1.00 . A A . 73 GLY HA2  1 1 
        3  3938 1 1 76 GLY HA3  H  -7.929 -30.620   1.802 1.00 . A A . 73 GLY HA3  1 1 
        3  3939 1 1 76 GLY N    N  -7.566 -29.109   3.170 1.00 . A A . 73 GLY N    1 1 
        3  3940 1 1 76 GLY O    O  -5.799 -30.134   0.125 1.00 . A A . 73 GLY O    1 1 
        3  3941 1 1 77 ASN C    C  -4.862 -26.446   0.988 1.00 . A A . 74 ASN C    1 1 
        3  3942 1 1 77 ASN CA   C  -5.507 -27.372  -0.014 1.00 . A A . 74 ASN CA   1 1 
        3  3943 1 1 77 ASN CB   C  -6.004 -26.613  -1.293 1.00 . A A . 74 ASN CB   1 1 
        3  3944 1 1 77 ASN CG   C  -6.604 -27.549  -2.326 1.00 . A A . 74 ASN CG   1 1 
        3  3945 1 1 77 ASN H    H  -7.357 -27.650   1.045 1.00 . A A . 74 ASN H    1 1 
        3  3946 1 1 77 ASN HA   H  -4.762 -28.095  -0.309 1.00 . A A . 74 ASN HA   1 1 
        3  3947 1 1 77 ASN HB2  H  -6.741 -25.844  -1.057 1.00 . A A . 74 ASN HB2  1 1 
        3  3948 1 1 77 ASN HB3  H  -5.158 -26.134  -1.752 1.00 . A A . 74 ASN HB3  1 1 
        3  3949 1 1 77 ASN HD21 H  -4.840 -27.730  -3.230 1.00 . A A . 74 ASN HD21 1 1 
        3  3950 1 1 77 ASN HD22 H  -6.147 -28.611  -3.937 1.00 . A A . 74 ASN HD22 1 1 
        3  3951 1 1 77 ASN N    N  -6.549 -28.109   0.716 1.00 . A A . 74 ASN N    1 1 
        3  3952 1 1 77 ASN ND2  N  -5.780 -28.011  -3.258 1.00 . A A . 74 ASN ND2  1 1 
        3  3953 1 1 77 ASN O    O  -5.548 -25.667   1.626 1.00 . A A . 74 ASN O    1 1 
        3  3954 1 1 77 ASN OD1  O  -7.797 -27.849  -2.299 1.00 . A A . 74 ASN OD1  1 1 
        3  3955 1 1 78 LYS C    C  -2.289 -24.507   1.563 1.00 . A A . 75 LYS C    1 1 
        3  3956 1 1 78 LYS CA   C  -2.891 -25.760   2.217 1.00 . A A . 75 LYS CA   1 1 
        3  3957 1 1 78 LYS CB   C  -1.776 -26.525   3.015 1.00 . A A . 75 LYS CB   1 1 
        3  3958 1 1 78 LYS CD   C  -3.039 -28.087   4.700 1.00 . A A . 75 LYS CD   1 1 
        3  3959 1 1 78 LYS CE   C  -4.133 -27.831   5.740 1.00 . A A . 75 LYS CE   1 1 
        3  3960 1 1 78 LYS CG   C  -2.115 -26.859   4.492 1.00 . A A . 75 LYS CG   1 1 
        3  3961 1 1 78 LYS H    H  -3.016 -27.172   0.581 1.00 . A A . 75 LYS H    1 1 
        3  3962 1 1 78 LYS HA   H  -3.661 -25.458   2.910 1.00 . A A . 75 LYS HA   1 1 
        3  3963 1 1 78 LYS HB2  H  -1.518 -27.444   2.515 1.00 . A A . 75 LYS HB2  1 1 
        3  3964 1 1 78 LYS HB3  H  -0.893 -25.894   3.022 1.00 . A A . 75 LYS HB3  1 1 
        3  3965 1 1 78 LYS HD2  H  -3.508 -28.368   3.781 1.00 . A A . 75 LYS HD2  1 1 
        3  3966 1 1 78 LYS HD3  H  -2.433 -28.915   5.055 1.00 . A A . 75 LYS HD3  1 1 
        3  3967 1 1 78 LYS HE2  H  -4.841 -27.103   5.355 1.00 . A A . 75 LYS HE2  1 1 
        3  3968 1 1 78 LYS HE3  H  -4.656 -28.762   5.927 1.00 . A A . 75 LYS HE3  1 1 
        3  3969 1 1 78 LYS HG2  H  -1.184 -27.059   5.008 1.00 . A A . 75 LYS HG2  1 1 
        3  3970 1 1 78 LYS HG3  H  -2.572 -25.994   4.950 1.00 . A A . 75 LYS HG3  1 1 
        3  3971 1 1 78 LYS HZ1  H  -3.067 -26.436   6.872 1.00 . A A . 75 LYS HZ1  1 1 
        3  3972 1 1 78 LYS HZ2  H  -2.895 -28.026   7.412 1.00 . A A . 75 LYS HZ2  1 1 
        3  3973 1 1 78 LYS HZ3  H  -4.333 -27.185   7.716 1.00 . A A . 75 LYS HZ3  1 1 
        3  3974 1 1 78 LYS N    N  -3.552 -26.581   1.188 1.00 . A A . 75 LYS N    1 1 
        3  3975 1 1 78 LYS NZ   N  -3.569 -27.334   7.025 1.00 . A A . 75 LYS NZ   1 1 
        3  3976 1 1 78 LYS O    O  -1.241 -24.643   0.939 1.00 . A A . 75 LYS O    1 1 
        3  3977 1 1 79 LEU C    C  -2.967 -20.756   1.570 1.00 . A A . 76 LEU C    1 1 
        3  3978 1 1 79 LEU CA   C  -2.299 -22.073   1.074 1.00 . A A . 76 LEU CA   1 1 
        3  3979 1 1 79 LEU CB   C  -2.392 -22.101  -0.501 1.00 . A A . 76 LEU CB   1 1 
        3  3980 1 1 79 LEU CD1  C  -1.337 -23.252  -2.447 1.00 . A A . 76 LEU CD1  1 1 
        3  3981 1 1 79 LEU CD2  C  -0.458 -21.045  -1.717 1.00 . A A . 76 LEU CD2  1 1 
        3  3982 1 1 79 LEU CG   C  -1.075 -22.358  -1.251 1.00 . A A . 76 LEU CG   1 1 
        3  3983 1 1 79 LEU H    H  -3.732 -23.190   2.239 1.00 . A A . 76 LEU H    1 1 
        3  3984 1 1 79 LEU HA   H  -1.244 -22.075   1.327 1.00 . A A . 76 LEU HA   1 1 
        3  3985 1 1 79 LEU HB2  H  -3.101 -22.854  -0.814 1.00 . A A . 76 LEU HB2  1 1 
        3  3986 1 1 79 LEU HB3  H  -2.765 -21.136  -0.824 1.00 . A A . 76 LEU HB3  1 1 
        3  3987 1 1 79 LEU HD11 H  -0.418 -23.407  -2.993 1.00 . A A . 76 LEU HD11 1 1 
        3  3988 1 1 79 LEU HD12 H  -2.063 -22.781  -3.090 1.00 . A A . 76 LEU HD12 1 1 
        3  3989 1 1 79 LEU HD13 H  -1.718 -24.204  -2.105 1.00 . A A . 76 LEU HD13 1 1 
        3  3990 1 1 79 LEU HD21 H   0.484 -21.244  -2.209 1.00 . A A . 76 LEU HD21 1 1 
        3  3991 1 1 79 LEU HD22 H  -0.290 -20.396  -0.869 1.00 . A A . 76 LEU HD22 1 1 
        3  3992 1 1 79 LEU HD23 H  -1.130 -20.563  -2.412 1.00 . A A . 76 LEU HD23 1 1 
        3  3993 1 1 79 LEU HG   H  -0.370 -22.852  -0.597 1.00 . A A . 76 LEU HG   1 1 
        3  3994 1 1 79 LEU N    N  -2.903 -23.286   1.703 1.00 . A A . 76 LEU N    1 1 
        3  3995 1 1 79 LEU O    O  -3.601 -20.113   0.765 1.00 . A A . 76 LEU O    1 1 
        3  3996 1 1 80 ARG C    C  -2.794 -17.819   3.143 1.00 . A A . 77 ARG C    1 1 
        3  3997 1 1 80 ARG CA   C  -3.615 -19.137   3.317 1.00 . A A . 77 ARG CA   1 1 
        3  3998 1 1 80 ARG CB   C  -4.017 -19.406   4.819 1.00 . A A . 77 ARG CB   1 1 
        3  3999 1 1 80 ARG CD   C  -5.570 -17.346   5.350 1.00 . A A . 77 ARG CD   1 1 
        3  4000 1 1 80 ARG CG   C  -4.343 -18.177   5.739 1.00 . A A . 77 ARG CG   1 1 
        3  4001 1 1 80 ARG CZ   C  -6.643 -15.231   6.042 1.00 . A A . 77 ARG CZ   1 1 
        3  4002 1 1 80 ARG H    H  -2.117 -20.658   3.447 1.00 . A A . 77 ARG H    1 1 
        3  4003 1 1 80 ARG HA   H  -4.511 -19.114   2.713 1.00 . A A . 77 ARG HA   1 1 
        3  4004 1 1 80 ARG HB2  H  -4.864 -20.078   4.826 1.00 . A A . 77 ARG HB2  1 1 
        3  4005 1 1 80 ARG HB3  H  -3.193 -19.933   5.277 1.00 . A A . 77 ARG HB3  1 1 
        3  4006 1 1 80 ARG HD2  H  -5.515 -17.103   4.297 1.00 . A A . 77 ARG HD2  1 1 
        3  4007 1 1 80 ARG HD3  H  -6.491 -17.903   5.570 1.00 . A A . 77 ARG HD3  1 1 
        3  4008 1 1 80 ARG HE   H  -4.873 -15.888   6.705 1.00 . A A . 77 ARG HE   1 1 
        3  4009 1 1 80 ARG HG2  H  -4.500 -18.535   6.749 1.00 . A A . 77 ARG HG2  1 1 
        3  4010 1 1 80 ARG HG3  H  -3.479 -17.522   5.736 1.00 . A A . 77 ARG HG3  1 1 
        3  4011 1 1 80 ARG HH11 H  -7.666 -16.257   4.622 1.00 . A A . 77 ARG HH11 1 1 
        3  4012 1 1 80 ARG HH12 H  -8.424 -14.783   5.142 1.00 . A A . 77 ARG HH12 1 1 
        3  4013 1 1 80 ARG HH21 H  -5.933 -13.975   7.466 1.00 . A A . 77 ARG HH21 1 1 
        3  4014 1 1 80 ARG HH22 H  -7.440 -13.496   6.751 1.00 . A A . 77 ARG HH22 1 1 
        3  4015 1 1 80 ARG N    N  -2.806 -20.286   2.846 1.00 . A A . 77 ARG N    1 1 
        3  4016 1 1 80 ARG NE   N  -5.633 -16.100   6.122 1.00 . A A . 77 ARG NE   1 1 
        3  4017 1 1 80 ARG NH1  N  -7.658 -15.447   5.201 1.00 . A A . 77 ARG NH1  1 1 
        3  4018 1 1 80 ARG NH2  N  -6.670 -14.152   6.818 1.00 . A A . 77 ARG NH2  1 1 
        3  4019 1 1 80 ARG O    O  -1.843 -17.591   3.875 1.00 . A A . 77 ARG O    1 1 
        3  4020 1 1 81 VAL C    C  -3.466 -14.489   2.006 1.00 . A A . 78 VAL C    1 1 
        3  4021 1 1 81 VAL CA   C  -2.438 -15.681   1.994 1.00 . A A . 78 VAL CA   1 1 
        3  4022 1 1 81 VAL CB   C  -1.625 -15.733   0.630 1.00 . A A . 78 VAL CB   1 1 
        3  4023 1 1 81 VAL CG1  C  -0.830 -14.470   0.451 1.00 . A A . 78 VAL CG1  1 1 
        3  4024 1 1 81 VAL CG2  C  -0.633 -16.912   0.582 1.00 . A A . 78 VAL CG2  1 1 
        3  4025 1 1 81 VAL H    H  -3.906 -17.125   1.573 1.00 . A A . 78 VAL H    1 1 
        3  4026 1 1 81 VAL HA   H  -1.735 -15.573   2.810 1.00 . A A . 78 VAL HA   1 1 
        3  4027 1 1 81 VAL HB   H  -2.323 -15.828  -0.223 1.00 . A A . 78 VAL HB   1 1 
        3  4028 1 1 81 VAL HG11 H  -1.381 -13.642   0.866 1.00 . A A . 78 VAL HG11 1 1 
        3  4029 1 1 81 VAL HG12 H  -0.655 -14.297  -0.602 1.00 . A A . 78 VAL HG12 1 1 
        3  4030 1 1 81 VAL HG13 H   0.116 -14.568   0.963 1.00 . A A . 78 VAL HG13 1 1 
        3  4031 1 1 81 VAL HG21 H  -0.968 -17.670  -0.111 1.00 . A A . 78 VAL HG21 1 1 
        3  4032 1 1 81 VAL HG22 H  -0.544 -17.349   1.561 1.00 . A A . 78 VAL HG22 1 1 
        3  4033 1 1 81 VAL HG23 H   0.336 -16.543   0.271 1.00 . A A . 78 VAL HG23 1 1 
        3  4034 1 1 81 VAL N    N  -3.159 -16.935   2.183 1.00 . A A . 78 VAL N    1 1 
        3  4035 1 1 81 VAL O    O  -4.349 -14.464   1.148 1.00 . A A . 78 VAL O    1 1 
        3  4036 1 1 82 GLU C    C  -3.660 -11.092   3.484 1.00 . A A . 79 GLU C    1 1 
        3  4037 1 1 82 GLU CA   C  -4.344 -12.378   2.977 1.00 . A A . 79 GLU CA   1 1 
        3  4038 1 1 82 GLU CB   C  -5.563 -12.686   3.875 1.00 . A A . 79 GLU CB   1 1 
        3  4039 1 1 82 GLU CD   C  -7.909 -12.033   4.574 1.00 . A A . 79 GLU CD   1 1 
        3  4040 1 1 82 GLU CG   C  -6.862 -11.951   3.494 1.00 . A A . 79 GLU CG   1 1 
        3  4041 1 1 82 GLU H    H  -2.704 -13.513   3.649 1.00 . A A . 79 GLU H    1 1 
        3  4042 1 1 82 GLU HA   H  -4.688 -12.226   1.965 1.00 . A A . 79 GLU HA   1 1 
        3  4043 1 1 82 GLU HB2  H  -5.759 -13.743   3.842 1.00 . A A . 79 GLU HB2  1 1 
        3  4044 1 1 82 GLU HB3  H  -5.314 -12.415   4.892 1.00 . A A . 79 GLU HB3  1 1 
        3  4045 1 1 82 GLU HG2  H  -6.649 -10.914   3.315 1.00 . A A . 79 GLU HG2  1 1 
        3  4046 1 1 82 GLU HG3  H  -7.273 -12.401   2.594 1.00 . A A . 79 GLU HG3  1 1 
        3  4047 1 1 82 GLU N    N  -3.387 -13.503   2.965 1.00 . A A . 79 GLU N    1 1 
        3  4048 1 1 82 GLU O    O  -2.730 -11.135   4.346 1.00 . A A . 79 GLU O    1 1 
        3  4049 1 1 82 GLU OE1  O  -7.762 -11.324   5.584 1.00 . A A . 79 GLU OE1  1 1 
        3  4050 1 1 82 GLU OE2  O  -8.858 -12.835   4.437 1.00 . A A . 79 GLU OE2  1 1 
        3  4051 1 1 83 VAL C    C  -4.801  -8.187   4.484 1.00 . A A . 80 VAL C    1 1 
        3  4052 1 1 83 VAL CA   C  -3.743  -8.661   3.463 1.00 . A A . 80 VAL CA   1 1 
        3  4053 1 1 83 VAL CB   C  -3.535  -7.607   2.337 1.00 . A A . 80 VAL CB   1 1 
        3  4054 1 1 83 VAL CG1  C  -2.351  -8.020   1.489 1.00 . A A . 80 VAL CG1  1 1 
        3  4055 1 1 83 VAL CG2  C  -4.757  -7.429   1.436 1.00 . A A . 80 VAL CG2  1 1 
        3  4056 1 1 83 VAL H    H  -4.576  -9.994   2.070 1.00 . A A . 80 VAL H    1 1 
        3  4057 1 1 83 VAL HA   H  -2.801  -8.768   3.982 1.00 . A A . 80 VAL HA   1 1 
        3  4058 1 1 83 VAL HB   H  -3.305  -6.652   2.795 1.00 . A A . 80 VAL HB   1 1 
        3  4059 1 1 83 VAL HG11 H  -1.482  -8.141   2.117 1.00 . A A . 80 VAL HG11 1 1 
        3  4060 1 1 83 VAL HG12 H  -2.156  -7.260   0.746 1.00 . A A . 80 VAL HG12 1 1 
        3  4061 1 1 83 VAL HG13 H  -2.572  -8.956   0.997 1.00 . A A . 80 VAL HG13 1 1 
        3  4062 1 1 83 VAL HG21 H  -4.980  -8.363   0.939 1.00 . A A . 80 VAL HG21 1 1 
        3  4063 1 1 83 VAL HG22 H  -4.550  -6.670   0.694 1.00 . A A . 80 VAL HG22 1 1 
        3  4064 1 1 83 VAL HG23 H  -5.603  -7.127   2.032 1.00 . A A . 80 VAL HG23 1 1 
        3  4065 1 1 83 VAL N    N  -4.072  -9.957   2.909 1.00 . A A . 80 VAL N    1 1 
        3  4066 1 1 83 VAL O    O  -5.998  -8.139   4.198 1.00 . A A . 80 VAL O    1 1 
        3  4067 1 1 84 PRO C    C  -5.167  -5.630   6.589 1.00 . A A . 81 PRO C    1 1 
        3  4068 1 1 84 PRO CA   C  -5.207  -7.170   6.711 1.00 . A A . 81 PRO CA   1 1 
        3  4069 1 1 84 PRO CB   C  -4.601  -7.625   8.042 1.00 . A A . 81 PRO CB   1 1 
        3  4070 1 1 84 PRO CD   C  -3.074  -8.282   6.295 1.00 . A A . 81 PRO CD   1 1 
        3  4071 1 1 84 PRO CG   C  -3.167  -7.919   7.755 1.00 . A A . 81 PRO CG   1 1 
        3  4072 1 1 84 PRO HA   H  -6.234  -7.499   6.653 1.00 . A A . 81 PRO HA   1 1 
        3  4073 1 1 84 PRO HB2  H  -4.692  -6.834   8.777 1.00 . A A . 81 PRO HB2  1 1 
        3  4074 1 1 84 PRO HB3  H  -5.100  -8.518   8.392 1.00 . A A . 81 PRO HB3  1 1 
        3  4075 1 1 84 PRO HD2  H  -2.261  -7.746   5.828 1.00 . A A . 81 PRO HD2  1 1 
        3  4076 1 1 84 PRO HD3  H  -2.937  -9.348   6.183 1.00 . A A . 81 PRO HD3  1 1 
        3  4077 1 1 84 PRO HG2  H  -2.569  -7.041   7.960 1.00 . A A . 81 PRO HG2  1 1 
        3  4078 1 1 84 PRO HG3  H  -2.832  -8.750   8.358 1.00 . A A . 81 PRO HG3  1 1 
        3  4079 1 1 84 PRO N    N  -4.367  -7.865   5.722 1.00 . A A . 81 PRO N    1 1 
        3  4080 1 1 84 PRO O    O  -5.355  -4.921   7.583 1.00 . A A . 81 PRO O    1 1 
        3  4081 1 1 85 PHE C    C  -5.860  -3.243   3.991 1.00 . A A . 82 PHE C    1 1 
        3  4082 1 1 85 PHE CA   C  -4.931  -3.673   5.145 1.00 . A A . 82 PHE CA   1 1 
        3  4083 1 1 85 PHE CB   C  -3.486  -3.130   4.935 1.00 . A A . 82 PHE CB   1 1 
        3  4084 1 1 85 PHE CD1  C  -2.910  -3.669   2.530 1.00 . A A . 82 PHE CD1  1 1 
        3  4085 1 1 85 PHE CD2  C  -1.527  -4.543   4.243 1.00 . A A . 82 PHE CD2  1 1 
        3  4086 1 1 85 PHE CE1  C  -2.117  -4.256   1.576 1.00 . A A . 82 PHE CE1  1 1 
        3  4087 1 1 85 PHE CE2  C  -0.719  -5.128   3.296 1.00 . A A . 82 PHE CE2  1 1 
        3  4088 1 1 85 PHE CG   C  -2.633  -3.812   3.875 1.00 . A A . 82 PHE CG   1 1 
        3  4089 1 1 85 PHE CZ   C  -1.011  -4.981   1.960 1.00 . A A . 82 PHE CZ   1 1 
        3  4090 1 1 85 PHE H    H  -4.837  -5.733   4.614 1.00 . A A . 82 PHE H    1 1 
        3  4091 1 1 85 PHE HA   H  -5.319  -3.226   6.051 1.00 . A A . 82 PHE HA   1 1 
        3  4092 1 1 85 PHE HB2  H  -3.554  -2.094   4.656 1.00 . A A . 82 PHE HB2  1 1 
        3  4093 1 1 85 PHE HB3  H  -2.949  -3.193   5.876 1.00 . A A . 82 PHE HB3  1 1 
        3  4094 1 1 85 PHE HD1  H  -3.780  -3.102   2.229 1.00 . A A . 82 PHE HD1  1 1 
        3  4095 1 1 85 PHE HD2  H  -1.294  -4.664   5.289 1.00 . A A . 82 PHE HD2  1 1 
        3  4096 1 1 85 PHE HE1  H  -2.352  -4.137   0.527 1.00 . A A . 82 PHE HE1  1 1 
        3  4097 1 1 85 PHE HE2  H   0.149  -5.705   3.606 1.00 . A A . 82 PHE HE2  1 1 
        3  4098 1 1 85 PHE HZ   H  -0.384  -5.441   1.216 1.00 . A A . 82 PHE HZ   1 1 
        3  4099 1 1 85 PHE N    N  -4.954  -5.121   5.369 1.00 . A A . 82 PHE N    1 1 
        3  4100 1 1 85 PHE O    O  -6.354  -2.115   4.000 1.00 . A A . 82 PHE O    1 1 
        3  4101 1 1 86 ASN C    C  -6.368  -2.744   0.933 1.00 . A A . 83 ASN C    1 1 
        3  4102 1 1 86 ASN CA   C  -6.891  -3.935   1.795 1.00 . A A . 83 ASN CA   1 1 
        3  4103 1 1 86 ASN CB   C  -8.400  -3.732   2.120 1.00 . A A . 83 ASN CB   1 1 
        3  4104 1 1 86 ASN CG   C  -9.110  -5.010   2.553 1.00 . A A . 83 ASN CG   1 1 
        3  4105 1 1 86 ASN H    H  -5.703  -5.066   3.161 1.00 . A A . 83 ASN H    1 1 
        3  4106 1 1 86 ASN HA   H  -6.814  -4.837   1.204 1.00 . A A . 83 ASN HA   1 1 
        3  4107 1 1 86 ASN HB2  H  -8.502  -3.000   2.910 1.00 . A A . 83 ASN HB2  1 1 
        3  4108 1 1 86 ASN HB3  H  -8.893  -3.357   1.235 1.00 . A A . 83 ASN HB3  1 1 
        3  4109 1 1 86 ASN HD21 H -10.804  -4.345   1.762 1.00 . A A . 83 ASN HD21 1 1 
        3  4110 1 1 86 ASN HD22 H -10.882  -5.900   2.512 1.00 . A A . 83 ASN HD22 1 1 
        3  4111 1 1 86 ASN N    N  -6.083  -4.171   3.027 1.00 . A A . 83 ASN N    1 1 
        3  4112 1 1 86 ASN ND2  N -10.395  -5.094   2.246 1.00 . A A . 83 ASN ND2  1 1 
        3  4113 1 1 86 ASN O    O  -6.940  -1.647   0.996 1.00 . A A . 83 ASN O    1 1 
        3  4114 1 1 86 ASN OD1  O  -8.517  -5.911   3.149 1.00 . A A . 83 ASN OD1  1 1 
        3  4115 1 1 87 ALA C    C  -4.100  -0.747   0.118 1.00 . A A . 84 ALA C    1 1 
        3  4116 1 1 87 ALA CA   C  -4.646  -1.927  -0.727 1.00 . A A . 84 ALA CA   1 1 
        3  4117 1 1 87 ALA CB   C  -5.612  -1.497  -1.855 1.00 . A A . 84 ALA CB   1 1 
        3  4118 1 1 87 ALA H    H  -4.809  -3.837   0.201 1.00 . A A . 84 ALA H    1 1 
        3  4119 1 1 87 ALA HA   H  -3.793  -2.402  -1.200 1.00 . A A . 84 ALA HA   1 1 
        3  4120 1 1 87 ALA HB1  H  -5.090  -0.869  -2.562 1.00 . A A . 84 ALA HB1  1 1 
        3  4121 1 1 87 ALA HB2  H  -6.446  -0.954  -1.435 1.00 . A A . 84 ALA HB2  1 1 
        3  4122 1 1 87 ALA HB3  H  -5.984  -2.373  -2.369 1.00 . A A . 84 ALA HB3  1 1 
        3  4123 1 1 87 ALA N    N  -5.260  -2.962   0.152 1.00 . A A . 84 ALA N    1 1 
        3  4124 1 1 87 ALA O    O  -3.639  -0.964   1.234 1.00 . A A . 84 ALA O    1 1 
        3  4125 1 1 88 ARG C    C  -4.569   2.769   0.433 1.00 . A A . 85 ARG C    1 1 
        3  4126 1 1 88 ARG CA   C  -3.558   1.613   0.393 1.00 . A A . 85 ARG CA   1 1 
        3  4127 1 1 88 ARG CB   C  -2.169   2.036  -0.174 1.00 . A A . 85 ARG CB   1 1 
        3  4128 1 1 88 ARG CD   C   0.105   3.058   0.289 1.00 . A A . 85 ARG CD   1 1 
        3  4129 1 1 88 ARG CG   C  -1.375   3.009   0.703 1.00 . A A . 85 ARG CG   1 1 
        3  4130 1 1 88 ARG CZ   C   1.347   4.915   1.433 1.00 . A A . 85 ARG CZ   1 1 
        3  4131 1 1 88 ARG H    H  -4.514   0.639  -1.294 1.00 . A A . 85 ARG H    1 1 
        3  4132 1 1 88 ARG HA   H  -3.420   1.254   1.410 1.00 . A A . 85 ARG HA   1 1 
        3  4133 1 1 88 ARG HB2  H  -1.574   1.150  -0.312 1.00 . A A . 85 ARG HB2  1 1 
        3  4134 1 1 88 ARG HB3  H  -2.311   2.509  -1.135 1.00 . A A . 85 ARG HB3  1 1 
        3  4135 1 1 88 ARG HD2  H   0.676   2.404   0.936 1.00 . A A . 85 ARG HD2  1 1 
        3  4136 1 1 88 ARG HD3  H   0.187   2.707  -0.732 1.00 . A A . 85 ARG HD3  1 1 
        3  4137 1 1 88 ARG HE   H   0.586   4.977  -0.422 1.00 . A A . 85 ARG HE   1 1 
        3  4138 1 1 88 ARG HG2  H  -1.802   3.996   0.600 1.00 . A A . 85 ARG HG2  1 1 
        3  4139 1 1 88 ARG HG3  H  -1.446   2.688   1.729 1.00 . A A . 85 ARG HG3  1 1 
        3  4140 1 1 88 ARG HH11 H   1.184   3.262   2.596 1.00 . A A . 85 ARG HH11 1 1 
        3  4141 1 1 88 ARG HH12 H   2.036   4.589   3.311 1.00 . A A . 85 ARG HH12 1 1 
        3  4142 1 1 88 ARG HH21 H   1.727   6.704   0.554 1.00 . A A . 85 ARG HH21 1 1 
        3  4143 1 1 88 ARG HH22 H   2.342   6.526   2.165 1.00 . A A . 85 ARG HH22 1 1 
        3  4144 1 1 88 ARG N    N  -4.107   0.484  -0.395 1.00 . A A . 85 ARG N    1 1 
        3  4145 1 1 88 ARG NE   N   0.682   4.412   0.372 1.00 . A A . 85 ARG NE   1 1 
        3  4146 1 1 88 ARG NH1  N   1.537   4.194   2.536 1.00 . A A . 85 ARG NH1  1 1 
        3  4147 1 1 88 ARG NH2  N   1.846   6.147   1.378 1.00 . A A . 85 ARG NH2  1 1 
        3  4148 1 1 88 ARG O    O  -4.511   3.673  -0.399 1.00 . A A . 85 ARG O    1 1 
        3  4149 1 1 89 GLU C    C  -6.392   4.916   2.074 1.00 . A A . 86 GLU C    1 1 
        3  4150 1 1 89 GLU CA   C  -6.686   3.597   1.365 1.00 . A A . 86 GLU CA   1 1 
        3  4151 1 1 89 GLU CB   C  -7.903   2.924   2.024 1.00 . A A . 86 GLU CB   1 1 
        3  4152 1 1 89 GLU CD   C -10.394   3.116   2.496 1.00 . A A . 86 GLU CD   1 1 
        3  4153 1 1 89 GLU CG   C  -9.243   3.548   1.614 1.00 . A A . 86 GLU CG   1 1 
        3  4154 1 1 89 GLU H    H  -5.364   2.192   2.226 1.00 . A A . 86 GLU H    1 1 
        3  4155 1 1 89 GLU HA   H  -6.910   3.793   0.326 1.00 . A A . 86 GLU HA   1 1 
        3  4156 1 1 89 GLU HB2  H  -7.914   1.873   1.760 1.00 . A A . 86 GLU HB2  1 1 
        3  4157 1 1 89 GLU HB3  H  -7.803   3.012   3.096 1.00 . A A . 86 GLU HB3  1 1 
        3  4158 1 1 89 GLU HG2  H  -9.164   4.627   1.649 1.00 . A A . 86 GLU HG2  1 1 
        3  4159 1 1 89 GLU HG3  H  -9.468   3.241   0.599 1.00 . A A . 86 GLU HG3  1 1 
        3  4160 1 1 89 GLU N    N  -5.505   2.738   1.413 1.00 . A A . 86 GLU N    1 1 
        3  4161 1 1 89 GLU O    O  -6.788   5.967   1.552 1.00 . A A . 86 GLU O    1 1 
        3  4162 1 1 89 GLU OXT  O  -5.763   4.887   3.153 1.00 . A A . 86 GLU OXT  1 1 
        3  4163 1 1 89 GLU OE1  O -10.974   2.043   2.215 1.00 . A A . 86 GLU OE1  1 1 
        3  4164 1 1 89 GLU OE2  O -10.737   3.854   3.445 1.00 . A A . 86 GLU OE2  1 1 
        4  4165 1 1  1 GLY C    C -13.255   5.917  -1.432 1.00 . A A . -2 GLY C    1 1 
        4  4166 1 1  1 GLY CA   C -14.645   6.438  -1.724 1.00 . A A . -2 GLY CA   1 1 
        4  4167 1 1  1 GLY H1   H -15.513   4.555  -1.959 1.00 . A A . -2 GLY H1   1 1 
        4  4168 1 1  1 GLY H2   H -15.028   5.279  -3.411 1.00 . A A . -2 GLY H2   1 1 
        4  4169 1 1  1 GLY H3   H -16.422   5.821  -2.623 1.00 . A A . -2 GLY H3   1 1 
        4  4170 1 1  1 GLY HA2  H -14.557   7.342  -2.310 1.00 . A A . -2 GLY HA2  1 1 
        4  4171 1 1  1 GLY HA3  H -15.145   6.671  -0.794 1.00 . A A . -2 GLY HA3  1 1 
        4  4172 1 1  1 GLY N    N -15.460   5.455  -2.481 1.00 . A A . -2 GLY N    1 1 
        4  4173 1 1  1 GLY O    O -13.034   4.703  -1.451 1.00 . A A . -2 GLY O    1 1 
        4  4174 1 1  2 SER C    C -10.525   6.731   0.516 1.00 . A A . -1 SER C    1 1 
        4  4175 1 1  2 SER CA   C -10.932   6.462  -0.929 1.00 . A A . -1 SER CA   1 1 
        4  4176 1 1  2 SER CB   C -10.004   7.193  -1.906 1.00 . A A . -1 SER CB   1 1 
        4  4177 1 1  2 SER H    H -12.570   7.777  -1.141 1.00 . A A . -1 SER H    1 1 
        4  4178 1 1  2 SER HA   H -10.854   5.402  -1.105 1.00 . A A . -1 SER HA   1 1 
        4  4179 1 1  2 SER HB2  H -10.064   8.258  -1.740 1.00 . A A . -1 SER HB2  1 1 
        4  4180 1 1  2 SER HB3  H  -8.989   6.866  -1.749 1.00 . A A . -1 SER HB3  1 1 
        4  4181 1 1  2 SER HG   H  -9.756   6.249  -3.598 1.00 . A A . -1 SER HG   1 1 
        4  4182 1 1  2 SER N    N -12.319   6.832  -1.170 1.00 . A A . -1 SER N    1 1 
        4  4183 1 1  2 SER O    O -10.624   5.829   1.330 1.00 . A A . -1 SER O    1 1 
        4  4184 1 1  2 SER OG   O -10.362   6.925  -3.247 1.00 . A A . -1 SER OG   1 1 
        4  4185 1 1  3 HIS C    C  -8.282   7.841   2.469 1.00 . A A .  0 HIS C    1 1 
        4  4186 1 1  3 HIS CA   C  -9.643   8.464   2.152 1.00 . A A .  0 HIS CA   1 1 
        4  4187 1 1  3 HIS CB   C -10.609   8.175   3.335 1.00 . A A .  0 HIS CB   1 1 
        4  4188 1 1  3 HIS CD2  C -13.163   7.805   3.095 1.00 . A A .  0 HIS CD2  1 1 
        4  4189 1 1  3 HIS CE1  C -13.759   9.879   2.731 1.00 . A A .  0 HIS CE1  1 1 
        4  4190 1 1  3 HIS CG   C -12.040   8.565   3.121 1.00 . A A .  0 HIS CG   1 1 
        4  4191 1 1  3 HIS H    H -10.130   8.655   0.090 1.00 . A A .  0 HIS H    1 1 
        4  4192 1 1  3 HIS HA   H  -9.507   9.533   2.079 1.00 . A A .  0 HIS HA   1 1 
        4  4193 1 1  3 HIS HB2  H -10.591   7.117   3.536 1.00 . A A .  0 HIS HB2  1 1 
        4  4194 1 1  3 HIS HB3  H -10.249   8.703   4.209 1.00 . A A .  0 HIS HB3  1 1 
        4  4195 1 1  3 HIS HD1  H -11.861  10.641   2.838 1.00 . A A .  0 HIS HD1  1 1 
        4  4196 1 1  3 HIS HD2  H -13.215   6.738   3.253 1.00 . A A .  0 HIS HD2  1 1 
        4  4197 1 1  3 HIS HE1  H -14.350  10.756   2.525 1.00 . A A .  0 HIS HE1  1 1 
        4  4198 1 1  3 HIS HE2  H -15.161   8.416   3.004 1.00 . A A .  0 HIS HE2  1 1 
        4  4199 1 1  3 HIS N    N -10.129   7.999   0.816 1.00 . A A .  0 HIS N    1 1 
        4  4200 1 1  3 HIS ND1  N -12.448   9.855   2.887 1.00 . A A .  0 HIS ND1  1 1 
        4  4201 1 1  3 HIS NE2  N -14.221   8.647   2.850 1.00 . A A .  0 HIS NE2  1 1 
        4  4202 1 1  3 HIS O    O  -8.210   6.756   3.028 1.00 . A A .  0 HIS O    1 1 
        4  4203 1 1  4 MET C    C  -5.200   8.621   3.542 1.00 . A A .  1 MET C    1 1 
        4  4204 1 1  4 MET CA   C  -5.864   7.976   2.319 1.00 . A A .  1 MET CA   1 1 
        4  4205 1 1  4 MET CB   C  -4.971   8.188   1.078 1.00 . A A .  1 MET CB   1 1 
        4  4206 1 1  4 MET CE   C  -5.028  10.221  -1.537 1.00 . A A .  1 MET CE   1 1 
        4  4207 1 1  4 MET CG   C  -5.632   7.834  -0.249 1.00 . A A .  1 MET CG   1 1 
        4  4208 1 1  4 MET H    H  -7.303   9.414   1.712 1.00 . A A .  1 MET H    1 1 
        4  4209 1 1  4 MET HA   H  -5.974   6.916   2.498 1.00 . A A .  1 MET HA   1 1 
        4  4210 1 1  4 MET HB2  H  -4.682   9.224   1.038 1.00 . A A .  1 MET HB2  1 1 
        4  4211 1 1  4 MET HB3  H  -4.080   7.581   1.181 1.00 . A A .  1 MET HB3  1 1 
        4  4212 1 1  4 MET HE1  H  -5.371  11.100  -2.060 1.00 . A A .  1 MET HE1  1 1 
        4  4213 1 1  4 MET HE2  H  -4.407   9.632  -2.194 1.00 . A A .  1 MET HE2  1 1 
        4  4214 1 1  4 MET HE3  H  -4.454  10.519  -0.671 1.00 . A A .  1 MET HE3  1 1 
        4  4215 1 1  4 MET HG2  H  -4.878   7.457  -0.925 1.00 . A A .  1 MET HG2  1 1 
        4  4216 1 1  4 MET HG3  H  -6.370   7.066  -0.074 1.00 . A A .  1 MET HG3  1 1 
        4  4217 1 1  4 MET N    N  -7.203   8.528   2.117 1.00 . A A .  1 MET N    1 1 
        4  4218 1 1  4 MET O    O  -5.622   9.707   3.962 1.00 . A A .  1 MET O    1 1 
        4  4219 1 1  4 MET SD   S  -6.444   9.249  -1.023 1.00 . A A .  1 MET SD   1 1 
        4  4220 1 1  5 VAL C    C  -4.050   8.231   6.598 1.00 . A A .  2 VAL C    1 1 
        4  4221 1 1  5 VAL CA   C  -3.316   8.373   5.250 1.00 . A A .  2 VAL CA   1 1 
        4  4222 1 1  5 VAL CB   C  -2.736   9.825   5.082 1.00 . A A .  2 VAL CB   1 1 
        4  4223 1 1  5 VAL CG1  C  -1.886  10.223   6.286 1.00 . A A .  2 VAL CG1  1 1 
        4  4224 1 1  5 VAL CG2  C  -1.905   9.932   3.810 1.00 . A A .  2 VAL CG2  1 1 
        4  4225 1 1  5 VAL H    H  -3.993   7.021   3.743 1.00 . A A .  2 VAL H    1 1 
        4  4226 1 1  5 VAL HA   H  -2.468   7.695   5.283 1.00 . A A .  2 VAL HA   1 1 
        4  4227 1 1  5 VAL HB   H  -3.563  10.516   5.006 1.00 . A A .  2 VAL HB   1 1 
        4  4228 1 1  5 VAL HG11 H  -1.540  11.241   6.168 1.00 . A A .  2 VAL HG11 1 1 
        4  4229 1 1  5 VAL HG12 H  -1.037   9.561   6.359 1.00 . A A .  2 VAL HG12 1 1 
        4  4230 1 1  5 VAL HG13 H  -2.481  10.146   7.183 1.00 . A A .  2 VAL HG13 1 1 
        4  4231 1 1  5 VAL HG21 H  -1.537  10.940   3.705 1.00 . A A .  2 VAL HG21 1 1 
        4  4232 1 1  5 VAL HG22 H  -2.521   9.681   2.959 1.00 . A A .  2 VAL HG22 1 1 
        4  4233 1 1  5 VAL HG23 H  -1.073   9.245   3.867 1.00 . A A .  2 VAL HG23 1 1 
        4  4234 1 1  5 VAL N    N  -4.171   7.916   4.104 1.00 . A A .  2 VAL N    1 1 
        4  4235 1 1  5 VAL O    O  -3.625   7.449   7.456 1.00 . A A .  2 VAL O    1 1 
        4  4236 1 1  6 ILE C    C  -5.366   9.757   9.126 1.00 . A A .  3 ILE C    1 1 
        4  4237 1 1  6 ILE CA   C  -6.053   9.062   7.918 1.00 . A A .  3 ILE CA   1 1 
        4  4238 1 1  6 ILE CB   C  -6.722   7.690   8.364 1.00 . A A .  3 ILE CB   1 1 
        4  4239 1 1  6 ILE CD1  C  -8.200   7.252   6.278 1.00 . A A .  3 ILE CD1  1 1 
        4  4240 1 1  6 ILE CG1  C  -7.039   6.788   7.137 1.00 . A A .  3 ILE CG1  1 1 
        4  4241 1 1  6 ILE CG2  C  -8.034   7.952   9.168 1.00 . A A .  3 ILE CG2  1 1 
        4  4242 1 1  6 ILE H    H  -5.400   9.545   5.955 1.00 . A A .  3 ILE H    1 1 
        4  4243 1 1  6 ILE HA   H  -6.867   9.715   7.620 1.00 . A A .  3 ILE HA   1 1 
        4  4244 1 1  6 ILE HB   H  -6.031   7.174   9.011 1.00 . A A .  3 ILE HB   1 1 
        4  4245 1 1  6 ILE HD11 H  -9.098   7.281   6.877 1.00 . A A .  3 ILE HD11 1 1 
        4  4246 1 1  6 ILE HD12 H  -8.335   6.564   5.458 1.00 . A A .  3 ILE HD12 1 1 
        4  4247 1 1  6 ILE HD13 H  -7.993   8.240   5.891 1.00 . A A .  3 ILE HD13 1 1 
        4  4248 1 1  6 ILE HG12 H  -6.167   6.759   6.502 1.00 . A A .  3 ILE HG12 1 1 
        4  4249 1 1  6 ILE HG13 H  -7.253   5.784   7.476 1.00 . A A .  3 ILE HG13 1 1 
        4  4250 1 1  6 ILE HG21 H  -7.957   8.877   9.715 1.00 . A A .  3 ILE HG21 1 1 
        4  4251 1 1  6 ILE HG22 H  -8.221   7.142   9.870 1.00 . A A .  3 ILE HG22 1 1 
        4  4252 1 1  6 ILE HG23 H  -8.875   8.020   8.483 1.00 . A A .  3 ILE HG23 1 1 
        4  4253 1 1  6 ILE N    N  -5.157   8.988   6.729 1.00 . A A .  3 ILE N    1 1 
        4  4254 1 1  6 ILE O    O  -5.757  10.880   9.458 1.00 . A A .  3 ILE O    1 1 
        4  4255 1 1  7 ARG C    C  -2.518   8.759  11.419 1.00 . A A .  4 ARG C    1 1 
        4  4256 1 1  7 ARG CA   C  -3.744   9.615  11.017 1.00 . A A .  4 ARG CA   1 1 
        4  4257 1 1  7 ARG CB   C  -4.822   9.658  12.158 1.00 . A A .  4 ARG CB   1 1 
        4  4258 1 1  7 ARG CD   C  -7.022   8.501  12.632 1.00 . A A .  4 ARG CD   1 1 
        4  4259 1 1  7 ARG CG   C  -5.510   8.327  12.482 1.00 . A A .  4 ARG CG   1 1 
        4  4260 1 1  7 ARG CZ   C  -8.630   9.998  13.825 1.00 . A A .  4 ARG CZ   1 1 
        4  4261 1 1  7 ARG H    H  -3.836   8.402   9.267 1.00 . A A .  4 ARG H    1 1 
        4  4262 1 1  7 ARG HA   H  -3.397  10.624  10.841 1.00 . A A .  4 ARG HA   1 1 
        4  4263 1 1  7 ARG HB2  H  -4.349  10.016  13.059 1.00 . A A .  4 ARG HB2  1 1 
        4  4264 1 1  7 ARG HB3  H  -5.594  10.367  11.875 1.00 . A A .  4 ARG HB3  1 1 
        4  4265 1 1  7 ARG HD2  H  -7.412   8.867  11.701 1.00 . A A .  4 ARG HD2  1 1 
        4  4266 1 1  7 ARG HD3  H  -7.456   7.535  12.846 1.00 . A A .  4 ARG HD3  1 1 
        4  4267 1 1  7 ARG HE   H  -6.712   9.666  14.363 1.00 . A A .  4 ARG HE   1 1 
        4  4268 1 1  7 ARG HG2  H  -5.317   7.632  11.680 1.00 . A A .  4 ARG HG2  1 1 
        4  4269 1 1  7 ARG HG3  H  -5.106   7.936  13.406 1.00 . A A .  4 ARG HG3  1 1 
        4  4270 1 1  7 ARG HH11 H  -9.438   9.118  12.179 1.00 . A A .  4 ARG HH11 1 1 
        4  4271 1 1  7 ARG HH12 H -10.506  10.166  13.055 1.00 . A A .  4 ARG HH12 1 1 
        4  4272 1 1  7 ARG HH21 H  -8.162  11.025  15.510 1.00 . A A .  4 ARG HH21 1 1 
        4  4273 1 1  7 ARG HH22 H  -9.785  11.239  14.936 1.00 . A A .  4 ARG HH22 1 1 
        4  4274 1 1  7 ARG N    N  -4.311   9.139   9.735 1.00 . A A .  4 ARG N    1 1 
        4  4275 1 1  7 ARG NE   N  -7.405   9.438  13.696 1.00 . A A .  4 ARG NE   1 1 
        4  4276 1 1  7 ARG NH1  N  -9.601   9.737  12.948 1.00 . A A .  4 ARG NH1  1 1 
        4  4277 1 1  7 ARG NH2  N  -8.875  10.819  14.838 1.00 . A A .  4 ARG NH2  1 1 
        4  4278 1 1  7 ARG O    O  -2.340   8.442  12.604 1.00 . A A .  4 ARG O    1 1 
        4  4279 1 1  8 GLU C    C  -0.593   6.162  10.764 1.00 . A A .  5 GLU C    1 1 
        4  4280 1 1  8 GLU CA   C  -0.376   7.684  10.527 1.00 . A A .  5 GLU CA   1 1 
        4  4281 1 1  8 GLU CB   C   0.525   8.296  11.664 1.00 . A A .  5 GLU CB   1 1 
        4  4282 1 1  8 GLU CD   C   2.734   8.365  10.424 1.00 . A A .  5 GLU CD   1 1 
        4  4283 1 1  8 GLU CG   C   2.016   7.880  11.666 1.00 . A A .  5 GLU CG   1 1 
        4  4284 1 1  8 GLU H    H  -2.006   8.594   9.480 1.00 . A A .  5 GLU H    1 1 
        4  4285 1 1  8 GLU HA   H   0.118   7.830   9.571 1.00 . A A .  5 GLU HA   1 1 
        4  4286 1 1  8 GLU HB2  H   0.493   9.378  11.587 1.00 . A A .  5 GLU HB2  1 1 
        4  4287 1 1  8 GLU HB3  H   0.098   8.016  12.621 1.00 . A A .  5 GLU HB3  1 1 
        4  4288 1 1  8 GLU HG2  H   2.510   8.317  12.533 1.00 . A A .  5 GLU HG2  1 1 
        4  4289 1 1  8 GLU HG3  H   2.105   6.797  11.727 1.00 . A A .  5 GLU HG3  1 1 
        4  4290 1 1  8 GLU N    N  -1.696   8.396  10.393 1.00 . A A .  5 GLU N    1 1 
        4  4291 1 1  8 GLU O    O  -1.245   5.783  11.743 1.00 . A A .  5 GLU O    1 1 
        4  4292 1 1  8 GLU OE1  O   3.006   9.585  10.333 1.00 . A A .  5 GLU OE1  1 1 
        4  4293 1 1  8 GLU OE2  O   3.021   7.533   9.539 1.00 . A A .  5 GLU OE2  1 1 
        4  4294 1 1  9 SER C    C   0.814   2.977   9.485 1.00 . A A .  6 SER C    1 1 
        4  4295 1 1  9 SER CA   C  -0.354   3.838  10.027 1.00 . A A .  6 SER CA   1 1 
        4  4296 1 1  9 SER CB   C  -1.667   3.493   9.290 1.00 . A A .  6 SER CB   1 1 
        4  4297 1 1  9 SER H    H   0.583   5.563   9.204 1.00 . A A .  6 SER H    1 1 
        4  4298 1 1  9 SER HA   H  -0.485   3.647  11.080 1.00 . A A .  6 SER HA   1 1 
        4  4299 1 1  9 SER HB2  H  -2.400   4.260   9.486 1.00 . A A .  6 SER HB2  1 1 
        4  4300 1 1  9 SER HB3  H  -1.479   3.441   8.225 1.00 . A A .  6 SER HB3  1 1 
        4  4301 1 1  9 SER HG   H  -3.038   2.387  10.156 1.00 . A A .  6 SER HG   1 1 
        4  4302 1 1  9 SER N    N  -0.055   5.270   9.897 1.00 . A A .  6 SER N    1 1 
        4  4303 1 1  9 SER O    O   1.695   3.492   8.790 1.00 . A A .  6 SER O    1 1 
        4  4304 1 1  9 SER OG   O  -2.193   2.245   9.717 1.00 . A A .  6 SER OG   1 1 
        4  4305 1 1 10 VAL C    C   1.204  -0.315   8.351 1.00 . A A .  7 VAL C    1 1 
        4  4306 1 1 10 VAL CA   C   1.836   0.728   9.299 1.00 . A A .  7 VAL CA   1 1 
        4  4307 1 1 10 VAL CB   C   2.686   0.027  10.446 1.00 . A A .  7 VAL CB   1 1 
        4  4308 1 1 10 VAL CG1  C   3.420   1.055  11.285 1.00 . A A .  7 VAL CG1  1 1 
        4  4309 1 1 10 VAL CG2  C   1.891  -0.924  11.375 1.00 . A A .  7 VAL CG2  1 1 
        4  4310 1 1 10 VAL H    H   0.056   1.312  10.317 1.00 . A A .  7 VAL H    1 1 
        4  4311 1 1 10 VAL HA   H   2.525   1.335   8.704 1.00 . A A .  7 VAL HA   1 1 
        4  4312 1 1 10 VAL HB   H   3.445  -0.572   9.958 1.00 . A A .  7 VAL HB   1 1 
        4  4313 1 1 10 VAL HG11 H   3.996   0.550  12.048 1.00 . A A .  7 VAL HG11 1 1 
        4  4314 1 1 10 VAL HG12 H   2.707   1.714  11.753 1.00 . A A .  7 VAL HG12 1 1 
        4  4315 1 1 10 VAL HG13 H   4.084   1.628  10.654 1.00 . A A .  7 VAL HG13 1 1 
        4  4316 1 1 10 VAL HG21 H   2.437  -1.050  12.299 1.00 . A A .  7 VAL HG21 1 1 
        4  4317 1 1 10 VAL HG22 H   1.791  -1.888  10.900 1.00 . A A .  7 VAL HG22 1 1 
        4  4318 1 1 10 VAL HG23 H   0.915  -0.532  11.590 1.00 . A A .  7 VAL HG23 1 1 
        4  4319 1 1 10 VAL N    N   0.803   1.663   9.794 1.00 . A A .  7 VAL N    1 1 
        4  4320 1 1 10 VAL O    O   0.261  -1.031   8.720 1.00 . A A .  7 VAL O    1 1 
        4  4321 1 1 11 SER C    C   1.738  -2.643   6.110 1.00 . A A .  8 SER C    1 1 
        4  4322 1 1 11 SER CA   C   1.104  -1.232   6.077 1.00 . A A .  8 SER CA   1 1 
        4  4323 1 1 11 SER CB   C   1.224  -0.566   4.690 1.00 . A A .  8 SER CB   1 1 
        4  4324 1 1 11 SER H    H   2.449   0.231   6.867 1.00 . A A .  8 SER H    1 1 
        4  4325 1 1 11 SER HA   H   0.054  -1.339   6.313 1.00 . A A .  8 SER HA   1 1 
        4  4326 1 1 11 SER HB2  H   0.262  -0.140   4.412 1.00 . A A .  8 SER HB2  1 1 
        4  4327 1 1 11 SER HB3  H   1.964   0.219   4.728 1.00 . A A .  8 SER HB3  1 1 
        4  4328 1 1 11 SER HG   H   2.483  -1.817   3.890 1.00 . A A .  8 SER HG   1 1 
        4  4329 1 1 11 SER N    N   1.678  -0.342   7.100 1.00 . A A .  8 SER N    1 1 
        4  4330 1 1 11 SER O    O   2.952  -2.812   5.868 1.00 . A A .  8 SER O    1 1 
        4  4331 1 1 11 SER OG   O   1.597  -1.493   3.699 1.00 . A A .  8 SER OG   1 1 
        4  4332 1 1 12 ARG C    C   0.434  -6.155   5.929 1.00 . A A .  9 ARG C    1 1 
        4  4333 1 1 12 ARG CA   C   1.358  -5.055   6.558 1.00 . A A .  9 ARG CA   1 1 
        4  4334 1 1 12 ARG CB   C   1.546  -5.299   8.083 1.00 . A A .  9 ARG CB   1 1 
        4  4335 1 1 12 ARG CD   C   0.633  -4.928  10.411 1.00 . A A .  9 ARG CD   1 1 
        4  4336 1 1 12 ARG CG   C   0.309  -4.979   8.926 1.00 . A A .  9 ARG CG   1 1 
        4  4337 1 1 12 ARG CZ   C  -0.532  -5.373  12.570 1.00 . A A .  9 ARG CZ   1 1 
        4  4338 1 1 12 ARG H    H  -0.105  -3.459   6.294 1.00 . A A .  9 ARG H    1 1 
        4  4339 1 1 12 ARG HA   H   2.326  -5.117   6.085 1.00 . A A .  9 ARG HA   1 1 
        4  4340 1 1 12 ARG HB2  H   1.801  -6.342   8.240 1.00 . A A .  9 ARG HB2  1 1 
        4  4341 1 1 12 ARG HB3  H   2.370  -4.689   8.440 1.00 . A A .  9 ARG HB3  1 1 
        4  4342 1 1 12 ARG HD2  H   1.509  -5.524  10.602 1.00 . A A .  9 ARG HD2  1 1 
        4  4343 1 1 12 ARG HD3  H   0.829  -3.900  10.685 1.00 . A A .  9 ARG HD3  1 1 
        4  4344 1 1 12 ARG HE   H  -1.227  -5.843  10.750 1.00 . A A .  9 ARG HE   1 1 
        4  4345 1 1 12 ARG HG2  H  -0.079  -4.016   8.625 1.00 . A A .  9 ARG HG2  1 1 
        4  4346 1 1 12 ARG HG3  H  -0.448  -5.735   8.758 1.00 . A A .  9 ARG HG3  1 1 
        4  4347 1 1 12 ARG HH11 H   1.246  -4.414  12.820 1.00 . A A .  9 ARG HH11 1 1 
        4  4348 1 1 12 ARG HH12 H   0.384  -4.764  14.282 1.00 . A A .  9 ARG HH12 1 1 
        4  4349 1 1 12 ARG HH21 H  -2.290  -6.371  12.685 1.00 . A A .  9 ARG HH21 1 1 
        4  4350 1 1 12 ARG HH22 H  -1.621  -5.875  14.201 1.00 . A A .  9 ARG HH22 1 1 
        4  4351 1 1 12 ARG N    N   0.878  -3.659   6.325 1.00 . A A .  9 ARG N    1 1 
        4  4352 1 1 12 ARG NE   N  -0.474  -5.433  11.230 1.00 . A A .  9 ARG NE   1 1 
        4  4353 1 1 12 ARG NH1  N   0.446  -4.801  13.279 1.00 . A A .  9 ARG NH1  1 1 
        4  4354 1 1 12 ARG NH2  N  -1.562  -5.916  13.205 1.00 . A A .  9 ARG NH2  1 1 
        4  4355 1 1 12 ARG O    O  -0.754  -5.925   5.819 1.00 . A A .  9 ARG O    1 1 
        4  4356 1 1 13 ILE C    C   0.148  -9.618   6.009 1.00 . A A . 10 ILE C    1 1 
        4  4357 1 1 13 ILE CA   C   0.111  -8.458   5.021 1.00 . A A . 10 ILE CA   1 1 
        4  4358 1 1 13 ILE CB   C   0.571  -9.006   3.589 1.00 . A A . 10 ILE CB   1 1 
        4  4359 1 1 13 ILE CD1  C   0.453  -8.400   1.021 1.00 . A A . 10 ILE CD1  1 1 
        4  4360 1 1 13 ILE CG1  C   0.410  -7.922   2.488 1.00 . A A . 10 ILE CG1  1 1 
        4  4361 1 1 13 ILE CG2  C  -0.158 -10.317   3.176 1.00 . A A . 10 ILE CG2  1 1 
        4  4362 1 1 13 ILE H    H   1.931  -7.549   5.654 1.00 . A A . 10 ILE H    1 1 
        4  4363 1 1 13 ILE HA   H  -0.902  -8.075   4.962 1.00 . A A . 10 ILE HA   1 1 
        4  4364 1 1 13 ILE HB   H   1.625  -9.245   3.689 1.00 . A A . 10 ILE HB   1 1 
        4  4365 1 1 13 ILE HD11 H   0.660  -7.560   0.375 1.00 . A A . 10 ILE HD11 1 1 
        4  4366 1 1 13 ILE HD12 H  -0.508  -8.817   0.740 1.00 . A A . 10 ILE HD12 1 1 
        4  4367 1 1 13 ILE HD13 H   1.209  -9.147   0.894 1.00 . A A . 10 ILE HD13 1 1 
        4  4368 1 1 13 ILE HG12 H  -0.535  -7.431   2.624 1.00 . A A . 10 ILE HG12 1 1 
        4  4369 1 1 13 ILE HG13 H   1.192  -7.199   2.615 1.00 . A A . 10 ILE HG13 1 1 
        4  4370 1 1 13 ILE HG21 H   0.320 -10.739   2.304 1.00 . A A . 10 ILE HG21 1 1 
        4  4371 1 1 13 ILE HG22 H  -1.196 -10.114   2.939 1.00 . A A . 10 ILE HG22 1 1 
        4  4372 1 1 13 ILE HG23 H  -0.108 -11.030   3.986 1.00 . A A . 10 ILE HG23 1 1 
        4  4373 1 1 13 ILE N    N   0.959  -7.371   5.560 1.00 . A A . 10 ILE N    1 1 
        4  4374 1 1 13 ILE O    O   1.235  -9.959   6.528 1.00 . A A . 10 ILE O    1 1 
        4  4375 1 1 14 TYR C    C  -1.370 -12.652   6.323 1.00 . A A . 11 TYR C    1 1 
        4  4376 1 1 14 TYR CA   C  -1.237 -11.329   7.161 1.00 . A A . 11 TYR CA   1 1 
        4  4377 1 1 14 TYR CB   C  -2.510 -11.092   8.012 1.00 . A A . 11 TYR CB   1 1 
        4  4378 1 1 14 TYR CD1  C  -2.031 -11.702  10.407 1.00 . A A . 11 TYR CD1  1 1 
        4  4379 1 1 14 TYR CD2  C  -3.413 -13.174   9.134 1.00 . A A . 11 TYR CD2  1 1 
        4  4380 1 1 14 TYR CE1  C  -2.164 -12.523  11.510 1.00 . A A . 11 TYR CE1  1 1 
        4  4381 1 1 14 TYR CE2  C  -3.547 -14.001  10.232 1.00 . A A . 11 TYR CE2  1 1 
        4  4382 1 1 14 TYR CG   C  -2.651 -12.013   9.203 1.00 . A A . 11 TYR CG   1 1 
        4  4383 1 1 14 TYR CZ   C  -2.921 -13.670  11.417 1.00 . A A . 11 TYR CZ   1 1 
        4  4384 1 1 14 TYR H    H  -1.858  -9.787   5.824 1.00 . A A . 11 TYR H    1 1 
        4  4385 1 1 14 TYR HA   H  -0.380 -11.371   7.816 1.00 . A A . 11 TYR HA   1 1 
        4  4386 1 1 14 TYR HB2  H  -2.503 -10.078   8.391 1.00 . A A . 11 TYR HB2  1 1 
        4  4387 1 1 14 TYR HB3  H  -3.393 -11.223   7.390 1.00 . A A . 11 TYR HB3  1 1 
        4  4388 1 1 14 TYR HD1  H  -1.437 -10.802  10.475 1.00 . A A . 11 TYR HD1  1 1 
        4  4389 1 1 14 TYR HD2  H  -3.897 -13.428   8.206 1.00 . A A . 11 TYR HD2  1 1 
        4  4390 1 1 14 TYR HE1  H  -1.675 -12.263  12.438 1.00 . A A . 11 TYR HE1  1 1 
        4  4391 1 1 14 TYR HE2  H  -4.143 -14.897  10.161 1.00 . A A . 11 TYR HE2  1 1 
        4  4392 1 1 14 TYR HH   H  -2.889 -15.397  12.257 1.00 . A A . 11 TYR HH   1 1 
        4  4393 1 1 14 TYR N    N  -1.054 -10.178   6.269 1.00 . A A . 11 TYR N    1 1 
        4  4394 1 1 14 TYR O    O  -2.260 -12.744   5.458 1.00 . A A . 11 TYR O    1 1 
        4  4395 1 1 14 TYR OH   O  -3.059 -14.490  12.515 1.00 . A A . 11 TYR OH   1 1 
        4  4396 1 1 15 VAL C    C  -0.701 -16.105   6.715 1.00 . A A . 12 VAL C    1 1 
        4  4397 1 1 15 VAL CA   C  -0.578 -14.921   5.748 1.00 . A A . 12 VAL CA   1 1 
        4  4398 1 1 15 VAL CB   C   0.692 -15.112   4.779 1.00 . A A . 12 VAL CB   1 1 
        4  4399 1 1 15 VAL CG1  C   0.658 -16.399   3.944 1.00 . A A . 12 VAL CG1  1 1 
        4  4400 1 1 15 VAL CG2  C   0.892 -13.919   3.853 1.00 . A A . 12 VAL CG2  1 1 
        4  4401 1 1 15 VAL H    H   0.213 -13.627   7.241 1.00 . A A . 12 VAL H    1 1 
        4  4402 1 1 15 VAL HA   H  -1.491 -14.861   5.164 1.00 . A A . 12 VAL HA   1 1 
        4  4403 1 1 15 VAL HB   H   1.594 -15.180   5.395 1.00 . A A . 12 VAL HB   1 1 
        4  4404 1 1 15 VAL HG11 H  -0.173 -16.387   3.251 1.00 . A A . 12 VAL HG11 1 1 
        4  4405 1 1 15 VAL HG12 H   0.577 -17.254   4.598 1.00 . A A . 12 VAL HG12 1 1 
        4  4406 1 1 15 VAL HG13 H   1.581 -16.475   3.384 1.00 . A A . 12 VAL HG13 1 1 
        4  4407 1 1 15 VAL HG21 H   1.219 -13.067   4.427 1.00 . A A . 12 VAL HG21 1 1 
        4  4408 1 1 15 VAL HG22 H  -0.034 -13.683   3.357 1.00 . A A . 12 VAL HG22 1 1 
        4  4409 1 1 15 VAL HG23 H   1.641 -14.167   3.113 1.00 . A A . 12 VAL HG23 1 1 
        4  4410 1 1 15 VAL N    N  -0.495 -13.680   6.534 1.00 . A A . 12 VAL N    1 1 
        4  4411 1 1 15 VAL O    O   0.230 -16.380   7.456 1.00 . A A . 12 VAL O    1 1 
        4  4412 1 1 16 GLY C    C  -2.081 -19.240   6.732 1.00 . A A . 13 GLY C    1 1 
        4  4413 1 1 16 GLY CA   C  -1.953 -17.986   7.579 1.00 . A A . 13 GLY CA   1 1 
        4  4414 1 1 16 GLY H    H  -2.666 -16.452   6.233 1.00 . A A . 13 GLY H    1 1 
        4  4415 1 1 16 GLY HA2  H  -1.055 -18.063   8.178 1.00 . A A . 13 GLY HA2  1 1 
        4  4416 1 1 16 GLY HA3  H  -2.805 -17.907   8.226 1.00 . A A . 13 GLY HA3  1 1 
        4  4417 1 1 16 GLY N    N  -1.862 -16.774   6.763 1.00 . A A . 13 GLY N    1 1 
        4  4418 1 1 16 GLY O    O  -2.394 -19.131   5.559 1.00 . A A . 13 GLY O    1 1 
        4  4419 1 1 17 ASN C    C  -1.189 -21.885   5.266 1.00 . A A . 14 ASN C    1 1 
        4  4420 1 1 17 ASN CA   C  -1.932 -21.760   6.624 1.00 . A A . 14 ASN CA   1 1 
        4  4421 1 1 17 ASN CB   C  -3.410 -22.093   6.415 1.00 . A A . 14 ASN CB   1 1 
        4  4422 1 1 17 ASN CG   C  -4.144 -22.404   7.703 1.00 . A A . 14 ASN CG   1 1 
        4  4423 1 1 17 ASN H    H  -1.587 -20.446   8.302 1.00 . A A . 14 ASN H    1 1 
        4  4424 1 1 17 ASN HA   H  -1.518 -22.506   7.280 1.00 . A A . 14 ASN HA   1 1 
        4  4425 1 1 17 ASN HB2  H  -3.892 -21.252   5.944 1.00 . A A . 14 ASN HB2  1 1 
        4  4426 1 1 17 ASN HB3  H  -3.487 -22.954   5.763 1.00 . A A . 14 ASN HB3  1 1 
        4  4427 1 1 17 ASN HD21 H  -5.783 -21.539   6.995 1.00 . A A . 14 ASN HD21 1 1 
        4  4428 1 1 17 ASN HD22 H  -5.895 -22.165   8.601 1.00 . A A . 14 ASN HD22 1 1 
        4  4429 1 1 17 ASN N    N  -1.821 -20.435   7.327 1.00 . A A . 14 ASN N    1 1 
        4  4430 1 1 17 ASN ND2  N  -5.401 -21.998   7.771 1.00 . A A . 14 ASN ND2  1 1 
        4  4431 1 1 17 ASN O    O  -1.533 -22.745   4.465 1.00 . A A . 14 ASN O    1 1 
        4  4432 1 1 17 ASN OD1  O  -3.591 -22.991   8.632 1.00 . A A . 14 ASN OD1  1 1 
        4  4433 1 1 18 LEU C    C   1.617 -22.471   4.066 1.00 . A A . 15 LEU C    1 1 
        4  4434 1 1 18 LEU CA   C   0.749 -21.210   3.908 1.00 . A A . 15 LEU CA   1 1 
        4  4435 1 1 18 LEU CB   C   1.613 -19.927   3.813 1.00 . A A . 15 LEU CB   1 1 
        4  4436 1 1 18 LEU CD1  C   3.175 -18.896   2.120 1.00 . A A . 15 LEU CD1  1 1 
        4  4437 1 1 18 LEU CD2  C   4.105 -19.952   4.164 1.00 . A A . 15 LEU CD2  1 1 
        4  4438 1 1 18 LEU CG   C   2.993 -20.024   3.123 1.00 . A A . 15 LEU CG   1 1 
        4  4439 1 1 18 LEU H    H  -0.071 -20.281   5.597 1.00 . A A . 15 LEU H    1 1 
        4  4440 1 1 18 LEU HA   H   0.154 -21.299   3.012 1.00 . A A . 15 LEU HA   1 1 
        4  4441 1 1 18 LEU HB2  H   1.037 -19.184   3.287 1.00 . A A . 15 LEU HB2  1 1 
        4  4442 1 1 18 LEU HB3  H   1.768 -19.576   4.817 1.00 . A A . 15 LEU HB3  1 1 
        4  4443 1 1 18 LEU HD11 H   2.381 -18.927   1.389 1.00 . A A . 15 LEU HD11 1 1 
        4  4444 1 1 18 LEU HD12 H   4.126 -19.011   1.624 1.00 . A A . 15 LEU HD12 1 1 
        4  4445 1 1 18 LEU HD13 H   3.155 -17.952   2.642 1.00 . A A . 15 LEU HD13 1 1 
        4  4446 1 1 18 LEU HD21 H   5.065 -20.039   3.675 1.00 . A A . 15 LEU HD21 1 1 
        4  4447 1 1 18 LEU HD22 H   3.986 -20.763   4.869 1.00 . A A . 15 LEU HD22 1 1 
        4  4448 1 1 18 LEU HD23 H   4.052 -19.009   4.689 1.00 . A A . 15 LEU HD23 1 1 
        4  4449 1 1 18 LEU HG   H   3.075 -20.966   2.601 1.00 . A A . 15 LEU HG   1 1 
        4  4450 1 1 18 LEU N    N  -0.169 -21.060   5.035 1.00 . A A . 15 LEU N    1 1 
        4  4451 1 1 18 LEU O    O   2.253 -22.667   5.109 1.00 . A A . 15 LEU O    1 1 
        4  4452 1 1 19 PRO C    C   3.857 -24.090   2.223 1.00 . A A . 16 PRO C    1 1 
        4  4453 1 1 19 PRO CA   C   2.569 -24.477   3.005 1.00 . A A . 16 PRO CA   1 1 
        4  4454 1 1 19 PRO CB   C   1.772 -25.557   2.258 1.00 . A A . 16 PRO CB   1 1 
        4  4455 1 1 19 PRO CD   C   0.661 -23.408   1.935 1.00 . A A . 16 PRO CD   1 1 
        4  4456 1 1 19 PRO CG   C   0.709 -24.842   1.465 1.00 . A A . 16 PRO CG   1 1 
        4  4457 1 1 19 PRO HA   H   2.805 -24.829   3.993 1.00 . A A . 16 PRO HA   1 1 
        4  4458 1 1 19 PRO HB2  H   2.437 -26.103   1.603 1.00 . A A . 16 PRO HB2  1 1 
        4  4459 1 1 19 PRO HB3  H   1.314 -26.239   2.961 1.00 . A A . 16 PRO HB3  1 1 
        4  4460 1 1 19 PRO HD2  H   0.980 -22.744   1.146 1.00 . A A . 16 PRO HD2  1 1 
        4  4461 1 1 19 PRO HD3  H  -0.335 -23.146   2.269 1.00 . A A . 16 PRO HD3  1 1 
        4  4462 1 1 19 PRO HG2  H   0.972 -24.876   0.412 1.00 . A A . 16 PRO HG2  1 1 
        4  4463 1 1 19 PRO HG3  H  -0.251 -25.315   1.619 1.00 . A A . 16 PRO HG3  1 1 
        4  4464 1 1 19 PRO N    N   1.618 -23.368   3.053 1.00 . A A . 16 PRO N    1 1 
        4  4465 1 1 19 PRO O    O   3.756 -23.766   1.027 1.00 . A A . 16 PRO O    1 1 
        4  4466 1 1 20 SER C    C   6.293 -22.477   1.471 1.00 . A A . 17 SER C    1 1 
        4  4467 1 1 20 SER CA   C   6.374 -23.763   2.328 1.00 . A A . 17 SER CA   1 1 
        4  4468 1 1 20 SER CB   C   7.096 -24.893   1.569 1.00 . A A . 17 SER CB   1 1 
        4  4469 1 1 20 SER H    H   5.071 -24.628   3.765 1.00 . A A . 17 SER H    1 1 
        4  4470 1 1 20 SER HA   H   6.976 -23.520   3.197 1.00 . A A . 17 SER HA   1 1 
        4  4471 1 1 20 SER HB2  H   6.469 -25.242   0.763 1.00 . A A . 17 SER HB2  1 1 
        4  4472 1 1 20 SER HB3  H   8.028 -24.517   1.162 1.00 . A A . 17 SER HB3  1 1 
        4  4473 1 1 20 SER HG   H   7.795 -25.648   3.234 1.00 . A A . 17 SER HG   1 1 
        4  4474 1 1 20 SER N    N   5.057 -24.215   2.874 1.00 . A A . 17 SER N    1 1 
        4  4475 1 1 20 SER O    O   6.165 -21.394   2.035 1.00 . A A . 17 SER O    1 1 
        4  4476 1 1 20 SER OG   O   7.379 -25.980   2.433 1.00 . A A . 17 SER OG   1 1 
        4  4477 1 1 21 HIS C    C   7.378 -20.523  -0.695 1.00 . A A . 18 HIS C    1 1 
        4  4478 1 1 21 HIS CA   C   6.273 -21.577  -0.912 1.00 . A A . 18 HIS CA   1 1 
        4  4479 1 1 21 HIS CB   C   4.862 -20.955  -1.060 1.00 . A A . 18 HIS CB   1 1 
        4  4480 1 1 21 HIS CD2  C   3.837 -18.980  -2.447 1.00 . A A . 18 HIS CD2  1 1 
        4  4481 1 1 21 HIS CE1  C   5.189 -19.063  -4.173 1.00 . A A . 18 HIS CE1  1 1 
        4  4482 1 1 21 HIS CG   C   4.700 -20.009  -2.239 1.00 . A A . 18 HIS CG   1 1 
        4  4483 1 1 21 HIS H    H   6.348 -23.580  -0.213 1.00 . A A . 18 HIS H    1 1 
        4  4484 1 1 21 HIS HA   H   6.497 -22.068  -1.844 1.00 . A A . 18 HIS HA   1 1 
        4  4485 1 1 21 HIS HB2  H   4.144 -21.756  -1.174 1.00 . A A . 18 HIS HB2  1 1 
        4  4486 1 1 21 HIS HB3  H   4.634 -20.416  -0.162 1.00 . A A . 18 HIS HB3  1 1 
        4  4487 1 1 21 HIS HD1  H   6.262 -20.671  -3.504 1.00 . A A . 18 HIS HD1  1 1 
        4  4488 1 1 21 HIS HD2  H   3.026 -18.679  -1.796 1.00 . A A . 18 HIS HD2  1 1 
        4  4489 1 1 21 HIS HE1  H   5.668 -18.844  -5.112 1.00 . A A . 18 HIS HE1  1 1 
        4  4490 1 1 21 HIS HE2  H   3.575 -17.810  -4.182 1.00 . A A . 18 HIS HE2  1 1 
        4  4491 1 1 21 HIS N    N   6.306 -22.653   0.115 1.00 . A A . 18 HIS N    1 1 
        4  4492 1 1 21 HIS ND1  N   5.531 -20.029  -3.344 1.00 . A A . 18 HIS ND1  1 1 
        4  4493 1 1 21 HIS NE2  N   4.165 -18.406  -3.659 1.00 . A A . 18 HIS NE2  1 1 
        4  4494 1 1 21 HIS O    O   8.473 -20.676  -1.237 1.00 . A A . 18 HIS O    1 1 
        4  4495 1 1 22 VAL C    C   8.808 -18.807   1.759 1.00 . A A . 19 VAL C    1 1 
        4  4496 1 1 22 VAL CA   C   8.146 -18.500   0.365 1.00 . A A . 19 VAL CA   1 1 
        4  4497 1 1 22 VAL CB   C   7.604 -16.988   0.233 1.00 . A A . 19 VAL CB   1 1 
        4  4498 1 1 22 VAL CG1  C   7.163 -16.663  -1.203 1.00 . A A . 19 VAL CG1  1 1 
        4  4499 1 1 22 VAL CG2  C   6.435 -16.650   1.187 1.00 . A A . 19 VAL CG2  1 1 
        4  4500 1 1 22 VAL H    H   6.216 -19.396   0.511 1.00 . A A . 19 VAL H    1 1 
        4  4501 1 1 22 VAL HA   H   8.878 -18.658  -0.401 1.00 . A A . 19 VAL HA   1 1 
        4  4502 1 1 22 VAL HB   H   8.408 -16.315   0.464 1.00 . A A . 19 VAL HB   1 1 
        4  4503 1 1 22 VAL HG11 H   8.009 -16.702  -1.872 1.00 . A A . 19 VAL HG11 1 1 
        4  4504 1 1 22 VAL HG12 H   6.738 -15.669  -1.231 1.00 . A A . 19 VAL HG12 1 1 
        4  4505 1 1 22 VAL HG13 H   6.415 -17.372  -1.530 1.00 . A A . 19 VAL HG13 1 1 
        4  4506 1 1 22 VAL HG21 H   5.575 -17.256   0.938 1.00 . A A . 19 VAL HG21 1 1 
        4  4507 1 1 22 VAL HG22 H   6.174 -15.596   1.096 1.00 . A A . 19 VAL HG22 1 1 
        4  4508 1 1 22 VAL HG23 H   6.730 -16.848   2.207 1.00 . A A . 19 VAL HG23 1 1 
        4  4509 1 1 22 VAL N    N   7.106 -19.476   0.091 1.00 . A A . 19 VAL N    1 1 
        4  4510 1 1 22 VAL O    O   8.110 -18.801   2.774 1.00 . A A . 19 VAL O    1 1 
        4  4511 1 1 23 SER C    C  11.276 -17.710   3.487 1.00 . A A . 20 SER C    1 1 
        4  4512 1 1 23 SER CA   C  10.870 -19.158   3.119 1.00 . A A . 20 SER CA   1 1 
        4  4513 1 1 23 SER CB   C  12.102 -20.074   3.001 1.00 . A A . 20 SER CB   1 1 
        4  4514 1 1 23 SER H    H  10.645 -19.509   1.024 1.00 . A A . 20 SER H    1 1 
        4  4515 1 1 23 SER HA   H  10.200 -19.547   3.868 1.00 . A A . 20 SER HA   1 1 
        4  4516 1 1 23 SER HB2  H  12.864 -19.596   2.405 1.00 . A A . 20 SER HB2  1 1 
        4  4517 1 1 23 SER HB3  H  12.496 -20.284   3.981 1.00 . A A . 20 SER HB3  1 1 
        4  4518 1 1 23 SER HG   H  10.965 -21.665   2.823 1.00 . A A . 20 SER HG   1 1 
        4  4519 1 1 23 SER N    N  10.152 -19.145   1.824 1.00 . A A . 20 SER N    1 1 
        4  4520 1 1 23 SER O    O  11.126 -16.849   2.625 1.00 . A A . 20 SER O    1 1 
        4  4521 1 1 23 SER OG   O  11.749 -21.304   2.392 1.00 . A A . 20 SER OG   1 1 
        4  4522 1 1 24 SER C    C  12.839 -15.145   4.203 1.00 . A A . 21 SER C    1 1 
        4  4523 1 1 24 SER CA   C  12.075 -16.052   5.224 1.00 . A A . 21 SER CA   1 1 
        4  4524 1 1 24 SER CB   C  12.926 -16.163   6.489 1.00 . A A . 21 SER CB   1 1 
        4  4525 1 1 24 SER H    H  11.935 -18.163   5.383 1.00 . A A . 21 SER H    1 1 
        4  4526 1 1 24 SER HA   H  11.131 -15.605   5.499 1.00 . A A . 21 SER HA   1 1 
        4  4527 1 1 24 SER HB2  H  13.932 -16.445   6.218 1.00 . A A . 21 SER HB2  1 1 
        4  4528 1 1 24 SER HB3  H  12.946 -15.205   6.994 1.00 . A A . 21 SER HB3  1 1 
        4  4529 1 1 24 SER HG   H  12.393 -16.785   8.272 1.00 . A A . 21 SER HG   1 1 
        4  4530 1 1 24 SER N    N  11.792 -17.432   4.734 1.00 . A A . 21 SER N    1 1 
        4  4531 1 1 24 SER O    O  12.417 -13.984   3.909 1.00 . A A . 21 SER O    1 1 
        4  4532 1 1 24 SER OG   O  12.400 -17.140   7.378 1.00 . A A . 21 SER OG   1 1 
        4  4533 1 1 25 ARG C    C  13.989 -14.576   1.349 1.00 . A A . 22 ARG C    1 1 
        4  4534 1 1 25 ARG CA   C  14.779 -14.969   2.657 1.00 . A A . 22 ARG CA   1 1 
        4  4535 1 1 25 ARG CB   C  16.173 -15.689   2.392 1.00 . A A . 22 ARG CB   1 1 
        4  4536 1 1 25 ARG CD   C  16.602 -16.330  -0.053 1.00 . A A . 22 ARG CD   1 1 
        4  4537 1 1 25 ARG CG   C  16.909 -15.354   1.079 1.00 . A A . 22 ARG CG   1 1 
        4  4538 1 1 25 ARG CZ   C  17.037 -14.991  -2.130 1.00 . A A . 22 ARG CZ   1 1 
        4  4539 1 1 25 ARG H    H  14.225 -16.596   3.968 1.00 . A A . 22 ARG H    1 1 
        4  4540 1 1 25 ARG HA   H  15.000 -14.037   3.166 1.00 . A A . 22 ARG HA   1 1 
        4  4541 1 1 25 ARG HB2  H  16.840 -15.385   3.181 1.00 . A A . 22 ARG HB2  1 1 
        4  4542 1 1 25 ARG HB3  H  16.073 -16.762   2.454 1.00 . A A . 22 ARG HB3  1 1 
        4  4543 1 1 25 ARG HD2  H  17.474 -16.928  -0.253 1.00 . A A . 22 ARG HD2  1 1 
        4  4544 1 1 25 ARG HD3  H  15.779 -16.976   0.247 1.00 . A A . 22 ARG HD3  1 1 
        4  4545 1 1 25 ARG HE   H  15.252 -15.627  -1.493 1.00 . A A . 22 ARG HE   1 1 
        4  4546 1 1 25 ARG HG2  H  16.628 -14.369   0.746 1.00 . A A . 22 ARG HG2  1 1 
        4  4547 1 1 25 ARG HG3  H  17.973 -15.373   1.264 1.00 . A A . 22 ARG HG3  1 1 
        4  4548 1 1 25 ARG HH11 H  18.751 -15.442  -1.162 1.00 . A A . 22 ARG HH11 1 1 
        4  4549 1 1 25 ARG HH12 H  18.941 -14.511  -2.606 1.00 . A A . 22 ARG HH12 1 1 
        4  4550 1 1 25 ARG HH21 H  15.506 -14.360  -3.303 1.00 . A A . 22 ARG HH21 1 1 
        4  4551 1 1 25 ARG HH22 H  17.095 -13.891  -3.825 1.00 . A A . 22 ARG HH22 1 1 
        4  4552 1 1 25 ARG N    N  13.945 -15.700   3.651 1.00 . A A . 22 ARG N    1 1 
        4  4553 1 1 25 ARG NE   N  16.219 -15.612  -1.271 1.00 . A A . 22 ARG NE   1 1 
        4  4554 1 1 25 ARG NH1  N  18.350 -14.981  -1.954 1.00 . A A . 22 ARG NH1  1 1 
        4  4555 1 1 25 ARG NH2  N  16.510 -14.357  -3.166 1.00 . A A . 22 ARG NH2  1 1 
        4  4556 1 1 25 ARG O    O  14.110 -13.427   0.880 1.00 . A A . 22 ARG O    1 1 
        4  4557 1 1 26 ASP C    C  11.028 -14.287   0.089 1.00 . A A . 23 ASP C    1 1 
        4  4558 1 1 26 ASP CA   C  12.291 -15.093  -0.342 1.00 . A A . 23 ASP CA   1 1 
        4  4559 1 1 26 ASP CB   C  12.083 -16.146  -1.534 1.00 . A A . 23 ASP CB   1 1 
        4  4560 1 1 26 ASP CG   C  13.275 -16.171  -2.452 1.00 . A A . 23 ASP CG   1 1 
        4  4561 1 1 26 ASP H    H  13.149 -16.391   1.093 1.00 . A A . 23 ASP H    1 1 
        4  4562 1 1 26 ASP HA   H  12.897 -14.314  -0.802 1.00 . A A . 23 ASP HA   1 1 
        4  4563 1 1 26 ASP HB2  H  11.951 -17.171  -1.207 1.00 . A A . 23 ASP HB2  1 1 
        4  4564 1 1 26 ASP HB3  H  11.233 -15.852  -2.146 1.00 . A A . 23 ASP HB3  1 1 
        4  4565 1 1 26 ASP N    N  13.164 -15.485   0.774 1.00 . A A . 23 ASP N    1 1 
        4  4566 1 1 26 ASP O    O  10.466 -13.646  -0.811 1.00 . A A . 23 ASP O    1 1 
        4  4567 1 1 26 ASP OD1  O  13.452 -15.221  -3.241 1.00 . A A . 23 ASP OD1  1 1 
        4  4568 1 1 26 ASP OD2  O  14.056 -17.138  -2.372 1.00 . A A . 23 ASP OD2  1 1 
        4  4569 1 1 27 VAL C    C  10.256 -11.878   1.615 1.00 . A A . 24 VAL C    1 1 
        4  4570 1 1 27 VAL CA   C   9.575 -13.237   1.804 1.00 . A A . 24 VAL CA   1 1 
        4  4571 1 1 27 VAL CB   C   8.961 -13.363   3.270 1.00 . A A . 24 VAL CB   1 1 
        4  4572 1 1 27 VAL CG1  C   7.634 -12.669   3.403 1.00 . A A . 24 VAL CG1  1 1 
        4  4573 1 1 27 VAL CG2  C   8.786 -14.788   3.777 1.00 . A A . 24 VAL CG2  1 1 
        4  4574 1 1 27 VAL H    H  10.777 -14.938   2.130 1.00 . A A . 24 VAL H    1 1 
        4  4575 1 1 27 VAL HA   H   8.775 -13.263   1.103 1.00 . A A . 24 VAL HA   1 1 
        4  4576 1 1 27 VAL HB   H   9.599 -12.850   3.950 1.00 . A A . 24 VAL HB   1 1 
        4  4577 1 1 27 VAL HG11 H   7.731 -11.643   3.093 1.00 . A A . 24 VAL HG11 1 1 
        4  4578 1 1 27 VAL HG12 H   7.327 -12.705   4.440 1.00 . A A . 24 VAL HG12 1 1 
        4  4579 1 1 27 VAL HG13 H   6.892 -13.173   2.800 1.00 . A A . 24 VAL HG13 1 1 
        4  4580 1 1 27 VAL HG21 H   9.607 -15.044   4.410 1.00 . A A . 24 VAL HG21 1 1 
        4  4581 1 1 27 VAL HG22 H   8.732 -15.489   2.955 1.00 . A A . 24 VAL HG22 1 1 
        4  4582 1 1 27 VAL HG23 H   7.872 -14.834   4.351 1.00 . A A . 24 VAL HG23 1 1 
        4  4583 1 1 27 VAL N    N  10.519 -14.279   1.419 1.00 . A A . 24 VAL N    1 1 
        4  4584 1 1 27 VAL O    O   9.637 -10.988   0.994 1.00 . A A . 24 VAL O    1 1 
        4  4585 1 1 28 GLU C    C  12.405 -10.207   0.261 1.00 . A A . 25 GLU C    1 1 
        4  4586 1 1 28 GLU CA   C  12.272 -10.497   1.783 1.00 . A A . 25 GLU CA   1 1 
        4  4587 1 1 28 GLU CB   C  13.660 -10.466   2.479 1.00 . A A . 25 GLU CB   1 1 
        4  4588 1 1 28 GLU CD   C  15.345  -8.616   1.974 1.00 . A A . 25 GLU CD   1 1 
        4  4589 1 1 28 GLU CG   C  14.170  -9.061   2.829 1.00 . A A . 25 GLU CG   1 1 
        4  4590 1 1 28 GLU H    H  11.986 -12.411   2.600 1.00 . A A . 25 GLU H    1 1 
        4  4591 1 1 28 GLU HA   H  11.664  -9.710   2.204 1.00 . A A . 25 GLU HA   1 1 
        4  4592 1 1 28 GLU HB2  H  13.629 -11.055   3.385 1.00 . A A . 25 GLU HB2  1 1 
        4  4593 1 1 28 GLU HB3  H  14.381 -10.905   1.817 1.00 . A A . 25 GLU HB3  1 1 
        4  4594 1 1 28 GLU HG2  H  13.374  -8.350   2.696 1.00 . A A . 25 GLU HG2  1 1 
        4  4595 1 1 28 GLU HG3  H  14.485  -9.053   3.865 1.00 . A A . 25 GLU HG3  1 1 
        4  4596 1 1 28 GLU N    N  11.550 -11.729   2.058 1.00 . A A . 25 GLU N    1 1 
        4  4597 1 1 28 GLU O    O  11.959  -9.154  -0.127 1.00 . A A . 25 GLU O    1 1 
        4  4598 1 1 28 GLU OE1  O  15.122  -8.179   0.821 1.00 . A A . 25 GLU OE1  1 1 
        4  4599 1 1 28 GLU OE2  O  16.491  -8.700   2.460 1.00 . A A . 25 GLU OE2  1 1 
        4  4600 1 1 29 ASN C    C  11.829 -10.635  -2.912 1.00 . A A . 26 ASN C    1 1 
        4  4601 1 1 29 ASN CA   C  13.147 -10.719  -2.059 1.00 . A A . 26 ASN CA   1 1 
        4  4602 1 1 29 ASN CB   C  14.219 -11.578  -2.811 1.00 . A A . 26 ASN CB   1 1 
        4  4603 1 1 29 ASN CG   C  14.440 -11.106  -4.245 1.00 . A A . 26 ASN CG   1 1 
        4  4604 1 1 29 ASN H    H  13.245 -11.983  -0.304 1.00 . A A . 26 ASN H    1 1 
        4  4605 1 1 29 ASN HA   H  13.536  -9.725  -2.007 1.00 . A A . 26 ASN HA   1 1 
        4  4606 1 1 29 ASN HB2  H  15.181 -11.501  -2.304 1.00 . A A . 26 ASN HB2  1 1 
        4  4607 1 1 29 ASN HB3  H  13.906 -12.615  -2.854 1.00 . A A . 26 ASN HB3  1 1 
        4  4608 1 1 29 ASN HD21 H  15.746  -9.748  -3.618 1.00 . A A . 26 ASN HD21 1 1 
        4  4609 1 1 29 ASN HD22 H  15.456  -9.781  -5.321 1.00 . A A . 26 ASN HD22 1 1 
        4  4610 1 1 29 ASN N    N  12.944 -11.119  -0.619 1.00 . A A . 26 ASN N    1 1 
        4  4611 1 1 29 ASN ND2  N  15.303 -10.114  -4.411 1.00 . A A . 26 ASN ND2  1 1 
        4  4612 1 1 29 ASN O    O  11.534  -9.515  -3.521 1.00 . A A . 26 ASN O    1 1 
        4  4613 1 1 29 ASN OD1  O  13.844 -11.624  -5.189 1.00 . A A . 26 ASN OD1  1 1 
        4  4614 1 1 30 GLU C    C   8.837 -10.596  -3.130 1.00 . A A . 27 GLU C    1 1 
        4  4615 1 1 30 GLU CA   C   9.734 -11.713  -3.672 1.00 . A A . 27 GLU CA   1 1 
        4  4616 1 1 30 GLU CB   C   9.018 -13.092  -3.631 1.00 . A A . 27 GLU CB   1 1 
        4  4617 1 1 30 GLU CD   C   8.393 -13.543  -6.084 1.00 . A A . 27 GLU CD   1 1 
        4  4618 1 1 30 GLU CG   C   7.888 -13.364  -4.665 1.00 . A A . 27 GLU CG   1 1 
        4  4619 1 1 30 GLU H    H  11.287 -12.622  -2.547 1.00 . A A . 27 GLU H    1 1 
        4  4620 1 1 30 GLU HA   H   9.970 -11.479  -4.703 1.00 . A A . 27 GLU HA   1 1 
        4  4621 1 1 30 GLU HB2  H   9.764 -13.852  -3.770 1.00 . A A . 27 GLU HB2  1 1 
        4  4622 1 1 30 GLU HB3  H   8.596 -13.213  -2.662 1.00 . A A . 27 GLU HB3  1 1 
        4  4623 1 1 30 GLU HG2  H   7.386 -14.287  -4.381 1.00 . A A . 27 GLU HG2  1 1 
        4  4624 1 1 30 GLU HG3  H   7.163 -12.561  -4.650 1.00 . A A . 27 GLU HG3  1 1 
        4  4625 1 1 30 GLU N    N  11.004 -11.745  -2.947 1.00 . A A . 27 GLU N    1 1 
        4  4626 1 1 30 GLU O    O   8.224  -9.931  -3.940 1.00 . A A . 27 GLU O    1 1 
        4  4627 1 1 30 GLU OE1  O   8.724 -14.694  -6.448 1.00 . A A . 27 GLU OE1  1 1 
        4  4628 1 1 30 GLU OE2  O   8.444 -12.548  -6.836 1.00 . A A . 27 GLU OE2  1 1 
        4  4629 1 1 31 PHE C    C   8.543  -7.793  -1.601 1.00 . A A . 28 PHE C    1 1 
        4  4630 1 1 31 PHE CA   C   7.899  -9.182  -1.440 1.00 . A A . 28 PHE CA   1 1 
        4  4631 1 1 31 PHE CB   C   7.220  -9.349  -0.073 1.00 . A A . 28 PHE CB   1 1 
        4  4632 1 1 31 PHE CD1  C   4.771  -9.833  -0.443 1.00 . A A . 28 PHE CD1  1 1 
        4  4633 1 1 31 PHE CD2  C   6.149 -11.638   0.332 1.00 . A A . 28 PHE CD2  1 1 
        4  4634 1 1 31 PHE CE1  C   3.673 -10.677  -0.420 1.00 . A A . 28 PHE CE1  1 1 
        4  4635 1 1 31 PHE CE2  C   5.034 -12.457   0.351 1.00 . A A . 28 PHE CE2  1 1 
        4  4636 1 1 31 PHE CG   C   6.034 -10.298  -0.063 1.00 . A A . 28 PHE CG   1 1 
        4  4637 1 1 31 PHE CZ   C   3.811 -11.974  -0.020 1.00 . A A . 28 PHE CZ   1 1 
        4  4638 1 1 31 PHE H    H   9.370 -10.701  -1.109 1.00 . A A . 28 PHE H    1 1 
        4  4639 1 1 31 PHE HA   H   7.135  -9.235  -2.193 1.00 . A A . 28 PHE HA   1 1 
        4  4640 1 1 31 PHE HB2  H   7.936  -9.717   0.634 1.00 . A A . 28 PHE HB2  1 1 
        4  4641 1 1 31 PHE HB3  H   6.868  -8.381   0.254 1.00 . A A . 28 PHE HB3  1 1 
        4  4642 1 1 31 PHE HD1  H   4.648  -8.810  -0.772 1.00 . A A . 28 PHE HD1  1 1 
        4  4643 1 1 31 PHE HD2  H   7.107 -12.041   0.651 1.00 . A A . 28 PHE HD2  1 1 
        4  4644 1 1 31 PHE HE1  H   2.702 -10.320  -0.729 1.00 . A A . 28 PHE HE1  1 1 
        4  4645 1 1 31 PHE HE2  H   5.128 -13.484   0.639 1.00 . A A . 28 PHE HE2  1 1 
        4  4646 1 1 31 PHE HZ   H   2.950 -12.625   0.008 1.00 . A A . 28 PHE HZ   1 1 
        4  4647 1 1 31 PHE N    N   8.788 -10.277  -1.795 1.00 . A A . 28 PHE N    1 1 
        4  4648 1 1 31 PHE O    O   7.808  -6.819  -1.787 1.00 . A A . 28 PHE O    1 1 
        4  4649 1 1 32 ARG C    C  10.473  -5.880  -3.183 1.00 . A A . 29 ARG C    1 1 
        4  4650 1 1 32 ARG CA   C  10.617  -6.407  -1.788 1.00 . A A . 29 ARG CA   1 1 
        4  4651 1 1 32 ARG CB   C  12.138  -6.360  -1.366 1.00 . A A . 29 ARG CB   1 1 
        4  4652 1 1 32 ARG CD   C  13.675  -6.207  -3.457 1.00 . A A . 29 ARG CD   1 1 
        4  4653 1 1 32 ARG CG   C  13.215  -7.051  -2.258 1.00 . A A . 29 ARG CG   1 1 
        4  4654 1 1 32 ARG CZ   C  14.763  -4.127  -2.552 1.00 . A A . 29 ARG CZ   1 1 
        4  4655 1 1 32 ARG H    H  10.392  -8.475  -1.278 1.00 . A A . 29 ARG H    1 1 
        4  4656 1 1 32 ARG HA   H  10.104  -5.697  -1.167 1.00 . A A . 29 ARG HA   1 1 
        4  4657 1 1 32 ARG HB2  H  12.417  -5.321  -1.302 1.00 . A A . 29 ARG HB2  1 1 
        4  4658 1 1 32 ARG HB3  H  12.222  -6.779  -0.368 1.00 . A A . 29 ARG HB3  1 1 
        4  4659 1 1 32 ARG HD2  H  14.659  -6.541  -3.771 1.00 . A A . 29 ARG HD2  1 1 
        4  4660 1 1 32 ARG HD3  H  12.977  -6.353  -4.275 1.00 . A A . 29 ARG HD3  1 1 
        4  4661 1 1 32 ARG HE   H  12.949  -4.226  -3.402 1.00 . A A . 29 ARG HE   1 1 
        4  4662 1 1 32 ARG HG2  H  14.096  -7.256  -1.650 1.00 . A A . 29 ARG HG2  1 1 
        4  4663 1 1 32 ARG HG3  H  12.799  -7.991  -2.632 1.00 . A A . 29 ARG HG3  1 1 
        4  4664 1 1 32 ARG HH11 H  15.893  -5.786  -2.318 1.00 . A A . 29 ARG HH11 1 1 
        4  4665 1 1 32 ARG HH12 H  16.592  -4.323  -1.715 1.00 . A A . 29 ARG HH12 1 1 
        4  4666 1 1 32 ARG HH21 H  13.859  -2.314  -2.614 1.00 . A A . 29 ARG HH21 1 1 
        4  4667 1 1 32 ARG HH22 H  15.430  -2.345  -1.885 1.00 . A A . 29 ARG HH22 1 1 
        4  4668 1 1 32 ARG N    N   9.898  -7.693  -1.546 1.00 . A A . 29 ARG N    1 1 
        4  4669 1 1 32 ARG NE   N  13.743  -4.761  -3.148 1.00 . A A . 29 ARG NE   1 1 
        4  4670 1 1 32 ARG NH1  N  15.840  -4.795  -2.166 1.00 . A A . 29 ARG NH1  1 1 
        4  4671 1 1 32 ARG NH2  N  14.680  -2.824  -2.325 1.00 . A A . 29 ARG NH2  1 1 
        4  4672 1 1 32 ARG O    O  10.541  -4.646  -3.337 1.00 . A A . 29 ARG O    1 1 
        4  4673 1 1 33 LYS C    C   8.680  -5.414  -5.605 1.00 . A A . 30 LYS C    1 1 
        4  4674 1 1 33 LYS CA   C  10.083  -6.012  -5.529 1.00 . A A . 30 LYS CA   1 1 
        4  4675 1 1 33 LYS CB   C  10.398  -6.734  -6.900 1.00 . A A . 30 LYS CB   1 1 
        4  4676 1 1 33 LYS CD   C   8.655  -7.586  -8.627 1.00 . A A . 30 LYS CD   1 1 
        4  4677 1 1 33 LYS CE   C   7.598  -6.460  -8.505 1.00 . A A . 30 LYS CE   1 1 
        4  4678 1 1 33 LYS CG   C   9.447  -7.887  -7.323 1.00 . A A . 30 LYS CG   1 1 
        4  4679 1 1 33 LYS H    H  10.408  -7.714  -4.116 1.00 . A A . 30 LYS H    1 1 
        4  4680 1 1 33 LYS HA   H  10.726  -5.145  -5.438 1.00 . A A . 30 LYS HA   1 1 
        4  4681 1 1 33 LYS HB2  H  10.317  -5.979  -7.674 1.00 . A A . 30 LYS HB2  1 1 
        4  4682 1 1 33 LYS HB3  H  11.422  -7.102  -6.915 1.00 . A A . 30 LYS HB3  1 1 
        4  4683 1 1 33 LYS HD2  H   9.345  -7.313  -9.401 1.00 . A A . 30 LYS HD2  1 1 
        4  4684 1 1 33 LYS HD3  H   8.142  -8.496  -8.924 1.00 . A A . 30 LYS HD3  1 1 
        4  4685 1 1 33 LYS HE2  H   6.813  -6.754  -7.785 1.00 . A A . 30 LYS HE2  1 1 
        4  4686 1 1 33 LYS HE3  H   8.074  -5.563  -8.136 1.00 . A A . 30 LYS HE3  1 1 
        4  4687 1 1 33 LYS HG2  H  10.051  -8.784  -7.493 1.00 . A A . 30 LYS HG2  1 1 
        4  4688 1 1 33 LYS HG3  H   8.745  -8.070  -6.529 1.00 . A A . 30 LYS HG3  1 1 
        4  4689 1 1 33 LYS HZ1  H   6.217  -5.435  -9.690 1.00 . A A . 30 LYS HZ1  1 1 
        4  4690 1 1 33 LYS HZ2  H   6.514  -7.018 -10.203 1.00 . A A . 30 LYS HZ2  1 1 
        4  4691 1 1 33 LYS HZ3  H   7.662  -5.806 -10.491 1.00 . A A . 30 LYS HZ3  1 1 
        4  4692 1 1 33 LYS N    N  10.323  -6.719  -4.226 1.00 . A A . 30 LYS N    1 1 
        4  4693 1 1 33 LYS NZ   N   6.958  -6.162  -9.813 1.00 . A A . 30 LYS NZ   1 1 
        4  4694 1 1 33 LYS O    O   8.516  -4.324  -6.162 1.00 . A A . 30 LYS O    1 1 
        4  4695 1 1 34 TYR C    C   5.945  -4.441  -4.437 1.00 . A A . 31 TYR C    1 1 
        4  4696 1 1 34 TYR CA   C   6.312  -5.706  -5.248 1.00 . A A . 31 TYR CA   1 1 
        4  4697 1 1 34 TYR CB   C   5.384  -6.911  -4.952 1.00 . A A . 31 TYR CB   1 1 
        4  4698 1 1 34 TYR CD1  C   4.742  -7.965  -7.282 1.00 . A A . 31 TYR CD1  1 1 
        4  4699 1 1 34 TYR CD2  C   5.999  -9.267  -5.728 1.00 . A A . 31 TYR CD2  1 1 
        4  4700 1 1 34 TYR CE1  C   4.760  -9.030  -8.184 1.00 . A A . 31 TYR CE1  1 1 
        4  4701 1 1 34 TYR CE2  C   6.016 -10.320  -6.621 1.00 . A A . 31 TYR CE2  1 1 
        4  4702 1 1 34 TYR CG   C   5.375  -8.059  -6.012 1.00 . A A . 31 TYR CG   1 1 
        4  4703 1 1 34 TYR CZ   C   5.400 -10.198  -7.844 1.00 . A A . 31 TYR CZ   1 1 
        4  4704 1 1 34 TYR H    H   7.905  -6.790  -4.398 1.00 . A A . 31 TYR H    1 1 
        4  4705 1 1 34 TYR HA   H   6.246  -5.442  -6.300 1.00 . A A . 31 TYR HA   1 1 
        4  4706 1 1 34 TYR HB2  H   5.717  -7.351  -4.019 1.00 . A A . 31 TYR HB2  1 1 
        4  4707 1 1 34 TYR HB3  H   4.388  -6.563  -4.808 1.00 . A A . 31 TYR HB3  1 1 
        4  4708 1 1 34 TYR HD1  H   4.228  -7.063  -7.560 1.00 . A A . 31 TYR HD1  1 1 
        4  4709 1 1 34 TYR HD2  H   6.471  -9.402  -4.763 1.00 . A A . 31 TYR HD2  1 1 
        4  4710 1 1 34 TYR HE1  H   4.272  -8.932  -9.165 1.00 . A A . 31 TYR HE1  1 1 
        4  4711 1 1 34 TYR HE2  H   6.525 -11.241  -6.350 1.00 . A A . 31 TYR HE2  1 1 
        4  4712 1 1 34 TYR HH   H   5.305 -12.084  -8.248 1.00 . A A . 31 TYR HH   1 1 
        4  4713 1 1 34 TYR N    N   7.692  -6.080  -5.020 1.00 . A A . 31 TYR N    1 1 
        4  4714 1 1 34 TYR O    O   5.320  -3.547  -4.986 1.00 . A A . 31 TYR O    1 1 
        4  4715 1 1 34 TYR OH   O   5.411 -11.252  -8.728 1.00 . A A . 31 TYR OH   1 1 
        4  4716 1 1 35 GLY C    C   7.875  -2.979  -1.766 1.00 . A A . 32 GLY C    1 1 
        4  4717 1 1 35 GLY CA   C   6.607  -3.000  -2.608 1.00 . A A . 32 GLY CA   1 1 
        4  4718 1 1 35 GLY H    H   6.495  -5.106  -2.608 1.00 . A A . 32 GLY H    1 1 
        4  4719 1 1 35 GLY HA2  H   6.712  -2.306  -3.424 1.00 . A A . 32 GLY HA2  1 1 
        4  4720 1 1 35 GLY HA3  H   5.766  -2.732  -1.998 1.00 . A A . 32 GLY HA3  1 1 
        4  4721 1 1 35 GLY N    N   6.394  -4.316  -3.180 1.00 . A A . 32 GLY N    1 1 
        4  4722 1 1 35 GLY O    O   8.357  -4.048  -1.416 1.00 . A A . 32 GLY O    1 1 
        4  4723 1 1 36 ASN C    C   9.514  -2.172   0.782 1.00 . A A . 33 ASN C    1 1 
        4  4724 1 1 36 ASN CA   C   9.704  -1.775  -0.683 1.00 . A A . 33 ASN CA   1 1 
        4  4725 1 1 36 ASN CB   C  10.404  -0.406  -0.743 1.00 . A A . 33 ASN CB   1 1 
        4  4726 1 1 36 ASN CG   C  11.271  -0.210  -1.973 1.00 . A A . 33 ASN CG   1 1 
        4  4727 1 1 36 ASN H    H   7.926  -0.956  -1.529 1.00 . A A . 33 ASN H    1 1 
        4  4728 1 1 36 ASN HA   H  10.340  -2.499  -1.168 1.00 . A A . 33 ASN HA   1 1 
        4  4729 1 1 36 ASN HB2  H   9.667   0.380  -0.722 1.00 . A A . 33 ASN HB2  1 1 
        4  4730 1 1 36 ASN HB3  H  11.029  -0.308   0.132 1.00 . A A . 33 ASN HB3  1 1 
        4  4731 1 1 36 ASN HD21 H  10.948   1.748  -1.893 1.00 . A A . 33 ASN HD21 1 1 
        4  4732 1 1 36 ASN HD22 H  11.971   1.200  -3.178 1.00 . A A . 33 ASN HD22 1 1 
        4  4733 1 1 36 ASN N    N   8.417  -1.800  -1.393 1.00 . A A . 33 ASN N    1 1 
        4  4734 1 1 36 ASN ND2  N  11.409   1.035  -2.395 1.00 . A A . 33 ASN ND2  1 1 
        4  4735 1 1 36 ASN O    O   9.026  -1.365   1.575 1.00 . A A . 33 ASN O    1 1 
        4  4736 1 1 36 ASN OD1  O  11.829  -1.163  -2.522 1.00 . A A . 33 ASN OD1  1 1 
        4  4737 1 1 37 ILE C    C  10.576  -3.251   3.595 1.00 . A A . 34 ILE C    1 1 
        4  4738 1 1 37 ILE CA   C   9.636  -3.906   2.527 1.00 . A A . 34 ILE CA   1 1 
        4  4739 1 1 37 ILE CB   C   9.622  -5.495   2.645 1.00 . A A . 34 ILE CB   1 1 
        4  4740 1 1 37 ILE CD1  C  11.312  -6.292   4.496 1.00 . A A . 34 ILE CD1  1 1 
        4  4741 1 1 37 ILE CG1  C   9.850  -6.024   4.087 1.00 . A A . 34 ILE CG1  1 1 
        4  4742 1 1 37 ILE CG2  C  10.613  -6.136   1.704 1.00 . A A . 34 ILE CG2  1 1 
        4  4743 1 1 37 ILE H    H  10.208  -4.046   0.425 1.00 . A A . 34 ILE H    1 1 
        4  4744 1 1 37 ILE HA   H   8.646  -3.584   2.749 1.00 . A A . 34 ILE HA   1 1 
        4  4745 1 1 37 ILE HB   H   8.631  -5.826   2.333 1.00 . A A . 34 ILE HB   1 1 
        4  4746 1 1 37 ILE HD11 H  11.760  -6.970   3.807 1.00 . A A . 34 ILE HD11 1 1 
        4  4747 1 1 37 ILE HD12 H  11.338  -6.716   5.485 1.00 . A A . 34 ILE HD12 1 1 
        4  4748 1 1 37 ILE HD13 H  11.864  -5.362   4.495 1.00 . A A . 34 ILE HD13 1 1 
        4  4749 1 1 37 ILE HG12 H   9.460  -5.297   4.779 1.00 . A A . 34 ILE HG12 1 1 
        4  4750 1 1 37 ILE HG13 H   9.304  -6.950   4.208 1.00 . A A . 34 ILE HG13 1 1 
        4  4751 1 1 37 ILE HG21 H  11.586  -5.705   1.868 1.00 . A A . 34 ILE HG21 1 1 
        4  4752 1 1 37 ILE HG22 H  10.305  -5.960   0.700 1.00 . A A . 34 ILE HG22 1 1 
        4  4753 1 1 37 ILE HG23 H  10.652  -7.202   1.884 1.00 . A A . 34 ILE HG23 1 1 
        4  4754 1 1 37 ILE N    N   9.872  -3.419   1.137 1.00 . A A . 34 ILE N    1 1 
        4  4755 1 1 37 ILE O    O  11.775  -3.049   3.355 1.00 . A A . 34 ILE O    1 1 
        4  4756 1 1 38 LEU C    C  11.061  -3.735   6.906 1.00 . A A . 35 LEU C    1 1 
        4  4757 1 1 38 LEU CA   C  10.758  -2.511   5.978 1.00 . A A . 35 LEU CA   1 1 
        4  4758 1 1 38 LEU CB   C  10.077  -1.393   6.803 1.00 . A A . 35 LEU CB   1 1 
        4  4759 1 1 38 LEU CD1  C   8.533   0.590   6.749 1.00 . A A . 35 LEU CD1  1 1 
        4  4760 1 1 38 LEU CD2  C  10.844   0.839   5.842 1.00 . A A . 35 LEU CD2  1 1 
        4  4761 1 1 38 LEU CG   C   9.667  -0.132   6.028 1.00 . A A . 35 LEU CG   1 1 
        4  4762 1 1 38 LEU H    H   8.982  -2.798   4.763 1.00 . A A . 35 LEU H    1 1 
        4  4763 1 1 38 LEU HA   H  11.708  -2.134   5.629 1.00 . A A . 35 LEU HA   1 1 
        4  4764 1 1 38 LEU HB2  H   9.197  -1.790   7.293 1.00 . A A . 35 LEU HB2  1 1 
        4  4765 1 1 38 LEU HB3  H  10.770  -1.090   7.576 1.00 . A A . 35 LEU HB3  1 1 
        4  4766 1 1 38 LEU HD11 H   7.644  -0.020   6.739 1.00 . A A . 35 LEU HD11 1 1 
        4  4767 1 1 38 LEU HD12 H   8.329   1.525   6.250 1.00 . A A . 35 LEU HD12 1 1 
        4  4768 1 1 38 LEU HD13 H   8.824   0.788   7.770 1.00 . A A . 35 LEU HD13 1 1 
        4  4769 1 1 38 LEU HD21 H  11.361   0.965   6.784 1.00 . A A . 35 LEU HD21 1 1 
        4  4770 1 1 38 LEU HD22 H  10.466   1.800   5.519 1.00 . A A . 35 LEU HD22 1 1 
        4  4771 1 1 38 LEU HD23 H  11.534   0.463   5.100 1.00 . A A . 35 LEU HD23 1 1 
        4  4772 1 1 38 LEU HG   H   9.318  -0.433   5.058 1.00 . A A . 35 LEU HG   1 1 
        4  4773 1 1 38 LEU N    N   9.976  -2.875   4.757 1.00 . A A . 35 LEU N    1 1 
        4  4774 1 1 38 LEU O    O  12.221  -3.908   7.289 1.00 . A A . 35 LEU O    1 1 
        4  4775 1 1 39 LYS C    C   9.402  -7.046   7.525 1.00 . A A . 36 LYS C    1 1 
        4  4776 1 1 39 LYS CA   C  10.320  -5.852   8.020 1.00 . A A . 36 LYS CA   1 1 
        4  4777 1 1 39 LYS CB   C  10.159  -5.591   9.570 1.00 . A A . 36 LYS CB   1 1 
        4  4778 1 1 39 LYS CD   C   8.376  -6.136  11.270 1.00 . A A . 36 LYS CD   1 1 
        4  4779 1 1 39 LYS CE   C   6.879  -6.388  11.350 1.00 . A A . 36 LYS CE   1 1 
        4  4780 1 1 39 LYS CG   C   8.745  -5.261  10.074 1.00 . A A . 36 LYS CG   1 1 
        4  4781 1 1 39 LYS H    H   9.128  -4.354   7.075 1.00 . A A . 36 LYS H    1 1 
        4  4782 1 1 39 LYS HA   H  11.348  -6.109   7.831 1.00 . A A . 36 LYS HA   1 1 
        4  4783 1 1 39 LYS HB2  H  10.502  -6.448  10.125 1.00 . A A . 36 LYS HB2  1 1 
        4  4784 1 1 39 LYS HB3  H  10.795  -4.762   9.832 1.00 . A A . 36 LYS HB3  1 1 
        4  4785 1 1 39 LYS HD2  H   8.879  -7.083  11.176 1.00 . A A . 36 LYS HD2  1 1 
        4  4786 1 1 39 LYS HD3  H   8.701  -5.649  12.178 1.00 . A A . 36 LYS HD3  1 1 
        4  4787 1 1 39 LYS HE2  H   6.552  -6.753  10.389 1.00 . A A . 36 LYS HE2  1 1 
        4  4788 1 1 39 LYS HE3  H   6.688  -7.135  12.104 1.00 . A A . 36 LYS HE3  1 1 
        4  4789 1 1 39 LYS HG2  H   8.712  -4.221  10.379 1.00 . A A . 36 LYS HG2  1 1 
        4  4790 1 1 39 LYS HG3  H   8.031  -5.422   9.288 1.00 . A A . 36 LYS HG3  1 1 
        4  4791 1 1 39 LYS HZ1  H   6.256  -4.428  10.956 1.00 . A A . 36 LYS HZ1  1 1 
        4  4792 1 1 39 LYS HZ2  H   6.422  -4.779  12.601 1.00 . A A . 36 LYS HZ2  1 1 
        4  4793 1 1 39 LYS HZ3  H   5.099  -5.379  11.744 1.00 . A A . 36 LYS HZ3  1 1 
        4  4794 1 1 39 LYS N    N  10.051  -4.593   7.265 1.00 . A A . 36 LYS N    1 1 
        4  4795 1 1 39 LYS NZ   N   6.111  -5.160  11.685 1.00 . A A . 36 LYS NZ   1 1 
        4  4796 1 1 39 LYS O    O   8.182  -6.878   7.397 1.00 . A A . 36 LYS O    1 1 
        4  4797 1 1 40 CYS C    C   9.480 -10.379   8.200 1.00 . A A . 37 CYS C    1 1 
        4  4798 1 1 40 CYS CA   C   9.220  -9.501   6.995 1.00 . A A . 37 CYS CA   1 1 
        4  4799 1 1 40 CYS CB   C   9.635 -10.343   5.752 1.00 . A A . 37 CYS CB   1 1 
        4  4800 1 1 40 CYS H    H  10.972  -8.295   7.011 1.00 . A A . 37 CYS H    1 1 
        4  4801 1 1 40 CYS HA   H   8.167  -9.257   6.941 1.00 . A A . 37 CYS HA   1 1 
        4  4802 1 1 40 CYS HB2  H  10.512 -10.928   6.001 1.00 . A A . 37 CYS HB2  1 1 
        4  4803 1 1 40 CYS HB3  H   8.840 -11.035   5.507 1.00 . A A . 37 CYS HB3  1 1 
        4  4804 1 1 40 CYS HG   H   9.316  -9.991   3.244 1.00 . A A . 37 CYS HG   1 1 
        4  4805 1 1 40 CYS N    N  10.001  -8.249   7.178 1.00 . A A . 37 CYS N    1 1 
        4  4806 1 1 40 CYS O    O  10.611 -10.851   8.373 1.00 . A A . 37 CYS O    1 1 
        4  4807 1 1 40 CYS SG   S   9.976  -9.424   4.246 1.00 . A A . 37 CYS SG   1 1 
        4  4808 1 1 41 ASP C    C   7.879 -12.790  10.064 1.00 . A A . 38 ASP C    1 1 
        4  4809 1 1 41 ASP CA   C   8.737 -11.523  10.189 1.00 . A A . 38 ASP CA   1 1 
        4  4810 1 1 41 ASP CB   C   8.528 -10.825  11.540 1.00 . A A . 38 ASP CB   1 1 
        4  4811 1 1 41 ASP CG   C   9.180 -11.556  12.700 1.00 . A A . 38 ASP CG   1 1 
        4  4812 1 1 41 ASP H    H   7.615 -10.086   8.949 1.00 . A A . 38 ASP H    1 1 
        4  4813 1 1 41 ASP HA   H   9.790 -11.828  10.126 1.00 . A A . 38 ASP HA   1 1 
        4  4814 1 1 41 ASP HB2  H   8.957  -9.832  11.486 1.00 . A A . 38 ASP HB2  1 1 
        4  4815 1 1 41 ASP HB3  H   7.468 -10.763  11.752 1.00 . A A . 38 ASP HB3  1 1 
        4  4816 1 1 41 ASP N    N   8.492 -10.586   9.056 1.00 . A A . 38 ASP N    1 1 
        4  4817 1 1 41 ASP O    O   6.713 -12.722   9.678 1.00 . A A . 38 ASP O    1 1 
        4  4818 1 1 41 ASP OD1  O  10.376 -11.884  12.606 1.00 . A A . 38 ASP OD1  1 1 
        4  4819 1 1 41 ASP OD2  O   8.494 -11.772  13.721 1.00 . A A . 38 ASP OD2  1 1 
        4  4820 1 1 42 VAL C    C   7.602 -15.756  11.701 1.00 . A A . 39 VAL C    1 1 
        4  4821 1 1 42 VAL CA   C   7.776 -15.241  10.289 1.00 . A A . 39 VAL CA   1 1 
        4  4822 1 1 42 VAL CB   C   8.592 -16.349   9.462 1.00 . A A . 39 VAL CB   1 1 
        4  4823 1 1 42 VAL CG1  C   7.761 -17.497   8.887 1.00 . A A . 39 VAL CG1  1 1 
        4  4824 1 1 42 VAL CG2  C   9.445 -15.799   8.334 1.00 . A A . 39 VAL CG2  1 1 
        4  4825 1 1 42 VAL H    H   9.371 -13.933  10.767 1.00 . A A . 39 VAL H    1 1 
        4  4826 1 1 42 VAL HA   H   6.789 -15.071   9.871 1.00 . A A . 39 VAL HA   1 1 
        4  4827 1 1 42 VAL HB   H   9.284 -16.808  10.161 1.00 . A A . 39 VAL HB   1 1 
        4  4828 1 1 42 VAL HG11 H   8.420 -18.129   8.301 1.00 . A A . 39 VAL HG11 1 1 
        4  4829 1 1 42 VAL HG12 H   6.989 -17.117   8.235 1.00 . A A . 39 VAL HG12 1 1 
        4  4830 1 1 42 VAL HG13 H   7.327 -18.085   9.680 1.00 . A A . 39 VAL HG13 1 1 
        4  4831 1 1 42 VAL HG21 H   8.943 -15.003   7.822 1.00 . A A . 39 VAL HG21 1 1 
        4  4832 1 1 42 VAL HG22 H   9.623 -16.610   7.636 1.00 . A A . 39 VAL HG22 1 1 
        4  4833 1 1 42 VAL HG23 H  10.386 -15.454   8.726 1.00 . A A . 39 VAL HG23 1 1 
        4  4834 1 1 42 VAL N    N   8.472 -13.951  10.391 1.00 . A A . 39 VAL N    1 1 
        4  4835 1 1 42 VAL O    O   8.578 -16.128  12.365 1.00 . A A . 39 VAL O    1 1 
        4  4836 1 1 43 LYS C    C   5.328 -17.682  13.290 1.00 . A A . 40 LYS C    1 1 
        4  4837 1 1 43 LYS CA   C   6.069 -16.326  13.470 1.00 . A A . 40 LYS CA   1 1 
        4  4838 1 1 43 LYS CB   C   5.266 -15.265  14.267 1.00 . A A . 40 LYS CB   1 1 
        4  4839 1 1 43 LYS CD   C   6.371 -13.810  16.031 1.00 . A A . 40 LYS CD   1 1 
        4  4840 1 1 43 LYS CE   C   6.571 -12.336  16.362 1.00 . A A . 40 LYS CE   1 1 
        4  4841 1 1 43 LYS CG   C   6.064 -14.006  14.546 1.00 . A A . 40 LYS CG   1 1 
        4  4842 1 1 43 LYS H    H   5.643 -15.297  11.666 1.00 . A A . 40 LYS H    1 1 
        4  4843 1 1 43 LYS HA   H   7.020 -16.498  13.940 1.00 . A A . 40 LYS HA   1 1 
        4  4844 1 1 43 LYS HB2  H   4.404 -14.959  13.673 1.00 . A A . 40 LYS HB2  1 1 
        4  4845 1 1 43 LYS HB3  H   4.935 -15.670  15.209 1.00 . A A . 40 LYS HB3  1 1 
        4  4846 1 1 43 LYS HD2  H   5.540 -14.192  16.607 1.00 . A A . 40 LYS HD2  1 1 
        4  4847 1 1 43 LYS HD3  H   7.273 -14.345  16.293 1.00 . A A . 40 LYS HD3  1 1 
        4  4848 1 1 43 LYS HE2  H   6.970 -11.831  15.493 1.00 . A A . 40 LYS HE2  1 1 
        4  4849 1 1 43 LYS HE3  H   5.612 -11.906  16.617 1.00 . A A . 40 LYS HE3  1 1 
        4  4850 1 1 43 LYS HG2  H   6.999 -14.082  13.999 1.00 . A A . 40 LYS HG2  1 1 
        4  4851 1 1 43 LYS HG3  H   5.506 -13.158  14.186 1.00 . A A . 40 LYS HG3  1 1 
        4  4852 1 1 43 LYS HZ1  H   8.452 -12.485  17.250 1.00 . A A . 40 LYS HZ1  1 1 
        4  4853 1 1 43 LYS HZ2  H   7.169 -12.649  18.340 1.00 . A A . 40 LYS HZ2  1 1 
        4  4854 1 1 43 LYS HZ3  H   7.574 -11.123  17.730 1.00 . A A . 40 LYS HZ3  1 1 
        4  4855 1 1 43 LYS N    N   6.365 -15.762  12.170 1.00 . A A . 40 LYS N    1 1 
        4  4856 1 1 43 LYS NZ   N   7.503 -12.136  17.500 1.00 . A A . 40 LYS NZ   1 1 
        4  4857 1 1 43 LYS O    O   4.532 -17.803  12.361 1.00 . A A . 40 LYS O    1 1 
        4  4858 1 1 44 LYS C    C   4.300 -20.606  15.093 1.00 . A A . 41 LYS C    1 1 
        4  4859 1 1 44 LYS CA   C   5.048 -20.075  13.828 1.00 . A A . 41 LYS CA   1 1 
        4  4860 1 1 44 LYS CB   C   6.182 -21.084  13.262 1.00 . A A . 41 LYS CB   1 1 
        4  4861 1 1 44 LYS CD   C   7.718 -21.123  15.321 1.00 . A A . 41 LYS CD   1 1 
        4  4862 1 1 44 LYS CE   C   8.614 -20.033  14.718 1.00 . A A . 41 LYS CE   1 1 
        4  4863 1 1 44 LYS CG   C   6.975 -21.950  14.269 1.00 . A A . 41 LYS CG   1 1 
        4  4864 1 1 44 LYS H    H   6.060 -18.571  15.010 1.00 . A A . 41 LYS H    1 1 
        4  4865 1 1 44 LYS HA   H   4.319 -19.906  13.056 1.00 . A A . 41 LYS HA   1 1 
        4  4866 1 1 44 LYS HB2  H   5.727 -21.765  12.561 1.00 . A A . 41 LYS HB2  1 1 
        4  4867 1 1 44 LYS HB3  H   6.930 -20.521  12.702 1.00 . A A . 41 LYS HB3  1 1 
        4  4868 1 1 44 LYS HD2  H   6.966 -20.649  15.934 1.00 . A A . 41 LYS HD2  1 1 
        4  4869 1 1 44 LYS HD3  H   8.314 -21.785  15.926 1.00 . A A . 41 LYS HD3  1 1 
        4  4870 1 1 44 LYS HE2  H   9.019 -20.382  13.785 1.00 . A A . 41 LYS HE2  1 1 
        4  4871 1 1 44 LYS HE3  H   7.999 -19.148  14.537 1.00 . A A . 41 LYS HE3  1 1 
        4  4872 1 1 44 LYS HG2  H   6.290 -22.623  14.773 1.00 . A A . 41 LYS HG2  1 1 
        4  4873 1 1 44 LYS HG3  H   7.698 -22.543  13.719 1.00 . A A . 41 LYS HG3  1 1 
        4  4874 1 1 44 LYS HZ1  H  10.318 -18.918  15.185 1.00 . A A . 41 LYS HZ1  1 1 
        4  4875 1 1 44 LYS HZ2  H  10.329 -20.485  15.819 1.00 . A A . 41 LYS HZ2  1 1 
        4  4876 1 1 44 LYS HZ3  H   9.360 -19.297  16.526 1.00 . A A . 41 LYS HZ3  1 1 
        4  4877 1 1 44 LYS N    N   5.590 -18.723  14.136 1.00 . A A . 41 LYS N    1 1 
        4  4878 1 1 44 LYS NZ   N   9.729 -19.657  15.626 1.00 . A A . 41 LYS NZ   1 1 
        4  4879 1 1 44 LYS O    O   4.724 -20.287  16.211 1.00 . A A . 41 LYS O    1 1 
        4  4880 1 1 45 THR C    C   2.781 -23.281  16.461 1.00 . A A . 42 THR C    1 1 
        4  4881 1 1 45 THR CA   C   2.461 -21.793  16.155 1.00 . A A . 42 THR CA   1 1 
        4  4882 1 1 45 THR CB   C   0.910 -21.559  16.052 1.00 . A A . 42 THR CB   1 1 
        4  4883 1 1 45 THR CG2  C   0.241 -22.465  15.010 1.00 . A A . 42 THR CG2  1 1 
        4  4884 1 1 45 THR H    H   2.780 -21.545  14.082 1.00 . A A . 42 THR H    1 1 
        4  4885 1 1 45 THR HA   H   2.841 -21.182  16.968 1.00 . A A . 42 THR HA   1 1 
        4  4886 1 1 45 THR HB   H   0.743 -20.537  15.762 1.00 . A A . 42 THR HB   1 1 
        4  4887 1 1 45 THR HG1  H  -0.209 -20.966  17.571 1.00 . A A . 42 THR HG1  1 1 
        4  4888 1 1 45 THR HG21 H   0.687 -23.441  15.049 1.00 . A A . 42 THR HG21 1 1 
        4  4889 1 1 45 THR HG22 H   0.369 -22.056  14.020 1.00 . A A . 42 THR HG22 1 1 
        4  4890 1 1 45 THR HG23 H  -0.815 -22.547  15.226 1.00 . A A . 42 THR HG23 1 1 
        4  4891 1 1 45 THR N    N   3.160 -21.333  14.964 1.00 . A A . 42 THR N    1 1 
        4  4892 1 1 45 THR O    O   3.359 -23.981  15.621 1.00 . A A . 42 THR O    1 1 
        4  4893 1 1 45 THR OG1  O   0.276 -21.766  17.319 1.00 . A A . 42 THR OG1  1 1 
        4  4894 1 1 46 VAL C    C   1.702 -26.207  17.290 1.00 . A A . 43 VAL C    1 1 
        4  4895 1 1 46 VAL CA   C   2.516 -25.152  18.121 1.00 . A A . 43 VAL CA   1 1 
        4  4896 1 1 46 VAL CB   C   2.184 -25.292  19.650 1.00 . A A . 43 VAL CB   1 1 
        4  4897 1 1 46 VAL CG1  C   3.189 -24.506  20.482 1.00 . A A . 43 VAL CG1  1 1 
        4  4898 1 1 46 VAL CG2  C   0.756 -24.841  20.004 1.00 . A A . 43 VAL CG2  1 1 
        4  4899 1 1 46 VAL H    H   2.060 -23.087  18.340 1.00 . A A . 43 VAL H    1 1 
        4  4900 1 1 46 VAL HA   H   3.561 -25.410  18.010 1.00 . A A . 43 VAL HA   1 1 
        4  4901 1 1 46 VAL HB   H   2.279 -26.335  19.918 1.00 . A A . 43 VAL HB   1 1 
        4  4902 1 1 46 VAL HG11 H   3.152 -23.464  20.203 1.00 . A A . 43 VAL HG11 1 1 
        4  4903 1 1 46 VAL HG12 H   4.182 -24.889  20.307 1.00 . A A . 43 VAL HG12 1 1 
        4  4904 1 1 46 VAL HG13 H   2.945 -24.605  21.531 1.00 . A A . 43 VAL HG13 1 1 
        4  4905 1 1 46 VAL HG21 H   0.606 -24.933  21.071 1.00 . A A . 43 VAL HG21 1 1 
        4  4906 1 1 46 VAL HG22 H   0.040 -25.461  19.492 1.00 . A A . 43 VAL HG22 1 1 
        4  4907 1 1 46 VAL HG23 H   0.614 -23.810  19.716 1.00 . A A . 43 VAL HG23 1 1 
        4  4908 1 1 46 VAL N    N   2.397 -23.742  17.676 1.00 . A A . 43 VAL N    1 1 
        4  4909 1 1 46 VAL O    O   1.870 -27.409  17.511 1.00 . A A . 43 VAL O    1 1 
        4  4910 1 1 47 SER C    C   0.564 -27.058  14.234 1.00 . A A . 44 SER C    1 1 
        4  4911 1 1 47 SER CA   C  -0.046 -26.695  15.613 1.00 . A A . 44 SER CA   1 1 
        4  4912 1 1 47 SER CB   C  -1.454 -26.051  15.445 1.00 . A A . 44 SER CB   1 1 
        4  4913 1 1 47 SER H    H   0.850 -24.850  16.070 1.00 . A A . 44 SER H    1 1 
        4  4914 1 1 47 SER HA   H  -0.134 -27.607  16.202 1.00 . A A . 44 SER HA   1 1 
        4  4915 1 1 47 SER HB2  H  -1.773 -25.595  16.377 1.00 . A A . 44 SER HB2  1 1 
        4  4916 1 1 47 SER HB3  H  -1.407 -25.290  14.675 1.00 . A A . 44 SER HB3  1 1 
        4  4917 1 1 47 SER HG   H  -2.059 -27.589  14.386 1.00 . A A . 44 SER HG   1 1 
        4  4918 1 1 47 SER N    N   0.838 -25.780  16.341 1.00 . A A . 44 SER N    1 1 
        4  4919 1 1 47 SER O    O  -0.087 -27.713  13.412 1.00 . A A . 44 SER O    1 1 
        4  4920 1 1 47 SER OG   O  -2.428 -27.009  15.061 1.00 . A A . 44 SER OG   1 1 
        4  4921 1 1 48 GLY C    C   2.152 -25.845  11.586 1.00 . A A . 45 GLY C    1 1 
        4  4922 1 1 48 GLY CA   C   2.494 -26.856  12.702 1.00 . A A . 45 GLY CA   1 1 
        4  4923 1 1 48 GLY H    H   2.336 -26.219  14.741 1.00 . A A . 45 GLY H    1 1 
        4  4924 1 1 48 GLY HA2  H   3.559 -26.817  12.864 1.00 . A A . 45 GLY HA2  1 1 
        4  4925 1 1 48 GLY HA3  H   2.241 -27.849  12.354 1.00 . A A . 45 GLY HA3  1 1 
        4  4926 1 1 48 GLY N    N   1.823 -26.632  13.996 1.00 . A A . 45 GLY N    1 1 
        4  4927 1 1 48 GLY O    O   2.728 -25.920  10.499 1.00 . A A . 45 GLY O    1 1 
        4  4928 1 1 49 ALA C    C   1.853 -22.676  10.957 1.00 . A A . 46 ALA C    1 1 
        4  4929 1 1 49 ALA CA   C   0.854 -23.873  10.878 1.00 . A A . 46 ALA CA   1 1 
        4  4930 1 1 49 ALA CB   C  -0.610 -23.445  11.139 1.00 . A A . 46 ALA CB   1 1 
        4  4931 1 1 49 ALA H    H   0.754 -24.955  12.690 1.00 . A A . 46 ALA H    1 1 
        4  4932 1 1 49 ALA HA   H   0.894 -24.311   9.888 1.00 . A A . 46 ALA HA   1 1 
        4  4933 1 1 49 ALA HB1  H  -0.771 -23.272  12.188 1.00 . A A . 46 ALA HB1  1 1 
        4  4934 1 1 49 ALA HB2  H  -1.275 -24.231  10.808 1.00 . A A . 46 ALA HB2  1 1 
        4  4935 1 1 49 ALA HB3  H  -0.833 -22.546  10.601 1.00 . A A . 46 ALA HB3  1 1 
        4  4936 1 1 49 ALA N    N   1.224 -24.916  11.844 1.00 . A A . 46 ALA N    1 1 
        4  4937 1 1 49 ALA O    O   2.195 -22.226  12.059 1.00 . A A . 46 ALA O    1 1 
        4  4938 1 1 50 ALA C    C   2.563 -19.760   9.369 1.00 . A A . 47 ALA C    1 1 
        4  4939 1 1 50 ALA CA   C   3.301 -21.039   9.756 1.00 . A A . 47 ALA CA   1 1 
        4  4940 1 1 50 ALA CB   C   4.525 -21.275   8.799 1.00 . A A . 47 ALA CB   1 1 
        4  4941 1 1 50 ALA H    H   1.953 -22.504   8.945 1.00 . A A . 47 ALA H    1 1 
        4  4942 1 1 50 ALA HA   H   3.681 -20.931  10.751 1.00 . A A . 47 ALA HA   1 1 
        4  4943 1 1 50 ALA HB1  H   5.301 -20.537   9.000 1.00 . A A . 47 ALA HB1  1 1 
        4  4944 1 1 50 ALA HB2  H   4.231 -21.170   7.763 1.00 . A A . 47 ALA HB2  1 1 
        4  4945 1 1 50 ALA HB3  H   4.938 -22.262   8.957 1.00 . A A . 47 ALA HB3  1 1 
        4  4946 1 1 50 ALA N    N   2.320 -22.164   9.789 1.00 . A A . 47 ALA N    1 1 
        4  4947 1 1 50 ALA O    O   1.561 -19.841   8.641 1.00 . A A . 47 ALA O    1 1 
        4  4948 1 1 51 PHE C    C   3.430 -16.412   8.809 1.00 . A A . 48 PHE C    1 1 
        4  4949 1 1 51 PHE CA   C   2.375 -17.357   9.392 1.00 . A A . 48 PHE CA   1 1 
        4  4950 1 1 51 PHE CB   C   1.730 -16.653  10.606 1.00 . A A . 48 PHE CB   1 1 
        4  4951 1 1 51 PHE CD1  C  -0.438 -17.790  11.091 1.00 . A A . 48 PHE CD1  1 1 
        4  4952 1 1 51 PHE CD2  C   1.377 -18.134  12.586 1.00 . A A . 48 PHE CD2  1 1 
        4  4953 1 1 51 PHE CE1  C  -1.224 -18.612  11.857 1.00 . A A . 48 PHE CE1  1 1 
        4  4954 1 1 51 PHE CE2  C   0.609 -18.938  13.349 1.00 . A A . 48 PHE CE2  1 1 
        4  4955 1 1 51 PHE CG   C   0.871 -17.545  11.442 1.00 . A A . 48 PHE CG   1 1 
        4  4956 1 1 51 PHE CZ   C  -0.699 -19.196  12.997 1.00 . A A . 48 PHE CZ   1 1 
        4  4957 1 1 51 PHE H    H   3.642 -18.522  10.621 1.00 . A A . 48 PHE H    1 1 
        4  4958 1 1 51 PHE HA   H   1.608 -17.605   8.670 1.00 . A A . 48 PHE HA   1 1 
        4  4959 1 1 51 PHE HB2  H   2.514 -16.267  11.241 1.00 . A A . 48 PHE HB2  1 1 
        4  4960 1 1 51 PHE HB3  H   1.120 -15.829  10.269 1.00 . A A . 48 PHE HB3  1 1 
        4  4961 1 1 51 PHE HD1  H  -0.844 -17.328  10.203 1.00 . A A . 48 PHE HD1  1 1 
        4  4962 1 1 51 PHE HD2  H   2.409 -17.978  12.865 1.00 . A A . 48 PHE HD2  1 1 
        4  4963 1 1 51 PHE HE1  H  -2.235 -18.803  11.562 1.00 . A A . 48 PHE HE1  1 1 
        4  4964 1 1 51 PHE HE2  H   1.039 -19.360  14.223 1.00 . A A . 48 PHE HE2  1 1 
        4  4965 1 1 51 PHE HZ   H  -1.308 -19.842  13.609 1.00 . A A . 48 PHE HZ   1 1 
        4  4966 1 1 51 PHE N    N   3.012 -18.577   9.841 1.00 . A A . 48 PHE N    1 1 
        4  4967 1 1 51 PHE O    O   4.558 -16.356   9.315 1.00 . A A . 48 PHE O    1 1 
        4  4968 1 1 52 ALA C    C   3.428 -13.259   7.391 1.00 . A A . 49 ALA C    1 1 
        4  4969 1 1 52 ALA CA   C   3.982 -14.665   7.192 1.00 . A A . 49 ALA CA   1 1 
        4  4970 1 1 52 ALA CB   C   4.275 -14.979   5.706 1.00 . A A . 49 ALA CB   1 1 
        4  4971 1 1 52 ALA H    H   2.174 -15.784   7.354 1.00 . A A . 49 ALA H    1 1 
        4  4972 1 1 52 ALA HA   H   4.901 -14.732   7.732 1.00 . A A . 49 ALA HA   1 1 
        4  4973 1 1 52 ALA HB1  H   4.260 -16.043   5.545 1.00 . A A . 49 ALA HB1  1 1 
        4  4974 1 1 52 ALA HB2  H   5.252 -14.617   5.444 1.00 . A A . 49 ALA HB2  1 1 
        4  4975 1 1 52 ALA HB3  H   3.537 -14.508   5.069 1.00 . A A . 49 ALA HB3  1 1 
        4  4976 1 1 52 ALA N    N   3.062 -15.650   7.767 1.00 . A A . 49 ALA N    1 1 
        4  4977 1 1 52 ALA O    O   2.227 -13.035   7.243 1.00 . A A . 49 ALA O    1 1 
        4  4978 1 1 53 PHE C    C   4.750  -9.986   7.352 1.00 . A A . 50 PHE C    1 1 
        4  4979 1 1 53 PHE CA   C   3.871 -10.988   8.109 1.00 . A A . 50 PHE CA   1 1 
        4  4980 1 1 53 PHE CB   C   4.019 -10.807   9.636 1.00 . A A . 50 PHE CB   1 1 
        4  4981 1 1 53 PHE CD1  C   2.114  -9.147   9.618 1.00 . A A . 50 PHE CD1  1 1 
        4  4982 1 1 53 PHE CD2  C   2.535 -10.393  11.604 1.00 . A A . 50 PHE CD2  1 1 
        4  4983 1 1 53 PHE CE1  C   1.059  -8.515  10.235 1.00 . A A . 50 PHE CE1  1 1 
        4  4984 1 1 53 PHE CE2  C   1.479  -9.762  12.226 1.00 . A A . 50 PHE CE2  1 1 
        4  4985 1 1 53 PHE CG   C   2.870 -10.091  10.293 1.00 . A A . 50 PHE CG   1 1 
        4  4986 1 1 53 PHE CZ   C   0.736  -8.822  11.539 1.00 . A A . 50 PHE CZ   1 1 
        4  4987 1 1 53 PHE H    H   5.259 -12.510   7.762 1.00 . A A . 50 PHE H    1 1 
        4  4988 1 1 53 PHE HA   H   2.834 -10.886   7.833 1.00 . A A . 50 PHE HA   1 1 
        4  4989 1 1 53 PHE HB2  H   4.078 -11.792  10.080 1.00 . A A . 50 PHE HB2  1 1 
        4  4990 1 1 53 PHE HB3  H   4.937 -10.262   9.864 1.00 . A A . 50 PHE HB3  1 1 
        4  4991 1 1 53 PHE HD1  H   2.356  -8.904   8.592 1.00 . A A . 50 PHE HD1  1 1 
        4  4992 1 1 53 PHE HD2  H   3.110 -11.130  12.139 1.00 . A A . 50 PHE HD2  1 1 
        4  4993 1 1 53 PHE HE1  H   0.476  -7.782   9.696 1.00 . A A . 50 PHE HE1  1 1 
        4  4994 1 1 53 PHE HE2  H   1.228 -10.010  13.246 1.00 . A A . 50 PHE HE2  1 1 
        4  4995 1 1 53 PHE HZ   H  -0.090  -8.330  12.026 1.00 . A A . 50 PHE HZ   1 1 
        4  4996 1 1 53 PHE N    N   4.302 -12.318   7.759 1.00 . A A . 50 PHE N    1 1 
        4  4997 1 1 53 PHE O    O   5.975  -9.922   7.624 1.00 . A A . 50 PHE O    1 1 
        4  4998 1 1 54 ILE C    C   4.652  -6.874   5.671 1.00 . A A . 51 ILE C    1 1 
        4  4999 1 1 54 ILE CA   C   5.026  -8.334   5.552 1.00 . A A . 51 ILE CA   1 1 
        4  5000 1 1 54 ILE CB   C   5.054  -8.677   3.990 1.00 . A A . 51 ILE CB   1 1 
        4  5001 1 1 54 ILE CD1  C   3.979 -11.112   4.076 1.00 . A A . 51 ILE CD1  1 1 
        4  5002 1 1 54 ILE CG1  C   5.117 -10.182   3.620 1.00 . A A . 51 ILE CG1  1 1 
        4  5003 1 1 54 ILE CG2  C   6.312  -8.039   3.399 1.00 . A A . 51 ILE CG2  1 1 
        4  5004 1 1 54 ILE H    H   3.153  -9.151   6.353 1.00 . A A . 51 ILE H    1 1 
        4  5005 1 1 54 ILE HA   H   6.041  -8.440   5.924 1.00 . A A . 51 ILE HA   1 1 
        4  5006 1 1 54 ILE HB   H   4.217  -8.202   3.502 1.00 . A A . 51 ILE HB   1 1 
        4  5007 1 1 54 ILE HD11 H   3.055 -10.845   3.578 1.00 . A A . 51 ILE HD11 1 1 
        4  5008 1 1 54 ILE HD12 H   3.847 -11.032   5.146 1.00 . A A . 51 ILE HD12 1 1 
        4  5009 1 1 54 ILE HD13 H   4.228 -12.139   3.828 1.00 . A A . 51 ILE HD13 1 1 
        4  5010 1 1 54 ILE HG12 H   5.127 -10.260   2.550 1.00 . A A . 51 ILE HG12 1 1 
        4  5011 1 1 54 ILE HG13 H   6.065 -10.561   3.979 1.00 . A A . 51 ILE HG13 1 1 
        4  5012 1 1 54 ILE HG21 H   6.296  -6.974   3.569 1.00 . A A . 51 ILE HG21 1 1 
        4  5013 1 1 54 ILE HG22 H   6.349  -8.235   2.335 1.00 . A A . 51 ILE HG22 1 1 
        4  5014 1 1 54 ILE HG23 H   7.186  -8.468   3.868 1.00 . A A . 51 ILE HG23 1 1 
        4  5015 1 1 54 ILE N    N   4.153  -9.182   6.431 1.00 . A A . 51 ILE N    1 1 
        4  5016 1 1 54 ILE O    O   3.648  -6.435   5.129 1.00 . A A . 51 ILE O    1 1 
        4  5017 1 1 55 GLU C    C   6.181  -3.854   5.529 1.00 . A A . 52 GLU C    1 1 
        4  5018 1 1 55 GLU CA   C   5.318  -4.680   6.513 1.00 . A A . 52 GLU CA   1 1 
        4  5019 1 1 55 GLU CB   C   5.633  -4.294   7.960 1.00 . A A . 52 GLU CB   1 1 
        4  5020 1 1 55 GLU CD   C   5.977  -2.456   9.666 1.00 . A A . 52 GLU CD   1 1 
        4  5021 1 1 55 GLU CG   C   5.447  -2.807   8.290 1.00 . A A . 52 GLU CG   1 1 
        4  5022 1 1 55 GLU H    H   6.328  -6.551   6.644 1.00 . A A . 52 GLU H    1 1 
        4  5023 1 1 55 GLU HA   H   4.273  -4.486   6.329 1.00 . A A . 52 GLU HA   1 1 
        4  5024 1 1 55 GLU HB2  H   4.994  -4.870   8.620 1.00 . A A . 52 GLU HB2  1 1 
        4  5025 1 1 55 GLU HB3  H   6.651  -4.556   8.159 1.00 . A A . 52 GLU HB3  1 1 
        4  5026 1 1 55 GLU HG2  H   5.976  -2.216   7.557 1.00 . A A . 52 GLU HG2  1 1 
        4  5027 1 1 55 GLU HG3  H   4.390  -2.556   8.258 1.00 . A A . 52 GLU HG3  1 1 
        4  5028 1 1 55 GLU N    N   5.526  -6.122   6.311 1.00 . A A . 52 GLU N    1 1 
        4  5029 1 1 55 GLU O    O   7.406  -3.832   5.648 1.00 . A A . 52 GLU O    1 1 
        4  5030 1 1 55 GLU OE1  O   5.209  -2.544  10.632 1.00 . A A . 52 GLU OE1  1 1 
        4  5031 1 1 55 GLU OE2  O   7.168  -2.118   9.781 1.00 . A A . 52 GLU OE2  1 1 
        4  5032 1 1 56 PHE C    C   5.902  -0.910   3.577 1.00 . A A . 53 PHE C    1 1 
        4  5033 1 1 56 PHE CA   C   6.263  -2.416   3.511 1.00 . A A . 53 PHE CA   1 1 
        4  5034 1 1 56 PHE CB   C   6.080  -2.999   2.049 1.00 . A A . 53 PHE CB   1 1 
        4  5035 1 1 56 PHE CD1  C   3.623  -3.409   2.157 1.00 . A A . 53 PHE CD1  1 1 
        4  5036 1 1 56 PHE CD2  C   4.993  -5.137   1.251 1.00 . A A . 53 PHE CD2  1 1 
        4  5037 1 1 56 PHE CE1  C   2.522  -4.179   1.960 1.00 . A A . 53 PHE CE1  1 1 
        4  5038 1 1 56 PHE CE2  C   3.893  -5.908   1.058 1.00 . A A . 53 PHE CE2  1 1 
        4  5039 1 1 56 PHE CG   C   4.876  -3.867   1.818 1.00 . A A . 53 PHE CG   1 1 
        4  5040 1 1 56 PHE CZ   C   2.652  -5.431   1.413 1.00 . A A . 53 PHE CZ   1 1 
        4  5041 1 1 56 PHE H    H   4.535  -3.263   4.496 1.00 . A A . 53 PHE H    1 1 
        4  5042 1 1 56 PHE HA   H   7.304  -2.494   3.783 1.00 . A A . 53 PHE HA   1 1 
        4  5043 1 1 56 PHE HB2  H   6.009  -2.187   1.343 1.00 . A A . 53 PHE HB2  1 1 
        4  5044 1 1 56 PHE HB3  H   6.947  -3.589   1.798 1.00 . A A . 53 PHE HB3  1 1 
        4  5045 1 1 56 PHE HD1  H   3.524  -2.428   2.599 1.00 . A A . 53 PHE HD1  1 1 
        4  5046 1 1 56 PHE HD2  H   5.955  -5.512   0.922 1.00 . A A . 53 PHE HD2  1 1 
        4  5047 1 1 56 PHE HE1  H   1.548  -3.803   2.234 1.00 . A A . 53 PHE HE1  1 1 
        4  5048 1 1 56 PHE HE2  H   4.000  -6.884   0.624 1.00 . A A . 53 PHE HE2  1 1 
        4  5049 1 1 56 PHE HZ   H   1.780  -6.026   1.237 1.00 . A A . 53 PHE HZ   1 1 
        4  5050 1 1 56 PHE N    N   5.540  -3.224   4.529 1.00 . A A . 53 PHE N    1 1 
        4  5051 1 1 56 PHE O    O   4.836  -0.576   4.111 1.00 . A A . 53 PHE O    1 1 
        4  5052 1 1 57 GLU C    C   5.259   1.588   1.819 1.00 . A A . 54 GLU C    1 1 
        4  5053 1 1 57 GLU CA   C   6.420   1.446   2.822 1.00 . A A . 54 GLU CA   1 1 
        4  5054 1 1 57 GLU CB   C   7.575   2.415   2.351 1.00 . A A . 54 GLU CB   1 1 
        4  5055 1 1 57 GLU CD   C   9.661   2.640   0.895 1.00 . A A . 54 GLU CD   1 1 
        4  5056 1 1 57 GLU CG   C   8.239   2.105   0.992 1.00 . A A . 54 GLU CG   1 1 
        4  5057 1 1 57 GLU H    H   7.761  -0.275   2.973 1.00 . A A . 54 GLU H    1 1 
        4  5058 1 1 57 GLU HA   H   6.049   1.813   3.768 1.00 . A A . 54 GLU HA   1 1 
        4  5059 1 1 57 GLU HB2  H   7.146   3.411   2.280 1.00 . A A . 54 GLU HB2  1 1 
        4  5060 1 1 57 GLU HB3  H   8.346   2.466   3.094 1.00 . A A . 54 GLU HB3  1 1 
        4  5061 1 1 57 GLU HG2  H   8.260   1.041   0.840 1.00 . A A . 54 GLU HG2  1 1 
        4  5062 1 1 57 GLU HG3  H   7.657   2.570   0.181 1.00 . A A . 54 GLU HG3  1 1 
        4  5063 1 1 57 GLU N    N   6.808   0.003   3.076 1.00 . A A . 54 GLU N    1 1 
        4  5064 1 1 57 GLU O    O   4.439   2.500   1.958 1.00 . A A . 54 GLU O    1 1 
        4  5065 1 1 57 GLU OE1  O  10.527   2.182   1.670 1.00 . A A . 54 GLU OE1  1 1 
        4  5066 1 1 57 GLU OE2  O   9.923   3.490   0.015 1.00 . A A . 54 GLU OE2  1 1 
        4  5067 1 1 58 ASP C    C   3.098  -0.319  -0.050 1.00 . A A . 55 ASP C    1 1 
        4  5068 1 1 58 ASP CA   C   4.082   0.849  -0.150 1.00 . A A . 55 ASP CA   1 1 
        4  5069 1 1 58 ASP CB   C   4.670   0.859  -1.581 1.00 . A A . 55 ASP CB   1 1 
        4  5070 1 1 58 ASP CG   C   5.652   1.981  -1.827 1.00 . A A . 55 ASP CG   1 1 
        4  5071 1 1 58 ASP H    H   5.770  -0.059   0.757 1.00 . A A . 55 ASP H    1 1 
        4  5072 1 1 58 ASP HA   H   3.592   1.795   0.036 1.00 . A A . 55 ASP HA   1 1 
        4  5073 1 1 58 ASP HB2  H   5.181  -0.073  -1.746 1.00 . A A . 55 ASP HB2  1 1 
        4  5074 1 1 58 ASP HB3  H   3.868   0.947  -2.308 1.00 . A A . 55 ASP HB3  1 1 
        4  5075 1 1 58 ASP N    N   5.142   0.689   0.828 1.00 . A A . 55 ASP N    1 1 
        4  5076 1 1 58 ASP O    O   3.452  -1.455  -0.377 1.00 . A A . 55 ASP O    1 1 
        4  5077 1 1 58 ASP OD1  O   5.221   3.156  -1.823 1.00 . A A . 55 ASP OD1  1 1 
        4  5078 1 1 58 ASP OD2  O   6.843   1.687  -2.056 1.00 . A A . 55 ASP OD2  1 1 
        4  5079 1 1 59 ALA C    C   0.152  -1.300  -1.075 1.00 . A A . 56 ALA C    1 1 
        4  5080 1 1 59 ALA CA   C   0.781  -1.058   0.319 1.00 . A A . 56 ALA CA   1 1 
        4  5081 1 1 59 ALA CB   C  -0.310  -0.862   1.382 1.00 . A A . 56 ALA CB   1 1 
        4  5082 1 1 59 ALA H    H   1.699   0.798   0.893 1.00 . A A . 56 ALA H    1 1 
        4  5083 1 1 59 ALA HA   H   1.267  -1.974   0.586 1.00 . A A . 56 ALA HA   1 1 
        4  5084 1 1 59 ALA HB1  H  -1.028  -1.672   1.296 1.00 . A A . 56 ALA HB1  1 1 
        4  5085 1 1 59 ALA HB2  H  -0.817   0.071   1.274 1.00 . A A . 56 ALA HB2  1 1 
        4  5086 1 1 59 ALA HB3  H   0.135  -0.920   2.368 1.00 . A A . 56 ALA HB3  1 1 
        4  5087 1 1 59 ALA N    N   1.850  -0.037   0.382 1.00 . A A . 56 ALA N    1 1 
        4  5088 1 1 59 ALA O    O  -0.108  -2.459  -1.414 1.00 . A A . 56 ALA O    1 1 
        4  5089 1 1 60 ARG C    C  -0.189  -1.132  -4.295 1.00 . A A . 57 ARG C    1 1 
        4  5090 1 1 60 ARG CA   C  -0.943  -0.438  -3.101 1.00 . A A . 57 ARG CA   1 1 
        4  5091 1 1 60 ARG CB   C  -1.740   0.835  -3.544 1.00 . A A . 57 ARG CB   1 1 
        4  5092 1 1 60 ARG CD   C  -1.425   3.240  -4.265 1.00 . A A . 57 ARG CD   1 1 
        4  5093 1 1 60 ARG CG   C  -1.066   1.785  -4.556 1.00 . A A . 57 ARG CG   1 1 
        4  5094 1 1 60 ARG CZ   C  -1.137   5.471  -5.313 1.00 . A A . 57 ARG CZ   1 1 
        4  5095 1 1 60 ARG H    H   0.232   0.640  -1.655 1.00 . A A . 57 ARG H    1 1 
        4  5096 1 1 60 ARG HA   H  -1.701  -1.149  -2.787 1.00 . A A . 57 ARG HA   1 1 
        4  5097 1 1 60 ARG HB2  H  -2.665   0.492  -3.994 1.00 . A A . 57 ARG HB2  1 1 
        4  5098 1 1 60 ARG HB3  H  -2.014   1.413  -2.662 1.00 . A A . 57 ARG HB3  1 1 
        4  5099 1 1 60 ARG HD2  H  -2.482   3.313  -4.064 1.00 . A A . 57 ARG HD2  1 1 
        4  5100 1 1 60 ARG HD3  H  -0.871   3.563  -3.392 1.00 . A A . 57 ARG HD3  1 1 
        4  5101 1 1 60 ARG HE   H  -0.834   3.708  -6.226 1.00 . A A . 57 ARG HE   1 1 
        4  5102 1 1 60 ARG HG2  H   0.004   1.665  -4.518 1.00 . A A . 57 ARG HG2  1 1 
        4  5103 1 1 60 ARG HG3  H  -1.413   1.530  -5.554 1.00 . A A . 57 ARG HG3  1 1 
        4  5104 1 1 60 ARG HH11 H  -1.697   5.566  -3.365 1.00 . A A . 57 ARG HH11 1 1 
        4  5105 1 1 60 ARG HH12 H  -1.493   7.099  -4.145 1.00 . A A . 57 ARG HH12 1 1 
        4  5106 1 1 60 ARG HH21 H  -0.662   5.718  -7.267 1.00 . A A . 57 ARG HH21 1 1 
        4  5107 1 1 60 ARG HH22 H  -0.902   7.182  -6.375 1.00 . A A . 57 ARG HH22 1 1 
        4  5108 1 1 60 ARG N    N  -0.118  -0.243  -1.881 1.00 . A A . 57 ARG N    1 1 
        4  5109 1 1 60 ARG NE   N  -1.106   4.134  -5.379 1.00 . A A . 57 ARG NE   1 1 
        4  5110 1 1 60 ARG NH1  N  -1.468   6.095  -4.179 1.00 . A A . 57 ARG NH1  1 1 
        4  5111 1 1 60 ARG NH2  N  -0.888   6.182  -6.403 1.00 . A A . 57 ARG NH2  1 1 
        4  5112 1 1 60 ARG O    O  -0.836  -1.859  -5.043 1.00 . A A . 57 ARG O    1 1 
        4  5113 1 1 61 ASP C    C   2.073  -3.240  -5.214 1.00 . A A . 58 ASP C    1 1 
        4  5114 1 1 61 ASP CA   C   1.908  -1.704  -5.552 1.00 . A A . 58 ASP CA   1 1 
        4  5115 1 1 61 ASP CB   C   3.289  -1.055  -5.905 1.00 . A A . 58 ASP CB   1 1 
        4  5116 1 1 61 ASP CG   C   3.417  -0.748  -7.381 1.00 . A A . 58 ASP CG   1 1 
        4  5117 1 1 61 ASP H    H   1.599  -0.163  -4.036 1.00 . A A . 58 ASP H    1 1 
        4  5118 1 1 61 ASP HA   H   1.290  -1.642  -6.436 1.00 . A A . 58 ASP HA   1 1 
        4  5119 1 1 61 ASP HB2  H   3.416  -0.120  -5.372 1.00 . A A . 58 ASP HB2  1 1 
        4  5120 1 1 61 ASP HB3  H   4.103  -1.741  -5.652 1.00 . A A . 58 ASP HB3  1 1 
        4  5121 1 1 61 ASP N    N   1.151  -0.917  -4.498 1.00 . A A . 58 ASP N    1 1 
        4  5122 1 1 61 ASP O    O   1.883  -4.091  -6.089 1.00 . A A . 58 ASP O    1 1 
        4  5123 1 1 61 ASP OD1  O   2.523  -0.074  -7.915 1.00 . A A . 58 ASP OD1  1 1 
        4  5124 1 1 61 ASP OD2  O   4.417  -1.150  -8.000 1.00 . A A . 58 ASP OD2  1 1 
        4  5125 1 1 62 ALA C    C   1.193  -5.854  -3.525 1.00 . A A . 59 ALA C    1 1 
        4  5126 1 1 62 ALA CA   C   2.492  -4.938  -3.357 1.00 . A A . 59 ALA CA   1 1 
        4  5127 1 1 62 ALA CB   C   2.958  -4.756  -1.919 1.00 . A A . 59 ALA CB   1 1 
        4  5128 1 1 62 ALA H    H   2.852  -2.882  -3.413 1.00 . A A . 59 ALA H    1 1 
        4  5129 1 1 62 ALA HA   H   3.300  -5.428  -3.851 1.00 . A A . 59 ALA HA   1 1 
        4  5130 1 1 62 ALA HB1  H   2.780  -5.638  -1.326 1.00 . A A . 59 ALA HB1  1 1 
        4  5131 1 1 62 ALA HB2  H   2.463  -3.918  -1.465 1.00 . A A . 59 ALA HB2  1 1 
        4  5132 1 1 62 ALA HB3  H   4.035  -4.558  -1.924 1.00 . A A . 59 ALA HB3  1 1 
        4  5133 1 1 62 ALA N    N   2.445  -3.570  -3.949 1.00 . A A . 59 ALA N    1 1 
        4  5134 1 1 62 ALA O    O   1.221  -7.120  -3.339 1.00 . A A . 59 ALA O    1 1 
        4  5135 1 1 63 ALA C    C  -0.975  -6.882  -5.433 1.00 . A A . 60 ALA C    1 1 
        4  5136 1 1 63 ALA CA   C  -1.189  -5.884  -4.220 1.00 . A A . 60 ALA CA   1 1 
        4  5137 1 1 63 ALA CB   C  -2.290  -4.820  -4.515 1.00 . A A . 60 ALA CB   1 1 
        4  5138 1 1 63 ALA H    H   0.016  -4.270  -3.596 1.00 . A A . 60 ALA H    1 1 
        4  5139 1 1 63 ALA HA   H  -1.536  -6.460  -3.378 1.00 . A A . 60 ALA HA   1 1 
        4  5140 1 1 63 ALA HB1  H  -2.611  -4.356  -3.585 1.00 . A A . 60 ALA HB1  1 1 
        4  5141 1 1 63 ALA HB2  H  -3.143  -5.287  -4.976 1.00 . A A . 60 ALA HB2  1 1 
        4  5142 1 1 63 ALA HB3  H  -1.910  -4.044  -5.178 1.00 . A A . 60 ALA HB3  1 1 
        4  5143 1 1 63 ALA N    N   0.048  -5.211  -3.777 1.00 . A A . 60 ALA N    1 1 
        4  5144 1 1 63 ALA O    O  -1.678  -7.897  -5.471 1.00 . A A . 60 ALA O    1 1 
        4  5145 1 1 64 ASP C    C   0.980  -8.931  -6.750 1.00 . A A . 61 ASP C    1 1 
        4  5146 1 1 64 ASP CA   C   0.471  -7.622  -7.405 1.00 . A A . 61 ASP CA   1 1 
        4  5147 1 1 64 ASP CB   C   1.563  -7.044  -8.336 1.00 . A A . 61 ASP CB   1 1 
        4  5148 1 1 64 ASP CG   C   0.989  -6.114  -9.397 1.00 . A A . 61 ASP CG   1 1 
        4  5149 1 1 64 ASP H    H   0.259  -5.667  -6.548 1.00 . A A . 61 ASP H    1 1 
        4  5150 1 1 64 ASP HA   H  -0.349  -7.886  -8.045 1.00 . A A . 61 ASP HA   1 1 
        4  5151 1 1 64 ASP HB2  H   2.298  -6.506  -7.759 1.00 . A A . 61 ASP HB2  1 1 
        4  5152 1 1 64 ASP HB3  H   2.057  -7.863  -8.850 1.00 . A A . 61 ASP HB3  1 1 
        4  5153 1 1 64 ASP N    N  -0.026  -6.599  -6.414 1.00 . A A . 61 ASP N    1 1 
        4  5154 1 1 64 ASP O    O   0.664 -10.035  -7.238 1.00 . A A . 61 ASP O    1 1 
        4  5155 1 1 64 ASP OD1  O   0.692  -4.945  -9.080 1.00 . A A . 61 ASP OD1  1 1 
        4  5156 1 1 64 ASP OD2  O   0.846  -6.560 -10.558 1.00 . A A . 61 ASP OD2  1 1 
        4  5157 1 1 65 ALA C    C   0.940 -10.720  -4.323 1.00 . A A . 62 ALA C    1 1 
        4  5158 1 1 65 ALA CA   C   2.157 -10.033  -4.899 1.00 . A A . 62 ALA CA   1 1 
        4  5159 1 1 65 ALA CB   C   3.158  -9.766  -3.757 1.00 . A A . 62 ALA CB   1 1 
        4  5160 1 1 65 ALA H    H   2.135  -7.971  -5.444 1.00 . A A . 62 ALA H    1 1 
        4  5161 1 1 65 ALA HA   H   2.629 -10.715  -5.587 1.00 . A A . 62 ALA HA   1 1 
        4  5162 1 1 65 ALA HB1  H   2.725  -9.129  -3.009 1.00 . A A . 62 ALA HB1  1 1 
        4  5163 1 1 65 ALA HB2  H   4.049  -9.310  -4.145 1.00 . A A . 62 ALA HB2  1 1 
        4  5164 1 1 65 ALA HB3  H   3.428 -10.704  -3.293 1.00 . A A . 62 ALA HB3  1 1 
        4  5165 1 1 65 ALA N    N   1.776  -8.833  -5.679 1.00 . A A . 62 ALA N    1 1 
        4  5166 1 1 65 ALA O    O   0.745 -11.936  -4.580 1.00 . A A . 62 ALA O    1 1 
        4  5167 1 1 66 ILE C    C  -2.007 -11.378  -3.895 1.00 . A A . 63 ILE C    1 1 
        4  5168 1 1 66 ILE CA   C  -1.017 -10.691  -2.910 1.00 . A A . 63 ILE CA   1 1 
        4  5169 1 1 66 ILE CB   C  -1.744  -9.868  -1.796 1.00 . A A . 63 ILE CB   1 1 
        4  5170 1 1 66 ILE CD1  C  -3.260 -10.472   0.231 1.00 . A A . 63 ILE CD1  1 1 
        4  5171 1 1 66 ILE CG1  C  -2.124 -10.876  -0.678 1.00 . A A . 63 ILE CG1  1 1 
        4  5172 1 1 66 ILE CG2  C  -2.959  -9.079  -2.288 1.00 . A A . 63 ILE CG2  1 1 
        4  5173 1 1 66 ILE H    H   0.223  -9.009  -3.450 1.00 . A A . 63 ILE H    1 1 
        4  5174 1 1 66 ILE HA   H  -0.542 -11.514  -2.391 1.00 . A A . 63 ILE HA   1 1 
        4  5175 1 1 66 ILE HB   H  -1.041  -9.160  -1.391 1.00 . A A . 63 ILE HB   1 1 
        4  5176 1 1 66 ILE HD11 H  -3.121 -10.927   1.203 1.00 . A A . 63 ILE HD11 1 1 
        4  5177 1 1 66 ILE HD12 H  -4.191 -10.807  -0.200 1.00 . A A . 63 ILE HD12 1 1 
        4  5178 1 1 66 ILE HD13 H  -3.279  -9.404   0.331 1.00 . A A . 63 ILE HD13 1 1 
        4  5179 1 1 66 ILE HG12 H  -2.407 -11.808  -1.136 1.00 . A A . 63 ILE HG12 1 1 
        4  5180 1 1 66 ILE HG13 H  -1.255 -11.051  -0.055 1.00 . A A . 63 ILE HG13 1 1 
        4  5181 1 1 66 ILE HG21 H  -3.297  -8.418  -1.499 1.00 . A A . 63 ILE HG21 1 1 
        4  5182 1 1 66 ILE HG22 H  -3.748  -9.771  -2.527 1.00 . A A . 63 ILE HG22 1 1 
        4  5183 1 1 66 ILE HG23 H  -2.698  -8.507  -3.157 1.00 . A A . 63 ILE HG23 1 1 
        4  5184 1 1 66 ILE N    N   0.087  -9.983  -3.576 1.00 . A A . 63 ILE N    1 1 
        4  5185 1 1 66 ILE O    O  -2.415 -12.488  -3.616 1.00 . A A . 63 ILE O    1 1 
        4  5186 1 1 67 LYS C    C  -2.317 -12.593  -6.783 1.00 . A A . 64 LYS C    1 1 
        4  5187 1 1 67 LYS CA   C  -3.091 -11.425  -6.105 1.00 . A A . 64 LYS CA   1 1 
        4  5188 1 1 67 LYS CB   C  -3.643 -10.447  -7.206 1.00 . A A . 64 LYS CB   1 1 
        4  5189 1 1 67 LYS CD   C  -1.817 -10.227  -9.077 1.00 . A A . 64 LYS CD   1 1 
        4  5190 1 1 67 LYS CE   C  -1.302  -9.262 -10.135 1.00 . A A . 64 LYS CE   1 1 
        4  5191 1 1 67 LYS CG   C  -2.635  -9.530  -7.968 1.00 . A A . 64 LYS CG   1 1 
        4  5192 1 1 67 LYS H    H  -2.331  -9.782  -5.011 1.00 . A A . 64 LYS H    1 1 
        4  5193 1 1 67 LYS HA   H  -3.952 -11.865  -5.609 1.00 . A A . 64 LYS HA   1 1 
        4  5194 1 1 67 LYS HB2  H  -4.144 -11.047  -7.944 1.00 . A A . 64 LYS HB2  1 1 
        4  5195 1 1 67 LYS HB3  H  -4.387  -9.806  -6.747 1.00 . A A . 64 LYS HB3  1 1 
        4  5196 1 1 67 LYS HD2  H  -0.946 -10.692  -8.611 1.00 . A A . 64 LYS HD2  1 1 
        4  5197 1 1 67 LYS HD3  H  -2.414 -10.987  -9.554 1.00 . A A . 64 LYS HD3  1 1 
        4  5198 1 1 67 LYS HE2  H  -1.236  -8.280  -9.708 1.00 . A A . 64 LYS HE2  1 1 
        4  5199 1 1 67 LYS HE3  H  -0.316  -9.584 -10.436 1.00 . A A . 64 LYS HE3  1 1 
        4  5200 1 1 67 LYS HG2  H  -3.172  -8.720  -8.410 1.00 . A A . 64 LYS HG2  1 1 
        4  5201 1 1 67 LYS HG3  H  -1.927  -9.125  -7.236 1.00 . A A . 64 LYS HG3  1 1 
        4  5202 1 1 67 LYS HZ1  H  -3.132  -8.891 -11.057 1.00 . A A . 64 LYS HZ1  1 1 
        4  5203 1 1 67 LYS HZ2  H  -2.230 -10.135 -11.774 1.00 . A A . 64 LYS HZ2  1 1 
        4  5204 1 1 67 LYS HZ3  H  -1.781  -8.526 -12.013 1.00 . A A . 64 LYS HZ3  1 1 
        4  5205 1 1 67 LYS N    N  -2.374 -10.733  -5.012 1.00 . A A . 64 LYS N    1 1 
        4  5206 1 1 67 LYS NZ   N  -2.175  -9.200 -11.326 1.00 . A A . 64 LYS NZ   1 1 
        4  5207 1 1 67 LYS O    O  -2.966 -13.543  -7.212 1.00 . A A . 64 LYS O    1 1 
        4  5208 1 1 68 GLU C    C  -0.337 -14.935  -6.625 1.00 . A A . 65 GLU C    1 1 
        4  5209 1 1 68 GLU CA   C  -0.251 -13.713  -7.540 1.00 . A A . 65 GLU CA   1 1 
        4  5210 1 1 68 GLU CB   C   1.234 -13.431  -7.921 1.00 . A A . 65 GLU CB   1 1 
        4  5211 1 1 68 GLU CD   C   3.081 -14.752  -6.718 1.00 . A A . 65 GLU CD   1 1 
        4  5212 1 1 68 GLU CG   C   2.235 -13.479  -6.767 1.00 . A A . 65 GLU CG   1 1 
        4  5213 1 1 68 GLU H    H  -0.466 -11.726  -6.751 1.00 . A A . 65 GLU H    1 1 
        4  5214 1 1 68 GLU HA   H  -0.788 -13.962  -8.451 1.00 . A A . 65 GLU HA   1 1 
        4  5215 1 1 68 GLU HB2  H   1.544 -14.172  -8.639 1.00 . A A . 65 GLU HB2  1 1 
        4  5216 1 1 68 GLU HB3  H   1.298 -12.461  -8.374 1.00 . A A . 65 GLU HB3  1 1 
        4  5217 1 1 68 GLU HG2  H   2.870 -12.649  -6.825 1.00 . A A . 65 GLU HG2  1 1 
        4  5218 1 1 68 GLU HG3  H   1.678 -13.398  -5.863 1.00 . A A . 65 GLU HG3  1 1 
        4  5219 1 1 68 GLU N    N  -0.960 -12.542  -6.947 1.00 . A A . 65 GLU N    1 1 
        4  5220 1 1 68 GLU O    O  -0.398 -16.062  -7.124 1.00 . A A . 65 GLU O    1 1 
        4  5221 1 1 68 GLU OE1  O   3.730 -15.078  -7.729 1.00 . A A . 65 GLU OE1  1 1 
        4  5222 1 1 68 GLU OE2  O   3.075 -15.445  -5.670 1.00 . A A . 65 GLU OE2  1 1 
        4  5223 1 1 69 LYS C    C  -1.975 -15.936  -3.790 1.00 . A A . 66 LYS C    1 1 
        4  5224 1 1 69 LYS CA   C  -0.533 -15.871  -4.420 1.00 . A A . 66 LYS CA   1 1 
        4  5225 1 1 69 LYS CB   C   0.667 -16.020  -3.429 1.00 . A A . 66 LYS CB   1 1 
        4  5226 1 1 69 LYS CD   C   1.455 -13.810  -2.267 1.00 . A A . 66 LYS CD   1 1 
        4  5227 1 1 69 LYS CE   C   2.899 -13.916  -2.818 1.00 . A A . 66 LYS CE   1 1 
        4  5228 1 1 69 LYS CG   C   0.692 -15.153  -2.149 1.00 . A A . 66 LYS CG   1 1 
        4  5229 1 1 69 LYS H    H  -0.063 -13.862  -4.926 1.00 . A A . 66 LYS H    1 1 
        4  5230 1 1 69 LYS HA   H  -0.482 -16.723  -5.080 1.00 . A A . 66 LYS HA   1 1 
        4  5231 1 1 69 LYS HB2  H   0.723 -17.054  -3.121 1.00 . A A . 66 LYS HB2  1 1 
        4  5232 1 1 69 LYS HB3  H   1.577 -15.794  -4.004 1.00 . A A . 66 LYS HB3  1 1 
        4  5233 1 1 69 LYS HD2  H   0.894 -13.137  -2.904 1.00 . A A . 66 LYS HD2  1 1 
        4  5234 1 1 69 LYS HD3  H   1.502 -13.370  -1.278 1.00 . A A . 66 LYS HD3  1 1 
        4  5235 1 1 69 LYS HE2  H   2.877 -14.146  -3.880 1.00 . A A . 66 LYS HE2  1 1 
        4  5236 1 1 69 LYS HE3  H   3.372 -12.947  -2.692 1.00 . A A . 66 LYS HE3  1 1 
        4  5237 1 1 69 LYS HG2  H  -0.329 -14.932  -1.873 1.00 . A A . 66 LYS HG2  1 1 
        4  5238 1 1 69 LYS HG3  H   1.143 -15.737  -1.351 1.00 . A A . 66 LYS HG3  1 1 
        4  5239 1 1 69 LYS HZ1  H   4.664 -15.003  -2.556 1.00 . A A . 66 LYS HZ1  1 1 
        4  5240 1 1 69 LYS HZ2  H   3.264 -15.863  -2.151 1.00 . A A . 66 LYS HZ2  1 1 
        4  5241 1 1 69 LYS HZ3  H   3.851 -14.669  -1.107 1.00 . A A . 66 LYS HZ3  1 1 
        4  5242 1 1 69 LYS N    N  -0.318 -14.733  -5.295 1.00 . A A . 66 LYS N    1 1 
        4  5243 1 1 69 LYS NZ   N   3.726 -14.937  -2.105 1.00 . A A . 66 LYS NZ   1 1 
        4  5244 1 1 69 LYS O    O  -2.173 -16.691  -2.846 1.00 . A A . 66 LYS O    1 1 
        4  5245 1 1 70 ASP C    C  -5.167 -16.409  -3.910 1.00 . A A . 67 ASP C    1 1 
        4  5246 1 1 70 ASP CA   C  -4.378 -15.110  -3.784 1.00 . A A . 67 ASP CA   1 1 
        4  5247 1 1 70 ASP CB   C  -5.287 -13.917  -4.161 1.00 . A A . 67 ASP CB   1 1 
        4  5248 1 1 70 ASP CG   C  -6.155 -14.093  -5.414 1.00 . A A . 67 ASP CG   1 1 
        4  5249 1 1 70 ASP H    H  -2.848 -14.816  -5.265 1.00 . A A . 67 ASP H    1 1 
        4  5250 1 1 70 ASP HA   H  -4.182 -14.986  -2.751 1.00 . A A . 67 ASP HA   1 1 
        4  5251 1 1 70 ASP HB2  H  -5.962 -13.780  -3.312 1.00 . A A . 67 ASP HB2  1 1 
        4  5252 1 1 70 ASP HB3  H  -4.702 -13.029  -4.258 1.00 . A A . 67 ASP HB3  1 1 
        4  5253 1 1 70 ASP N    N  -2.993 -15.206  -4.372 1.00 . A A . 67 ASP N    1 1 
        4  5254 1 1 70 ASP O    O  -4.803 -17.277  -4.716 1.00 . A A . 67 ASP O    1 1 
        4  5255 1 1 70 ASP OD1  O  -5.623 -14.122  -6.536 1.00 . A A . 67 ASP OD1  1 1 
        4  5256 1 1 70 ASP OD2  O  -7.393 -14.186  -5.259 1.00 . A A . 67 ASP OD2  1 1 
        4  5257 1 1 71 GLY C    C  -6.833 -18.364  -1.502 1.00 . A A . 68 GLY C    1 1 
        4  5258 1 1 71 GLY CA   C  -6.790 -17.879  -2.938 1.00 . A A . 68 GLY CA   1 1 
        4  5259 1 1 71 GLY H    H  -6.670 -15.781  -2.731 1.00 . A A . 68 GLY H    1 1 
        4  5260 1 1 71 GLY HA2  H  -7.794 -17.894  -3.327 1.00 . A A . 68 GLY HA2  1 1 
        4  5261 1 1 71 GLY HA3  H  -6.198 -18.578  -3.514 1.00 . A A . 68 GLY HA3  1 1 
        4  5262 1 1 71 GLY N    N  -6.249 -16.561  -3.131 1.00 . A A . 68 GLY N    1 1 
        4  5263 1 1 71 GLY O    O  -6.595 -19.551  -1.279 1.00 . A A . 68 GLY O    1 1 
        4  5264 1 1 72 CYS C    C  -8.213 -18.923   1.078 1.00 . A A . 69 CYS C    1 1 
        4  5265 1 1 72 CYS CA   C  -7.154 -17.828   0.892 1.00 . A A . 69 CYS CA   1 1 
        4  5266 1 1 72 CYS CB   C  -7.594 -16.583   1.715 1.00 . A A . 69 CYS CB   1 1 
        4  5267 1 1 72 CYS H    H  -7.023 -16.476  -0.705 1.00 . A A . 69 CYS H    1 1 
        4  5268 1 1 72 CYS HA   H  -6.198 -18.174   1.245 1.00 . A A . 69 CYS HA   1 1 
        4  5269 1 1 72 CYS HB2  H  -8.337 -16.875   2.438 1.00 . A A . 69 CYS HB2  1 1 
        4  5270 1 1 72 CYS HB3  H  -6.742 -16.189   2.235 1.00 . A A . 69 CYS HB3  1 1 
        4  5271 1 1 72 CYS HG   H  -8.334 -14.152   1.474 1.00 . A A . 69 CYS HG   1 1 
        4  5272 1 1 72 CYS N    N  -7.024 -17.432  -0.509 1.00 . A A . 69 CYS N    1 1 
        4  5273 1 1 72 CYS O    O  -9.376 -18.764   0.698 1.00 . A A . 69 CYS O    1 1 
        4  5274 1 1 72 CYS SG   S  -8.310 -15.250   0.724 1.00 . A A . 69 CYS SG   1 1 
        4  5275 1 1 73 ASP C    C  -8.520 -21.690   3.392 1.00 . A A . 70 ASP C    1 1 
        4  5276 1 1 73 ASP CA   C  -8.645 -21.173   1.943 1.00 . A A . 70 ASP CA   1 1 
        4  5277 1 1 73 ASP CB   C  -8.365 -22.297   0.934 1.00 . A A . 70 ASP CB   1 1 
        4  5278 1 1 73 ASP CG   C  -9.620 -22.729   0.198 1.00 . A A . 70 ASP CG   1 1 
        4  5279 1 1 73 ASP H    H  -6.819 -20.108   1.965 1.00 . A A . 70 ASP H    1 1 
        4  5280 1 1 73 ASP HA   H  -9.643 -20.802   1.791 1.00 . A A . 70 ASP HA   1 1 
        4  5281 1 1 73 ASP HB2  H  -7.645 -21.954   0.200 1.00 . A A . 70 ASP HB2  1 1 
        4  5282 1 1 73 ASP HB3  H  -7.954 -23.152   1.457 1.00 . A A . 70 ASP HB3  1 1 
        4  5283 1 1 73 ASP N    N  -7.773 -20.035   1.707 1.00 . A A . 70 ASP N    1 1 
        4  5284 1 1 73 ASP O    O  -7.416 -21.646   3.987 1.00 . A A . 70 ASP O    1 1 
        4  5285 1 1 73 ASP OD1  O -10.537 -23.288   0.842 1.00 . A A . 70 ASP OD1  1 1 
        4  5286 1 1 73 ASP OD2  O  -9.690 -22.494  -1.026 1.00 . A A . 70 ASP OD2  1 1 
        4  5287 1 1 74 PHE C    C -10.793 -23.783   5.314 1.00 . A A . 71 PHE C    1 1 
        4  5288 1 1 74 PHE CA   C  -9.890 -22.550   5.289 1.00 . A A . 71 PHE CA   1 1 
        4  5289 1 1 74 PHE CB   C -10.498 -21.352   6.071 1.00 . A A . 71 PHE CB   1 1 
        4  5290 1 1 74 PHE CD1  C -12.072 -20.044   4.580 1.00 . A A . 71 PHE CD1  1 1 
        4  5291 1 1 74 PHE CD2  C -13.010 -21.338   6.361 1.00 . A A . 71 PHE CD2  1 1 
        4  5292 1 1 74 PHE CE1  C -13.333 -19.622   4.218 1.00 . A A . 71 PHE CE1  1 1 
        4  5293 1 1 74 PHE CE2  C -14.275 -20.917   5.995 1.00 . A A . 71 PHE CE2  1 1 
        4  5294 1 1 74 PHE CG   C -11.888 -20.906   5.659 1.00 . A A . 71 PHE CG   1 1 
        4  5295 1 1 74 PHE CZ   C -14.438 -20.060   4.923 1.00 . A A . 71 PHE CZ   1 1 
        4  5296 1 1 74 PHE H    H -10.334 -22.574   3.281 1.00 . A A . 71 PHE H    1 1 
        4  5297 1 1 74 PHE HA   H  -8.932 -22.819   5.734 1.00 . A A . 71 PHE HA   1 1 
        4  5298 1 1 74 PHE HB2  H -10.545 -21.607   7.118 1.00 . A A . 71 PHE HB2  1 1 
        4  5299 1 1 74 PHE HB3  H  -9.834 -20.500   5.960 1.00 . A A . 71 PHE HB3  1 1 
        4  5300 1 1 74 PHE HD1  H -11.218 -19.701   4.028 1.00 . A A . 71 PHE HD1  1 1 
        4  5301 1 1 74 PHE HD2  H -12.888 -22.019   7.200 1.00 . A A . 71 PHE HD2  1 1 
        4  5302 1 1 74 PHE HE1  H -13.463 -18.955   3.379 1.00 . A A . 71 PHE HE1  1 1 
        4  5303 1 1 74 PHE HE2  H -15.138 -21.260   6.549 1.00 . A A . 71 PHE HE2  1 1 
        4  5304 1 1 74 PHE HZ   H -15.424 -19.726   4.643 1.00 . A A . 71 PHE HZ   1 1 
        4  5305 1 1 74 PHE N    N  -9.644 -22.243   3.901 1.00 . A A . 71 PHE N    1 1 
        4  5306 1 1 74 PHE O    O -11.589 -23.953   4.382 1.00 . A A . 71 PHE O    1 1 
        4  5307 1 1 75 GLU C    C -11.229 -26.960   5.383 1.00 . A A . 72 GLU C    1 1 
        4  5308 1 1 75 GLU CA   C -11.437 -25.889   6.501 1.00 . A A . 72 GLU CA   1 1 
        4  5309 1 1 75 GLU CB   C -12.970 -25.510   6.652 1.00 . A A . 72 GLU CB   1 1 
        4  5310 1 1 75 GLU CD   C -15.285 -26.546   7.018 1.00 . A A . 72 GLU CD   1 1 
        4  5311 1 1 75 GLU CG   C -13.887 -26.356   7.588 1.00 . A A . 72 GLU CG   1 1 
        4  5312 1 1 75 GLU H    H  -9.915 -24.449   6.971 1.00 . A A . 72 GLU H    1 1 
        4  5313 1 1 75 GLU HA   H -11.067 -26.323   7.418 1.00 . A A . 72 GLU HA   1 1 
        4  5314 1 1 75 GLU HB2  H -13.023 -24.489   7.004 1.00 . A A . 72 GLU HB2  1 1 
        4  5315 1 1 75 GLU HB3  H -13.405 -25.537   5.665 1.00 . A A . 72 GLU HB3  1 1 
        4  5316 1 1 75 GLU HG2  H -13.465 -27.332   7.760 1.00 . A A . 72 GLU HG2  1 1 
        4  5317 1 1 75 GLU HG3  H -14.004 -25.827   8.534 1.00 . A A . 72 GLU HG3  1 1 
        4  5318 1 1 75 GLU N    N -10.595 -24.662   6.307 1.00 . A A . 72 GLU N    1 1 
        4  5319 1 1 75 GLU O    O -12.116 -27.229   4.568 1.00 . A A . 72 GLU O    1 1 
        4  5320 1 1 75 GLU OE1  O -16.036 -25.550   6.940 1.00 . A A . 72 GLU OE1  1 1 
        4  5321 1 1 75 GLU OE2  O -15.649 -27.699   6.693 1.00 . A A . 72 GLU OE2  1 1 
        4  5322 1 1 76 GLY C    C  -8.950 -28.294   3.150 1.00 . A A . 73 GLY C    1 1 
        4  5323 1 1 76 GLY CA   C  -9.694 -28.640   4.441 1.00 . A A . 73 GLY CA   1 1 
        4  5324 1 1 76 GLY H    H  -9.327 -27.206   5.963 1.00 . A A . 73 GLY H    1 1 
        4  5325 1 1 76 GLY HA2  H  -9.090 -29.343   4.988 1.00 . A A . 73 GLY HA2  1 1 
        4  5326 1 1 76 GLY HA3  H -10.615 -29.131   4.175 1.00 . A A . 73 GLY HA3  1 1 
        4  5327 1 1 76 GLY N    N -10.012 -27.525   5.343 1.00 . A A . 73 GLY N    1 1 
        4  5328 1 1 76 GLY O    O  -8.440 -29.202   2.490 1.00 . A A . 73 GLY O    1 1 
        4  5329 1 1 77 ASN C    C  -6.940 -25.575   2.721 1.00 . A A . 74 ASN C    1 1 
        4  5330 1 1 77 ASN CA   C  -7.725 -26.595   1.917 1.00 . A A . 74 ASN CA   1 1 
        4  5331 1 1 77 ASN CB   C  -8.120 -26.074   0.473 1.00 . A A . 74 ASN CB   1 1 
        4  5332 1 1 77 ASN CG   C  -9.139 -26.961  -0.219 1.00 . A A . 74 ASN CG   1 1 
        4  5333 1 1 77 ASN H    H  -9.542 -26.382   3.094 1.00 . A A . 74 ASN H    1 1 
        4  5334 1 1 77 ASN HA   H  -7.089 -27.462   1.801 1.00 . A A . 74 ASN HA   1 1 
        4  5335 1 1 77 ASN HB2  H  -8.500 -25.044   0.459 1.00 . A A . 74 ASN HB2  1 1 
        4  5336 1 1 77 ASN HB3  H  -7.236 -26.096  -0.139 1.00 . A A . 74 ASN HB3  1 1 
        4  5337 1 1 77 ASN HD21 H  -7.680 -28.007  -1.067 1.00 . A A . 74 ASN HD21 1 1 
        4  5338 1 1 77 ASN HD22 H  -9.286 -28.517  -1.438 1.00 . A A . 74 ASN HD22 1 1 
        4  5339 1 1 77 ASN N    N  -8.851 -27.023   2.789 1.00 . A A . 74 ASN N    1 1 
        4  5340 1 1 77 ASN ND2  N  -8.652 -27.928  -0.984 1.00 . A A . 74 ASN ND2  1 1 
        4  5341 1 1 77 ASN O    O  -7.520 -24.621   3.217 1.00 . A A . 74 ASN O    1 1 
        4  5342 1 1 77 ASN OD1  O -10.345 -26.781  -0.071 1.00 . A A . 74 ASN OD1  1 1 
        4  5343 1 1 78 LYS C    C  -4.184 -23.828   3.066 1.00 . A A . 75 LYS C    1 1 
        4  5344 1 1 78 LYS CA   C  -4.892 -24.932   3.871 1.00 . A A . 75 LYS CA   1 1 
        4  5345 1 1 78 LYS CB   C  -3.848 -25.706   4.749 1.00 . A A . 75 LYS CB   1 1 
        4  5346 1 1 78 LYS CD   C  -5.308 -26.875   6.573 1.00 . A A . 75 LYS CD   1 1 
        4  5347 1 1 78 LYS CE   C  -6.355 -26.322   7.536 1.00 . A A . 75 LYS CE   1 1 
        4  5348 1 1 78 LYS CG   C  -4.192 -25.852   6.252 1.00 . A A . 75 LYS CG   1 1 
        4  5349 1 1 78 LYS H    H  -5.162 -26.552   2.445 1.00 . A A . 75 LYS H    1 1 
        4  5350 1 1 78 LYS HA   H  -5.622 -24.475   4.525 1.00 . A A . 75 LYS HA   1 1 
        4  5351 1 1 78 LYS HB2  H  -3.694 -26.695   4.352 1.00 . A A . 75 LYS HB2  1 1 
        4  5352 1 1 78 LYS HB3  H  -2.909 -25.172   4.679 1.00 . A A . 75 LYS HB3  1 1 
        4  5353 1 1 78 LYS HD2  H  -5.802 -27.178   5.680 1.00 . A A . 75 LYS HD2  1 1 
        4  5354 1 1 78 LYS HD3  H  -4.853 -27.744   7.036 1.00 . A A . 75 LYS HD3  1 1 
        4  5355 1 1 78 LYS HE2  H  -6.926 -25.535   7.048 1.00 . A A . 75 LYS HE2  1 1 
        4  5356 1 1 78 LYS HE3  H  -7.027 -27.129   7.808 1.00 . A A . 75 LYS HE3  1 1 
        4  5357 1 1 78 LYS HG2  H  -3.293 -26.177   6.764 1.00 . A A . 75 LYS HG2  1 1 
        4  5358 1 1 78 LYS HG3  H  -4.473 -24.884   6.645 1.00 . A A . 75 LYS HG3  1 1 
        4  5359 1 1 78 LYS HZ1  H  -5.102 -24.991   8.533 1.00 . A A . 75 LYS HZ1  1 1 
        4  5360 1 1 78 LYS HZ2  H  -5.160 -26.532   9.233 1.00 . A A . 75 LYS HZ2  1 1 
        4  5361 1 1 78 LYS HZ3  H  -6.456 -25.467   9.431 1.00 . A A . 75 LYS HZ3  1 1 
        4  5362 1 1 78 LYS N    N  -5.640 -25.820   2.956 1.00 . A A . 75 LYS N    1 1 
        4  5363 1 1 78 LYS NZ   N  -5.726 -25.788   8.766 1.00 . A A . 75 LYS NZ   1 1 
        4  5364 1 1 78 LYS O    O  -3.135 -24.123   2.497 1.00 . A A . 75 LYS O    1 1 
        4  5365 1 1 79 LEU C    C  -4.539 -20.069   2.370 1.00 . A A . 76 LEU C    1 1 
        4  5366 1 1 79 LEU CA   C  -4.044 -21.530   2.141 1.00 . A A . 76 LEU CA   1 1 
        4  5367 1 1 79 LEU CB   C  -4.257 -21.871   0.626 1.00 . A A . 76 LEU CB   1 1 
        4  5368 1 1 79 LEU CD1  C  -3.377 -23.351  -1.174 1.00 . A A . 76 LEU CD1  1 1 
        4  5369 1 1 79 LEU CD2  C  -2.297 -21.143  -0.771 1.00 . A A . 76 LEU CD2  1 1 
        4  5370 1 1 79 LEU CG   C  -3.002 -22.329  -0.119 1.00 . A A . 76 LEU CG   1 1 
        4  5371 1 1 79 LEU H    H  -5.479 -22.294   3.589 1.00 . A A . 76 LEU H    1 1 
        4  5372 1 1 79 LEU HA   H  -2.979 -21.579   2.323 1.00 . A A . 76 LEU HA   1 1 
        4  5373 1 1 79 LEU HB2  H  -5.009 -22.640   0.519 1.00 . A A . 76 LEU HB2  1 1 
        4  5374 1 1 79 LEU HB3  H  -4.618 -20.975   0.141 1.00 . A A . 76 LEU HB3  1 1 
        4  5375 1 1 79 LEU HD11 H  -2.498 -23.647  -1.726 1.00 . A A . 76 LEU HD11 1 1 
        4  5376 1 1 79 LEU HD12 H  -4.101 -22.920  -1.847 1.00 . A A . 76 LEU HD12 1 1 
        4  5377 1 1 79 LEU HD13 H  -3.807 -24.217  -0.690 1.00 . A A . 76 LEU HD13 1 1 
        4  5378 1 1 79 LEU HD21 H  -1.395 -21.484  -1.259 1.00 . A A . 76 LEU HD21 1 1 
        4  5379 1 1 79 LEU HD22 H  -2.044 -20.410  -0.019 1.00 . A A . 76 LEU HD22 1 1 
        4  5380 1 1 79 LEU HD23 H  -2.953 -20.694  -1.503 1.00 . A A . 76 LEU HD23 1 1 
        4  5381 1 1 79 LEU HG   H  -2.319 -22.791   0.580 1.00 . A A . 76 LEU HG   1 1 
        4  5382 1 1 79 LEU N    N  -4.699 -22.553   3.024 1.00 . A A . 76 LEU N    1 1 
        4  5383 1 1 79 LEU O    O  -4.917 -19.457   1.412 1.00 . A A . 76 LEU O    1 1 
        4  5384 1 1 80 ARG C    C  -4.097 -16.974   3.505 1.00 . A A . 77 ARG C    1 1 
        4  5385 1 1 80 ARG CA   C  -5.090 -18.144   3.841 1.00 . A A . 77 ARG CA   1 1 
        4  5386 1 1 80 ARG CB   C  -5.516 -18.118   5.354 1.00 . A A . 77 ARG CB   1 1 
        4  5387 1 1 80 ARG CD   C  -6.736 -15.827   5.550 1.00 . A A . 77 ARG CD   1 1 
        4  5388 1 1 80 ARG CG   C  -5.612 -16.732   6.054 1.00 . A A . 77 ARG CG   1 1 
        4  5389 1 1 80 ARG CZ   C  -9.041 -16.102   6.456 1.00 . A A . 77 ARG CZ   1 1 
        4  5390 1 1 80 ARG H    H  -3.875 -19.832   4.267 1.00 . A A . 77 ARG H    1 1 
        4  5391 1 1 80 ARG HA   H  -6.000 -18.083   3.251 1.00 . A A . 77 ARG HA   1 1 
        4  5392 1 1 80 ARG HB2  H  -6.491 -18.592   5.435 1.00 . A A . 77 ARG HB2  1 1 
        4  5393 1 1 80 ARG HB3  H  -4.811 -18.719   5.906 1.00 . A A . 77 ARG HB3  1 1 
        4  5394 1 1 80 ARG HD2  H  -6.743 -14.938   6.157 1.00 . A A . 77 ARG HD2  1 1 
        4  5395 1 1 80 ARG HD3  H  -6.541 -15.540   4.530 1.00 . A A . 77 ARG HD3  1 1 
        4  5396 1 1 80 ARG HE   H  -8.213 -17.220   5.017 1.00 . A A . 77 ARG HE   1 1 
        4  5397 1 1 80 ARG HG2  H  -5.759 -16.890   7.111 1.00 . A A . 77 ARG HG2  1 1 
        4  5398 1 1 80 ARG HG3  H  -4.669 -16.217   5.904 1.00 . A A . 77 ARG HG3  1 1 
        4  5399 1 1 80 ARG HH11 H  -8.003 -14.593   7.345 1.00 . A A . 77 ARG HH11 1 1 
        4  5400 1 1 80 ARG HH12 H  -9.616 -14.828   7.928 1.00 . A A . 77 ARG HH12 1 1 
        4  5401 1 1 80 ARG HH21 H -10.349 -17.476   5.761 1.00 . A A . 77 ARG HH21 1 1 
        4  5402 1 1 80 ARG HH22 H -10.948 -16.463   7.031 1.00 . A A . 77 ARG HH22 1 1 
        4  5403 1 1 80 ARG N    N  -4.441 -19.454   3.569 1.00 . A A . 77 ARG N    1 1 
        4  5404 1 1 80 ARG NE   N  -8.054 -16.467   5.622 1.00 . A A . 77 ARG NE   1 1 
        4  5405 1 1 80 ARG NH1  N  -8.875 -15.101   7.317 1.00 . A A . 77 ARG NH1  1 1 
        4  5406 1 1 80 ARG NH2  N -10.205 -16.732   6.409 1.00 . A A . 77 ARG NH2  1 1 
        4  5407 1 1 80 ARG O    O  -3.080 -16.816   4.168 1.00 . A A . 77 ARG O    1 1 
        4  5408 1 1 81 VAL C    C  -4.415 -13.697   2.277 1.00 . A A . 78 VAL C    1 1 
        4  5409 1 1 81 VAL CA   C  -3.523 -14.965   2.198 1.00 . A A . 78 VAL CA   1 1 
        4  5410 1 1 81 VAL CB   C  -2.765 -15.018   0.802 1.00 . A A . 78 VAL CB   1 1 
        4  5411 1 1 81 VAL CG1  C  -1.456 -14.276   0.909 1.00 . A A . 78 VAL CG1  1 1 
        4  5412 1 1 81 VAL CG2  C  -2.479 -16.439   0.311 1.00 . A A . 78 VAL CG2  1 1 
        4  5413 1 1 81 VAL H    H  -5.105 -16.360   1.835 1.00 . A A . 78 VAL H    1 1 
        4  5414 1 1 81 VAL HA   H  -2.783 -14.934   2.996 1.00 . A A . 78 VAL HA   1 1 
        4  5415 1 1 81 VAL HB   H  -3.361 -14.509   0.030 1.00 . A A . 78 VAL HB   1 1 
        4  5416 1 1 81 VAL HG11 H  -0.878 -14.441   0.013 1.00 . A A . 78 VAL HG11 1 1 
        4  5417 1 1 81 VAL HG12 H  -0.910 -14.645   1.760 1.00 . A A . 78 VAL HG12 1 1 
        4  5418 1 1 81 VAL HG13 H  -1.647 -13.220   1.028 1.00 . A A . 78 VAL HG13 1 1 
        4  5419 1 1 81 VAL HG21 H  -2.014 -17.020   1.090 1.00 . A A . 78 VAL HG21 1 1 
        4  5420 1 1 81 VAL HG22 H  -1.805 -16.386  -0.533 1.00 . A A . 78 VAL HG22 1 1 
        4  5421 1 1 81 VAL HG23 H  -3.394 -16.907  -0.004 1.00 . A A . 78 VAL HG23 1 1 
        4  5422 1 1 81 VAL N    N  -4.366 -16.155   2.458 1.00 . A A . 78 VAL N    1 1 
        4  5423 1 1 81 VAL O    O  -5.380 -13.596   1.520 1.00 . A A . 78 VAL O    1 1 
        4  5424 1 1 82 GLU C    C  -4.389 -10.324   3.776 1.00 . A A . 79 GLU C    1 1 
        4  5425 1 1 82 GLU CA   C  -5.096 -11.660   3.485 1.00 . A A . 79 GLU CA   1 1 
        4  5426 1 1 82 GLU CB   C  -5.908 -12.230   4.688 1.00 . A A . 79 GLU CB   1 1 
        4  5427 1 1 82 GLU CD   C  -7.565 -12.094   6.569 1.00 . A A . 79 GLU CD   1 1 
        4  5428 1 1 82 GLU CG   C  -6.677 -11.292   5.643 1.00 . A A . 79 GLU CG   1 1 
        4  5429 1 1 82 GLU H    H  -3.219 -12.663   3.590 1.00 . A A . 79 GLU H    1 1 
        4  5430 1 1 82 GLU HA   H  -5.760 -11.542   2.644 1.00 . A A . 79 GLU HA   1 1 
        4  5431 1 1 82 GLU HB2  H  -6.636 -12.917   4.273 1.00 . A A . 79 GLU HB2  1 1 
        4  5432 1 1 82 GLU HB3  H  -5.220 -12.806   5.290 1.00 . A A . 79 GLU HB3  1 1 
        4  5433 1 1 82 GLU HG2  H  -5.980 -10.743   6.271 1.00 . A A . 79 GLU HG2  1 1 
        4  5434 1 1 82 GLU HG3  H  -7.297 -10.611   5.082 1.00 . A A . 79 GLU HG3  1 1 
        4  5435 1 1 82 GLU N    N  -4.114 -12.714   3.169 1.00 . A A . 79 GLU N    1 1 
        4  5436 1 1 82 GLU O    O  -3.400 -10.288   4.514 1.00 . A A . 79 GLU O    1 1 
        4  5437 1 1 82 GLU OE1  O  -7.034 -12.704   7.524 1.00 . A A . 79 GLU OE1  1 1 
        4  5438 1 1 82 GLU OE2  O  -8.787 -12.140   6.328 1.00 . A A . 79 GLU OE2  1 1 
        4  5439 1 1 83 VAL C    C  -5.326  -7.350   4.714 1.00 . A A . 80 VAL C    1 1 
        4  5440 1 1 83 VAL CA   C  -4.426  -7.903   3.607 1.00 . A A . 80 VAL CA   1 1 
        4  5441 1 1 83 VAL CB   C  -4.302  -6.876   2.444 1.00 . A A . 80 VAL CB   1 1 
        4  5442 1 1 83 VAL CG1  C  -3.090  -7.186   1.602 1.00 . A A . 80 VAL CG1  1 1 
        4  5443 1 1 83 VAL CG2  C  -5.533  -6.827   1.545 1.00 . A A . 80 VAL CG2  1 1 
        4  5444 1 1 83 VAL H    H  -5.438  -9.294   2.353 1.00 . A A . 80 VAL H    1 1 
        4  5445 1 1 83 VAL HA   H  -3.437  -8.035   4.027 1.00 . A A . 80 VAL HA   1 1 
        4  5446 1 1 83 VAL HB   H  -4.163  -5.895   2.878 1.00 . A A . 80 VAL HB   1 1 
        4  5447 1 1 83 VAL HG11 H  -3.352  -7.136   0.552 1.00 . A A . 80 VAL HG11 1 1 
        4  5448 1 1 83 VAL HG12 H  -2.722  -8.173   1.843 1.00 . A A . 80 VAL HG12 1 1 
        4  5449 1 1 83 VAL HG13 H  -2.319  -6.458   1.810 1.00 . A A . 80 VAL HG13 1 1 
        4  5450 1 1 83 VAL HG21 H  -5.665  -7.783   1.066 1.00 . A A . 80 VAL HG21 1 1 
        4  5451 1 1 83 VAL HG22 H  -5.393  -6.063   0.792 1.00 . A A . 80 VAL HG22 1 1 
        4  5452 1 1 83 VAL HG23 H  -6.403  -6.596   2.138 1.00 . A A . 80 VAL HG23 1 1 
        4  5453 1 1 83 VAL N    N  -4.866  -9.219   3.167 1.00 . A A . 80 VAL N    1 1 
        4  5454 1 1 83 VAL O    O  -6.549  -7.275   4.560 1.00 . A A . 80 VAL O    1 1 
        4  5455 1 1 84 PRO C    C  -5.251  -4.663   6.696 1.00 . A A . 81 PRO C    1 1 
        4  5456 1 1 84 PRO CA   C  -5.424  -6.186   6.883 1.00 . A A . 81 PRO CA   1 1 
        4  5457 1 1 84 PRO CB   C  -4.762  -6.665   8.179 1.00 . A A . 81 PRO CB   1 1 
        4  5458 1 1 84 PRO CD   C  -3.411  -7.434   6.345 1.00 . A A . 81 PRO CD   1 1 
        4  5459 1 1 84 PRO CG   C  -3.368  -7.025   7.795 1.00 . A A . 81 PRO CG   1 1 
        4  5460 1 1 84 PRO HA   H  -6.478  -6.418   6.915 1.00 . A A . 81 PRO HA   1 1 
        4  5461 1 1 84 PRO HB2  H  -4.768  -5.868   8.913 1.00 . A A . 81 PRO HB2  1 1 
        4  5462 1 1 84 PRO HB3  H  -5.275  -7.531   8.562 1.00 . A A . 81 PRO HB3  1 1 
        4  5463 1 1 84 PRO HD2  H  -2.621  -6.942   5.796 1.00 . A A . 81 PRO HD2  1 1 
        4  5464 1 1 84 PRO HD3  H  -3.314  -8.507   6.257 1.00 . A A . 81 PRO HD3  1 1 
        4  5465 1 1 84 PRO HG2  H  -2.721  -6.163   7.922 1.00 . A A . 81 PRO HG2  1 1 
        4  5466 1 1 84 PRO HG3  H  -3.016  -7.847   8.400 1.00 . A A . 81 PRO HG3  1 1 
        4  5467 1 1 84 PRO N    N  -4.736  -6.983   5.868 1.00 . A A . 81 PRO N    1 1 
        4  5468 1 1 84 PRO O    O  -5.502  -3.892   7.627 1.00 . A A . 81 PRO O    1 1 
        4  5469 1 1 85 PHE C    C  -5.779  -2.319   4.195 1.00 . A A . 82 PHE C    1 1 
        4  5470 1 1 85 PHE CA   C  -4.725  -2.785   5.213 1.00 . A A . 82 PHE CA   1 1 
        4  5471 1 1 85 PHE CB   C  -3.293  -2.327   4.775 1.00 . A A . 82 PHE CB   1 1 
        4  5472 1 1 85 PHE CD1  C  -3.088  -2.995   2.326 1.00 . A A . 82 PHE CD1  1 1 
        4  5473 1 1 85 PHE CD2  C  -1.465  -3.781   3.854 1.00 . A A . 82 PHE CD2  1 1 
        4  5474 1 1 85 PHE CE1  C  -2.433  -3.619   1.292 1.00 . A A . 82 PHE CE1  1 1 
        4  5475 1 1 85 PHE CE2  C  -0.805  -4.416   2.835 1.00 . A A . 82 PHE CE2  1 1 
        4  5476 1 1 85 PHE CG   C  -2.615  -3.068   3.627 1.00 . A A . 82 PHE CG   1 1 
        4  5477 1 1 85 PHE CZ   C  -1.281  -4.337   1.547 1.00 . A A . 82 PHE CZ   1 1 
        4  5478 1 1 85 PHE H    H  -4.609  -4.879   4.795 1.00 . A A . 82 PHE H    1 1 
        4  5479 1 1 85 PHE HA   H  -4.950  -2.293   6.150 1.00 . A A . 82 PHE HA   1 1 
        4  5480 1 1 85 PHE HB2  H  -3.356  -1.296   4.471 1.00 . A A . 82 PHE HB2  1 1 
        4  5481 1 1 85 PHE HB3  H  -2.632  -2.382   5.634 1.00 . A A . 82 PHE HB3  1 1 
        4  5482 1 1 85 PHE HD1  H  -3.989  -2.438   2.122 1.00 . A A . 82 PHE HD1  1 1 
        4  5483 1 1 85 PHE HD2  H  -1.080  -3.858   4.858 1.00 . A A . 82 PHE HD2  1 1 
        4  5484 1 1 85 PHE HE1  H  -2.822  -3.551   0.284 1.00 . A A . 82 PHE HE1  1 1 
        4  5485 1 1 85 PHE HE2  H   0.089  -4.983   3.054 1.00 . A A . 82 PHE HE2  1 1 
        4  5486 1 1 85 PHE HZ   H  -0.756  -4.827   0.740 1.00 . A A . 82 PHE HZ   1 1 
        4  5487 1 1 85 PHE N    N  -4.828  -4.224   5.494 1.00 . A A . 82 PHE N    1 1 
        4  5488 1 1 85 PHE O    O  -6.227  -1.173   4.269 1.00 . A A . 82 PHE O    1 1 
        4  5489 1 1 86 ASN C    C  -6.578  -1.777   1.228 1.00 . A A . 83 ASN C    1 1 
        4  5490 1 1 86 ASN CA   C  -7.101  -2.952   2.134 1.00 . A A . 83 ASN CA   1 1 
        4  5491 1 1 86 ASN CB   C  -8.551  -2.642   2.668 1.00 . A A . 83 ASN CB   1 1 
        4  5492 1 1 86 ASN CG   C  -9.625  -2.668   1.589 1.00 . A A . 83 ASN CG   1 1 
        4  5493 1 1 86 ASN H    H  -5.719  -4.118   3.307 1.00 . A A . 83 ASN H    1 1 
        4  5494 1 1 86 ASN HA   H  -7.153  -3.857   1.542 1.00 . A A . 83 ASN HA   1 1 
        4  5495 1 1 86 ASN HB2  H  -8.841  -3.362   3.425 1.00 . A A . 83 ASN HB2  1 1 
        4  5496 1 1 86 ASN HB3  H  -8.545  -1.655   3.109 1.00 . A A . 83 ASN HB3  1 1 
        4  5497 1 1 86 ASN HD21 H  -9.443  -0.707   1.322 1.00 . A A . 83 ASN HD21 1 1 
        4  5498 1 1 86 ASN HD22 H -10.609  -1.503   0.322 1.00 . A A . 83 ASN HD22 1 1 
        4  5499 1 1 86 ASN N    N  -6.141  -3.225   3.255 1.00 . A A . 83 ASN N    1 1 
        4  5500 1 1 86 ASN ND2  N  -9.927  -1.511   1.024 1.00 . A A . 83 ASN ND2  1 1 
        4  5501 1 1 86 ASN O    O  -7.083  -0.654   1.336 1.00 . A A . 83 ASN O    1 1 
        4  5502 1 1 86 ASN OD1  O -10.195  -3.713   1.289 1.00 . A A . 83 ASN OD1  1 1 
        4  5503 1 1 87 ALA C    C  -4.324   0.196   0.320 1.00 . A A . 84 ALA C    1 1 
        4  5504 1 1 87 ALA CA   C  -4.891  -1.005  -0.506 1.00 . A A . 84 ALA CA   1 1 
        4  5505 1 1 87 ALA CB   C  -5.867  -0.598  -1.641 1.00 . A A . 84 ALA CB   1 1 
        4  5506 1 1 87 ALA H    H  -5.122  -2.930   0.378 1.00 . A A . 84 ALA H    1 1 
        4  5507 1 1 87 ALA HA   H  -4.043  -1.488  -0.973 1.00 . A A . 84 ALA HA   1 1 
        4  5508 1 1 87 ALA HB1  H  -5.377   0.073  -2.329 1.00 . A A . 84 ALA HB1  1 1 
        4  5509 1 1 87 ALA HB2  H  -6.743  -0.122  -1.230 1.00 . A A . 84 ALA HB2  1 1 
        4  5510 1 1 87 ALA HB3  H  -6.176  -1.487  -2.183 1.00 . A A . 84 ALA HB3  1 1 
        4  5511 1 1 87 ALA N    N  -5.518  -2.031   0.384 1.00 . A A . 84 ALA N    1 1 
        4  5512 1 1 87 ALA O    O  -3.965   0.015   1.486 1.00 . A A . 84 ALA O    1 1 
        4  5513 1 1 88 ARG C    C  -4.783   3.648   0.501 1.00 . A A . 85 ARG C    1 1 
        4  5514 1 1 88 ARG CA   C  -3.696   2.558   0.533 1.00 . A A . 85 ARG CA   1 1 
        4  5515 1 1 88 ARG CB   C  -2.349   3.131   0.027 1.00 . A A . 85 ARG CB   1 1 
        4  5516 1 1 88 ARG CD   C  -0.727   5.076   0.352 1.00 . A A . 85 ARG CD   1 1 
        4  5517 1 1 88 ARG CG   C  -1.690   4.100   1.023 1.00 . A A . 85 ARG CG   1 1 
        4  5518 1 1 88 ARG CZ   C   1.367   5.107  -0.994 1.00 . A A . 85 ARG CZ   1 1 
        4  5519 1 1 88 ARG H    H  -4.383   1.488  -1.243 1.00 . A A . 85 ARG H    1 1 
        4  5520 1 1 88 ARG HA   H  -3.548   2.227   1.557 1.00 . A A . 85 ARG HA   1 1 
        4  5521 1 1 88 ARG HB2  H  -1.674   2.311  -0.147 1.00 . A A . 85 ARG HB2  1 1 
        4  5522 1 1 88 ARG HB3  H  -2.506   3.665  -0.902 1.00 . A A . 85 ARG HB3  1 1 
        4  5523 1 1 88 ARG HD2  H  -1.264   5.600  -0.421 1.00 . A A . 85 ARG HD2  1 1 
        4  5524 1 1 88 ARG HD3  H  -0.396   5.790   1.095 1.00 . A A . 85 ARG HD3  1 1 
        4  5525 1 1 88 ARG HE   H   0.574   3.480  -0.106 1.00 . A A . 85 ARG HE   1 1 
        4  5526 1 1 88 ARG HG2  H  -2.467   4.675   1.503 1.00 . A A . 85 ARG HG2  1 1 
        4  5527 1 1 88 ARG HG3  H  -1.154   3.536   1.770 1.00 . A A . 85 ARG HG3  1 1 
        4  5528 1 1 88 ARG HH11 H   0.451   6.918  -0.844 1.00 . A A . 85 ARG HH11 1 1 
        4  5529 1 1 88 ARG HH12 H   1.916   6.906  -1.775 1.00 . A A . 85 ARG HH12 1 1 
        4  5530 1 1 88 ARG HH21 H   2.567   3.497  -1.307 1.00 . A A . 85 ARG HH21 1 1 
        4  5531 1 1 88 ARG HH22 H   3.110   4.970  -2.038 1.00 . A A . 85 ARG HH22 1 1 
        4  5532 1 1 88 ARG N    N  -4.158   1.386  -0.272 1.00 . A A . 85 ARG N    1 1 
        4  5533 1 1 88 ARG NE   N   0.451   4.440  -0.262 1.00 . A A . 85 ARG NE   1 1 
        4  5534 1 1 88 ARG NH1  N   1.233   6.416  -1.222 1.00 . A A . 85 ARG NH1  1 1 
        4  5535 1 1 88 ARG NH2  N   2.429   4.472  -1.486 1.00 . A A . 85 ARG NH2  1 1 
        4  5536 1 1 88 ARG O    O  -4.567   4.706  -0.112 1.00 . A A . 85 ARG O    1 1 
        4  5537 1 1 89 GLU C    C  -8.263   3.588   1.881 1.00 . A A . 86 GLU C    1 1 
        4  5538 1 1 89 GLU CA   C  -7.225   4.044   0.843 1.00 . A A . 86 GLU CA   1 1 
        4  5539 1 1 89 GLU CB   C  -7.708   3.657  -0.604 1.00 . A A . 86 GLU CB   1 1 
        4  5540 1 1 89 GLU CD   C  -7.666   4.100  -3.155 1.00 . A A . 86 GLU CD   1 1 
        4  5541 1 1 89 GLU CG   C  -7.167   4.527  -1.775 1.00 . A A . 86 GLU CG   1 1 
        4  5542 1 1 89 GLU H    H  -5.895   2.928   2.078 1.00 . A A . 86 GLU H    1 1 
        4  5543 1 1 89 GLU HA   H  -7.106   5.111   0.913 1.00 . A A . 86 GLU HA   1 1 
        4  5544 1 1 89 GLU HB2  H  -7.423   2.632  -0.798 1.00 . A A . 86 GLU HB2  1 1 
        4  5545 1 1 89 GLU HB3  H  -8.787   3.717  -0.615 1.00 . A A . 86 GLU HB3  1 1 
        4  5546 1 1 89 GLU HG2  H  -7.458   5.551  -1.613 1.00 . A A . 86 GLU HG2  1 1 
        4  5547 1 1 89 GLU HG3  H  -6.084   4.472  -1.779 1.00 . A A . 86 GLU HG3  1 1 
        4  5548 1 1 89 GLU N    N  -5.929   3.425   1.203 1.00 . A A . 86 GLU N    1 1 
        4  5549 1 1 89 GLU O    O  -9.260   2.929   1.510 1.00 . A A . 86 GLU O    1 1 
        4  5550 1 1 89 GLU OXT  O  -8.019   3.826   3.087 1.00 . A A . 86 GLU OXT  1 1 
        4  5551 1 1 89 GLU OE1  O  -7.402   2.946  -3.569 1.00 . A A . 86 GLU OE1  1 1 
        4  5552 1 1 89 GLU OE2  O  -8.296   4.937  -3.841 1.00 . A A . 86 GLU OE2  1 1 
        5  5553 1 1  1 GLY C    C  -9.230   2.991  -4.432 1.00 . A A . -2 GLY C    1 1 
        5  5554 1 1  1 GLY CA   C  -8.966   1.518  -4.661 1.00 . A A . -2 GLY CA   1 1 
        5  5555 1 1  1 GLY H1   H  -9.810  -0.340  -4.214 1.00 . A A . -2 GLY H1   1 1 
        5  5556 1 1  1 GLY H2   H -10.946   0.893  -4.442 1.00 . A A . -2 GLY H2   1 1 
        5  5557 1 1  1 GLY H3   H -10.045   0.829  -3.013 1.00 . A A . -2 GLY H3   1 1 
        5  5558 1 1  1 GLY HA2  H  -8.007   1.266  -4.235 1.00 . A A . -2 GLY HA2  1 1 
        5  5559 1 1  1 GLY HA3  H  -8.942   1.326  -5.724 1.00 . A A . -2 GLY HA3  1 1 
        5  5560 1 1  1 GLY N    N -10.014   0.664  -4.039 1.00 . A A . -2 GLY N    1 1 
        5  5561 1 1  1 GLY O    O -10.371   3.438  -4.544 1.00 . A A . -2 GLY O    1 1 
        5  5562 1 1  2 SER C    C  -7.229   5.960  -4.598 1.00 . A A . -1 SER C    1 1 
        5  5563 1 1  2 SER CA   C  -8.294   5.167  -3.819 1.00 . A A . -1 SER CA   1 1 
        5  5564 1 1  2 SER CB   C  -8.179   5.410  -2.301 1.00 . A A . -1 SER CB   1 1 
        5  5565 1 1  2 SER H    H  -7.287   3.325  -4.072 1.00 . A A . -1 SER H    1 1 
        5  5566 1 1  2 SER HA   H  -9.272   5.484  -4.152 1.00 . A A . -1 SER HA   1 1 
        5  5567 1 1  2 SER HB2  H  -7.258   5.937  -2.090 1.00 . A A . -1 SER HB2  1 1 
        5  5568 1 1  2 SER HB3  H  -9.014   6.011  -1.975 1.00 . A A . -1 SER HB3  1 1 
        5  5569 1 1  2 SER HG   H  -7.408   4.165  -0.992 1.00 . A A . -1 SER HG   1 1 
        5  5570 1 1  2 SER N    N  -8.176   3.741  -4.113 1.00 . A A . -1 SER N    1 1 
        5  5571 1 1  2 SER O    O  -6.475   5.374  -5.388 1.00 . A A . -1 SER O    1 1 
        5  5572 1 1  2 SER OG   O  -8.186   4.190  -1.571 1.00 . A A . -1 SER OG   1 1 
        5  5573 1 1  3 HIS C    C  -5.894   9.412  -4.362 1.00 . A A .  0 HIS C    1 1 
        5  5574 1 1  3 HIS CA   C  -6.324   8.171  -5.178 1.00 . A A .  0 HIS CA   1 1 
        5  5575 1 1  3 HIS CB   C  -7.077   8.552  -6.484 1.00 . A A .  0 HIS CB   1 1 
        5  5576 1 1  3 HIS CD2  C  -5.053   9.510  -7.851 1.00 . A A .  0 HIS CD2  1 1 
        5  5577 1 1  3 HIS CE1  C  -6.109  11.147  -8.848 1.00 . A A .  0 HIS CE1  1 1 
        5  5578 1 1  3 HIS CG   C  -6.349   9.468  -7.447 1.00 . A A .  0 HIS CG   1 1 
        5  5579 1 1  3 HIS H    H  -7.687   7.660  -3.635 1.00 . A A .  0 HIS H    1 1 
        5  5580 1 1  3 HIS HA   H  -5.438   7.617  -5.441 1.00 . A A .  0 HIS HA   1 1 
        5  5581 1 1  3 HIS HB2  H  -7.306   7.645  -7.018 1.00 . A A .  0 HIS HB2  1 1 
        5  5582 1 1  3 HIS HB3  H  -8.008   9.033  -6.215 1.00 . A A .  0 HIS HB3  1 1 
        5  5583 1 1  3 HIS HD1  H  -7.934  10.722  -8.026 1.00 . A A .  0 HIS HD1  1 1 
        5  5584 1 1  3 HIS HD2  H  -4.269   8.821  -7.559 1.00 . A A .  0 HIS HD2  1 1 
        5  5585 1 1  3 HIS HE1  H  -6.328  11.993  -9.476 1.00 . A A .  0 HIS HE1  1 1 
        5  5586 1 1  3 HIS HE2  H  -4.077  10.971  -8.984 1.00 . A A .  0 HIS HE2  1 1 
        5  5587 1 1  3 HIS N    N  -7.170   7.279  -4.376 1.00 . A A .  0 HIS N    1 1 
        5  5588 1 1  3 HIS ND1  N  -6.979  10.504  -8.095 1.00 . A A .  0 HIS ND1  1 1 
        5  5589 1 1  3 HIS NE2  N  -4.929  10.567  -8.716 1.00 . A A .  0 HIS NE2  1 1 
        5  5590 1 1  3 HIS O    O  -6.486  10.491  -4.487 1.00 . A A .  0 HIS O    1 1 
        5  5591 1 1  4 MET C    C  -2.807   9.824  -2.350 1.00 . A A .  1 MET C    1 1 
        5  5592 1 1  4 MET CA   C  -4.203  10.295  -2.756 1.00 . A A .  1 MET CA   1 1 
        5  5593 1 1  4 MET CB   C  -4.970  10.707  -1.486 1.00 . A A .  1 MET CB   1 1 
        5  5594 1 1  4 MET CE   C  -7.917  13.574  -0.788 1.00 . A A .  1 MET CE   1 1 
        5  5595 1 1  4 MET CG   C  -5.913  11.881  -1.673 1.00 . A A .  1 MET CG   1 1 
        5  5596 1 1  4 MET H    H  -4.605   8.295  -3.320 1.00 . A A .  1 MET H    1 1 
        5  5597 1 1  4 MET HA   H  -4.113  11.150  -3.412 1.00 . A A .  1 MET HA   1 1 
        5  5598 1 1  4 MET HB2  H  -5.552   9.864  -1.145 1.00 . A A .  1 MET HB2  1 1 
        5  5599 1 1  4 MET HB3  H  -4.254  10.968  -0.720 1.00 . A A .  1 MET HB3  1 1 
        5  5600 1 1  4 MET HE1  H  -7.306  14.437  -1.014 1.00 . A A .  1 MET HE1  1 1 
        5  5601 1 1  4 MET HE2  H  -8.642  13.832  -0.028 1.00 . A A .  1 MET HE2  1 1 
        5  5602 1 1  4 MET HE3  H  -8.432  13.254  -1.683 1.00 . A A .  1 MET HE3  1 1 
        5  5603 1 1  4 MET HG2  H  -5.329  12.754  -1.924 1.00 . A A .  1 MET HG2  1 1 
        5  5604 1 1  4 MET HG3  H  -6.592  11.658  -2.485 1.00 . A A .  1 MET HG3  1 1 
        5  5605 1 1  4 MET N    N  -4.887   9.216  -3.498 1.00 . A A .  1 MET N    1 1 
        5  5606 1 1  4 MET O    O  -2.633   8.662  -1.996 1.00 . A A .  1 MET O    1 1 
        5  5607 1 1  4 MET SD   S  -6.878  12.244  -0.194 1.00 . A A .  1 MET SD   1 1 
        5  5608 1 1  5 VAL C    C   0.050  11.557  -1.059 1.00 . A A .  2 VAL C    1 1 
        5  5609 1 1  5 VAL CA   C  -0.433  10.393  -1.964 1.00 . A A .  2 VAL CA   1 1 
        5  5610 1 1  5 VAL CB   C   0.603  10.133  -3.129 1.00 . A A .  2 VAL CB   1 1 
        5  5611 1 1  5 VAL CG1  C   1.878   9.453  -2.613 1.00 . A A .  2 VAL CG1  1 1 
        5  5612 1 1  5 VAL CG2  C   0.023   9.281  -4.242 1.00 . A A .  2 VAL CG2  1 1 
        5  5613 1 1  5 VAL H    H  -1.966  11.570  -2.864 1.00 . A A .  2 VAL H    1 1 
        5  5614 1 1  5 VAL HA   H  -0.500   9.491  -1.359 1.00 . A A .  2 VAL HA   1 1 
        5  5615 1 1  5 VAL HB   H   0.883  11.092  -3.548 1.00 . A A .  2 VAL HB   1 1 
        5  5616 1 1  5 VAL HG11 H   2.552   9.269  -3.441 1.00 . A A .  2 VAL HG11 1 1 
        5  5617 1 1  5 VAL HG12 H   1.624   8.516  -2.143 1.00 . A A .  2 VAL HG12 1 1 
        5  5618 1 1  5 VAL HG13 H   2.362  10.097  -1.894 1.00 . A A .  2 VAL HG13 1 1 
        5  5619 1 1  5 VAL HG21 H  -0.860   9.759  -4.637 1.00 . A A .  2 VAL HG21 1 1 
        5  5620 1 1  5 VAL HG22 H  -0.239   8.311  -3.843 1.00 . A A .  2 VAL HG22 1 1 
        5  5621 1 1  5 VAL HG23 H   0.756   9.166  -5.023 1.00 . A A .  2 VAL HG23 1 1 
        5  5622 1 1  5 VAL N    N  -1.797  10.701  -2.453 1.00 . A A .  2 VAL N    1 1 
        5  5623 1 1  5 VAL O    O   1.131  12.123  -1.233 1.00 . A A .  2 VAL O    1 1 
        5  5624 1 1  6 ILE C    C  -0.634  12.497   2.297 1.00 . A A .  3 ILE C    1 1 
        5  5625 1 1  6 ILE CA   C  -0.433  13.017   0.857 1.00 . A A .  3 ILE CA   1 1 
        5  5626 1 1  6 ILE CB   C  -1.233  14.369   0.624 1.00 . A A .  3 ILE CB   1 1 
        5  5627 1 1  6 ILE CD1  C  -2.160  15.916  -1.228 1.00 . A A .  3 ILE CD1  1 1 
        5  5628 1 1  6 ILE CG1  C  -1.275  14.729  -0.882 1.00 . A A .  3 ILE CG1  1 1 
        5  5629 1 1  6 ILE CG2  C  -0.609  15.553   1.420 1.00 . A A .  3 ILE CG2  1 1 
        5  5630 1 1  6 ILE H    H  -1.675  11.523  -0.029 1.00 . A A .  3 ILE H    1 1 
        5  5631 1 1  6 ILE HA   H   0.621  13.223   0.718 1.00 . A A .  3 ILE HA   1 1 
        5  5632 1 1  6 ILE HB   H  -2.244  14.224   0.977 1.00 . A A .  3 ILE HB   1 1 
        5  5633 1 1  6 ILE HD11 H  -3.179  15.702  -0.939 1.00 . A A .  3 ILE HD11 1 1 
        5  5634 1 1  6 ILE HD12 H  -2.118  16.095  -2.291 1.00 . A A .  3 ILE HD12 1 1 
        5  5635 1 1  6 ILE HD13 H  -1.812  16.788  -0.699 1.00 . A A .  3 ILE HD13 1 1 
        5  5636 1 1  6 ILE HG12 H  -0.276  14.968  -1.212 1.00 . A A .  3 ILE HG12 1 1 
        5  5637 1 1  6 ILE HG13 H  -1.636  13.870  -1.443 1.00 . A A .  3 ILE HG13 1 1 
        5  5638 1 1  6 ILE HG21 H  -0.674  15.358   2.482 1.00 . A A .  3 ILE HG21 1 1 
        5  5639 1 1  6 ILE HG22 H  -1.153  16.462   1.201 1.00 . A A .  3 ILE HG22 1 1 
        5  5640 1 1  6 ILE HG23 H   0.426  15.687   1.141 1.00 . A A .  3 ILE HG23 1 1 
        5  5641 1 1  6 ILE N    N  -0.797  11.951  -0.100 1.00 . A A .  3 ILE N    1 1 
        5  5642 1 1  6 ILE O    O  -1.532  12.951   3.014 1.00 . A A .  3 ILE O    1 1 
        5  5643 1 1  7 ARG C    C   1.427   9.996   4.210 1.00 . A A .  4 ARG C    1 1 
        5  5644 1 1  7 ARG CA   C   0.223  10.967   4.063 1.00 . A A .  4 ARG CA   1 1 
        5  5645 1 1  7 ARG CB   C  -1.097  10.278   4.499 1.00 . A A .  4 ARG CB   1 1 
        5  5646 1 1  7 ARG CD   C  -2.415   9.474   6.520 1.00 . A A .  4 ARG CD   1 1 
        5  5647 1 1  7 ARG CG   C  -1.403  10.476   5.985 1.00 . A A .  4 ARG CG   1 1 
        5  5648 1 1  7 ARG CZ   C  -2.948   8.454   8.728 1.00 . A A .  4 ARG CZ   1 1 
        5  5649 1 1  7 ARG H    H   0.715  11.005   1.991 1.00 . A A .  4 ARG H    1 1 
        5  5650 1 1  7 ARG HA   H   0.400  11.825   4.697 1.00 . A A .  4 ARG HA   1 1 
        5  5651 1 1  7 ARG HB2  H  -1.910  10.693   3.920 1.00 . A A .  4 ARG HB2  1 1 
        5  5652 1 1  7 ARG HB3  H  -1.025   9.220   4.298 1.00 . A A .  4 ARG HB3  1 1 
        5  5653 1 1  7 ARG HD2  H  -3.415   9.829   6.305 1.00 . A A .  4 ARG HD2  1 1 
        5  5654 1 1  7 ARG HD3  H  -2.257   8.521   6.040 1.00 . A A .  4 ARG HD3  1 1 
        5  5655 1 1  7 ARG HE   H  -1.594   9.894   8.402 1.00 . A A .  4 ARG HE   1 1 
        5  5656 1 1  7 ARG HG2  H  -0.490  10.374   6.552 1.00 . A A .  4 ARG HG2  1 1 
        5  5657 1 1  7 ARG HG3  H  -1.796  11.475   6.129 1.00 . A A .  4 ARG HG3  1 1 
        5  5658 1 1  7 ARG HH11 H  -4.076   7.682   7.225 1.00 . A A .  4 ARG HH11 1 1 
        5  5659 1 1  7 ARG HH12 H  -4.387   7.014   8.792 1.00 . A A .  4 ARG HH12 1 1 
        5  5660 1 1  7 ARG HH21 H  -1.970   8.973  10.421 1.00 . A A .  4 ARG HH21 1 1 
        5  5661 1 1  7 ARG HH22 H  -3.183   7.753  10.613 1.00 . A A .  4 ARG HH22 1 1 
        5  5662 1 1  7 ARG N    N   0.153  11.456   2.671 1.00 . A A .  4 ARG N    1 1 
        5  5663 1 1  7 ARG NE   N  -2.263   9.317   7.966 1.00 . A A .  4 ARG NE   1 1 
        5  5664 1 1  7 ARG NH1  N  -3.876   7.650   8.204 1.00 . A A .  4 ARG NH1  1 1 
        5  5665 1 1  7 ARG NH2  N  -2.683   8.389  10.025 1.00 . A A .  4 ARG NH2  1 1 
        5  5666 1 1  7 ARG O    O   2.309   9.978   3.345 1.00 . A A .  4 ARG O    1 1 
        5  5667 1 1  8 GLU C    C   2.035   7.269   6.680 1.00 . A A .  5 GLU C    1 1 
        5  5668 1 1  8 GLU CA   C   2.553   8.320   5.666 1.00 . A A .  5 GLU CA   1 1 
        5  5669 1 1  8 GLU CB   C   3.688   9.194   6.295 1.00 . A A .  5 GLU CB   1 1 
        5  5670 1 1  8 GLU CD   C   5.517   9.177   8.091 1.00 . A A .  5 GLU CD   1 1 
        5  5671 1 1  8 GLU CG   C   4.843   8.406   6.961 1.00 . A A .  5 GLU CG   1 1 
        5  5672 1 1  8 GLU H    H   0.563   9.050   5.757 1.00 . A A .  5 GLU H    1 1 
        5  5673 1 1  8 GLU HA   H   2.914   7.828   4.769 1.00 . A A .  5 GLU HA   1 1 
        5  5674 1 1  8 GLU HB2  H   4.104   9.810   5.504 1.00 . A A .  5 GLU HB2  1 1 
        5  5675 1 1  8 GLU HB3  H   3.266   9.863   7.042 1.00 . A A .  5 GLU HB3  1 1 
        5  5676 1 1  8 GLU HG2  H   4.447   7.488   7.379 1.00 . A A .  5 GLU HG2  1 1 
        5  5677 1 1  8 GLU HG3  H   5.600   8.158   6.214 1.00 . A A .  5 GLU HG3  1 1 
        5  5678 1 1  8 GLU N    N   1.413   9.159   5.264 1.00 . A A .  5 GLU N    1 1 
        5  5679 1 1  8 GLU O    O   1.284   7.646   7.587 1.00 . A A .  5 GLU O    1 1 
        5  5680 1 1  8 GLU OE1  O   5.148  10.352   8.338 1.00 . A A .  5 GLU OE1  1 1 
        5  5681 1 1  8 GLU OE2  O   6.401   8.600   8.751 1.00 . A A .  5 GLU OE2  1 1 
        5  5682 1 1  9 SER C    C   2.768   3.582   7.117 1.00 . A A .  6 SER C    1 1 
        5  5683 1 1  9 SER CA   C   1.946   4.878   7.410 1.00 . A A .  6 SER CA   1 1 
        5  5684 1 1  9 SER CB   C   0.421   4.613   7.223 1.00 . A A .  6 SER CB   1 1 
        5  5685 1 1  9 SER H    H   3.057   5.730   5.803 1.00 . A A .  6 SER H    1 1 
        5  5686 1 1  9 SER HA   H   2.126   5.211   8.421 1.00 . A A .  6 SER HA   1 1 
        5  5687 1 1  9 SER HB2  H  -0.091   5.551   7.081 1.00 . A A .  6 SER HB2  1 1 
        5  5688 1 1  9 SER HB3  H   0.265   3.983   6.360 1.00 . A A .  6 SER HB3  1 1 
        5  5689 1 1  9 SER HG   H   0.169   4.401   9.158 1.00 . A A .  6 SER HG   1 1 
        5  5690 1 1  9 SER N    N   2.412   5.966   6.515 1.00 . A A .  6 SER N    1 1 
        5  5691 1 1  9 SER O    O   3.800   3.655   6.447 1.00 . A A .  6 SER O    1 1 
        5  5692 1 1  9 SER OG   O  -0.139   3.961   8.357 1.00 . A A .  6 SER OG   1 1 
        5  5693 1 1 10 VAL C    C   1.756   0.183   6.791 1.00 . A A .  7 VAL C    1 1 
        5  5694 1 1 10 VAL CA   C   2.877   1.100   7.217 1.00 . A A .  7 VAL CA   1 1 
        5  5695 1 1 10 VAL CB   C   3.743   0.315   8.293 1.00 . A A .  7 VAL CB   1 1 
        5  5696 1 1 10 VAL CG1  C   5.224   0.428   7.961 1.00 . A A .  7 VAL CG1  1 1 
        5  5697 1 1 10 VAL CG2  C   3.499   0.697   9.765 1.00 . A A .  7 VAL CG2  1 1 
        5  5698 1 1 10 VAL H    H   1.479   2.399   8.127 1.00 . A A .  7 VAL H    1 1 
        5  5699 1 1 10 VAL HA   H   3.503   1.278   6.338 1.00 . A A .  7 VAL HA   1 1 
        5  5700 1 1 10 VAL HB   H   3.486  -0.737   8.201 1.00 . A A .  7 VAL HB   1 1 
        5  5701 1 1 10 VAL HG11 H   5.417  -0.044   7.008 1.00 . A A .  7 VAL HG11 1 1 
        5  5702 1 1 10 VAL HG12 H   5.803  -0.065   8.730 1.00 . A A .  7 VAL HG12 1 1 
        5  5703 1 1 10 VAL HG13 H   5.504   1.468   7.914 1.00 . A A .  7 VAL HG13 1 1 
        5  5704 1 1 10 VAL HG21 H   3.994  -0.030  10.398 1.00 . A A .  7 VAL HG21 1 1 
        5  5705 1 1 10 VAL HG22 H   2.441   0.689   9.986 1.00 . A A .  7 VAL HG22 1 1 
        5  5706 1 1 10 VAL HG23 H   3.915   1.669   9.973 1.00 . A A .  7 VAL HG23 1 1 
        5  5707 1 1 10 VAL N    N   2.296   2.404   7.595 1.00 . A A .  7 VAL N    1 1 
        5  5708 1 1 10 VAL O    O   0.748   0.036   7.491 1.00 . A A .  7 VAL O    1 1 
        5  5709 1 1 11 SER C    C   1.440  -2.750   5.695 1.00 . A A .  8 SER C    1 1 
        5  5710 1 1 11 SER CA   C   1.017  -1.379   5.112 1.00 . A A .  8 SER CA   1 1 
        5  5711 1 1 11 SER CB   C   1.061  -1.317   3.572 1.00 . A A .  8 SER CB   1 1 
        5  5712 1 1 11 SER H    H   2.695  -0.117   5.062 1.00 . A A .  8 SER H    1 1 
        5  5713 1 1 11 SER HA   H   0.019  -1.136   5.456 1.00 . A A .  8 SER HA   1 1 
        5  5714 1 1 11 SER HB2  H   0.069  -1.432   3.183 1.00 . A A .  8 SER HB2  1 1 
        5  5715 1 1 11 SER HB3  H   1.423  -0.341   3.283 1.00 . A A .  8 SER HB3  1 1 
        5  5716 1 1 11 SER HG   H   2.767  -1.895   2.799 1.00 . A A .  8 SER HG   1 1 
        5  5717 1 1 11 SER N    N   1.922  -0.380   5.616 1.00 . A A .  8 SER N    1 1 
        5  5718 1 1 11 SER O    O   2.625  -3.082   5.673 1.00 . A A .  8 SER O    1 1 
        5  5719 1 1 11 SER OG   O   1.914  -2.290   2.986 1.00 . A A .  8 SER OG   1 1 
        5  5720 1 1 12 ARG C    C   0.182  -5.953   6.172 1.00 . A A .  9 ARG C    1 1 
        5  5721 1 1 12 ARG CA   C   0.909  -4.813   6.888 1.00 . A A .  9 ARG CA   1 1 
        5  5722 1 1 12 ARG CB   C   0.640  -4.900   8.419 1.00 . A A .  9 ARG CB   1 1 
        5  5723 1 1 12 ARG CD   C   0.293  -2.623   9.532 1.00 . A A .  9 ARG CD   1 1 
        5  5724 1 1 12 ARG CG   C   1.266  -3.766   9.246 1.00 . A A .  9 ARG CG   1 1 
        5  5725 1 1 12 ARG CZ   C  -2.080  -2.546  10.252 1.00 . A A .  9 ARG CZ   1 1 
        5  5726 1 1 12 ARG H    H  -0.443  -3.267   6.226 1.00 . A A .  9 ARG H    1 1 
        5  5727 1 1 12 ARG HA   H   1.975  -4.901   6.721 1.00 . A A .  9 ARG HA   1 1 
        5  5728 1 1 12 ARG HB2  H  -0.428  -4.915   8.601 1.00 . A A .  9 ARG HB2  1 1 
        5  5729 1 1 12 ARG HB3  H   1.051  -5.837   8.782 1.00 . A A .  9 ARG HB3  1 1 
        5  5730 1 1 12 ARG HD2  H   0.821  -1.846  10.067 1.00 . A A .  9 ARG HD2  1 1 
        5  5731 1 1 12 ARG HD3  H  -0.067  -2.224   8.593 1.00 . A A .  9 ARG HD3  1 1 
        5  5732 1 1 12 ARG HE   H  -0.675  -3.766  11.002 1.00 . A A .  9 ARG HE   1 1 
        5  5733 1 1 12 ARG HG2  H   1.611  -4.167  10.188 1.00 . A A .  9 ARG HG2  1 1 
        5  5734 1 1 12 ARG HG3  H   2.112  -3.371   8.700 1.00 . A A .  9 ARG HG3  1 1 
        5  5735 1 1 12 ARG HH11 H  -1.640  -1.203   8.792 1.00 . A A .  9 ARG HH11 1 1 
        5  5736 1 1 12 ARG HH12 H  -3.285  -1.189   9.331 1.00 . A A .  9 ARG HH12 1 1 
        5  5737 1 1 12 ARG HH21 H  -2.833  -3.748  11.702 1.00 . A A .  9 ARG HH21 1 1 
        5  5738 1 1 12 ARG HH22 H  -3.970  -2.643  10.994 1.00 . A A .  9 ARG HH22 1 1 
        5  5739 1 1 12 ARG N    N   0.510  -3.524   6.274 1.00 . A A .  9 ARG N    1 1 
        5  5740 1 1 12 ARG NE   N  -0.848  -3.060  10.339 1.00 . A A .  9 ARG NE   1 1 
        5  5741 1 1 12 ARG NH1  N  -2.359  -1.563   9.394 1.00 . A A .  9 ARG NH1  1 1 
        5  5742 1 1 12 ARG NH2  N  -3.042  -3.015  11.046 1.00 . A A .  9 ARG NH2  1 1 
        5  5743 1 1 12 ARG O    O  -0.878  -5.705   5.613 1.00 . A A .  9 ARG O    1 1 
        5  5744 1 1 13 ILE C    C   0.185  -9.559   6.308 1.00 . A A . 10 ILE C    1 1 
        5  5745 1 1 13 ILE CA   C   0.068  -8.304   5.440 1.00 . A A . 10 ILE CA   1 1 
        5  5746 1 1 13 ILE CB   C   0.648  -8.640   3.990 1.00 . A A . 10 ILE CB   1 1 
        5  5747 1 1 13 ILE CD1  C   1.962  -6.588   3.103 1.00 . A A . 10 ILE CD1  1 1 
        5  5748 1 1 13 ILE CG1  C   0.726  -7.457   2.997 1.00 . A A . 10 ILE CG1  1 1 
        5  5749 1 1 13 ILE CG2  C  -0.143  -9.763   3.297 1.00 . A A . 10 ILE CG2  1 1 
        5  5750 1 1 13 ILE H    H   1.617  -7.376   6.616 1.00 . A A . 10 ILE H    1 1 
        5  5751 1 1 13 ILE HA   H  -0.982  -8.051   5.357 1.00 . A A . 10 ILE HA   1 1 
        5  5752 1 1 13 ILE HB   H   1.651  -9.012   4.141 1.00 . A A . 10 ILE HB   1 1 
        5  5753 1 1 13 ILE HD11 H   2.062  -5.995   2.205 1.00 . A A . 10 ILE HD11 1 1 
        5  5754 1 1 13 ILE HD12 H   2.832  -7.205   3.207 1.00 . A A . 10 ILE HD12 1 1 
        5  5755 1 1 13 ILE HD13 H   1.881  -5.936   3.953 1.00 . A A . 10 ILE HD13 1 1 
        5  5756 1 1 13 ILE HG12 H   0.706  -7.845   2.001 1.00 . A A . 10 ILE HG12 1 1 
        5  5757 1 1 13 ILE HG13 H  -0.135  -6.830   3.119 1.00 . A A . 10 ILE HG13 1 1 
        5  5758 1 1 13 ILE HG21 H   0.304  -9.979   2.339 1.00 . A A . 10 ILE HG21 1 1 
        5  5759 1 1 13 ILE HG22 H  -1.166  -9.453   3.147 1.00 . A A . 10 ILE HG22 1 1 
        5  5760 1 1 13 ILE HG23 H  -0.120 -10.657   3.907 1.00 . A A . 10 ILE HG23 1 1 
        5  5761 1 1 13 ILE N    N   0.734  -7.192   6.143 1.00 . A A . 10 ILE N    1 1 
        5  5762 1 1 13 ILE O    O   1.279  -9.822   6.883 1.00 . A A . 10 ILE O    1 1 
        5  5763 1 1 14 TYR C    C  -1.125 -12.764   6.192 1.00 . A A . 11 TYR C    1 1 
        5  5764 1 1 14 TYR CA   C  -1.051 -11.543   7.177 1.00 . A A . 11 TYR CA   1 1 
        5  5765 1 1 14 TYR CB   C  -2.327 -11.488   8.047 1.00 . A A . 11 TYR CB   1 1 
        5  5766 1 1 14 TYR CD1  C  -2.600 -13.675   9.313 1.00 . A A . 11 TYR CD1  1 1 
        5  5767 1 1 14 TYR CD2  C  -1.862 -11.745  10.506 1.00 . A A . 11 TYR CD2  1 1 
        5  5768 1 1 14 TYR CE1  C  -2.537 -14.417  10.476 1.00 . A A . 11 TYR CE1  1 1 
        5  5769 1 1 14 TYR CE2  C  -1.799 -12.482  11.670 1.00 . A A . 11 TYR CE2  1 1 
        5  5770 1 1 14 TYR CG   C  -2.260 -12.324   9.308 1.00 . A A . 11 TYR CG   1 1 
        5  5771 1 1 14 TYR CZ   C  -2.139 -13.817  11.650 1.00 . A A . 11 TYR CZ   1 1 
        5  5772 1 1 14 TYR H    H  -1.788  -9.919   5.987 1.00 . A A . 11 TYR H    1 1 
        5  5773 1 1 14 TYR HA   H  -0.192 -11.619   7.825 1.00 . A A . 11 TYR HA   1 1 
        5  5774 1 1 14 TYR HB2  H  -2.507 -10.461   8.353 1.00 . A A . 11 TYR HB2  1 1 
        5  5775 1 1 14 TYR HB3  H  -3.174 -11.831   7.462 1.00 . A A . 11 TYR HB3  1 1 
        5  5776 1 1 14 TYR HD1  H  -2.914 -14.142   8.392 1.00 . A A . 11 TYR HD1  1 1 
        5  5777 1 1 14 TYR HD2  H  -1.596 -10.698  10.519 1.00 . A A . 11 TYR HD2  1 1 
        5  5778 1 1 14 TYR HE1  H  -2.815 -15.454  10.470 1.00 . A A . 11 TYR HE1  1 1 
        5  5779 1 1 14 TYR HE2  H  -1.487 -12.011  12.591 1.00 . A A . 11 TYR HE2  1 1 
        5  5780 1 1 14 TYR HH   H  -2.439 -14.072  13.534 1.00 . A A . 11 TYR HH   1 1 
        5  5781 1 1 14 TYR N    N  -0.962 -10.277   6.422 1.00 . A A . 11 TYR N    1 1 
        5  5782 1 1 14 TYR O    O  -2.124 -12.881   5.453 1.00 . A A . 11 TYR O    1 1 
        5  5783 1 1 14 TYR OH   O  -2.063 -14.568  12.804 1.00 . A A . 11 TYR OH   1 1 
        5  5784 1 1 15 VAL C    C  -0.066 -16.139   6.104 1.00 . A A . 12 VAL C    1 1 
        5  5785 1 1 15 VAL CA   C  -0.216 -14.850   5.249 1.00 . A A . 12 VAL CA   1 1 
        5  5786 1 1 15 VAL CB   C   0.825 -14.751   4.002 1.00 . A A . 12 VAL CB   1 1 
        5  5787 1 1 15 VAL CG1  C   2.217 -14.342   4.447 1.00 . A A . 12 VAL CG1  1 1 
        5  5788 1 1 15 VAL CG2  C   0.954 -16.042   3.157 1.00 . A A . 12 VAL CG2  1 1 
        5  5789 1 1 15 VAL H    H   0.663 -13.636   6.773 1.00 . A A . 12 VAL H    1 1 
        5  5790 1 1 15 VAL HA   H  -1.229 -14.831   4.856 1.00 . A A . 12 VAL HA   1 1 
        5  5791 1 1 15 VAL HB   H   0.480 -13.959   3.319 1.00 . A A . 12 VAL HB   1 1 
        5  5792 1 1 15 VAL HG11 H   2.558 -15.016   5.220 1.00 . A A . 12 VAL HG11 1 1 
        5  5793 1 1 15 VAL HG12 H   2.194 -13.332   4.833 1.00 . A A . 12 VAL HG12 1 1 
        5  5794 1 1 15 VAL HG13 H   2.894 -14.389   3.608 1.00 . A A . 12 VAL HG13 1 1 
        5  5795 1 1 15 VAL HG21 H   1.729 -15.897   2.409 1.00 . A A . 12 VAL HG21 1 1 
        5  5796 1 1 15 VAL HG22 H   0.029 -16.257   2.649 1.00 . A A . 12 VAL HG22 1 1 
        5  5797 1 1 15 VAL HG23 H   1.233 -16.878   3.785 1.00 . A A . 12 VAL HG23 1 1 
        5  5798 1 1 15 VAL N    N  -0.112 -13.684   6.154 1.00 . A A . 12 VAL N    1 1 
        5  5799 1 1 15 VAL O    O   1.015 -16.460   6.566 1.00 . A A . 12 VAL O    1 1 
        5  5800 1 1 16 GLY C    C  -1.612 -19.291   6.472 1.00 . A A . 13 GLY C    1 1 
        5  5801 1 1 16 GLY CA   C  -1.111 -18.059   7.195 1.00 . A A . 13 GLY CA   1 1 
        5  5802 1 1 16 GLY H    H  -2.067 -16.541   6.013 1.00 . A A . 13 GLY H    1 1 
        5  5803 1 1 16 GLY HA2  H  -0.085 -18.222   7.498 1.00 . A A . 13 GLY HA2  1 1 
        5  5804 1 1 16 GLY HA3  H  -1.708 -17.920   8.071 1.00 . A A . 13 GLY HA3  1 1 
        5  5805 1 1 16 GLY N    N  -1.180 -16.848   6.367 1.00 . A A . 13 GLY N    1 1 
        5  5806 1 1 16 GLY O    O  -2.047 -19.178   5.339 1.00 . A A . 13 GLY O    1 1 
        5  5807 1 1 17 ASN C    C  -1.379 -22.095   5.138 1.00 . A A . 14 ASN C    1 1 
        5  5808 1 1 17 ASN CA   C  -1.967 -21.783   6.553 1.00 . A A . 14 ASN CA   1 1 
        5  5809 1 1 17 ASN CB   C  -3.516 -21.842   6.516 1.00 . A A . 14 ASN CB   1 1 
        5  5810 1 1 17 ASN CG   C  -4.158 -21.596   7.876 1.00 . A A . 14 ASN CG   1 1 
        5  5811 1 1 17 ASN H    H  -1.213 -20.477   8.086 1.00 . A A . 14 ASN H    1 1 
        5  5812 1 1 17 ASN HA   H  -1.632 -22.564   7.214 1.00 . A A . 14 ASN HA   1 1 
        5  5813 1 1 17 ASN HB2  H  -3.883 -21.091   5.831 1.00 . A A . 14 ASN HB2  1 1 
        5  5814 1 1 17 ASN HB3  H  -3.821 -22.815   6.162 1.00 . A A . 14 ASN HB3  1 1 
        5  5815 1 1 17 ASN HD21 H  -3.878 -23.491   8.383 1.00 . A A . 14 ASN HD21 1 1 
        5  5816 1 1 17 ASN HD22 H  -4.628 -22.492   9.579 1.00 . A A . 14 ASN HD22 1 1 
        5  5817 1 1 17 ASN N    N  -1.534 -20.476   7.138 1.00 . A A . 14 ASN N    1 1 
        5  5818 1 1 17 ASN ND2  N  -4.233 -22.631   8.694 1.00 . A A . 14 ASN ND2  1 1 
        5  5819 1 1 17 ASN O    O  -1.936 -22.906   4.417 1.00 . A A . 14 ASN O    1 1 
        5  5820 1 1 17 ASN OD1  O  -4.563 -20.483   8.191 1.00 . A A . 14 ASN OD1  1 1 
        5  5821 1 1 18 LEU C    C   1.199 -22.997   3.456 1.00 . A A . 15 LEU C    1 1 
        5  5822 1 1 18 LEU CA   C   0.421 -21.667   3.503 1.00 . A A . 15 LEU CA   1 1 
        5  5823 1 1 18 LEU CB   C   1.361 -20.449   3.180 1.00 . A A . 15 LEU CB   1 1 
        5  5824 1 1 18 LEU CD1  C   3.623 -19.303   3.453 1.00 . A A . 15 LEU CD1  1 1 
        5  5825 1 1 18 LEU CD2  C   2.138 -19.420   5.391 1.00 . A A . 15 LEU CD2  1 1 
        5  5826 1 1 18 LEU CG   C   2.560 -20.150   4.134 1.00 . A A . 15 LEU CG   1 1 
        5  5827 1 1 18 LEU H    H   0.181 -20.911   5.430 1.00 . A A . 15 LEU H    1 1 
        5  5828 1 1 18 LEU HA   H  -0.360 -21.700   2.757 1.00 . A A . 15 LEU HA   1 1 
        5  5829 1 1 18 LEU HB2  H   1.770 -20.609   2.199 1.00 . A A . 15 LEU HB2  1 1 
        5  5830 1 1 18 LEU HB3  H   0.744 -19.561   3.141 1.00 . A A . 15 LEU HB3  1 1 
        5  5831 1 1 18 LEU HD11 H   4.188 -19.914   2.764 1.00 . A A . 15 LEU HD11 1 1 
        5  5832 1 1 18 LEU HD12 H   4.285 -18.894   4.206 1.00 . A A . 15 LEU HD12 1 1 
        5  5833 1 1 18 LEU HD13 H   3.154 -18.489   2.913 1.00 . A A . 15 LEU HD13 1 1 
        5  5834 1 1 18 LEU HD21 H   1.590 -20.090   6.034 1.00 . A A . 15 LEU HD21 1 1 
        5  5835 1 1 18 LEU HD22 H   1.507 -18.583   5.126 1.00 . A A . 15 LEU HD22 1 1 
        5  5836 1 1 18 LEU HD23 H   3.015 -19.060   5.911 1.00 . A A . 15 LEU HD23 1 1 
        5  5837 1 1 18 LEU HG   H   3.015 -21.082   4.430 1.00 . A A . 15 LEU HG   1 1 
        5  5838 1 1 18 LEU N    N  -0.228 -21.498   4.797 1.00 . A A . 15 LEU N    1 1 
        5  5839 1 1 18 LEU O    O   2.048 -23.258   4.311 1.00 . A A . 15 LEU O    1 1 
        5  5840 1 1 19 PRO C    C   2.893 -24.852   1.297 1.00 . A A . 16 PRO C    1 1 
        5  5841 1 1 19 PRO CA   C   1.702 -25.089   2.274 1.00 . A A . 16 PRO CA   1 1 
        5  5842 1 1 19 PRO CB   C   0.684 -26.061   1.650 1.00 . A A . 16 PRO CB   1 1 
        5  5843 1 1 19 PRO CD   C  -0.266 -23.821   1.566 1.00 . A A . 16 PRO CD   1 1 
        5  5844 1 1 19 PRO CG   C  -0.377 -25.218   0.999 1.00 . A A . 16 PRO CG   1 1 
        5  5845 1 1 19 PRO HA   H   2.037 -25.490   3.216 1.00 . A A . 16 PRO HA   1 1 
        5  5846 1 1 19 PRO HB2  H   1.185 -26.675   0.919 1.00 . A A . 16 PRO HB2  1 1 
        5  5847 1 1 19 PRO HB3  H   0.245 -26.689   2.417 1.00 . A A . 16 PRO HB3  1 1 
        5  5848 1 1 19 PRO HD2  H  -0.101 -23.105   0.774 1.00 . A A . 16 PRO HD2  1 1 
        5  5849 1 1 19 PRO HD3  H  -1.164 -23.569   2.118 1.00 . A A . 16 PRO HD3  1 1 
        5  5850 1 1 19 PRO HG2  H  -0.209 -25.202  -0.069 1.00 . A A . 16 PRO HG2  1 1 
        5  5851 1 1 19 PRO HG3  H  -1.356 -25.624   1.211 1.00 . A A . 16 PRO HG3  1 1 
        5  5852 1 1 19 PRO N    N   0.901 -23.882   2.471 1.00 . A A . 16 PRO N    1 1 
        5  5853 1 1 19 PRO O    O   2.646 -24.543   0.114 1.00 . A A . 16 PRO O    1 1 
        5  5854 1 1 20 SER C    C   5.415 -23.725  -0.005 1.00 . A A . 17 SER C    1 1 
        5  5855 1 1 20 SER CA   C   5.425 -24.923   0.978 1.00 . A A . 17 SER CA   1 1 
        5  5856 1 1 20 SER CB   C   5.703 -26.229   0.211 1.00 . A A . 17 SER CB   1 1 
        5  5857 1 1 20 SER H    H   4.278 -25.318   2.719 1.00 . A A . 17 SER H    1 1 
        5  5858 1 1 20 SER HA   H   6.236 -24.767   1.681 1.00 . A A . 17 SER HA   1 1 
        5  5859 1 1 20 SER HB2  H   4.881 -26.429  -0.466 1.00 . A A . 17 SER HB2  1 1 
        5  5860 1 1 20 SER HB3  H   6.612 -26.122  -0.363 1.00 . A A . 17 SER HB3  1 1 
        5  5861 1 1 20 SER HG   H   6.759 -27.649   1.082 1.00 . A A . 17 SER HG   1 1 
        5  5862 1 1 20 SER N    N   4.167 -25.065   1.780 1.00 . A A . 17 SER N    1 1 
        5  5863 1 1 20 SER O    O   5.872 -23.844  -1.144 1.00 . A A . 17 SER O    1 1 
        5  5864 1 1 20 SER OG   O   5.851 -27.331   1.100 1.00 . A A . 17 SER OG   1 1 
        5  5865 1 1 21 HIS C    C   5.790 -20.484  -0.556 1.00 . A A . 18 HIS C    1 1 
        5  5866 1 1 21 HIS CA   C   4.609 -21.469  -0.455 1.00 . A A . 18 HIS CA   1 1 
        5  5867 1 1 21 HIS CB   C   3.293 -20.796  -0.006 1.00 . A A . 18 HIS CB   1 1 
        5  5868 1 1 21 HIS CD2  C   2.792 -19.753  -2.351 1.00 . A A . 18 HIS CD2  1 1 
        5  5869 1 1 21 HIS CE1  C   0.748 -19.071  -1.974 1.00 . A A . 18 HIS CE1  1 1 
        5  5870 1 1 21 HIS CG   C   2.489 -20.095  -1.080 1.00 . A A . 18 HIS CG   1 1 
        5  5871 1 1 21 HIS H    H   4.803 -22.451   1.427 1.00 . A A . 18 HIS H    1 1 
        5  5872 1 1 21 HIS HA   H   4.456 -21.902  -1.422 1.00 . A A . 18 HIS HA   1 1 
        5  5873 1 1 21 HIS HB2  H   2.652 -21.546   0.431 1.00 . A A . 18 HIS HB2  1 1 
        5  5874 1 1 21 HIS HB3  H   3.536 -20.077   0.742 1.00 . A A . 18 HIS HB3  1 1 
        5  5875 1 1 21 HIS HD1  H   0.676 -19.746  -0.042 1.00 . A A . 18 HIS HD1  1 1 
        5  5876 1 1 21 HIS HD2  H   3.725 -19.946  -2.853 1.00 . A A . 18 HIS HD2  1 1 
        5  5877 1 1 21 HIS HE1  H  -0.230 -18.627  -2.098 1.00 . A A . 18 HIS HE1  1 1 
        5  5878 1 1 21 HIS HE2  H   1.519 -19.051  -3.854 1.00 . A A . 18 HIS HE2  1 1 
        5  5879 1 1 21 HIS N    N   4.930 -22.567   0.456 1.00 . A A . 18 HIS N    1 1 
        5  5880 1 1 21 HIS ND1  N   1.199 -19.642  -0.869 1.00 . A A . 18 HIS ND1  1 1 
        5  5881 1 1 21 HIS NE2  N   1.695 -19.119  -2.889 1.00 . A A . 18 HIS NE2  1 1 
        5  5882 1 1 21 HIS O    O   6.684 -20.696  -1.370 1.00 . A A . 18 HIS O    1 1 
        5  5883 1 1 22 VAL C    C   7.913 -18.684   1.402 1.00 . A A . 19 VAL C    1 1 
        5  5884 1 1 22 VAL CA   C   6.909 -18.456   0.182 1.00 . A A . 19 VAL CA   1 1 
        5  5885 1 1 22 VAL CB   C   6.307 -16.967   0.049 1.00 . A A . 19 VAL CB   1 1 
        5  5886 1 1 22 VAL CG1  C   5.356 -16.843  -1.161 1.00 . A A . 19 VAL CG1  1 1 
        5  5887 1 1 22 VAL CG2  C   5.539 -16.496   1.297 1.00 . A A . 19 VAL CG2  1 1 
        5  5888 1 1 22 VAL H    H   5.091 -19.294   0.916 1.00 . A A . 19 VAL H    1 1 
        5  5889 1 1 22 VAL HA   H   7.437 -18.677  -0.739 1.00 . A A . 19 VAL HA   1 1 
        5  5890 1 1 22 VAL HB   H   7.115 -16.277  -0.135 1.00 . A A . 19 VAL HB   1 1 
        5  5891 1 1 22 VAL HG11 H   4.553 -17.561  -1.075 1.00 . A A . 19 VAL HG11 1 1 
        5  5892 1 1 22 VAL HG12 H   5.890 -17.017  -2.091 1.00 . A A . 19 VAL HG12 1 1 
        5  5893 1 1 22 VAL HG13 H   4.936 -15.850  -1.181 1.00 . A A . 19 VAL HG13 1 1 
        5  5894 1 1 22 VAL HG21 H   5.154 -15.496   1.135 1.00 . A A . 19 VAL HG21 1 1 
        5  5895 1 1 22 VAL HG22 H   6.196 -16.489   2.153 1.00 . A A . 19 VAL HG22 1 1 
        5  5896 1 1 22 VAL HG23 H   4.711 -17.164   1.482 1.00 . A A . 19 VAL HG23 1 1 
        5  5897 1 1 22 VAL N    N   5.808 -19.420   0.254 1.00 . A A . 19 VAL N    1 1 
        5  5898 1 1 22 VAL O    O   7.474 -18.628   2.551 1.00 . A A . 19 VAL O    1 1 
        5  5899 1 1 23 SER C    C  10.771 -17.631   2.597 1.00 . A A . 20 SER C    1 1 
        5  5900 1 1 23 SER CA   C  10.251 -19.060   2.295 1.00 . A A . 20 SER CA   1 1 
        5  5901 1 1 23 SER CB   C  11.412 -20.048   1.913 1.00 . A A . 20 SER CB   1 1 
        5  5902 1 1 23 SER H    H   9.546 -19.353   0.285 1.00 . A A . 20 SER H    1 1 
        5  5903 1 1 23 SER HA   H   9.757 -19.427   3.184 1.00 . A A . 20 SER HA   1 1 
        5  5904 1 1 23 SER HB2  H  12.374 -19.534   1.821 1.00 . A A . 20 SER HB2  1 1 
        5  5905 1 1 23 SER HB3  H  11.496 -20.813   2.671 1.00 . A A . 20 SER HB3  1 1 
        5  5906 1 1 23 SER HG   H  11.432 -20.108  -0.056 1.00 . A A . 20 SER HG   1 1 
        5  5907 1 1 23 SER N    N   9.245 -19.020   1.178 1.00 . A A . 20 SER N    1 1 
        5  5908 1 1 23 SER O    O  10.697 -16.778   1.717 1.00 . A A . 20 SER O    1 1 
        5  5909 1 1 23 SER OG   O  11.140 -20.688   0.669 1.00 . A A . 20 SER OG   1 1 
        5  5910 1 1 24 SER C    C  12.596 -15.231   3.378 1.00 . A A . 21 SER C    1 1 
        5  5911 1 1 24 SER CA   C  11.670 -16.032   4.335 1.00 . A A . 21 SER CA   1 1 
        5  5912 1 1 24 SER CB   C  12.372 -16.199   5.675 1.00 . A A . 21 SER CB   1 1 
        5  5913 1 1 24 SER H    H  11.287 -18.109   4.517 1.00 . A A . 21 SER H    1 1 
        5  5914 1 1 24 SER HA   H  10.776 -15.472   4.505 1.00 . A A . 21 SER HA   1 1 
        5  5915 1 1 24 SER HB2  H  11.781 -16.837   6.311 1.00 . A A . 21 SER HB2  1 1 
        5  5916 1 1 24 SER HB3  H  13.336 -16.647   5.508 1.00 . A A . 21 SER HB3  1 1 
        5  5917 1 1 24 SER HG   H  12.419 -15.060   7.274 1.00 . A A . 21 SER HG   1 1 
        5  5918 1 1 24 SER N    N  11.261 -17.376   3.852 1.00 . A A . 21 SER N    1 1 
        5  5919 1 1 24 SER O    O  12.353 -14.028   3.141 1.00 . A A . 21 SER O    1 1 
        5  5920 1 1 24 SER OG   O  12.556 -14.952   6.324 1.00 . A A . 21 SER OG   1 1 
        5  5921 1 1 25 ARG C    C  13.860 -14.756   0.571 1.00 . A A . 22 ARG C    1 1 
        5  5922 1 1 25 ARG CA   C  14.576 -15.236   1.898 1.00 . A A . 22 ARG CA   1 1 
        5  5923 1 1 25 ARG CB   C  15.882 -16.106   1.694 1.00 . A A . 22 ARG CB   1 1 
        5  5924 1 1 25 ARG CD   C  15.899 -17.161  -0.651 1.00 . A A . 22 ARG CD   1 1 
        5  5925 1 1 25 ARG CG   C  16.538 -16.152   0.306 1.00 . A A . 22 ARG CG   1 1 
        5  5926 1 1 25 ARG CZ   C  17.776 -17.495  -2.293 1.00 . A A . 22 ARG CZ   1 1 
        5  5927 1 1 25 ARG H    H  13.900 -16.770   3.262 1.00 . A A . 22 ARG H    1 1 
        5  5928 1 1 25 ARG HA   H  14.891 -14.335   2.402 1.00 . A A . 22 ARG HA   1 1 
        5  5929 1 1 25 ARG HB2  H  16.628 -15.688   2.348 1.00 . A A . 22 ARG HB2  1 1 
        5  5930 1 1 25 ARG HB3  H  15.712 -17.123   2.022 1.00 . A A . 22 ARG HB3  1 1 
        5  5931 1 1 25 ARG HD2  H  15.257 -17.829  -0.080 1.00 . A A . 22 ARG HD2  1 1 
        5  5932 1 1 25 ARG HD3  H  15.296 -16.628  -1.372 1.00 . A A . 22 ARG HD3  1 1 
        5  5933 1 1 25 ARG HE   H  16.940 -18.920  -1.138 1.00 . A A . 22 ARG HE   1 1 
        5  5934 1 1 25 ARG HG2  H  16.483 -15.174  -0.146 1.00 . A A . 22 ARG HG2  1 1 
        5  5935 1 1 25 ARG HG3  H  17.582 -16.418   0.432 1.00 . A A . 22 ARG HG3  1 1 
        5  5936 1 1 25 ARG HH11 H  17.105 -15.573  -2.260 1.00 . A A . 22 ARG HH11 1 1 
        5  5937 1 1 25 ARG HH12 H  18.404 -15.877  -3.364 1.00 . A A . 22 ARG HH12 1 1 
        5  5938 1 1 25 ARG HH21 H  18.696 -19.287  -2.523 1.00 . A A . 22 ARG HH21 1 1 
        5  5939 1 1 25 ARG HH22 H  19.317 -18.006  -3.511 1.00 . A A . 22 ARG HH22 1 1 
        5  5940 1 1 25 ARG N    N  13.668 -15.876   2.882 1.00 . A A . 22 ARG N    1 1 
        5  5941 1 1 25 ARG NE   N  16.914 -17.960  -1.361 1.00 . A A . 22 ARG NE   1 1 
        5  5942 1 1 25 ARG NH1  N  17.762 -16.209  -2.668 1.00 . A A . 22 ARG NH1  1 1 
        5  5943 1 1 25 ARG NH2  N  18.666 -18.330  -2.823 1.00 . A A . 22 ARG NH2  1 1 
        5  5944 1 1 25 ARG O    O  14.128 -13.618   0.090 1.00 . A A . 22 ARG O    1 1 
        5  5945 1 1 26 ASP C    C  11.129 -14.097  -0.791 1.00 . A A . 23 ASP C    1 1 
        5  5946 1 1 26 ASP CA   C  12.130 -15.200  -1.167 1.00 . A A . 23 ASP CA   1 1 
        5  5947 1 1 26 ASP CB   C  11.396 -16.400  -1.843 1.00 . A A . 23 ASP CB   1 1 
        5  5948 1 1 26 ASP CG   C  12.250 -17.651  -1.855 1.00 . A A . 23 ASP CG   1 1 
        5  5949 1 1 26 ASP H    H  12.872 -16.507   0.319 1.00 . A A . 23 ASP H    1 1 
        5  5950 1 1 26 ASP HA   H  12.817 -14.793  -1.906 1.00 . A A . 23 ASP HA   1 1 
        5  5951 1 1 26 ASP HB2  H  10.474 -16.599  -1.342 1.00 . A A . 23 ASP HB2  1 1 
        5  5952 1 1 26 ASP HB3  H  11.158 -16.158  -2.889 1.00 . A A . 23 ASP HB3  1 1 
        5  5953 1 1 26 ASP N    N  12.952 -15.594  -0.006 1.00 . A A . 23 ASP N    1 1 
        5  5954 1 1 26 ASP O    O  10.812 -13.291  -1.674 1.00 . A A . 23 ASP O    1 1 
        5  5955 1 1 26 ASP OD1  O  13.078 -17.800  -2.777 1.00 . A A . 23 ASP OD1  1 1 
        5  5956 1 1 26 ASP OD2  O  12.095 -18.483  -0.944 1.00 . A A . 23 ASP OD2  1 1 
        5  5957 1 1 27 VAL C    C  10.682 -11.608   0.883 1.00 . A A . 24 VAL C    1 1 
        5  5958 1 1 27 VAL CA   C   9.817 -12.863   0.875 1.00 . A A . 24 VAL CA   1 1 
        5  5959 1 1 27 VAL CB   C   9.023 -12.954   2.244 1.00 . A A . 24 VAL CB   1 1 
        5  5960 1 1 27 VAL CG1  C   7.797 -12.097   2.231 1.00 . A A . 24 VAL CG1  1 1 
        5  5961 1 1 27 VAL CG2  C   8.607 -14.349   2.707 1.00 . A A . 24 VAL CG2  1 1 
        5  5962 1 1 27 VAL H    H  10.752 -14.730   1.174 1.00 . A A . 24 VAL H    1 1 
        5  5963 1 1 27 VAL HA   H   9.110 -12.709   0.080 1.00 . A A . 24 VAL HA   1 1 
        5  5964 1 1 27 VAL HB   H   9.634 -12.529   2.992 1.00 . A A . 24 VAL HB   1 1 
        5  5965 1 1 27 VAL HG11 H   8.059 -11.078   1.976 1.00 . A A . 24 VAL HG11 1 1 
        5  5966 1 1 27 VAL HG12 H   7.349 -12.114   3.208 1.00 . A A . 24 VAL HG12 1 1 
        5  5967 1 1 27 VAL HG13 H   7.095 -12.482   1.512 1.00 . A A . 24 VAL HG13 1 1 
        5  5968 1 1 27 VAL HG21 H   9.444 -14.871   3.135 1.00 . A A . 24 VAL HG21 1 1 
        5  5969 1 1 27 VAL HG22 H   8.216 -14.925   1.884 1.00 . A A . 24 VAL HG22 1 1 
        5  5970 1 1 27 VAL HG23 H   7.835 -14.242   3.464 1.00 . A A . 24 VAL HG23 1 1 
        5  5971 1 1 27 VAL N    N  10.617 -14.016   0.500 1.00 . A A . 24 VAL N    1 1 
        5  5972 1 1 27 VAL O    O  10.213 -10.619   0.352 1.00 . A A . 24 VAL O    1 1 
        5  5973 1 1 28 GLU C    C  12.977  -9.988  -0.150 1.00 . A A . 25 GLU C    1 1 
        5  5974 1 1 28 GLU CA   C  12.725 -10.390   1.326 1.00 . A A . 25 GLU CA   1 1 
        5  5975 1 1 28 GLU CB   C  14.052 -10.434   2.119 1.00 . A A . 25 GLU CB   1 1 
        5  5976 1 1 28 GLU CD   C  15.889  -9.043   3.190 1.00 . A A . 25 GLU CD   1 1 
        5  5977 1 1 28 GLU CG   C  14.437  -9.097   2.762 1.00 . A A . 25 GLU CG   1 1 
        5  5978 1 1 28 GLU H    H  12.295 -12.379   1.901 1.00 . A A . 25 GLU H    1 1 
        5  5979 1 1 28 GLU HA   H  12.099  -9.621   1.756 1.00 . A A . 25 GLU HA   1 1 
        5  5980 1 1 28 GLU HB2  H  13.986 -11.171   2.905 1.00 . A A . 25 GLU HB2  1 1 
        5  5981 1 1 28 GLU HB3  H  14.844 -10.707   1.449 1.00 . A A . 25 GLU HB3  1 1 
        5  5982 1 1 28 GLU HG2  H  14.260  -8.287   2.069 1.00 . A A . 25 GLU HG2  1 1 
        5  5983 1 1 28 GLU HG3  H  13.824  -8.953   3.642 1.00 . A A . 25 GLU HG3  1 1 
        5  5984 1 1 28 GLU N    N  11.937 -11.611   1.419 1.00 . A A . 25 GLU N    1 1 
        5  5985 1 1 28 GLU O    O  12.540  -8.914  -0.506 1.00 . A A . 25 GLU O    1 1 
        5  5986 1 1 28 GLU OE1  O  16.784  -9.169   2.322 1.00 . A A . 25 GLU OE1  1 1 
        5  5987 1 1 28 GLU OE2  O  16.139  -8.861   4.396 1.00 . A A . 25 GLU OE2  1 1 
        5  5988 1 1 29 ASN C    C  12.543 -10.194  -3.305 1.00 . A A . 26 ASN C    1 1 
        5  5989 1 1 29 ASN CA   C  13.848 -10.385  -2.431 1.00 . A A . 26 ASN CA   1 1 
        5  5990 1 1 29 ASN CB   C  14.869 -11.340  -3.170 1.00 . A A . 26 ASN CB   1 1 
        5  5991 1 1 29 ASN CG   C  15.463 -10.779  -4.471 1.00 . A A . 26 ASN CG   1 1 
        5  5992 1 1 29 ASN H    H  13.807 -11.749  -0.739 1.00 . A A . 26 ASN H    1 1 
        5  5993 1 1 29 ASN HA   H  14.325  -9.420  -2.321 1.00 . A A . 26 ASN HA   1 1 
        5  5994 1 1 29 ASN HB2  H  15.725 -11.556  -2.517 1.00 . A A . 26 ASN HB2  1 1 
        5  5995 1 1 29 ASN HB3  H  14.372 -12.267  -3.423 1.00 . A A . 26 ASN HB3  1 1 
        5  5996 1 1 29 ASN HD21 H  17.048 -11.946  -4.232 1.00 . A A . 26 ASN HD21 1 1 
        5  5997 1 1 29 ASN HD22 H  17.051 -10.952  -5.643 1.00 . A A . 26 ASN HD22 1 1 
        5  5998 1 1 29 ASN N    N  13.550 -10.860  -1.034 1.00 . A A . 26 ASN N    1 1 
        5  5999 1 1 29 ASN ND2  N  16.639 -11.274  -4.816 1.00 . A A . 26 ASN ND2  1 1 
        5  6000 1 1 29 ASN O    O  12.222  -9.027  -3.734 1.00 . A A . 26 ASN O    1 1 
        5  6001 1 1 29 ASN OD1  O  14.892  -9.942  -5.169 1.00 . A A . 26 ASN OD1  1 1 
        5  6002 1 1 30 GLU C    C   9.450 -10.274  -3.745 1.00 . A A . 27 GLU C    1 1 
        5  6003 1 1 30 GLU CA   C  10.568 -11.135  -4.375 1.00 . A A . 27 GLU CA   1 1 
        5  6004 1 1 30 GLU CB   C  10.076 -12.532  -4.888 1.00 . A A . 27 GLU CB   1 1 
        5  6005 1 1 30 GLU CD   C   9.021 -13.894  -6.774 1.00 . A A . 27 GLU CD   1 1 
        5  6006 1 1 30 GLU CG   C   9.116 -12.534  -6.105 1.00 . A A . 27 GLU CG   1 1 
        5  6007 1 1 30 GLU H    H  11.939 -12.168  -3.150 1.00 . A A . 27 GLU H    1 1 
        5  6008 1 1 30 GLU HA   H  10.927 -10.581  -5.224 1.00 . A A . 27 GLU HA   1 1 
        5  6009 1 1 30 GLU HB2  H  10.939 -13.119  -5.163 1.00 . A A . 27 GLU HB2  1 1 
        5  6010 1 1 30 GLU HB3  H   9.571 -13.037  -4.076 1.00 . A A . 27 GLU HB3  1 1 
        5  6011 1 1 30 GLU HG2  H   8.122 -12.255  -5.781 1.00 . A A . 27 GLU HG2  1 1 
        5  6012 1 1 30 GLU HG3  H   9.463 -11.823  -6.841 1.00 . A A . 27 GLU HG3  1 1 
        5  6013 1 1 30 GLU N    N  11.727 -11.267  -3.512 1.00 . A A . 27 GLU N    1 1 
        5  6014 1 1 30 GLU O    O   8.797  -9.564  -4.501 1.00 . A A . 27 GLU O    1 1 
        5  6015 1 1 30 GLU OE1  O   9.843 -14.168  -7.669 1.00 . A A . 27 GLU OE1  1 1 
        5  6016 1 1 30 GLU OE2  O   8.108 -14.679  -6.432 1.00 . A A . 27 GLU OE2  1 1 
        5  6017 1 1 31 PHE C    C   8.719  -7.881  -1.728 1.00 . A A . 28 PHE C    1 1 
        5  6018 1 1 31 PHE CA   C   8.207  -9.321  -1.883 1.00 . A A . 28 PHE CA   1 1 
        5  6019 1 1 31 PHE CB   C   7.539  -9.794  -0.592 1.00 . A A . 28 PHE CB   1 1 
        5  6020 1 1 31 PHE CD1  C   5.018  -9.860  -0.721 1.00 . A A . 28 PHE CD1  1 1 
        5  6021 1 1 31 PHE CD2  C   6.191 -11.943  -0.830 1.00 . A A . 28 PHE CD2  1 1 
        5  6022 1 1 31 PHE CE1  C   3.805 -10.524  -0.790 1.00 . A A . 28 PHE CE1  1 1 
        5  6023 1 1 31 PHE CE2  C   4.971 -12.604  -0.918 1.00 . A A . 28 PHE CE2  1 1 
        5  6024 1 1 31 PHE CG   C   6.226 -10.550  -0.741 1.00 . A A . 28 PHE CG   1 1 
        5  6025 1 1 31 PHE CZ   C   3.782 -11.893  -0.898 1.00 . A A . 28 PHE CZ   1 1 
        5  6026 1 1 31 PHE H    H   9.776 -10.773  -1.737 1.00 . A A . 28 PHE H    1 1 
        5  6027 1 1 31 PHE HA   H   7.471  -9.292  -2.651 1.00 . A A . 28 PHE HA   1 1 
        5  6028 1 1 31 PHE HB2  H   8.230 -10.442  -0.075 1.00 . A A . 28 PHE HB2  1 1 
        5  6029 1 1 31 PHE HB3  H   7.355  -8.922   0.029 1.00 . A A . 28 PHE HB3  1 1 
        5  6030 1 1 31 PHE HD1  H   5.033  -8.780  -0.666 1.00 . A A . 28 PHE HD1  1 1 
        5  6031 1 1 31 PHE HD2  H   7.119 -12.512  -0.820 1.00 . A A . 28 PHE HD2  1 1 
        5  6032 1 1 31 PHE HE1  H   2.873  -9.960  -0.758 1.00 . A A . 28 PHE HE1  1 1 
        5  6033 1 1 31 PHE HE2  H   4.940 -13.676  -1.024 1.00 . A A . 28 PHE HE2  1 1 
        5  6034 1 1 31 PHE HZ   H   2.843 -12.418  -0.949 1.00 . A A . 28 PHE HZ   1 1 
        5  6035 1 1 31 PHE N    N   9.238 -10.233  -2.387 1.00 . A A . 28 PHE N    1 1 
        5  6036 1 1 31 PHE O    O   7.902  -6.970  -1.801 1.00 . A A . 28 PHE O    1 1 
        5  6037 1 1 32 ARG C    C  10.418  -5.769  -3.177 1.00 . A A . 29 ARG C    1 1 
        5  6038 1 1 32 ARG CA   C  10.630  -6.296  -1.727 1.00 . A A . 29 ARG CA   1 1 
        5  6039 1 1 32 ARG CB   C  12.133  -6.105  -1.326 1.00 . A A . 29 ARG CB   1 1 
        5  6040 1 1 32 ARG CD   C  14.566  -5.945  -2.071 1.00 . A A . 29 ARG CD   1 1 
        5  6041 1 1 32 ARG CG   C  13.135  -6.172  -2.493 1.00 . A A . 29 ARG CG   1 1 
        5  6042 1 1 32 ARG CZ   C  16.486  -4.978  -3.274 1.00 . A A . 29 ARG CZ   1 1 
        5  6043 1 1 32 ARG H    H  10.559  -8.302  -0.902 1.00 . A A . 29 ARG H    1 1 
        5  6044 1 1 32 ARG HA   H  10.063  -5.633  -1.095 1.00 . A A . 29 ARG HA   1 1 
        5  6045 1 1 32 ARG HB2  H  12.234  -5.133  -0.868 1.00 . A A . 29 ARG HB2  1 1 
        5  6046 1 1 32 ARG HB3  H  12.407  -6.856  -0.585 1.00 . A A . 29 ARG HB3  1 1 
        5  6047 1 1 32 ARG HD2  H  14.615  -5.064  -1.453 1.00 . A A . 29 ARG HD2  1 1 
        5  6048 1 1 32 ARG HD3  H  14.919  -6.807  -1.528 1.00 . A A . 29 ARG HD3  1 1 
        5  6049 1 1 32 ARG HE   H  15.150  -6.236  -4.069 1.00 . A A . 29 ARG HE   1 1 
        5  6050 1 1 32 ARG HG2  H  13.074  -7.130  -2.969 1.00 . A A . 29 ARG HG2  1 1 
        5  6051 1 1 32 ARG HG3  H  12.867  -5.411  -3.211 1.00 . A A . 29 ARG HG3  1 1 
        5  6052 1 1 32 ARG HH11 H  16.325  -4.413  -1.328 1.00 . A A . 29 ARG HH11 1 1 
        5  6053 1 1 32 ARG HH12 H  17.671  -3.732  -2.184 1.00 . A A . 29 ARG HH12 1 1 
        5  6054 1 1 32 ARG HH21 H  16.879  -5.338  -5.226 1.00 . A A . 29 ARG HH21 1 1 
        5  6055 1 1 32 ARG HH22 H  17.983  -4.269  -4.425 1.00 . A A . 29 ARG HH22 1 1 
        5  6056 1 1 32 ARG N    N  10.052  -7.649  -1.460 1.00 . A A . 29 ARG N    1 1 
        5  6057 1 1 32 ARG NE   N  15.412  -5.758  -3.248 1.00 . A A . 29 ARG NE   1 1 
        5  6058 1 1 32 ARG NH1  N  16.855  -4.318  -2.176 1.00 . A A . 29 ARG NH1  1 1 
        5  6059 1 1 32 ARG NH2  N  17.172  -4.849  -4.398 1.00 . A A . 29 ARG NH2  1 1 
        5  6060 1 1 32 ARG O    O  10.340  -4.538  -3.297 1.00 . A A . 29 ARG O    1 1 
        5  6061 1 1 33 LYS C    C   8.494  -5.387  -5.425 1.00 . A A . 30 LYS C    1 1 
        5  6062 1 1 33 LYS CA   C   9.875  -6.022  -5.589 1.00 . A A . 30 LYS CA   1 1 
        5  6063 1 1 33 LYS CB   C   9.930  -7.050  -6.816 1.00 . A A . 30 LYS CB   1 1 
        5  6064 1 1 33 LYS CD   C   8.139  -6.009  -8.471 1.00 . A A . 30 LYS CD   1 1 
        5  6065 1 1 33 LYS CE   C   6.608  -6.021  -8.643 1.00 . A A . 30 LYS CE   1 1 
        5  6066 1 1 33 LYS CG   C   8.658  -7.268  -7.733 1.00 . A A . 30 LYS CG   1 1 
        5  6067 1 1 33 LYS H    H  10.790  -7.535  -4.261 1.00 . A A . 30 LYS H    1 1 
        5  6068 1 1 33 LYS HA   H  10.546  -5.207  -5.807 1.00 . A A . 30 LYS HA   1 1 
        5  6069 1 1 33 LYS HB2  H  10.716  -6.726  -7.482 1.00 . A A . 30 LYS HB2  1 1 
        5  6070 1 1 33 LYS HB3  H  10.201  -8.015  -6.421 1.00 . A A . 30 LYS HB3  1 1 
        5  6071 1 1 33 LYS HD2  H   8.411  -5.133  -7.898 1.00 . A A . 30 LYS HD2  1 1 
        5  6072 1 1 33 LYS HD3  H   8.594  -5.949  -9.441 1.00 . A A . 30 LYS HD3  1 1 
        5  6073 1 1 33 LYS HE2  H   6.126  -6.214  -7.680 1.00 . A A . 30 LYS HE2  1 1 
        5  6074 1 1 33 LYS HE3  H   6.284  -5.046  -8.996 1.00 . A A . 30 LYS HE3  1 1 
        5  6075 1 1 33 LYS HG2  H   8.931  -7.979  -8.490 1.00 . A A . 30 LYS HG2  1 1 
        5  6076 1 1 33 LYS HG3  H   7.846  -7.690  -7.151 1.00 . A A . 30 LYS HG3  1 1 
        5  6077 1 1 33 LYS HZ1  H   6.566  -6.902 -10.534 1.00 . A A . 30 LYS HZ1  1 1 
        5  6078 1 1 33 LYS HZ2  H   5.119  -7.007  -9.685 1.00 . A A . 30 LYS HZ2  1 1 
        5  6079 1 1 33 LYS HZ3  H   6.422  -8.009  -9.257 1.00 . A A . 30 LYS HZ3  1 1 
        5  6080 1 1 33 LYS N    N  10.376  -6.619  -4.286 1.00 . A A . 30 LYS N    1 1 
        5  6081 1 1 33 LYS NZ   N   6.151  -7.056  -9.601 1.00 . A A . 30 LYS NZ   1 1 
        5  6082 1 1 33 LYS O    O   8.314  -4.212  -5.764 1.00 . A A . 30 LYS O    1 1 
        5  6083 1 1 34 TYR C    C   5.920  -4.496  -3.857 1.00 . A A . 31 TYR C    1 1 
        5  6084 1 1 34 TYR CA   C   6.173  -5.680  -4.820 1.00 . A A . 31 TYR CA   1 1 
        5  6085 1 1 34 TYR CB   C   5.216  -6.866  -4.533 1.00 . A A . 31 TYR CB   1 1 
        5  6086 1 1 34 TYR CD1  C   4.360  -7.945  -6.732 1.00 . A A . 31 TYR CD1  1 1 
        5  6087 1 1 34 TYR CD2  C   5.923  -9.180  -5.428 1.00 . A A . 31 TYR CD2  1 1 
        5  6088 1 1 34 TYR CE1  C   4.334  -8.991  -7.662 1.00 . A A . 31 TYR CE1  1 1 
        5  6089 1 1 34 TYR CE2  C   5.882 -10.211  -6.352 1.00 . A A . 31 TYR CE2  1 1 
        5  6090 1 1 34 TYR CG   C   5.175  -8.010  -5.587 1.00 . A A . 31 TYR CG   1 1 
        5  6091 1 1 34 TYR CZ   C   5.099 -10.104  -7.453 1.00 . A A . 31 TYR CZ   1 1 
        5  6092 1 1 34 TYR H    H   7.837  -6.913  -4.350 1.00 . A A . 31 TYR H    1 1 
        5  6093 1 1 34 TYR HA   H   5.979  -5.306  -5.821 1.00 . A A . 31 TYR HA   1 1 
        5  6094 1 1 34 TYR HB2  H   5.520  -7.301  -3.593 1.00 . A A . 31 TYR HB2  1 1 
        5  6095 1 1 34 TYR HB3  H   4.214  -6.480  -4.426 1.00 . A A . 31 TYR HB3  1 1 
        5  6096 1 1 34 TYR HD1  H   3.757  -7.069  -6.904 1.00 . A A . 31 TYR HD1  1 1 
        5  6097 1 1 34 TYR HD2  H   6.535  -9.298  -4.568 1.00 . A A . 31 TYR HD2  1 1 
        5  6098 1 1 34 TYR HE1  H   3.685  -8.947  -8.542 1.00 . A A . 31 TYR HE1  1 1 
        5  6099 1 1 34 TYR HE2  H   6.471 -11.104  -6.194 1.00 . A A . 31 TYR HE2  1 1 
        5  6100 1 1 34 TYR HH   H   4.737 -11.907  -7.988 1.00 . A A . 31 TYR HH   1 1 
        5  6101 1 1 34 TYR N    N   7.570  -6.100  -4.807 1.00 . A A . 31 TYR N    1 1 
        5  6102 1 1 34 TYR O    O   5.200  -3.592  -4.224 1.00 . A A . 31 TYR O    1 1 
        5  6103 1 1 34 TYR OH   O   5.107 -11.092  -8.379 1.00 . A A . 31 TYR OH   1 1 
        5  6104 1 1 35 GLY C    C   7.811  -3.140  -1.034 1.00 . A A . 32 GLY C    1 1 
        5  6105 1 1 35 GLY CA   C   6.546  -3.255  -1.846 1.00 . A A . 32 GLY CA   1 1 
        5  6106 1 1 35 GLY H    H   7.020  -5.257  -2.331 1.00 . A A . 32 GLY H    1 1 
        5  6107 1 1 35 GLY HA2  H   6.470  -2.403  -2.493 1.00 . A A . 32 GLY HA2  1 1 
        5  6108 1 1 35 GLY HA3  H   5.698  -3.284  -1.176 1.00 . A A . 32 GLY HA3  1 1 
        5  6109 1 1 35 GLY N    N   6.556  -4.460  -2.668 1.00 . A A . 32 GLY N    1 1 
        5  6110 1 1 35 GLY O    O   8.424  -4.166  -0.737 1.00 . A A . 32 GLY O    1 1 
        5  6111 1 1 36 ASN C    C   9.361  -2.142   1.520 1.00 . A A . 33 ASN C    1 1 
        5  6112 1 1 36 ASN CA   C   9.476  -1.718   0.057 1.00 . A A . 33 ASN CA   1 1 
        5  6113 1 1 36 ASN CB   C   9.958  -0.265  -0.018 1.00 . A A . 33 ASN CB   1 1 
        5  6114 1 1 36 ASN CG   C  11.062  -0.059  -1.029 1.00 . A A . 33 ASN CG   1 1 
        5  6115 1 1 36 ASN H    H   7.617  -1.141  -0.786 1.00 . A A . 33 ASN H    1 1 
        5  6116 1 1 36 ASN HA   H  10.207  -2.336  -0.447 1.00 . A A . 33 ASN HA   1 1 
        5  6117 1 1 36 ASN HB2  H   9.131   0.380  -0.275 1.00 . A A . 33 ASN HB2  1 1 
        5  6118 1 1 36 ASN HB3  H  10.334   0.027   0.951 1.00 . A A . 33 ASN HB3  1 1 
        5  6119 1 1 36 ASN HD21 H  10.566   1.859  -1.195 1.00 . A A . 33 ASN HD21 1 1 
        5  6120 1 1 36 ASN HD22 H  11.886   1.320  -2.186 1.00 . A A . 33 ASN HD22 1 1 
        5  6121 1 1 36 ASN N    N   8.202  -1.915  -0.642 1.00 . A A . 33 ASN N    1 1 
        5  6122 1 1 36 ASN ND2  N  11.186   1.158  -1.525 1.00 . A A . 33 ASN ND2  1 1 
        5  6123 1 1 36 ASN O    O   8.748  -1.446   2.307 1.00 . A A . 33 ASN O    1 1 
        5  6124 1 1 36 ASN OD1  O  11.813  -0.984  -1.353 1.00 . A A . 33 ASN OD1  1 1 
        5  6125 1 1 37 ILE C    C  10.690  -3.110   4.285 1.00 . A A . 34 ILE C    1 1 
        5  6126 1 1 37 ILE CA   C   9.829  -3.849   3.236 1.00 . A A . 34 ILE CA   1 1 
        5  6127 1 1 37 ILE CB   C  10.027  -5.433   3.298 1.00 . A A . 34 ILE CB   1 1 
        5  6128 1 1 37 ILE CD1  C  12.198  -6.103   4.650 1.00 . A A . 34 ILE CD1  1 1 
        5  6129 1 1 37 ILE CG1  C  10.680  -5.943   4.626 1.00 . A A . 34 ILE CG1  1 1 
        5  6130 1 1 37 ILE CG2  C  10.743  -5.975   2.061 1.00 . A A . 34 ILE CG2  1 1 
        5  6131 1 1 37 ILE H    H  10.368  -3.825   1.155 1.00 . A A . 34 ILE H    1 1 
        5  6132 1 1 37 ILE HA   H   8.815  -3.665   3.514 1.00 . A A . 34 ILE HA   1 1 
        5  6133 1 1 37 ILE HB   H   9.026  -5.855   3.265 1.00 . A A . 34 ILE HB   1 1 
        5  6134 1 1 37 ILE HD11 H  12.530  -6.572   3.744 1.00 . A A . 34 ILE HD11 1 1 
        5  6135 1 1 37 ILE HD12 H  12.476  -6.723   5.482 1.00 . A A . 34 ILE HD12 1 1 
        5  6136 1 1 37 ILE HD13 H  12.663  -5.135   4.750 1.00 . A A . 34 ILE HD13 1 1 
        5  6137 1 1 37 ILE HG12 H  10.430  -5.249   5.412 1.00 . A A . 34 ILE HG12 1 1 
        5  6138 1 1 37 ILE HG13 H  10.249  -6.904   4.872 1.00 . A A . 34 ILE HG13 1 1 
        5  6139 1 1 37 ILE HG21 H  10.952  -7.029   2.189 1.00 . A A . 34 ILE HG21 1 1 
        5  6140 1 1 37 ILE HG22 H  11.666  -5.437   1.915 1.00 . A A . 34 ILE HG22 1 1 
        5  6141 1 1 37 ILE HG23 H  10.108  -5.841   1.204 1.00 . A A . 34 ILE HG23 1 1 
        5  6142 1 1 37 ILE N    N   9.934  -3.297   1.861 1.00 . A A . 34 ILE N    1 1 
        5  6143 1 1 37 ILE O    O  11.860  -2.791   4.054 1.00 . A A . 34 ILE O    1 1 
        5  6144 1 1 38 LEU C    C  10.855  -3.214   7.737 1.00 . A A . 35 LEU C    1 1 
        5  6145 1 1 38 LEU CA   C  10.720  -2.198   6.580 1.00 . A A . 35 LEU CA   1 1 
        5  6146 1 1 38 LEU CB   C  10.058  -0.859   7.025 1.00 . A A . 35 LEU CB   1 1 
        5  6147 1 1 38 LEU CD1  C  10.152   0.391   4.768 1.00 . A A . 35 LEU CD1  1 1 
        5  6148 1 1 38 LEU CD2  C   9.939   1.660   6.878 1.00 . A A . 35 LEU CD2  1 1 
        5  6149 1 1 38 LEU CG   C  10.516   0.410   6.249 1.00 . A A . 35 LEU CG   1 1 
        5  6150 1 1 38 LEU H    H   9.109  -3.048   5.535 1.00 . A A . 35 LEU H    1 1 
        5  6151 1 1 38 LEU HA   H  11.719  -1.964   6.246 1.00 . A A . 35 LEU HA   1 1 
        5  6152 1 1 38 LEU HB2  H   8.982  -0.936   6.937 1.00 . A A . 35 LEU HB2  1 1 
        5  6153 1 1 38 LEU HB3  H  10.295  -0.704   8.069 1.00 . A A . 35 LEU HB3  1 1 
        5  6154 1 1 38 LEU HD11 H   9.085   0.263   4.657 1.00 . A A . 35 LEU HD11 1 1 
        5  6155 1 1 38 LEU HD12 H  10.663  -0.430   4.281 1.00 . A A . 35 LEU HD12 1 1 
        5  6156 1 1 38 LEU HD13 H  10.451   1.319   4.311 1.00 . A A . 35 LEU HD13 1 1 
        5  6157 1 1 38 LEU HD21 H  10.267   1.732   7.903 1.00 . A A . 35 LEU HD21 1 1 
        5  6158 1 1 38 LEU HD22 H   8.863   1.617   6.840 1.00 . A A . 35 LEU HD22 1 1 
        5  6159 1 1 38 LEU HD23 H  10.284   2.522   6.326 1.00 . A A . 35 LEU HD23 1 1 
        5  6160 1 1 38 LEU HG   H  11.592   0.485   6.315 1.00 . A A . 35 LEU HG   1 1 
        5  6161 1 1 38 LEU N    N  10.046  -2.801   5.435 1.00 . A A . 35 LEU N    1 1 
        5  6162 1 1 38 LEU O    O  11.744  -3.092   8.580 1.00 . A A . 35 LEU O    1 1 
        5  6163 1 1 39 LYS C    C   9.301  -6.566   8.270 1.00 . A A . 36 LYS C    1 1 
        5  6164 1 1 39 LYS CA   C   9.829  -5.214   8.854 1.00 . A A . 36 LYS CA   1 1 
        5  6165 1 1 39 LYS CB   C   8.842  -4.629   9.899 1.00 . A A . 36 LYS CB   1 1 
        5  6166 1 1 39 LYS CD   C   8.309  -6.493  11.574 1.00 . A A . 36 LYS CD   1 1 
        5  6167 1 1 39 LYS CE   C   8.239  -6.878  13.049 1.00 . A A . 36 LYS CE   1 1 
        5  6168 1 1 39 LYS CG   C   8.976  -5.133  11.348 1.00 . A A . 36 LYS CG   1 1 
        5  6169 1 1 39 LYS H    H   9.419  -4.374   6.935 1.00 . A A . 36 LYS H    1 1 
        5  6170 1 1 39 LYS HA   H  10.794  -5.347   9.323 1.00 . A A . 36 LYS HA   1 1 
        5  6171 1 1 39 LYS HB2  H   8.969  -3.560   9.918 1.00 . A A . 36 LYS HB2  1 1 
        5  6172 1 1 39 LYS HB3  H   7.837  -4.847   9.572 1.00 . A A . 36 LYS HB3  1 1 
        5  6173 1 1 39 LYS HD2  H   7.304  -6.460  11.179 1.00 . A A . 36 LYS HD2  1 1 
        5  6174 1 1 39 LYS HD3  H   8.879  -7.241  11.047 1.00 . A A . 36 LYS HD3  1 1 
        5  6175 1 1 39 LYS HE2  H   7.793  -6.064  13.602 1.00 . A A . 36 LYS HE2  1 1 
        5  6176 1 1 39 LYS HE3  H   7.621  -7.758  13.155 1.00 . A A . 36 LYS HE3  1 1 
        5  6177 1 1 39 LYS HG2  H  10.021  -5.216  11.594 1.00 . A A . 36 LYS HG2  1 1 
        5  6178 1 1 39 LYS HG3  H   8.514  -4.410  12.007 1.00 . A A . 36 LYS HG3  1 1 
        5  6179 1 1 39 LYS HZ1  H  10.212  -6.347  13.478 1.00 . A A . 36 LYS HZ1  1 1 
        5  6180 1 1 39 LYS HZ2  H   9.996  -7.997  13.158 1.00 . A A . 36 LYS HZ2  1 1 
        5  6181 1 1 39 LYS HZ3  H   9.502  -7.353  14.640 1.00 . A A . 36 LYS HZ3  1 1 
        5  6182 1 1 39 LYS N    N   9.968  -4.238   7.739 1.00 . A A . 36 LYS N    1 1 
        5  6183 1 1 39 LYS NZ   N   9.582  -7.163  13.620 1.00 . A A . 36 LYS NZ   1 1 
        5  6184 1 1 39 LYS O    O   8.331  -6.555   7.505 1.00 . A A . 36 LYS O    1 1 
        5  6185 1 1 40 CYS C    C   9.602  -9.979   9.363 1.00 . A A . 37 CYS C    1 1 
        5  6186 1 1 40 CYS CA   C   9.443  -9.059   8.192 1.00 . A A . 37 CYS CA   1 1 
        5  6187 1 1 40 CYS CB   C  10.247  -9.645   7.007 1.00 . A A . 37 CYS CB   1 1 
        5  6188 1 1 40 CYS H    H  10.713  -7.694   9.212 1.00 . A A . 37 CYS H    1 1 
        5  6189 1 1 40 CYS HA   H   8.390  -8.994   7.930 1.00 . A A . 37 CYS HA   1 1 
        5  6190 1 1 40 CYS HB2  H  11.279  -9.430   7.167 1.00 . A A . 37 CYS HB2  1 1 
        5  6191 1 1 40 CYS HB3  H  10.144 -10.710   6.973 1.00 . A A . 37 CYS HB3  1 1 
        5  6192 1 1 40 CYS HG   H   9.806 -10.034   4.517 1.00 . A A . 37 CYS HG   1 1 
        5  6193 1 1 40 CYS N    N   9.925  -7.721   8.615 1.00 . A A . 37 CYS N    1 1 
        5  6194 1 1 40 CYS O    O  10.734 -10.257   9.771 1.00 . A A . 37 CYS O    1 1 
        5  6195 1 1 40 CYS SG   S   9.776  -9.027   5.382 1.00 . A A . 37 CYS SG   1 1 
        5  6196 1 1 41 ASP C    C   7.886 -12.655  10.776 1.00 . A A . 38 ASP C    1 1 
        5  6197 1 1 41 ASP CA   C   8.662 -11.364  11.067 1.00 . A A . 38 ASP CA   1 1 
        5  6198 1 1 41 ASP CB   C   8.222 -10.716  12.379 1.00 . A A . 38 ASP CB   1 1 
        5  6199 1 1 41 ASP CG   C   8.979 -11.233  13.581 1.00 . A A . 38 ASP CG   1 1 
        5  6200 1 1 41 ASP H    H   7.606 -10.032   9.685 1.00 . A A . 38 ASP H    1 1 
        5  6201 1 1 41 ASP HA   H   9.728 -11.603  11.156 1.00 . A A . 38 ASP HA   1 1 
        5  6202 1 1 41 ASP HB2  H   8.420  -9.653  12.315 1.00 . A A . 38 ASP HB2  1 1 
        5  6203 1 1 41 ASP HB3  H   7.166 -10.899  12.536 1.00 . A A . 38 ASP HB3  1 1 
        5  6204 1 1 41 ASP N    N   8.508 -10.403   9.957 1.00 . A A . 38 ASP N    1 1 
        5  6205 1 1 41 ASP O    O   6.713 -12.605  10.444 1.00 . A A . 38 ASP O    1 1 
        5  6206 1 1 41 ASP OD1  O   8.769 -12.392  13.976 1.00 . A A . 38 ASP OD1  1 1 
        5  6207 1 1 41 ASP OD2  O   9.777 -10.448  14.142 1.00 . A A . 38 ASP OD2  1 1 
        5  6208 1 1 42 VAL C    C   7.888 -15.988  11.828 1.00 . A A . 39 VAL C    1 1 
        5  6209 1 1 42 VAL CA   C   7.906 -15.100  10.573 1.00 . A A . 39 VAL CA   1 1 
        5  6210 1 1 42 VAL CB   C   8.523 -15.817   9.246 1.00 . A A . 39 VAL CB   1 1 
        5  6211 1 1 42 VAL CG1  C  10.022 -15.602   9.105 1.00 . A A . 39 VAL CG1  1 1 
        5  6212 1 1 42 VAL CG2  C   8.321 -17.356   9.120 1.00 . A A . 39 VAL CG2  1 1 
        5  6213 1 1 42 VAL H    H   9.461 -13.805  11.203 1.00 . A A . 39 VAL H    1 1 
        5  6214 1 1 42 VAL HA   H   6.876 -14.823  10.384 1.00 . A A . 39 VAL HA   1 1 
        5  6215 1 1 42 VAL HB   H   8.064 -15.353   8.376 1.00 . A A . 39 VAL HB   1 1 
        5  6216 1 1 42 VAL HG11 H  10.516 -15.841  10.036 1.00 . A A . 39 VAL HG11 1 1 
        5  6217 1 1 42 VAL HG12 H  10.229 -14.583   8.820 1.00 . A A . 39 VAL HG12 1 1 
        5  6218 1 1 42 VAL HG13 H  10.387 -16.268   8.334 1.00 . A A . 39 VAL HG13 1 1 
        5  6219 1 1 42 VAL HG21 H   7.304 -17.649   9.304 1.00 . A A . 39 VAL HG21 1 1 
        5  6220 1 1 42 VAL HG22 H   8.978 -17.867   9.808 1.00 . A A . 39 VAL HG22 1 1 
        5  6221 1 1 42 VAL HG23 H   8.595 -17.656   8.113 1.00 . A A . 39 VAL HG23 1 1 
        5  6222 1 1 42 VAL N    N   8.553 -13.813  10.875 1.00 . A A . 39 VAL N    1 1 
        5  6223 1 1 42 VAL O    O   8.929 -16.404  12.347 1.00 . A A . 39 VAL O    1 1 
        5  6224 1 1 43 LYS C    C   5.588 -18.161  13.420 1.00 . A A . 40 LYS C    1 1 
        5  6225 1 1 43 LYS CA   C   6.424 -16.868  13.622 1.00 . A A . 40 LYS CA   1 1 
        5  6226 1 1 43 LYS CB   C   5.705 -15.822  14.490 1.00 . A A . 40 LYS CB   1 1 
        5  6227 1 1 43 LYS CD   C   6.260 -14.049  16.198 1.00 . A A . 40 LYS CD   1 1 
        5  6228 1 1 43 LYS CE   C   5.507 -12.738  16.055 1.00 . A A . 40 LYS CE   1 1 
        5  6229 1 1 43 LYS CG   C   6.632 -14.673  14.860 1.00 . A A . 40 LYS CG   1 1 
        5  6230 1 1 43 LYS H    H   5.869 -15.912  11.815 1.00 . A A . 40 LYS H    1 1 
        5  6231 1 1 43 LYS HA   H   7.380 -17.103  14.073 1.00 . A A . 40 LYS HA   1 1 
        5  6232 1 1 43 LYS HB2  H   4.873 -15.403  13.921 1.00 . A A . 40 LYS HB2  1 1 
        5  6233 1 1 43 LYS HB3  H   5.337 -16.273  15.395 1.00 . A A . 40 LYS HB3  1 1 
        5  6234 1 1 43 LYS HD2  H   5.624 -14.738  16.731 1.00 . A A . 40 LYS HD2  1 1 
        5  6235 1 1 43 LYS HD3  H   7.161 -13.871  16.771 1.00 . A A . 40 LYS HD3  1 1 
        5  6236 1 1 43 LYS HE2  H   6.123 -12.031  15.514 1.00 . A A . 40 LYS HE2  1 1 
        5  6237 1 1 43 LYS HE3  H   4.593 -12.916  15.513 1.00 . A A . 40 LYS HE3  1 1 
        5  6238 1 1 43 LYS HG2  H   7.648 -15.049  14.895 1.00 . A A . 40 LYS HG2  1 1 
        5  6239 1 1 43 LYS HG3  H   6.569 -13.918  14.087 1.00 . A A . 40 LYS HG3  1 1 
        5  6240 1 1 43 LYS HZ1  H   4.580 -12.832  17.925 1.00 . A A . 40 LYS HZ1  1 1 
        5  6241 1 1 43 LYS HZ2  H   4.679 -11.270  17.288 1.00 . A A . 40 LYS HZ2  1 1 
        5  6242 1 1 43 LYS HZ3  H   6.054 -12.006  17.931 1.00 . A A . 40 LYS HZ3  1 1 
        5  6243 1 1 43 LYS N    N   6.662 -16.218  12.329 1.00 . A A . 40 LYS N    1 1 
        5  6244 1 1 43 LYS NZ   N   5.181 -12.173  17.392 1.00 . A A . 40 LYS NZ   1 1 
        5  6245 1 1 43 LYS O    O   4.753 -18.187  12.512 1.00 . A A . 40 LYS O    1 1 
        5  6246 1 1 44 LYS C    C   4.259 -20.955  15.153 1.00 . A A . 41 LYS C    1 1 
        5  6247 1 1 44 LYS CA   C   5.074 -20.507  13.903 1.00 . A A . 41 LYS CA   1 1 
        5  6248 1 1 44 LYS CB   C   6.070 -21.634  13.322 1.00 . A A . 41 LYS CB   1 1 
        5  6249 1 1 44 LYS CD   C   7.491 -21.926  15.449 1.00 . A A . 41 LYS CD   1 1 
        5  6250 1 1 44 LYS CE   C   8.631 -21.043  14.957 1.00 . A A . 41 LYS CE   1 1 
        5  6251 1 1 44 LYS CG   C   6.723 -22.618  14.323 1.00 . A A . 41 LYS CG   1 1 
        5  6252 1 1 44 LYS H    H   6.294 -19.186  15.091 1.00 . A A . 41 LYS H    1 1 
        5  6253 1 1 44 LYS HA   H   4.381 -20.226  13.136 1.00 . A A . 41 LYS HA   1 1 
        5  6254 1 1 44 LYS HB2  H   5.534 -22.234  12.604 1.00 . A A . 41 LYS HB2  1 1 
        5  6255 1 1 44 LYS HB3  H   6.891 -21.161  12.774 1.00 . A A . 41 LYS HB3  1 1 
        5  6256 1 1 44 LYS HD2  H   6.785 -21.298  15.982 1.00 . A A . 41 LYS HD2  1 1 
        5  6257 1 1 44 LYS HD3  H   7.883 -22.676  16.115 1.00 . A A . 41 LYS HD3  1 1 
        5  6258 1 1 44 LYS HE2  H   9.109 -21.518  14.117 1.00 . A A . 41 LYS HE2  1 1 
        5  6259 1 1 44 LYS HE3  H   8.208 -20.088  14.647 1.00 . A A . 41 LYS HE3  1 1 
        5  6260 1 1 44 LYS HG2  H   5.954 -23.244  14.760 1.00 . A A . 41 LYS HG2  1 1 
        5  6261 1 1 44 LYS HG3  H   7.411 -23.253  13.775 1.00 . A A . 41 LYS HG3  1 1 
        5  6262 1 1 44 LYS HZ1  H  10.412 -20.199  15.647 1.00 . A A . 41 LYS HZ1  1 1 
        5  6263 1 1 44 LYS HZ2  H  10.047 -21.693  16.350 1.00 . A A . 41 LYS HZ2  1 1 
        5  6264 1 1 44 LYS HZ3  H   9.206 -20.305  16.828 1.00 . A A . 41 LYS HZ3  1 1 
        5  6265 1 1 44 LYS N    N   5.777 -19.248  14.229 1.00 . A A . 41 LYS N    1 1 
        5  6266 1 1 44 LYS NZ   N   9.642 -20.792  16.020 1.00 . A A . 41 LYS NZ   1 1 
        5  6267 1 1 44 LYS O    O   4.685 -20.647  16.271 1.00 . A A . 41 LYS O    1 1 
        5  6268 1 1 45 THR C    C   2.631 -23.607  16.392 1.00 . A A . 42 THR C    1 1 
        5  6269 1 1 45 THR CA   C   2.397 -22.085  16.214 1.00 . A A . 42 THR CA   1 1 
        5  6270 1 1 45 THR CB   C   0.863 -21.729  16.231 1.00 . A A . 42 THR CB   1 1 
        5  6271 1 1 45 THR CG2  C   0.008 -22.616  15.308 1.00 . A A . 42 THR CG2  1 1 
        5  6272 1 1 45 THR H    H   2.625 -21.680  14.158 1.00 . A A . 42 THR H    1 1 
        5  6273 1 1 45 THR HA   H   2.870 -21.571  17.046 1.00 . A A . 42 THR HA   1 1 
        5  6274 1 1 45 THR HB   H   0.756 -20.712  15.915 1.00 . A A . 42 THR HB   1 1 
        5  6275 1 1 45 THR HG1  H   0.073 -20.950  17.872 1.00 . A A . 42 THR HG1  1 1 
        5  6276 1 1 45 THR HG21 H   0.464 -23.587  15.229 1.00 . A A . 42 THR HG21 1 1 
        5  6277 1 1 45 THR HG22 H  -0.077 -22.177  14.330 1.00 . A A . 42 THR HG22 1 1 
        5  6278 1 1 45 THR HG23 H  -0.981 -22.722  15.733 1.00 . A A . 42 THR HG23 1 1 
        5  6279 1 1 45 THR N    N   3.070 -21.586  15.023 1.00 . A A . 42 THR N    1 1 
        5  6280 1 1 45 THR O    O   3.114 -24.278  15.468 1.00 . A A . 42 THR O    1 1 
        5  6281 1 1 45 THR OG1  O   0.348 -21.826  17.563 1.00 . A A . 42 THR OG1  1 1 
        5  6282 1 1 46 VAL C    C   1.490 -26.553  17.154 1.00 . A A . 43 VAL C    1 1 
        5  6283 1 1 46 VAL CA   C   2.423 -25.568  17.936 1.00 . A A . 43 VAL CA   1 1 
        5  6284 1 1 46 VAL CB   C   2.312 -25.804  19.480 1.00 . A A . 43 VAL CB   1 1 
        5  6285 1 1 46 VAL CG1  C   3.456 -25.099  20.191 1.00 . A A . 43 VAL CG1  1 1 
        5  6286 1 1 46 VAL CG2  C   0.974 -25.354  20.094 1.00 . A A . 43 VAL CG2  1 1 
        5  6287 1 1 46 VAL H    H   1.980 -23.518  18.307 1.00 . A A . 43 VAL H    1 1 
        5  6288 1 1 46 VAL HA   H   3.439 -25.829  17.665 1.00 . A A . 43 VAL HA   1 1 
        5  6289 1 1 46 VAL HB   H   2.421 -26.867  19.661 1.00 . A A . 43 VAL HB   1 1 
        5  6290 1 1 46 VAL HG11 H   3.459 -24.054  19.914 1.00 . A A . 43 VAL HG11 1 1 
        5  6291 1 1 46 VAL HG12 H   4.395 -25.550  19.901 1.00 . A A . 43 VAL HG12 1 1 
        5  6292 1 1 46 VAL HG13 H   3.326 -25.187  21.257 1.00 . A A . 43 VAL HG13 1 1 
        5  6293 1 1 46 VAL HG21 H   0.163 -25.919  19.663 1.00 . A A . 43 VAL HG21 1 1 
        5  6294 1 1 46 VAL HG22 H   0.818 -24.300  19.915 1.00 . A A . 43 VAL HG22 1 1 
        5  6295 1 1 46 VAL HG23 H   0.997 -25.528  21.162 1.00 . A A . 43 VAL HG23 1 1 
        5  6296 1 1 46 VAL N    N   2.290 -24.133  17.590 1.00 . A A . 43 VAL N    1 1 
        5  6297 1 1 46 VAL O    O   1.606 -27.766  17.338 1.00 . A A . 43 VAL O    1 1 
        5  6298 1 1 47 SER C    C   0.007 -27.284  14.232 1.00 . A A . 44 SER C    1 1 
        5  6299 1 1 47 SER CA   C  -0.449 -26.878  15.654 1.00 . A A . 44 SER CA   1 1 
        5  6300 1 1 47 SER CB   C  -1.792 -26.090  15.608 1.00 . A A . 44 SER CB   1 1 
        5  6301 1 1 47 SER H    H   0.681 -25.145  15.966 1.00 . A A . 44 SER H    1 1 
        5  6302 1 1 47 SER HA   H  -0.571 -27.777  16.252 1.00 . A A . 44 SER HA   1 1 
        5  6303 1 1 47 SER HB2  H  -1.999 -25.649  16.579 1.00 . A A . 44 SER HB2  1 1 
        5  6304 1 1 47 SER HB3  H  -1.717 -25.303  14.868 1.00 . A A . 44 SER HB3  1 1 
        5  6305 1 1 47 SER HG   H  -2.600 -27.590  14.632 1.00 . A A . 44 SER HG   1 1 
        5  6306 1 1 47 SER N    N   0.583 -26.054  16.285 1.00 . A A . 44 SER N    1 1 
        5  6307 1 1 47 SER O    O  -0.761 -27.881  13.466 1.00 . A A . 44 SER O    1 1 
        5  6308 1 1 47 SER OG   O  -2.890 -26.924  15.264 1.00 . A A . 44 SER OG   1 1 
        5  6309 1 1 48 GLY C    C   1.449 -26.105  11.516 1.00 . A A . 45 GLY C    1 1 
        5  6310 1 1 48 GLY CA   C   1.792 -27.194  12.549 1.00 . A A . 45 GLY CA   1 1 
        5  6311 1 1 48 GLY H    H   1.881 -26.627  14.604 1.00 . A A . 45 GLY H    1 1 
        5  6312 1 1 48 GLY HA2  H   2.868 -27.276  12.609 1.00 . A A . 45 GLY HA2  1 1 
        5  6313 1 1 48 GLY HA3  H   1.401 -28.136  12.194 1.00 . A A . 45 GLY HA3  1 1 
        5  6314 1 1 48 GLY N    N   1.269 -26.962  13.896 1.00 . A A . 45 GLY N    1 1 
        5  6315 1 1 48 GLY O    O   1.933 -26.162  10.387 1.00 . A A . 45 GLY O    1 1 
        5  6316 1 1 49 ALA C    C   1.396 -22.887  11.171 1.00 . A A . 46 ALA C    1 1 
        5  6317 1 1 49 ALA CA   C   0.318 -23.991  10.999 1.00 . A A . 46 ALA CA   1 1 
        5  6318 1 1 49 ALA CB   C  -1.114 -23.472  11.269 1.00 . A A . 46 ALA CB   1 1 
        5  6319 1 1 49 ALA H    H   0.201 -25.161  12.759 1.00 . A A . 46 ALA H    1 1 
        5  6320 1 1 49 ALA HA   H   0.347 -24.373   9.985 1.00 . A A . 46 ALA HA   1 1 
        5  6321 1 1 49 ALA HB1  H  -1.223 -23.173  12.300 1.00 . A A . 46 ALA HB1  1 1 
        5  6322 1 1 49 ALA HB2  H  -1.829 -24.255  11.053 1.00 . A A . 46 ALA HB2  1 1 
        5  6323 1 1 49 ALA HB3  H  -1.324 -22.629  10.636 1.00 . A A . 46 ALA HB3  1 1 
        5  6324 1 1 49 ALA N    N   0.621 -25.116  11.888 1.00 . A A . 46 ALA N    1 1 
        5  6325 1 1 49 ALA O    O   1.710 -22.501  12.301 1.00 . A A . 46 ALA O    1 1 
        5  6326 1 1 50 ALA C    C   2.572 -20.068   9.538 1.00 . A A . 47 ALA C    1 1 
        5  6327 1 1 50 ALA CA   C   3.065 -21.398  10.115 1.00 . A A . 47 ALA CA   1 1 
        5  6328 1 1 50 ALA CB   C   4.348 -21.906   9.402 1.00 . A A . 47 ALA CB   1 1 
        5  6329 1 1 50 ALA H    H   1.590 -22.628   9.179 1.00 . A A . 47 ALA H    1 1 
        5  6330 1 1 50 ALA HA   H   3.297 -21.253  11.141 1.00 . A A . 47 ALA HA   1 1 
        5  6331 1 1 50 ALA HB1  H   5.201 -21.327   9.726 1.00 . A A . 47 ALA HB1  1 1 
        5  6332 1 1 50 ALA HB2  H   4.253 -21.802   8.331 1.00 . A A . 47 ALA HB2  1 1 
        5  6333 1 1 50 ALA HB3  H   4.519 -22.949   9.649 1.00 . A A . 47 ALA HB3  1 1 
        5  6334 1 1 50 ALA N    N   1.961 -22.384  10.056 1.00 . A A . 47 ALA N    1 1 
        5  6335 1 1 50 ALA O    O   1.721 -20.090   8.640 1.00 . A A . 47 ALA O    1 1 
        5  6336 1 1 51 PHE C    C   3.647 -16.692   9.148 1.00 . A A . 48 PHE C    1 1 
        5  6337 1 1 51 PHE CA   C   2.518 -17.632   9.550 1.00 . A A . 48 PHE CA   1 1 
        5  6338 1 1 51 PHE CB   C   1.749 -16.934  10.695 1.00 . A A . 48 PHE CB   1 1 
        5  6339 1 1 51 PHE CD1  C  -0.366 -18.193  10.992 1.00 . A A . 48 PHE CD1  1 1 
        5  6340 1 1 51 PHE CD2  C   1.290 -18.343  12.696 1.00 . A A . 48 PHE CD2  1 1 
        5  6341 1 1 51 PHE CE1  C  -1.180 -19.031  11.705 1.00 . A A . 48 PHE CE1  1 1 
        5  6342 1 1 51 PHE CE2  C   0.490 -19.167  13.409 1.00 . A A . 48 PHE CE2  1 1 
        5  6343 1 1 51 PHE CG   C   0.870 -17.838  11.478 1.00 . A A . 48 PHE CG   1 1 
        5  6344 1 1 51 PHE CZ   C  -0.758 -19.523  12.926 1.00 . A A . 48 PHE CZ   1 1 
        5  6345 1 1 51 PHE H    H   3.648 -18.879  10.849 1.00 . A A . 48 PHE H    1 1 
        5  6346 1 1 51 PHE HA   H   1.850 -17.829   8.715 1.00 . A A . 48 PHE HA   1 1 
        5  6347 1 1 51 PHE HB2  H   2.462 -16.507  11.392 1.00 . A A . 48 PHE HB2  1 1 
        5  6348 1 1 51 PHE HB3  H   1.133 -16.145  10.292 1.00 . A A . 48 PHE HB3  1 1 
        5  6349 1 1 51 PHE HD1  H  -0.692 -17.802  10.040 1.00 . A A . 48 PHE HD1  1 1 
        5  6350 1 1 51 PHE HD2  H   2.275 -18.093  13.087 1.00 . A A . 48 PHE HD2  1 1 
        5  6351 1 1 51 PHE HE1  H  -2.139 -19.303  11.304 1.00 . A A . 48 PHE HE1  1 1 
        5  6352 1 1 51 PHE HE2  H   0.837 -19.520  14.346 1.00 . A A . 48 PHE HE2  1 1 
        5  6353 1 1 51 PHE HZ   H  -1.393 -20.184  13.498 1.00 . A A . 48 PHE HZ   1 1 
        5  6354 1 1 51 PHE N    N   3.051 -18.901  10.042 1.00 . A A . 48 PHE N    1 1 
        5  6355 1 1 51 PHE O    O   4.743 -16.763   9.712 1.00 . A A . 48 PHE O    1 1 
        5  6356 1 1 52 ALA C    C   3.678 -13.385   7.881 1.00 . A A . 49 ALA C    1 1 
        5  6357 1 1 52 ALA CA   C   4.336 -14.756   7.866 1.00 . A A . 49 ALA CA   1 1 
        5  6358 1 1 52 ALA CB   C   5.180 -15.042   6.601 1.00 . A A . 49 ALA CB   1 1 
        5  6359 1 1 52 ALA H    H   2.531 -15.855   7.693 1.00 . A A . 49 ALA H    1 1 
        5  6360 1 1 52 ALA HA   H   5.001 -14.741   8.687 1.00 . A A . 49 ALA HA   1 1 
        5  6361 1 1 52 ALA HB1  H   5.338 -16.104   6.497 1.00 . A A . 49 ALA HB1  1 1 
        5  6362 1 1 52 ALA HB2  H   6.153 -14.562   6.696 1.00 . A A . 49 ALA HB2  1 1 
        5  6363 1 1 52 ALA HB3  H   4.681 -14.671   5.724 1.00 . A A . 49 ALA HB3  1 1 
        5  6364 1 1 52 ALA N    N   3.384 -15.809   8.177 1.00 . A A . 49 ALA N    1 1 
        5  6365 1 1 52 ALA O    O   2.480 -13.230   7.575 1.00 . A A . 49 ALA O    1 1 
        5  6366 1 1 53 PHE C    C   4.855 -10.080   7.959 1.00 . A A . 50 PHE C    1 1 
        5  6367 1 1 53 PHE CA   C   3.986 -11.102   8.675 1.00 . A A . 50 PHE CA   1 1 
        5  6368 1 1 53 PHE CB   C   4.067 -10.926  10.208 1.00 . A A . 50 PHE CB   1 1 
        5  6369 1 1 53 PHE CD1  C   1.931  -9.763  10.853 1.00 . A A . 50 PHE CD1  1 1 
        5  6370 1 1 53 PHE CD2  C   3.976  -8.547  11.057 1.00 . A A . 50 PHE CD2  1 1 
        5  6371 1 1 53 PHE CE1  C   1.228  -8.665  11.313 1.00 . A A . 50 PHE CE1  1 1 
        5  6372 1 1 53 PHE CE2  C   3.277  -7.447  11.521 1.00 . A A . 50 PHE CE2  1 1 
        5  6373 1 1 53 PHE CG   C   3.311  -9.718  10.719 1.00 . A A . 50 PHE CG   1 1 
        5  6374 1 1 53 PHE CZ   C   1.902  -7.506  11.647 1.00 . A A . 50 PHE CZ   1 1 
        5  6375 1 1 53 PHE H    H   5.442 -12.511   8.193 1.00 . A A . 50 PHE H    1 1 
        5  6376 1 1 53 PHE HA   H   2.959 -11.029   8.351 1.00 . A A . 50 PHE HA   1 1 
        5  6377 1 1 53 PHE HB2  H   3.663 -11.812  10.695 1.00 . A A . 50 PHE HB2  1 1 
        5  6378 1 1 53 PHE HB3  H   5.116 -10.818  10.499 1.00 . A A . 50 PHE HB3  1 1 
        5  6379 1 1 53 PHE HD1  H   1.403 -10.668  10.593 1.00 . A A . 50 PHE HD1  1 1 
        5  6380 1 1 53 PHE HD2  H   5.051  -8.500  10.959 1.00 . A A . 50 PHE HD2  1 1 
        5  6381 1 1 53 PHE HE1  H   0.155  -8.713  11.415 1.00 . A A . 50 PHE HE1  1 1 
        5  6382 1 1 53 PHE HE2  H   3.805  -6.543  11.779 1.00 . A A . 50 PHE HE2  1 1 
        5  6383 1 1 53 PHE HZ   H   1.357  -6.648  12.010 1.00 . A A . 50 PHE HZ   1 1 
        5  6384 1 1 53 PHE N    N   4.476 -12.399   8.281 1.00 . A A . 50 PHE N    1 1 
        5  6385 1 1 53 PHE O    O   6.091 -10.015   8.223 1.00 . A A . 50 PHE O    1 1 
        5  6386 1 1 54 ILE C    C   4.630  -7.044   6.118 1.00 . A A . 51 ILE C    1 1 
        5  6387 1 1 54 ILE CA   C   5.012  -8.523   6.095 1.00 . A A . 51 ILE CA   1 1 
        5  6388 1 1 54 ILE CB   C   4.846  -9.145   4.648 1.00 . A A . 51 ILE CB   1 1 
        5  6389 1 1 54 ILE CD1  C   3.340 -10.726   3.192 1.00 . A A . 51 ILE CD1  1 1 
        5  6390 1 1 54 ILE CG1  C   3.825 -10.326   4.588 1.00 . A A . 51 ILE CG1  1 1 
        5  6391 1 1 54 ILE CG2  C   6.192  -9.648   4.199 1.00 . A A . 51 ILE CG2  1 1 
        5  6392 1 1 54 ILE H    H   3.258  -9.083   7.182 1.00 . A A . 51 ILE H    1 1 
        5  6393 1 1 54 ILE HA   H   6.075  -8.592   6.363 1.00 . A A . 51 ILE HA   1 1 
        5  6394 1 1 54 ILE HB   H   4.548  -8.366   3.967 1.00 . A A . 51 ILE HB   1 1 
        5  6395 1 1 54 ILE HD11 H   4.145 -11.168   2.633 1.00 . A A . 51 ILE HD11 1 1 
        5  6396 1 1 54 ILE HD12 H   2.961  -9.859   2.673 1.00 . A A . 51 ILE HD12 1 1 
        5  6397 1 1 54 ILE HD13 H   2.534 -11.450   3.279 1.00 . A A . 51 ILE HD13 1 1 
        5  6398 1 1 54 ILE HG12 H   4.294 -11.216   5.012 1.00 . A A . 51 ILE HG12 1 1 
        5  6399 1 1 54 ILE HG13 H   2.957 -10.063   5.176 1.00 . A A . 51 ILE HG13 1 1 
        5  6400 1 1 54 ILE HG21 H   6.901  -8.834   4.197 1.00 . A A . 51 ILE HG21 1 1 
        5  6401 1 1 54 ILE HG22 H   6.106 -10.054   3.202 1.00 . A A . 51 ILE HG22 1 1 
        5  6402 1 1 54 ILE HG23 H   6.531 -10.421   4.875 1.00 . A A . 51 ILE HG23 1 1 
        5  6403 1 1 54 ILE N    N   4.236  -9.255   7.104 1.00 . A A . 51 ILE N    1 1 
        5  6404 1 1 54 ILE O    O   3.502  -6.703   5.850 1.00 . A A . 51 ILE O    1 1 
        5  6405 1 1 55 GLU C    C   5.987  -3.935   5.461 1.00 . A A . 52 GLU C    1 1 
        5  6406 1 1 55 GLU CA   C   5.262  -4.735   6.572 1.00 . A A . 52 GLU CA   1 1 
        5  6407 1 1 55 GLU CB   C   5.601  -4.141   7.952 1.00 . A A . 52 GLU CB   1 1 
        5  6408 1 1 55 GLU CD   C   5.042  -4.030  10.441 1.00 . A A . 52 GLU CD   1 1 
        5  6409 1 1 55 GLU CG   C   4.827  -4.758   9.122 1.00 . A A . 52 GLU CG   1 1 
        5  6410 1 1 55 GLU H    H   6.439  -6.512   6.757 1.00 . A A . 52 GLU H    1 1 
        5  6411 1 1 55 GLU HA   H   4.198  -4.642   6.432 1.00 . A A . 52 GLU HA   1 1 
        5  6412 1 1 55 GLU HB2  H   6.645  -4.275   8.134 1.00 . A A . 52 GLU HB2  1 1 
        5  6413 1 1 55 GLU HB3  H   5.385  -3.082   7.936 1.00 . A A . 52 GLU HB3  1 1 
        5  6414 1 1 55 GLU HG2  H   3.775  -4.736   8.891 1.00 . A A . 52 GLU HG2  1 1 
        5  6415 1 1 55 GLU HG3  H   5.140  -5.787   9.246 1.00 . A A . 52 GLU HG3  1 1 
        5  6416 1 1 55 GLU N    N   5.562  -6.178   6.503 1.00 . A A . 52 GLU N    1 1 
        5  6417 1 1 55 GLU O    O   7.223  -3.792   5.502 1.00 . A A . 52 GLU O    1 1 
        5  6418 1 1 55 GLU OE1  O   4.776  -2.809  10.505 1.00 . A A . 52 GLU OE1  1 1 
        5  6419 1 1 55 GLU OE2  O   5.461  -4.673  11.422 1.00 . A A . 52 GLU OE2  1 1 
        5  6420 1 1 56 PHE C    C   5.484  -1.123   3.489 1.00 . A A . 53 PHE C    1 1 
        5  6421 1 1 56 PHE CA   C   5.833  -2.627   3.353 1.00 . A A . 53 PHE CA   1 1 
        5  6422 1 1 56 PHE CB   C   5.369  -3.126   1.960 1.00 . A A . 53 PHE CB   1 1 
        5  6423 1 1 56 PHE CD1  C   6.624  -5.289   2.210 1.00 . A A . 53 PHE CD1  1 1 
        5  6424 1 1 56 PHE CD2  C   4.531  -5.338   1.106 1.00 . A A . 53 PHE CD2  1 1 
        5  6425 1 1 56 PHE CE1  C   6.742  -6.644   2.069 1.00 . A A . 53 PHE CE1  1 1 
        5  6426 1 1 56 PHE CE2  C   4.648  -6.688   0.954 1.00 . A A . 53 PHE CE2  1 1 
        5  6427 1 1 56 PHE CG   C   5.518  -4.610   1.743 1.00 . A A . 53 PHE CG   1 1 
        5  6428 1 1 56 PHE CZ   C   5.750  -7.347   1.441 1.00 . A A . 53 PHE CZ   1 1 
        5  6429 1 1 56 PHE H    H   4.245  -3.591   4.442 1.00 . A A . 53 PHE H    1 1 
        5  6430 1 1 56 PHE HA   H   6.903  -2.754   3.438 1.00 . A A . 53 PHE HA   1 1 
        5  6431 1 1 56 PHE HB2  H   4.324  -2.883   1.829 1.00 . A A . 53 PHE HB2  1 1 
        5  6432 1 1 56 PHE HB3  H   5.946  -2.622   1.196 1.00 . A A . 53 PHE HB3  1 1 
        5  6433 1 1 56 PHE HD1  H   7.396  -4.741   2.700 1.00 . A A . 53 PHE HD1  1 1 
        5  6434 1 1 56 PHE HD2  H   3.658  -4.846   0.709 1.00 . A A . 53 PHE HD2  1 1 
        5  6435 1 1 56 PHE HE1  H   7.618  -7.159   2.445 1.00 . A A . 53 PHE HE1  1 1 
        5  6436 1 1 56 PHE HE2  H   3.855  -7.231   0.477 1.00 . A A . 53 PHE HE2  1 1 
        5  6437 1 1 56 PHE HZ   H   5.830  -8.415   1.336 1.00 . A A . 53 PHE HZ   1 1 
        5  6438 1 1 56 PHE N    N   5.228  -3.426   4.450 1.00 . A A . 53 PHE N    1 1 
        5  6439 1 1 56 PHE O    O   4.529  -0.787   4.180 1.00 . A A . 53 PHE O    1 1 
        5  6440 1 1 57 GLU C    C   4.808   1.674   1.895 1.00 . A A . 54 GLU C    1 1 
        5  6441 1 1 57 GLU CA   C   5.933   1.255   2.880 1.00 . A A . 54 GLU CA   1 1 
        5  6442 1 1 57 GLU CB   C   7.180   2.192   2.722 1.00 . A A . 54 GLU CB   1 1 
        5  6443 1 1 57 GLU CD   C   8.935   3.310   1.229 1.00 . A A . 54 GLU CD   1 1 
        5  6444 1 1 57 GLU CG   C   7.636   2.521   1.277 1.00 . A A . 54 GLU CG   1 1 
        5  6445 1 1 57 GLU H    H   7.078  -0.523   2.365 1.00 . A A . 54 GLU H    1 1 
        5  6446 1 1 57 GLU HA   H   5.540   1.424   3.876 1.00 . A A . 54 GLU HA   1 1 
        5  6447 1 1 57 GLU HB2  H   6.957   3.133   3.215 1.00 . A A . 54 GLU HB2  1 1 
        5  6448 1 1 57 GLU HB3  H   8.013   1.748   3.241 1.00 . A A . 54 GLU HB3  1 1 
        5  6449 1 1 57 GLU HG2  H   7.779   1.605   0.740 1.00 . A A . 54 GLU HG2  1 1 
        5  6450 1 1 57 GLU HG3  H   6.872   3.116   0.772 1.00 . A A . 54 GLU HG3  1 1 
        5  6451 1 1 57 GLU N    N   6.256  -0.210   2.832 1.00 . A A . 54 GLU N    1 1 
        5  6452 1 1 57 GLU O    O   4.094   2.647   2.159 1.00 . A A . 54 GLU O    1 1 
        5  6453 1 1 57 GLU OE1  O   9.090   4.257   2.022 1.00 . A A . 54 GLU OE1  1 1 
        5  6454 1 1 57 GLU OE2  O   9.806   2.985   0.398 1.00 . A A . 54 GLU OE2  1 1 
        5  6455 1 1 58 ASP C    C   2.549   0.171  -0.236 1.00 . A A . 55 ASP C    1 1 
        5  6456 1 1 58 ASP CA   C   3.607   1.274  -0.188 1.00 . A A . 55 ASP CA   1 1 
        5  6457 1 1 58 ASP CB   C   4.279   1.372  -1.565 1.00 . A A . 55 ASP CB   1 1 
        5  6458 1 1 58 ASP CG   C   4.986   2.691  -1.778 1.00 . A A . 55 ASP CG   1 1 
        5  6459 1 1 58 ASP H    H   5.167   0.158   0.639 1.00 . A A . 55 ASP H    1 1 
        5  6460 1 1 58 ASP HA   H   3.179   2.233   0.070 1.00 . A A . 55 ASP HA   1 1 
        5  6461 1 1 58 ASP HB2  H   5.014   0.586  -1.639 1.00 . A A . 55 ASP HB2  1 1 
        5  6462 1 1 58 ASP HB3  H   3.552   1.239  -2.353 1.00 . A A . 55 ASP HB3  1 1 
        5  6463 1 1 58 ASP N    N   4.617   0.931   0.797 1.00 . A A . 55 ASP N    1 1 
        5  6464 1 1 58 ASP O    O   2.883  -0.984  -0.514 1.00 . A A . 55 ASP O    1 1 
        5  6465 1 1 58 ASP OD1  O   4.374   3.741  -1.486 1.00 . A A . 55 ASP OD1  1 1 
        5  6466 1 1 58 ASP OD2  O   6.111   2.685  -2.304 1.00 . A A . 55 ASP OD2  1 1 
        5  6467 1 1 59 ALA C    C  -0.296  -0.789  -1.538 1.00 . A A . 56 ALA C    1 1 
        5  6468 1 1 59 ALA CA   C   0.200  -0.491  -0.089 1.00 . A A . 56 ALA CA   1 1 
        5  6469 1 1 59 ALA CB   C  -0.983  -0.184   0.830 1.00 . A A . 56 ALA CB   1 1 
        5  6470 1 1 59 ALA H    H   1.078   1.357   0.512 1.00 . A A . 56 ALA H    1 1 
        5  6471 1 1 59 ALA HA   H   0.623  -1.413   0.285 1.00 . A A . 56 ALA HA   1 1 
        5  6472 1 1 59 ALA HB1  H  -1.529   0.670   0.480 1.00 . A A . 56 ALA HB1  1 1 
        5  6473 1 1 59 ALA HB2  H  -0.634   0.000   1.838 1.00 . A A . 56 ALA HB2  1 1 
        5  6474 1 1 59 ALA HB3  H  -1.641  -1.045   0.846 1.00 . A A . 56 ALA HB3  1 1 
        5  6475 1 1 59 ALA N    N   1.274   0.499   0.058 1.00 . A A . 56 ALA N    1 1 
        5  6476 1 1 59 ALA O    O  -0.710  -1.929  -1.776 1.00 . A A . 56 ALA O    1 1 
        5  6477 1 1 60 ARG C    C  -0.159  -0.997  -4.783 1.00 . A A . 57 ARG C    1 1 
        5  6478 1 1 60 ARG CA   C  -1.001  -0.129  -3.792 1.00 . A A . 57 ARG CA   1 1 
        5  6479 1 1 60 ARG CB   C  -1.742   1.064  -4.507 1.00 . A A . 57 ARG CB   1 1 
        5  6480 1 1 60 ARG CD   C   0.031   2.936  -4.941 1.00 . A A . 57 ARG CD   1 1 
        5  6481 1 1 60 ARG CG   C  -0.958   1.932  -5.526 1.00 . A A . 57 ARG CG   1 1 
        5  6482 1 1 60 ARG CZ   C   2.455   2.954  -4.514 1.00 . A A . 57 ARG CZ   1 1 
        5  6483 1 1 60 ARG H    H   0.160   1.025  -2.409 1.00 . A A . 57 ARG H    1 1 
        5  6484 1 1 60 ARG HA   H  -1.809  -0.778  -3.466 1.00 . A A . 57 ARG HA   1 1 
        5  6485 1 1 60 ARG HB2  H  -2.560   0.612  -5.062 1.00 . A A . 57 ARG HB2  1 1 
        5  6486 1 1 60 ARG HB3  H  -2.196   1.711  -3.758 1.00 . A A . 57 ARG HB3  1 1 
        5  6487 1 1 60 ARG HD2  H  -0.108   3.889  -5.433 1.00 . A A . 57 ARG HD2  1 1 
        5  6488 1 1 60 ARG HD3  H  -0.122   3.057  -3.880 1.00 . A A . 57 ARG HD3  1 1 
        5  6489 1 1 60 ARG HE   H   1.555   1.841  -5.901 1.00 . A A . 57 ARG HE   1 1 
        5  6490 1 1 60 ARG HG2  H  -0.403   1.263  -6.167 1.00 . A A . 57 ARG HG2  1 1 
        5  6491 1 1 60 ARG HG3  H  -1.668   2.476  -6.135 1.00 . A A . 57 ARG HG3  1 1 
        5  6492 1 1 60 ARG HH11 H   1.410   4.193  -3.326 1.00 . A A . 57 ARG HH11 1 1 
        5  6493 1 1 60 ARG HH12 H   3.124   4.196  -3.036 1.00 . A A . 57 ARG HH12 1 1 
        5  6494 1 1 60 ARG HH21 H   3.766   1.838  -5.596 1.00 . A A . 57 ARG HH21 1 1 
        5  6495 1 1 60 ARG HH22 H   4.486   2.825  -4.359 1.00 . A A . 57 ARG HH22 1 1 
        5  6496 1 1 60 ARG N    N  -0.319   0.179  -2.517 1.00 . A A . 57 ARG N    1 1 
        5  6497 1 1 60 ARG NE   N   1.397   2.506  -5.175 1.00 . A A . 57 ARG NE   1 1 
        5  6498 1 1 60 ARG NH1  N   2.306   3.852  -3.552 1.00 . A A . 57 ARG NH1  1 1 
        5  6499 1 1 60 ARG NH2  N   3.660   2.507  -4.851 1.00 . A A . 57 ARG NH2  1 1 
        5  6500 1 1 60 ARG O    O  -0.760  -1.710  -5.580 1.00 . A A . 57 ARG O    1 1 
        5  6501 1 1 61 ASP C    C   2.082  -3.397  -5.051 1.00 . A A . 58 ASP C    1 1 
        5  6502 1 1 61 ASP CA   C   1.992  -1.920  -5.623 1.00 . A A . 58 ASP CA   1 1 
        5  6503 1 1 61 ASP CB   C   3.389  -1.359  -6.056 1.00 . A A . 58 ASP CB   1 1 
        5  6504 1 1 61 ASP CG   C   3.299  -0.379  -7.209 1.00 . A A . 58 ASP CG   1 1 
        5  6505 1 1 61 ASP H    H   1.693  -0.174  -4.385 1.00 . A A . 58 ASP H    1 1 
        5  6506 1 1 61 ASP HA   H   1.407  -2.003  -6.532 1.00 . A A . 58 ASP HA   1 1 
        5  6507 1 1 61 ASP HB2  H   3.867  -0.840  -5.239 1.00 . A A . 58 ASP HB2  1 1 
        5  6508 1 1 61 ASP HB3  H   4.023  -2.184  -6.373 1.00 . A A . 58 ASP HB3  1 1 
        5  6509 1 1 61 ASP N    N   1.217  -0.940  -4.792 1.00 . A A . 58 ASP N    1 1 
        5  6510 1 1 61 ASP O    O   2.183  -4.334  -5.848 1.00 . A A . 58 ASP O    1 1 
        5  6511 1 1 61 ASP OD1  O   2.632   0.665  -7.056 1.00 . A A . 58 ASP OD1  1 1 
        5  6512 1 1 61 ASP OD2  O   3.920  -0.625  -8.257 1.00 . A A . 58 ASP OD2  1 1 
        5  6513 1 1 62 ALA C    C   0.644  -5.768  -3.482 1.00 . A A . 59 ALA C    1 1 
        5  6514 1 1 62 ALA CA   C   1.954  -4.977  -3.064 1.00 . A A . 59 ALA CA   1 1 
        5  6515 1 1 62 ALA CB   C   2.172  -4.877  -1.540 1.00 . A A . 59 ALA CB   1 1 
        5  6516 1 1 62 ALA H    H   2.271  -2.898  -3.094 1.00 . A A . 59 ALA H    1 1 
        5  6517 1 1 62 ALA HA   H   2.797  -5.524  -3.430 1.00 . A A . 59 ALA HA   1 1 
        5  6518 1 1 62 ALA HB1  H   1.444  -4.228  -1.079 1.00 . A A . 59 ALA HB1  1 1 
        5  6519 1 1 62 ALA HB2  H   3.167  -4.482  -1.361 1.00 . A A . 59 ALA HB2  1 1 
        5  6520 1 1 62 ALA HB3  H   2.110  -5.860  -1.094 1.00 . A A . 59 ALA HB3  1 1 
        5  6521 1 1 62 ALA N    N   2.079  -3.624  -3.688 1.00 . A A . 59 ALA N    1 1 
        5  6522 1 1 62 ALA O    O   0.573  -7.022  -3.386 1.00 . A A . 59 ALA O    1 1 
        5  6523 1 1 63 ALA C    C  -1.479  -6.567  -5.596 1.00 . A A . 60 ALA C    1 1 
        5  6524 1 1 63 ALA CA   C  -1.670  -5.524  -4.448 1.00 . A A . 60 ALA CA   1 1 
        5  6525 1 1 63 ALA CB   C  -2.630  -4.351  -4.837 1.00 . A A . 60 ALA CB   1 1 
        5  6526 1 1 63 ALA H    H  -0.336  -4.069  -3.746 1.00 . A A . 60 ALA H    1 1 
        5  6527 1 1 63 ALA HA   H  -2.152  -6.045  -3.643 1.00 . A A . 60 ALA HA   1 1 
        5  6528 1 1 63 ALA HB1  H  -2.941  -3.829  -3.937 1.00 . A A . 60 ALA HB1  1 1 
        5  6529 1 1 63 ALA HB2  H  -3.513  -4.730  -5.326 1.00 . A A . 60 ALA HB2  1 1 
        5  6530 1 1 63 ALA HB3  H  -2.141  -3.641  -5.500 1.00 . A A . 60 ALA HB3  1 1 
        5  6531 1 1 63 ALA N    N  -0.402  -5.005  -3.891 1.00 . A A . 60 ALA N    1 1 
        5  6532 1 1 63 ALA O    O  -2.251  -7.544  -5.596 1.00 . A A . 60 ALA O    1 1 
        5  6533 1 1 64 ASP C    C   0.218  -8.820  -6.794 1.00 . A A . 61 ASP C    1 1 
        5  6534 1 1 64 ASP CA   C  -0.085  -7.482  -7.499 1.00 . A A . 61 ASP CA   1 1 
        5  6535 1 1 64 ASP CB   C   1.081  -7.101  -8.436 1.00 . A A . 61 ASP CB   1 1 
        5  6536 1 1 64 ASP CG   C   0.784  -5.875  -9.277 1.00 . A A . 61 ASP CG   1 1 
        5  6537 1 1 64 ASP H    H   0.012  -5.529  -6.605 1.00 . A A . 61 ASP H    1 1 
        5  6538 1 1 64 ASP HA   H  -0.938  -7.637  -8.136 1.00 . A A . 61 ASP HA   1 1 
        5  6539 1 1 64 ASP HB2  H   1.987  -6.941  -7.875 1.00 . A A . 61 ASP HB2  1 1 
        5  6540 1 1 64 ASP HB3  H   1.244  -7.927  -9.110 1.00 . A A . 61 ASP HB3  1 1 
        5  6541 1 1 64 ASP N    N  -0.453  -6.405  -6.527 1.00 . A A . 61 ASP N    1 1 
        5  6542 1 1 64 ASP O    O  -0.380  -9.836  -7.137 1.00 . A A . 61 ASP O    1 1 
        5  6543 1 1 64 ASP OD1  O  -0.035  -5.982 -10.223 1.00 . A A . 61 ASP OD1  1 1 
        5  6544 1 1 64 ASP OD2  O   1.365  -4.813  -9.000 1.00 . A A . 61 ASP OD2  1 1 
        5  6545 1 1 65 ALA C    C   0.125 -10.557  -4.278 1.00 . A A . 62 ALA C    1 1 
        5  6546 1 1 65 ALA CA   C   1.357 -10.043  -4.983 1.00 . A A . 62 ALA CA   1 1 
        5  6547 1 1 65 ALA CB   C   2.497  -9.940  -3.956 1.00 . A A . 62 ALA CB   1 1 
        5  6548 1 1 65 ALA H    H   1.602  -8.015  -5.601 1.00 . A A . 62 ALA H    1 1 
        5  6549 1 1 65 ALA HA   H   1.655 -10.803  -5.699 1.00 . A A . 62 ALA HA   1 1 
        5  6550 1 1 65 ALA HB1  H   2.512 -10.846  -3.361 1.00 . A A . 62 ALA HB1  1 1 
        5  6551 1 1 65 ALA HB2  H   2.368  -9.094  -3.292 1.00 . A A . 62 ALA HB2  1 1 
        5  6552 1 1 65 ALA HB3  H   3.432  -9.860  -4.470 1.00 . A A . 62 ALA HB3  1 1 
        5  6553 1 1 65 ALA N    N   1.102  -8.821  -5.778 1.00 . A A . 62 ALA N    1 1 
        5  6554 1 1 65 ALA O    O  -0.038 -11.771  -4.251 1.00 . A A . 62 ALA O    1 1 
        5  6555 1 1 66 ILE C    C  -2.962 -10.915  -3.926 1.00 . A A . 63 ILE C    1 1 
        5  6556 1 1 66 ILE CA   C  -1.890 -10.297  -2.991 1.00 . A A . 63 ILE CA   1 1 
        5  6557 1 1 66 ILE CB   C  -2.516  -9.440  -1.846 1.00 . A A . 63 ILE CB   1 1 
        5  6558 1 1 66 ILE CD1  C  -4.490  -9.869  -0.188 1.00 . A A . 63 ILE CD1  1 1 
        5  6559 1 1 66 ILE CG1  C  -3.321 -10.420  -0.962 1.00 . A A . 63 ILE CG1  1 1 
        5  6560 1 1 66 ILE CG2  C  -3.363  -8.278  -2.356 1.00 . A A . 63 ILE CG2  1 1 
        5  6561 1 1 66 ILE H    H  -0.652  -8.712  -3.799 1.00 . A A . 63 ILE H    1 1 
        5  6562 1 1 66 ILE HA   H  -1.443 -11.155  -2.489 1.00 . A A . 63 ILE HA   1 1 
        5  6563 1 1 66 ILE HB   H  -1.706  -9.034  -1.256 1.00 . A A . 63 ILE HB   1 1 
        5  6564 1 1 66 ILE HD11 H  -5.026 -10.683   0.265 1.00 . A A . 63 ILE HD11 1 1 
        5  6565 1 1 66 ILE HD12 H  -5.143  -9.322  -0.846 1.00 . A A . 63 ILE HD12 1 1 
        5  6566 1 1 66 ILE HD13 H  -4.125  -9.210   0.576 1.00 . A A . 63 ILE HD13 1 1 
        5  6567 1 1 66 ILE HG12 H  -3.704 -11.207  -1.592 1.00 . A A . 63 ILE HG12 1 1 
        5  6568 1 1 66 ILE HG13 H  -2.640 -10.862  -0.246 1.00 . A A . 63 ILE HG13 1 1 
        5  6569 1 1 66 ILE HG21 H  -4.372  -8.626  -2.513 1.00 . A A . 63 ILE HG21 1 1 
        5  6570 1 1 66 ILE HG22 H  -2.965  -7.920  -3.288 1.00 . A A . 63 ILE HG22 1 1 
        5  6571 1 1 66 ILE HG23 H  -3.363  -7.483  -1.625 1.00 . A A . 63 ILE HG23 1 1 
        5  6572 1 1 66 ILE N    N  -0.758  -9.698  -3.717 1.00 . A A . 63 ILE N    1 1 
        5  6573 1 1 66 ILE O    O  -3.385 -12.037  -3.660 1.00 . A A . 63 ILE O    1 1 
        5  6574 1 1 67 LYS C    C  -3.490 -12.155  -6.671 1.00 . A A . 64 LYS C    1 1 
        5  6575 1 1 67 LYS CA   C  -4.173 -10.895  -6.075 1.00 . A A . 64 LYS CA   1 1 
        5  6576 1 1 67 LYS CB   C  -4.532  -9.916  -7.240 1.00 . A A . 64 LYS CB   1 1 
        5  6577 1 1 67 LYS CD   C  -2.805  -9.941  -9.175 1.00 . A A . 64 LYS CD   1 1 
        5  6578 1 1 67 LYS CE   C  -2.219  -8.993 -10.222 1.00 . A A . 64 LYS CE   1 1 
        5  6579 1 1 67 LYS CG   C  -3.352  -9.199  -7.945 1.00 . A A . 64 LYS CG   1 1 
        5  6580 1 1 67 LYS H    H  -3.350  -9.247  -4.994 1.00 . A A . 64 LYS H    1 1 
        5  6581 1 1 67 LYS HA   H  -5.110 -11.220  -5.605 1.00 . A A . 64 LYS HA   1 1 
        5  6582 1 1 67 LYS HB2  H  -5.055 -10.488  -7.985 1.00 . A A . 64 LYS HB2  1 1 
        5  6583 1 1 67 LYS HB3  H  -5.221  -9.161  -6.872 1.00 . A A . 64 LYS HB3  1 1 
        5  6584 1 1 67 LYS HD2  H  -1.999 -10.608  -8.851 1.00 . A A . 64 LYS HD2  1 1 
        5  6585 1 1 67 LYS HD3  H  -3.595 -10.516  -9.615 1.00 . A A . 64 LYS HD3  1 1 
        5  6586 1 1 67 LYS HE2  H  -1.350  -8.513  -9.816 1.00 . A A . 64 LYS HE2  1 1 
        5  6587 1 1 67 LYS HE3  H  -1.920  -9.578 -11.085 1.00 . A A . 64 LYS HE3  1 1 
        5  6588 1 1 67 LYS HG2  H  -3.668  -8.215  -8.247 1.00 . A A . 64 LYS HG2  1 1 
        5  6589 1 1 67 LYS HG3  H  -2.531  -9.099  -7.221 1.00 . A A . 64 LYS HG3  1 1 
        5  6590 1 1 67 LYS HZ1  H  -4.050  -8.405 -11.025 1.00 . A A . 64 LYS HZ1  1 1 
        5  6591 1 1 67 LYS HZ2  H  -2.769  -7.381 -11.425 1.00 . A A . 64 LYS HZ2  1 1 
        5  6592 1 1 67 LYS HZ3  H  -3.434  -7.330  -9.871 1.00 . A A . 64 LYS HZ3  1 1 
        5  6593 1 1 67 LYS N    N  -3.392 -10.223  -5.003 1.00 . A A . 64 LYS N    1 1 
        5  6594 1 1 67 LYS NZ   N  -3.189  -7.955 -10.665 1.00 . A A . 64 LYS NZ   1 1 
        5  6595 1 1 67 LYS O    O  -4.182 -13.088  -7.047 1.00 . A A . 64 LYS O    1 1 
        5  6596 1 1 68 GLU C    C  -1.282 -14.504  -6.468 1.00 . A A . 65 GLU C    1 1 
        5  6597 1 1 68 GLU CA   C  -1.485 -13.303  -7.431 1.00 . A A . 65 GLU CA   1 1 
        5  6598 1 1 68 GLU CB   C  -0.200 -12.728  -8.063 1.00 . A A . 65 GLU CB   1 1 
        5  6599 1 1 68 GLU CD   C   2.305 -12.832  -8.288 1.00 . A A . 65 GLU CD   1 1 
        5  6600 1 1 68 GLU CG   C   1.049 -13.461  -7.760 1.00 . A A . 65 GLU CG   1 1 
        5  6601 1 1 68 GLU H    H  -1.595 -11.444  -6.448 1.00 . A A . 65 GLU H    1 1 
        5  6602 1 1 68 GLU HA   H  -2.128 -13.660  -8.224 1.00 . A A . 65 GLU HA   1 1 
        5  6603 1 1 68 GLU HB2  H  -0.320 -12.721  -9.134 1.00 . A A . 65 GLU HB2  1 1 
        5  6604 1 1 68 GLU HB3  H  -0.080 -11.712  -7.720 1.00 . A A . 65 GLU HB3  1 1 
        5  6605 1 1 68 GLU HG2  H   1.131 -13.553  -6.692 1.00 . A A . 65 GLU HG2  1 1 
        5  6606 1 1 68 GLU HG3  H   0.948 -14.406  -8.201 1.00 . A A . 65 GLU HG3  1 1 
        5  6607 1 1 68 GLU N    N  -2.151 -12.190  -6.784 1.00 . A A . 65 GLU N    1 1 
        5  6608 1 1 68 GLU O    O  -1.175 -15.654  -6.917 1.00 . A A . 65 GLU O    1 1 
        5  6609 1 1 68 GLU OE1  O   2.229 -11.970  -9.189 1.00 . A A . 65 GLU OE1  1 1 
        5  6610 1 1 68 GLU OE2  O   3.391 -13.244  -7.823 1.00 . A A . 65 GLU OE2  1 1 
        5  6611 1 1 69 LYS C    C  -2.656 -15.640  -3.602 1.00 . A A . 66 LYS C    1 1 
        5  6612 1 1 69 LYS CA   C  -1.228 -15.333  -4.178 1.00 . A A . 66 LYS CA   1 1 
        5  6613 1 1 69 LYS CB   C  -0.201 -14.996  -3.023 1.00 . A A . 66 LYS CB   1 1 
        5  6614 1 1 69 LYS CD   C   1.897 -15.512  -4.525 1.00 . A A . 66 LYS CD   1 1 
        5  6615 1 1 69 LYS CE   C   3.337 -15.094  -4.857 1.00 . A A . 66 LYS CE   1 1 
        5  6616 1 1 69 LYS CG   C   1.251 -14.612  -3.437 1.00 . A A . 66 LYS CG   1 1 
        5  6617 1 1 69 LYS H    H  -1.315 -13.328  -4.847 1.00 . A A . 66 LYS H    1 1 
        5  6618 1 1 69 LYS HA   H  -0.887 -16.212  -4.698 1.00 . A A . 66 LYS HA   1 1 
        5  6619 1 1 69 LYS HB2  H  -0.581 -14.147  -2.462 1.00 . A A . 66 LYS HB2  1 1 
        5  6620 1 1 69 LYS HB3  H  -0.150 -15.841  -2.343 1.00 . A A . 66 LYS HB3  1 1 
        5  6621 1 1 69 LYS HD2  H   1.916 -16.538  -4.188 1.00 . A A . 66 LYS HD2  1 1 
        5  6622 1 1 69 LYS HD3  H   1.306 -15.445  -5.435 1.00 . A A . 66 LYS HD3  1 1 
        5  6623 1 1 69 LYS HE2  H   3.356 -14.040  -5.101 1.00 . A A . 66 LYS HE2  1 1 
        5  6624 1 1 69 LYS HE3  H   3.965 -15.278  -3.994 1.00 . A A . 66 LYS HE3  1 1 
        5  6625 1 1 69 LYS HG2  H   1.236 -13.595  -3.796 1.00 . A A . 66 LYS HG2  1 1 
        5  6626 1 1 69 LYS HG3  H   1.865 -14.643  -2.544 1.00 . A A . 66 LYS HG3  1 1 
        5  6627 1 1 69 LYS HZ1  H   4.804 -15.462  -6.300 1.00 . A A . 66 LYS HZ1  1 1 
        5  6628 1 1 69 LYS HZ2  H   3.228 -15.792  -6.828 1.00 . A A . 66 LYS HZ2  1 1 
        5  6629 1 1 69 LYS HZ3  H   4.006 -16.861  -5.768 1.00 . A A . 66 LYS HZ3  1 1 
        5  6630 1 1 69 LYS N    N  -1.284 -14.254  -5.158 1.00 . A A . 66 LYS N    1 1 
        5  6631 1 1 69 LYS NZ   N   3.880 -15.857  -6.016 1.00 . A A . 66 LYS NZ   1 1 
        5  6632 1 1 69 LYS O    O  -2.756 -16.357  -2.608 1.00 . A A . 66 LYS O    1 1 
        5  6633 1 1 70 ASP C    C  -5.804 -16.526  -3.723 1.00 . A A . 67 ASP C    1 1 
        5  6634 1 1 70 ASP CA   C  -5.128 -15.160  -3.647 1.00 . A A . 67 ASP CA   1 1 
        5  6635 1 1 70 ASP CB   C  -6.074 -14.010  -3.991 1.00 . A A . 67 ASP CB   1 1 
        5  6636 1 1 70 ASP CG   C  -7.051 -14.287  -5.136 1.00 . A A . 67 ASP CG   1 1 
        5  6637 1 1 70 ASP H    H  -3.690 -14.895  -5.205 1.00 . A A . 67 ASP H    1 1 
        5  6638 1 1 70 ASP HA   H  -4.936 -15.031  -2.616 1.00 . A A . 67 ASP HA   1 1 
        5  6639 1 1 70 ASP HB2  H  -6.644 -13.820  -3.079 1.00 . A A . 67 ASP HB2  1 1 
        5  6640 1 1 70 ASP HB3  H  -5.502 -13.124  -4.210 1.00 . A A . 67 ASP HB3  1 1 
        5  6641 1 1 70 ASP N    N  -3.759 -15.134  -4.245 1.00 . A A . 67 ASP N    1 1 
        5  6642 1 1 70 ASP O    O  -5.373 -17.391  -4.501 1.00 . A A . 67 ASP O    1 1 
        5  6643 1 1 70 ASP OD1  O  -6.638 -14.283  -6.305 1.00 . A A . 67 ASP OD1  1 1 
        5  6644 1 1 70 ASP OD2  O  -8.240 -14.523  -4.848 1.00 . A A . 67 ASP OD2  1 1 
        5  6645 1 1 71 GLY C    C  -7.174 -18.430  -1.136 1.00 . A A . 68 GLY C    1 1 
        5  6646 1 1 71 GLY CA   C  -7.252 -18.081  -2.597 1.00 . A A . 68 GLY CA   1 1 
        5  6647 1 1 71 GLY H    H  -7.371 -15.981  -2.594 1.00 . A A . 68 GLY H    1 1 
        5  6648 1 1 71 GLY HA2  H  -8.262 -18.223  -2.919 1.00 . A A . 68 GLY HA2  1 1 
        5  6649 1 1 71 GLY HA3  H  -6.616 -18.766  -3.142 1.00 . A A . 68 GLY HA3  1 1 
        5  6650 1 1 71 GLY N    N  -6.855 -16.739  -2.923 1.00 . A A . 68 GLY N    1 1 
        5  6651 1 1 71 GLY O    O  -6.843 -19.572  -0.836 1.00 . A A . 68 GLY O    1 1 
        5  6652 1 1 72 CYS C    C  -8.563 -18.810   1.432 1.00 . A A . 69 CYS C    1 1 
        5  6653 1 1 72 CYS CA   C  -7.495 -17.735   1.225 1.00 . A A . 69 CYS CA   1 1 
        5  6654 1 1 72 CYS CB   C  -7.938 -16.518   2.082 1.00 . A A . 69 CYS CB   1 1 
        5  6655 1 1 72 CYS H    H  -7.289 -16.484  -0.501 1.00 . A A . 69 CYS H    1 1 
        5  6656 1 1 72 CYS HA   H  -6.544 -18.096   1.583 1.00 . A A . 69 CYS HA   1 1 
        5  6657 1 1 72 CYS HB2  H  -7.195 -15.745   2.045 1.00 . A A . 69 CYS HB2  1 1 
        5  6658 1 1 72 CYS HB3  H  -8.881 -16.136   1.709 1.00 . A A . 69 CYS HB3  1 1 
        5  6659 1 1 72 CYS HG   H  -9.283 -16.223   4.235 1.00 . A A . 69 CYS HG   1 1 
        5  6660 1 1 72 CYS N    N  -7.359 -17.416  -0.214 1.00 . A A . 69 CYS N    1 1 
        5  6661 1 1 72 CYS O    O  -9.715 -18.678   1.015 1.00 . A A . 69 CYS O    1 1 
        5  6662 1 1 72 CYS SG   S  -8.209 -16.902   3.830 1.00 . A A . 69 CYS SG   1 1 
        5  6663 1 1 73 ASP C    C  -8.844 -21.498   3.837 1.00 . A A . 70 ASP C    1 1 
        5  6664 1 1 73 ASP CA   C  -8.939 -21.032   2.371 1.00 . A A . 70 ASP CA   1 1 
        5  6665 1 1 73 ASP CB   C  -8.566 -22.161   1.415 1.00 . A A . 70 ASP CB   1 1 
        5  6666 1 1 73 ASP CG   C  -9.483 -22.207   0.216 1.00 . A A . 70 ASP CG   1 1 
        5  6667 1 1 73 ASP H    H  -7.201 -19.841   2.481 1.00 . A A . 70 ASP H    1 1 
        5  6668 1 1 73 ASP HA   H  -9.947 -20.730   2.161 1.00 . A A . 70 ASP HA   1 1 
        5  6669 1 1 73 ASP HB2  H  -7.548 -22.024   1.061 1.00 . A A . 70 ASP HB2  1 1 
        5  6670 1 1 73 ASP HB3  H  -8.624 -23.098   1.941 1.00 . A A . 70 ASP HB3  1 1 
        5  6671 1 1 73 ASP N    N  -8.125 -19.862   2.128 1.00 . A A . 70 ASP N    1 1 
        5  6672 1 1 73 ASP O    O  -7.741 -21.477   4.430 1.00 . A A . 70 ASP O    1 1 
        5  6673 1 1 73 ASP OD1  O -10.631 -22.672   0.368 1.00 . A A . 70 ASP OD1  1 1 
        5  6674 1 1 73 ASP OD2  O  -9.050 -21.810  -0.887 1.00 . A A . 70 ASP OD2  1 1 
        5  6675 1 1 74 PHE C    C -11.325 -23.252   5.900 1.00 . A A . 71 PHE C    1 1 
        5  6676 1 1 74 PHE CA   C -10.235 -22.176   5.792 1.00 . A A . 71 PHE CA   1 1 
        5  6677 1 1 74 PHE CB   C -10.612 -20.864   6.522 1.00 . A A . 71 PHE CB   1 1 
        5  6678 1 1 74 PHE CD1  C  -9.318 -21.483   8.607 1.00 . A A . 71 PHE CD1  1 1 
        5  6679 1 1 74 PHE CD2  C -11.464 -20.472   8.858 1.00 . A A . 71 PHE CD2  1 1 
        5  6680 1 1 74 PHE CE1  C  -9.187 -21.563   9.978 1.00 . A A . 71 PHE CE1  1 1 
        5  6681 1 1 74 PHE CE2  C -11.338 -20.555  10.229 1.00 . A A . 71 PHE CE2  1 1 
        5  6682 1 1 74 PHE CG   C -10.461 -20.935   8.027 1.00 . A A . 71 PHE CG   1 1 
        5  6683 1 1 74 PHE CZ   C -10.199 -21.100  10.791 1.00 . A A . 71 PHE CZ   1 1 
        5  6684 1 1 74 PHE H    H -10.658 -22.361   3.777 1.00 . A A . 71 PHE H    1 1 
        5  6685 1 1 74 PHE HA   H  -9.328 -22.573   6.223 1.00 . A A . 71 PHE HA   1 1 
        5  6686 1 1 74 PHE HB2  H  -9.975 -20.068   6.169 1.00 . A A . 71 PHE HB2  1 1 
        5  6687 1 1 74 PHE HB3  H -11.641 -20.619   6.308 1.00 . A A . 71 PHE HB3  1 1 
        5  6688 1 1 74 PHE HD1  H  -8.519 -21.844   7.975 1.00 . A A . 71 PHE HD1  1 1 
        5  6689 1 1 74 PHE HD2  H -12.347 -20.035   8.427 1.00 . A A . 71 PHE HD2  1 1 
        5  6690 1 1 74 PHE HE1  H  -8.297 -21.992  10.415 1.00 . A A . 71 PHE HE1  1 1 
        5  6691 1 1 74 PHE HE2  H -12.130 -20.190  10.863 1.00 . A A . 71 PHE HE2  1 1 
        5  6692 1 1 74 PHE HZ   H -10.106 -21.165  11.866 1.00 . A A . 71 PHE HZ   1 1 
        5  6693 1 1 74 PHE N    N  -9.987 -21.973   4.372 1.00 . A A . 71 PHE N    1 1 
        5  6694 1 1 74 PHE O    O -12.155 -23.313   4.992 1.00 . A A . 71 PHE O    1 1 
        5  6695 1 1 75 GLU C    C -12.122 -26.357   6.059 1.00 . A A . 72 GLU C    1 1 
        5  6696 1 1 75 GLU CA   C -12.281 -25.240   7.122 1.00 . A A . 72 GLU CA   1 1 
        5  6697 1 1 75 GLU CB   C -13.806 -24.804   7.124 1.00 . A A . 72 GLU CB   1 1 
        5  6698 1 1 75 GLU CD   C -15.758 -23.339   7.833 1.00 . A A . 72 GLU CD   1 1 
        5  6699 1 1 75 GLU CG   C -14.255 -23.543   7.908 1.00 . A A . 72 GLU CG   1 1 
        5  6700 1 1 75 GLU H    H -10.515 -24.053   7.568 1.00 . A A . 72 GLU H    1 1 
        5  6701 1 1 75 GLU HA   H -12.046 -25.700   8.077 1.00 . A A . 72 GLU HA   1 1 
        5  6702 1 1 75 GLU HB2  H -14.094 -24.646   6.100 1.00 . A A . 72 GLU HB2  1 1 
        5  6703 1 1 75 GLU HB3  H -14.379 -25.641   7.500 1.00 . A A . 72 GLU HB3  1 1 
        5  6704 1 1 75 GLU HG2  H -13.978 -23.612   8.947 1.00 . A A . 72 GLU HG2  1 1 
        5  6705 1 1 75 GLU HG3  H -13.797 -22.680   7.460 1.00 . A A . 72 GLU HG3  1 1 
        5  6706 1 1 75 GLU N    N -11.270 -24.132   6.930 1.00 . A A . 72 GLU N    1 1 
        5  6707 1 1 75 GLU O    O -12.973 -26.545   5.187 1.00 . A A . 72 GLU O    1 1 
        5  6708 1 1 75 GLU OE1  O -16.241 -22.899   6.766 1.00 . A A . 72 GLU OE1  1 1 
        5  6709 1 1 75 GLU OE2  O -16.448 -23.594   8.843 1.00 . A A . 72 GLU OE2  1 1 
        5  6710 1 1 76 GLY C    C  -9.936 -27.993   3.994 1.00 . A A . 73 GLY C    1 1 
        5  6711 1 1 76 GLY CA   C -10.751 -28.218   5.255 1.00 . A A . 73 GLY CA   1 1 
        5  6712 1 1 76 GLY H    H -10.317 -26.823   6.803 1.00 . A A . 73 GLY H    1 1 
        5  6713 1 1 76 GLY HA2  H -10.267 -28.983   5.834 1.00 . A A . 73 GLY HA2  1 1 
        5  6714 1 1 76 GLY HA3  H -11.713 -28.578   4.945 1.00 . A A . 73 GLY HA3  1 1 
        5  6715 1 1 76 GLY N    N -10.982 -27.054   6.114 1.00 . A A . 73 GLY N    1 1 
        5  6716 1 1 76 GLY O    O  -9.499 -28.969   3.384 1.00 . A A . 73 GLY O    1 1 
        5  6717 1 1 77 ASN C    C  -7.729 -25.461   3.324 1.00 . A A . 74 ASN C    1 1 
        5  6718 1 1 77 ASN CA   C  -8.628 -26.481   2.644 1.00 . A A . 74 ASN CA   1 1 
        5  6719 1 1 77 ASN CB   C  -9.127 -26.028   1.229 1.00 . A A . 74 ASN CB   1 1 
        5  6720 1 1 77 ASN CG   C  -7.979 -25.863   0.240 1.00 . A A . 74 ASN CG   1 1 
        5  6721 1 1 77 ASN H    H -10.262 -26.009   3.952 1.00 . A A . 74 ASN H    1 1 
        5  6722 1 1 77 ASN HA   H  -8.064 -27.403   2.533 1.00 . A A . 74 ASN HA   1 1 
        5  6723 1 1 77 ASN HB2  H  -9.808 -26.773   0.806 1.00 . A A . 74 ASN HB2  1 1 
        5  6724 1 1 77 ASN HB3  H  -9.650 -25.091   1.319 1.00 . A A . 74 ASN HB3  1 1 
        5  6725 1 1 77 ASN HD21 H  -8.991 -24.475  -0.748 1.00 . A A . 74 ASN HD21 1 1 
        5  6726 1 1 77 ASN HD22 H  -7.407 -24.828  -1.342 1.00 . A A . 74 ASN HD22 1 1 
        5  6727 1 1 77 ASN N    N  -9.713 -26.757   3.588 1.00 . A A . 74 ASN N    1 1 
        5  6728 1 1 77 ASN ND2  N  -8.144 -24.977  -0.719 1.00 . A A . 74 ASN ND2  1 1 
        5  6729 1 1 77 ASN O    O  -8.232 -24.479   3.840 1.00 . A A . 74 ASN O    1 1 
        5  6730 1 1 77 ASN OD1  O  -6.957 -26.548   0.331 1.00 . A A . 74 ASN OD1  1 1 
        5  6731 1 1 78 LYS C    C  -4.796 -23.854   3.335 1.00 . A A . 75 LYS C    1 1 
        5  6732 1 1 78 LYS CA   C  -5.569 -24.838   4.258 1.00 . A A . 75 LYS CA   1 1 
        5  6733 1 1 78 LYS CB   C  -4.570 -25.653   5.184 1.00 . A A . 75 LYS CB   1 1 
        5  6734 1 1 78 LYS CD   C  -5.224 -26.718   7.515 1.00 . A A . 75 LYS CD   1 1 
        5  6735 1 1 78 LYS CE   C  -6.682 -26.569   7.977 1.00 . A A . 75 LYS CE   1 1 
        5  6736 1 1 78 LYS CG   C  -4.716 -25.469   6.733 1.00 . A A . 75 LYS CG   1 1 
        5  6737 1 1 78 LYS H    H  -6.033 -26.483   2.896 1.00 . A A . 75 LYS H    1 1 
        5  6738 1 1 78 LYS HA   H  -6.238 -24.252   4.881 1.00 . A A . 75 LYS HA   1 1 
        5  6739 1 1 78 LYS HB2  H  -4.651 -26.704   4.975 1.00 . A A . 75 LYS HB2  1 1 
        5  6740 1 1 78 LYS HB3  H  -3.563 -25.351   4.915 1.00 . A A . 75 LYS HB3  1 1 
        5  6741 1 1 78 LYS HD2  H  -5.120 -27.622   6.923 1.00 . A A . 75 LYS HD2  1 1 
        5  6742 1 1 78 LYS HD3  H  -4.606 -26.832   8.405 1.00 . A A . 75 LYS HD3  1 1 
        5  6743 1 1 78 LYS HE2  H  -7.188 -25.812   7.385 1.00 . A A . 75 LYS HE2  1 1 
        5  6744 1 1 78 LYS HE3  H  -7.192 -27.515   7.867 1.00 . A A . 75 LYS HE3  1 1 
        5  6745 1 1 78 LYS HG2  H  -3.744 -25.212   7.130 1.00 . A A . 75 LYS HG2  1 1 
        5  6746 1 1 78 LYS HG3  H  -5.386 -24.648   6.932 1.00 . A A . 75 LYS HG3  1 1 
        5  6747 1 1 78 LYS HZ1  H  -7.735 -26.023   9.690 1.00 . A A . 75 LYS HZ1  1 1 
        5  6748 1 1 78 LYS HZ2  H  -6.228 -25.269   9.543 1.00 . A A . 75 LYS HZ2  1 1 
        5  6749 1 1 78 LYS HZ3  H  -6.319 -26.897   9.999 1.00 . A A . 75 LYS HZ3  1 1 
        5  6750 1 1 78 LYS N    N  -6.436 -25.738   3.450 1.00 . A A . 75 LYS N    1 1 
        5  6751 1 1 78 LYS NZ   N  -6.745 -26.157   9.399 1.00 . A A . 75 LYS NZ   1 1 
        5  6752 1 1 78 LYS O    O  -3.846 -24.305   2.690 1.00 . A A . 75 LYS O    1 1 
        5  6753 1 1 79 LEU C    C  -4.756 -20.059   2.603 1.00 . A A . 76 LEU C    1 1 
        5  6754 1 1 79 LEU CA   C  -4.393 -21.571   2.371 1.00 . A A . 76 LEU CA   1 1 
        5  6755 1 1 79 LEU CB   C  -4.648 -21.896   0.860 1.00 . A A . 76 LEU CB   1 1 
        5  6756 1 1 79 LEU CD1  C  -3.870 -23.193  -1.112 1.00 . A A . 76 LEU CD1  1 1 
        5  6757 1 1 79 LEU CD2  C  -2.636 -21.137  -0.475 1.00 . A A . 76 LEU CD2  1 1 
        5  6758 1 1 79 LEU CG   C  -3.424 -22.336   0.051 1.00 . A A . 76 LEU CG   1 1 
        5  6759 1 1 79 LEU H    H  -5.920 -22.173   3.767 1.00 . A A . 76 LEU H    1 1 
        5  6760 1 1 79 LEU HA   H  -3.337 -21.729   2.552 1.00 . A A . 76 LEU HA   1 1 
        5  6761 1 1 79 LEU HB2  H  -5.388 -22.680   0.780 1.00 . A A . 76 LEU HB2  1 1 
        5  6762 1 1 79 LEU HB3  H  -5.049 -21.002   0.395 1.00 . A A . 76 LEU HB3  1 1 
        5  6763 1 1 79 LEU HD11 H  -3.009 -23.473  -1.697 1.00 . A A . 76 LEU HD11 1 1 
        5  6764 1 1 79 LEU HD12 H  -4.555 -22.628  -1.727 1.00 . A A . 76 LEU HD12 1 1 
        5  6765 1 1 79 LEU HD13 H  -4.362 -24.078  -0.740 1.00 . A A . 76 LEU HD13 1 1 
        5  6766 1 1 79 LEU HD21 H  -3.278 -20.524  -1.090 1.00 . A A . 76 LEU HD21 1 1 
        5  6767 1 1 79 LEU HD22 H  -1.805 -21.491  -1.070 1.00 . A A . 76 LEU HD22 1 1 
        5  6768 1 1 79 LEU HD23 H  -2.256 -20.551   0.345 1.00 . A A . 76 LEU HD23 1 1 
        5  6769 1 1 79 LEU HG   H  -2.773 -22.925   0.682 1.00 . A A . 76 LEU HG   1 1 
        5  6770 1 1 79 LEU N    N  -5.157 -22.519   3.256 1.00 . A A . 76 LEU N    1 1 
        5  6771 1 1 79 LEU O    O  -5.274 -19.472   1.707 1.00 . A A . 76 LEU O    1 1 
        5  6772 1 1 80 ARG C    C  -3.881 -16.915   3.482 1.00 . A A . 77 ARG C    1 1 
        5  6773 1 1 80 ARG CA   C  -4.900 -17.998   4.004 1.00 . A A . 77 ARG CA   1 1 
        5  6774 1 1 80 ARG CB   C  -5.183 -17.867   5.557 1.00 . A A . 77 ARG CB   1 1 
        5  6775 1 1 80 ARG CD   C  -5.610 -15.267   5.694 1.00 . A A . 77 ARG CD   1 1 
        5  6776 1 1 80 ARG CG   C  -4.868 -16.498   6.235 1.00 . A A . 77 ARG CG   1 1 
        5  6777 1 1 80 ARG CZ   C  -6.743 -13.785   7.343 1.00 . A A . 77 ARG CZ   1 1 
        5  6778 1 1 80 ARG H    H  -3.814 -19.797   4.394 1.00 . A A . 77 ARG H    1 1 
        5  6779 1 1 80 ARG HA   H  -5.847 -17.884   3.492 1.00 . A A . 77 ARG HA   1 1 
        5  6780 1 1 80 ARG HB2  H  -6.222 -18.113   5.743 1.00 . A A . 77 ARG HB2  1 1 
        5  6781 1 1 80 ARG HB3  H  -4.585 -18.621   6.064 1.00 . A A . 77 ARG HB3  1 1 
        5  6782 1 1 80 ARG HD2  H  -4.896 -14.460   5.627 1.00 . A A . 77 ARG HD2  1 1 
        5  6783 1 1 80 ARG HD3  H  -5.986 -15.459   4.702 1.00 . A A . 77 ARG HD3  1 1 
        5  6784 1 1 80 ARG HE   H  -7.518 -15.454   6.545 1.00 . A A . 77 ARG HE   1 1 
        5  6785 1 1 80 ARG HG2  H  -5.105 -16.575   7.283 1.00 . A A . 77 ARG HG2  1 1 
        5  6786 1 1 80 ARG HG3  H  -3.807 -16.320   6.135 1.00 . A A . 77 ARG HG3  1 1 
        5  6787 1 1 80 ARG HH11 H  -4.877 -13.156   6.833 1.00 . A A . 77 ARG HH11 1 1 
        5  6788 1 1 80 ARG HH12 H  -5.701 -12.155   7.976 1.00 . A A . 77 ARG HH12 1 1 
        5  6789 1 1 80 ARG HH21 H  -8.624 -14.123   8.028 1.00 . A A . 77 ARG HH21 1 1 
        5  6790 1 1 80 ARG HH22 H  -7.853 -12.707   8.661 1.00 . A A . 77 ARG HH22 1 1 
        5  6791 1 1 80 ARG N    N  -4.415 -19.386   3.733 1.00 . A A . 77 ARG N    1 1 
        5  6792 1 1 80 ARG NE   N  -6.725 -14.878   6.563 1.00 . A A . 77 ARG NE   1 1 
        5  6793 1 1 80 ARG NH1  N  -5.687 -12.966   7.393 1.00 . A A . 77 ARG NH1  1 1 
        5  6794 1 1 80 ARG NH2  N  -7.826 -13.515   8.067 1.00 . A A . 77 ARG NH2  1 1 
        5  6795 1 1 80 ARG O    O  -2.741 -16.846   3.958 1.00 . A A . 77 ARG O    1 1 
        5  6796 1 1 81 VAL C    C  -4.367 -13.609   2.267 1.00 . A A . 78 VAL C    1 1 
        5  6797 1 1 81 VAL CA   C  -3.463 -14.854   2.173 1.00 . A A . 78 VAL CA   1 1 
        5  6798 1 1 81 VAL CB   C  -2.765 -14.931   0.742 1.00 . A A . 78 VAL CB   1 1 
        5  6799 1 1 81 VAL CG1  C  -1.865 -13.719   0.549 1.00 . A A . 78 VAL CG1  1 1 
        5  6800 1 1 81 VAL CG2  C  -1.912 -16.205   0.607 1.00 . A A . 78 VAL CG2  1 1 
        5  6801 1 1 81 VAL H    H  -5.169 -16.146   2.051 1.00 . A A . 78 VAL H    1 1 
        5  6802 1 1 81 VAL HA   H  -2.685 -14.779   2.911 1.00 . A A . 78 VAL HA   1 1 
        5  6803 1 1 81 VAL HB   H  -3.518 -14.911  -0.074 1.00 . A A . 78 VAL HB   1 1 
        5  6804 1 1 81 VAL HG11 H  -1.399 -13.763  -0.425 1.00 . A A . 78 VAL HG11 1 1 
        5  6805 1 1 81 VAL HG12 H  -1.104 -13.714   1.312 1.00 . A A . 78 VAL HG12 1 1 
        5  6806 1 1 81 VAL HG13 H  -2.457 -12.818   0.627 1.00 . A A . 78 VAL HG13 1 1 
        5  6807 1 1 81 VAL HG21 H  -1.666 -16.581   1.589 1.00 . A A . 78 VAL HG21 1 1 
        5  6808 1 1 81 VAL HG22 H  -0.995 -15.966   0.085 1.00 . A A . 78 VAL HG22 1 1 
        5  6809 1 1 81 VAL HG23 H  -2.444 -16.965   0.054 1.00 . A A . 78 VAL HG23 1 1 
        5  6810 1 1 81 VAL N    N  -4.289 -16.039   2.509 1.00 . A A . 78 VAL N    1 1 
        5  6811 1 1 81 VAL O    O  -5.334 -13.525   1.497 1.00 . A A . 78 VAL O    1 1 
        5  6812 1 1 82 GLU C    C  -4.227 -10.250   3.784 1.00 . A A . 79 GLU C    1 1 
        5  6813 1 1 82 GLU CA   C  -4.980 -11.487   3.297 1.00 . A A . 79 GLU CA   1 1 
        5  6814 1 1 82 GLU CB   C  -6.129 -11.838   4.243 1.00 . A A . 79 GLU CB   1 1 
        5  6815 1 1 82 GLU CD   C  -8.580 -11.748   4.786 1.00 . A A . 79 GLU CD   1 1 
        5  6816 1 1 82 GLU CG   C  -7.515 -11.427   3.766 1.00 . A A . 79 GLU CG   1 1 
        5  6817 1 1 82 GLU H    H  -3.374 -12.724   3.846 1.00 . A A . 79 GLU H    1 1 
        5  6818 1 1 82 GLU HA   H  -5.381 -11.295   2.318 1.00 . A A . 79 GLU HA   1 1 
        5  6819 1 1 82 GLU HB2  H  -6.136 -12.912   4.362 1.00 . A A . 79 GLU HB2  1 1 
        5  6820 1 1 82 GLU HB3  H  -5.946 -11.380   5.204 1.00 . A A . 79 GLU HB3  1 1 
        5  6821 1 1 82 GLU HG2  H  -7.535 -10.368   3.582 1.00 . A A . 79 GLU HG2  1 1 
        5  6822 1 1 82 GLU HG3  H  -7.738 -11.964   2.857 1.00 . A A . 79 GLU HG3  1 1 
        5  6823 1 1 82 GLU N    N  -4.106 -12.646   3.206 1.00 . A A . 79 GLU N    1 1 
        5  6824 1 1 82 GLU O    O  -3.386 -10.315   4.712 1.00 . A A . 79 GLU O    1 1 
        5  6825 1 1 82 GLU OE1  O  -8.809 -10.907   5.682 1.00 . A A . 79 GLU OE1  1 1 
        5  6826 1 1 82 GLU OE2  O  -9.169 -12.853   4.716 1.00 . A A . 79 GLU OE2  1 1 
        5  6827 1 1 83 VAL C    C  -5.069  -7.197   4.565 1.00 . A A . 80 VAL C    1 1 
        5  6828 1 1 83 VAL CA   C  -4.047  -7.830   3.606 1.00 . A A . 80 VAL CA   1 1 
        5  6829 1 1 83 VAL CB   C  -3.710  -6.863   2.423 1.00 . A A . 80 VAL CB   1 1 
        5  6830 1 1 83 VAL CG1  C  -2.590  -7.442   1.578 1.00 . A A . 80 VAL CG1  1 1 
        5  6831 1 1 83 VAL CG2  C  -4.911  -6.547   1.537 1.00 . A A . 80 VAL CG2  1 1 
        5  6832 1 1 83 VAL H    H  -5.050  -9.148   2.321 1.00 . A A . 80 VAL H    1 1 
        5  6833 1 1 83 VAL HA   H  -3.132  -8.009   4.153 1.00 . A A . 80 VAL HA   1 1 
        5  6834 1 1 83 VAL HB   H  -3.354  -5.932   2.846 1.00 . A A . 80 VAL HB   1 1 
        5  6835 1 1 83 VAL HG11 H  -1.643  -7.103   1.959 1.00 . A A . 80 VAL HG11 1 1 
        5  6836 1 1 83 VAL HG12 H  -2.703  -7.131   0.554 1.00 . A A . 80 VAL HG12 1 1 
        5  6837 1 1 83 VAL HG13 H  -2.621  -8.519   1.632 1.00 . A A . 80 VAL HG13 1 1 
        5  6838 1 1 83 VAL HG21 H  -5.675  -6.066   2.130 1.00 . A A . 80 VAL HG21 1 1 
        5  6839 1 1 83 VAL HG22 H  -5.306  -7.456   1.109 1.00 . A A . 80 VAL HG22 1 1 
        5  6840 1 1 83 VAL HG23 H  -4.602  -5.879   0.739 1.00 . A A . 80 VAL HG23 1 1 
        5  6841 1 1 83 VAL N    N  -4.519  -9.115   3.144 1.00 . A A . 80 VAL N    1 1 
        5  6842 1 1 83 VAL O    O  -6.267  -7.147   4.282 1.00 . A A . 80 VAL O    1 1 
        5  6843 1 1 84 PRO C    C  -5.083  -4.350   6.220 1.00 . A A . 81 PRO C    1 1 
        5  6844 1 1 84 PRO CA   C  -5.380  -5.831   6.579 1.00 . A A . 81 PRO CA   1 1 
        5  6845 1 1 84 PRO CB   C  -4.921  -6.173   8.008 1.00 . A A . 81 PRO CB   1 1 
        5  6846 1 1 84 PRO CD   C  -3.422  -7.263   6.443 1.00 . A A . 81 PRO CD   1 1 
        5  6847 1 1 84 PRO CG   C  -3.569  -6.799   7.873 1.00 . A A . 81 PRO CG   1 1 
        5  6848 1 1 84 PRO HA   H  -6.443  -6.007   6.499 1.00 . A A . 81 PRO HA   1 1 
        5  6849 1 1 84 PRO HB2  H  -4.866  -5.269   8.603 1.00 . A A . 81 PRO HB2  1 1 
        5  6850 1 1 84 PRO HB3  H  -5.609  -6.872   8.464 1.00 . A A . 81 PRO HB3  1 1 
        5  6851 1 1 84 PRO HD2  H  -2.539  -6.828   6.006 1.00 . A A . 81 PRO HD2  1 1 
        5  6852 1 1 84 PRO HD3  H  -3.379  -8.340   6.400 1.00 . A A . 81 PRO HD3  1 1 
        5  6853 1 1 84 PRO HG2  H  -2.809  -6.065   8.102 1.00 . A A . 81 PRO HG2  1 1 
        5  6854 1 1 84 PRO HG3  H  -3.482  -7.647   8.542 1.00 . A A . 81 PRO HG3  1 1 
        5  6855 1 1 84 PRO N    N  -4.622  -6.768   5.755 1.00 . A A . 81 PRO N    1 1 
        5  6856 1 1 84 PRO O    O  -5.152  -3.475   7.087 1.00 . A A . 81 PRO O    1 1 
        5  6857 1 1 85 PHE C    C  -5.562  -2.342   3.352 1.00 . A A . 82 PHE C    1 1 
        5  6858 1 1 85 PHE CA   C  -4.579  -2.698   4.473 1.00 . A A . 82 PHE CA   1 1 
        5  6859 1 1 85 PHE CB   C  -3.095  -2.370   4.065 1.00 . A A . 82 PHE CB   1 1 
        5  6860 1 1 85 PHE CD1  C  -2.919  -3.039   1.603 1.00 . A A . 82 PHE CD1  1 1 
        5  6861 1 1 85 PHE CD2  C  -1.289  -3.856   3.114 1.00 . A A . 82 PHE CD2  1 1 
        5  6862 1 1 85 PHE CE1  C  -2.279  -3.662   0.553 1.00 . A A . 82 PHE CE1  1 1 
        5  6863 1 1 85 PHE CE2  C  -0.636  -4.460   2.071 1.00 . A A . 82 PHE CE2  1 1 
        5  6864 1 1 85 PHE CG   C  -2.440  -3.133   2.905 1.00 . A A . 82 PHE CG   1 1 
        5  6865 1 1 85 PHE CZ   C  -1.127  -4.370   0.784 1.00 . A A . 82 PHE CZ   1 1 
        5  6866 1 1 85 PHE H    H  -4.699  -4.831   4.304 1.00 . A A . 82 PHE H    1 1 
        5  6867 1 1 85 PHE HA   H  -4.836  -2.066   5.312 1.00 . A A . 82 PHE HA   1 1 
        5  6868 1 1 85 PHE HB2  H  -3.058  -1.331   3.793 1.00 . A A . 82 PHE HB2  1 1 
        5  6869 1 1 85 PHE HB3  H  -2.457  -2.503   4.934 1.00 . A A . 82 PHE HB3  1 1 
        5  6870 1 1 85 PHE HD1  H  -3.832  -2.483   1.420 1.00 . A A . 82 PHE HD1  1 1 
        5  6871 1 1 85 PHE HD2  H  -0.898  -3.955   4.113 1.00 . A A . 82 PHE HD2  1 1 
        5  6872 1 1 85 PHE HE1  H  -2.672  -3.583  -0.447 1.00 . A A . 82 PHE HE1  1 1 
        5  6873 1 1 85 PHE HE2  H   0.267  -5.019   2.269 1.00 . A A . 82 PHE HE2  1 1 
        5  6874 1 1 85 PHE HZ   H  -0.609  -4.846  -0.034 1.00 . A A . 82 PHE HZ   1 1 
        5  6875 1 1 85 PHE N    N  -4.771  -4.079   4.939 1.00 . A A . 82 PHE N    1 1 
        5  6876 1 1 85 PHE O    O  -5.962  -1.183   3.230 1.00 . A A . 82 PHE O    1 1 
        5  6877 1 1 86 ASN C    C  -6.073  -2.591   0.146 1.00 . A A . 83 ASN C    1 1 
        5  6878 1 1 86 ASN CA   C  -6.781  -3.283   1.333 1.00 . A A . 83 ASN CA   1 1 
        5  6879 1 1 86 ASN CB   C  -8.186  -2.671   1.594 1.00 . A A . 83 ASN CB   1 1 
        5  6880 1 1 86 ASN CG   C  -8.993  -3.476   2.605 1.00 . A A . 83 ASN CG   1 1 
        5  6881 1 1 86 ASN H    H  -5.624  -4.256   2.827 1.00 . A A . 83 ASN H    1 1 
        5  6882 1 1 86 ASN HA   H  -6.932  -4.300   1.024 1.00 . A A . 83 ASN HA   1 1 
        5  6883 1 1 86 ASN HB2  H  -8.072  -1.665   1.964 1.00 . A A . 83 ASN HB2  1 1 
        5  6884 1 1 86 ASN HB3  H  -8.752  -2.653   0.661 1.00 . A A . 83 ASN HB3  1 1 
        5  6885 1 1 86 ASN HD21 H  -9.819  -4.532   1.141 1.00 . A A . 83 ASN HD21 1 1 
        5  6886 1 1 86 ASN HD22 H -10.310  -4.961   2.740 1.00 . A A . 83 ASN HD22 1 1 
        5  6887 1 1 86 ASN N    N  -5.933  -3.373   2.563 1.00 . A A . 83 ASN N    1 1 
        5  6888 1 1 86 ASN ND2  N  -9.792  -4.414   2.112 1.00 . A A . 83 ASN ND2  1 1 
        5  6889 1 1 86 ASN O    O  -5.943  -3.200  -0.916 1.00 . A A . 83 ASN O    1 1 
        5  6890 1 1 86 ASN OD1  O  -8.911  -3.251   3.812 1.00 . A A . 83 ASN OD1  1 1 
        5  6891 1 1 87 ALA C    C  -4.363   0.722  -0.012 1.00 . A A . 84 ALA C    1 1 
        5  6892 1 1 87 ALA CA   C  -4.921  -0.538  -0.688 1.00 . A A . 84 ALA CA   1 1 
        5  6893 1 1 87 ALA CB   C  -5.910  -0.164  -1.812 1.00 . A A . 84 ALA CB   1 1 
        5  6894 1 1 87 ALA H    H  -5.547  -1.022   1.290 1.00 . A A . 84 ALA H    1 1 
        5  6895 1 1 87 ALA HA   H  -4.109  -1.112  -1.114 1.00 . A A . 84 ALA HA   1 1 
        5  6896 1 1 87 ALA HB1  H  -5.381   0.352  -2.598 1.00 . A A . 84 ALA HB1  1 1 
        5  6897 1 1 87 ALA HB2  H  -6.684   0.476  -1.421 1.00 . A A . 84 ALA HB2  1 1 
        5  6898 1 1 87 ALA HB3  H  -6.360  -1.063  -2.216 1.00 . A A . 84 ALA HB3  1 1 
        5  6899 1 1 87 ALA N    N  -5.559  -1.368   0.356 1.00 . A A . 84 ALA N    1 1 
        5  6900 1 1 87 ALA O    O  -4.455   0.837   1.213 1.00 . A A . 84 ALA O    1 1 
        5  6901 1 1 88 ARG C    C  -4.500   3.934  -0.182 1.00 . A A . 85 ARG C    1 1 
        5  6902 1 1 88 ARG CA   C  -3.321   2.935  -0.144 1.00 . A A . 85 ARG CA   1 1 
        5  6903 1 1 88 ARG CB   C  -2.081   3.582  -0.843 1.00 . A A . 85 ARG CB   1 1 
        5  6904 1 1 88 ARG CD   C  -1.265   6.008  -0.763 1.00 . A A . 85 ARG CD   1 1 
        5  6905 1 1 88 ARG CG   C  -1.400   4.694  -0.002 1.00 . A A . 85 ARG CG   1 1 
        5  6906 1 1 88 ARG CZ   C  -0.495   7.901   0.674 1.00 . A A . 85 ARG CZ   1 1 
        5  6907 1 1 88 ARG H    H  -3.661   1.518  -1.735 1.00 . A A . 85 ARG H    1 1 
        5  6908 1 1 88 ARG HA   H  -3.069   2.691   0.886 1.00 . A A . 85 ARG HA   1 1 
        5  6909 1 1 88 ARG HB2  H  -1.352   2.811  -1.050 1.00 . A A . 85 ARG HB2  1 1 
        5  6910 1 1 88 ARG HB3  H  -2.396   4.027  -1.778 1.00 . A A . 85 ARG HB3  1 1 
        5  6911 1 1 88 ARG HD2  H  -0.964   5.804  -1.786 1.00 . A A . 85 ARG HD2  1 1 
        5  6912 1 1 88 ARG HD3  H  -2.214   6.528  -0.763 1.00 . A A . 85 ARG HD3  1 1 
        5  6913 1 1 88 ARG HE   H   0.682   6.645  -0.341 1.00 . A A . 85 ARG HE   1 1 
        5  6914 1 1 88 ARG HG2  H  -2.001   4.883   0.877 1.00 . A A . 85 ARG HG2  1 1 
        5  6915 1 1 88 ARG HG3  H  -0.416   4.382   0.313 1.00 . A A . 85 ARG HG3  1 1 
        5  6916 1 1 88 ARG HH11 H  -2.533   7.783   0.621 1.00 . A A . 85 ARG HH11 1 1 
        5  6917 1 1 88 ARG HH12 H  -1.880   9.057   1.601 1.00 . A A . 85 ARG HH12 1 1 
        5  6918 1 1 88 ARG HH21 H   1.466   8.293   0.949 1.00 . A A . 85 ARG HH21 1 1 
        5  6919 1 1 88 ARG HH22 H   0.374   9.344   1.784 1.00 . A A . 85 ARG HH22 1 1 
        5  6920 1 1 88 ARG N    N  -3.765   1.664  -0.769 1.00 . A A . 85 ARG N    1 1 
        5  6921 1 1 88 ARG NE   N  -0.253   6.867  -0.140 1.00 . A A . 85 ARG NE   1 1 
        5  6922 1 1 88 ARG NH1  N  -1.731   8.274   0.999 1.00 . A A . 85 ARG NH1  1 1 
        5  6923 1 1 88 ARG NH2  N   0.528   8.568   1.175 1.00 . A A . 85 ARG NH2  1 1 
        5  6924 1 1 88 ARG O    O  -5.355   3.814  -1.057 1.00 . A A . 85 ARG O    1 1 
        5  6925 1 1 89 GLU C    C  -5.259   7.104  -0.087 1.00 . A A . 86 GLU C    1 1 
        5  6926 1 1 89 GLU CA   C  -5.635   5.889   0.767 1.00 . A A . 86 GLU CA   1 1 
        5  6927 1 1 89 GLU CB   C  -5.894   6.305   2.220 1.00 . A A . 86 GLU CB   1 1 
        5  6928 1 1 89 GLU CD   C  -8.315   6.016   2.892 1.00 . A A . 86 GLU CD   1 1 
        5  6929 1 1 89 GLU CG   C  -7.239   6.995   2.467 1.00 . A A . 86 GLU CG   1 1 
        5  6930 1 1 89 GLU H    H  -3.798   5.052   1.353 1.00 . A A . 86 GLU H    1 1 
        5  6931 1 1 89 GLU HA   H  -6.519   5.419   0.361 1.00 . A A . 86 GLU HA   1 1 
        5  6932 1 1 89 GLU HB2  H  -5.857   5.418   2.838 1.00 . A A . 86 GLU HB2  1 1 
        5  6933 1 1 89 GLU HB3  H  -5.100   6.975   2.527 1.00 . A A . 86 GLU HB3  1 1 
        5  6934 1 1 89 GLU HG2  H  -7.125   7.740   3.245 1.00 . A A . 86 GLU HG2  1 1 
        5  6935 1 1 89 GLU HG3  H  -7.560   7.482   1.554 1.00 . A A . 86 GLU HG3  1 1 
        5  6936 1 1 89 GLU N    N  -4.538   4.929   0.726 1.00 . A A . 86 GLU N    1 1 
        5  6937 1 1 89 GLU O    O  -4.563   8.002   0.438 1.00 . A A . 86 GLU O    1 1 
        5  6938 1 1 89 GLU OXT  O  -5.602   7.123  -1.284 1.00 . A A . 86 GLU OXT  1 1 
        5  6939 1 1 89 GLU OE1  O  -8.404   5.725   4.111 1.00 . A A . 86 GLU OE1  1 1 
        5  6940 1 1 89 GLU OE2  O  -9.083   5.556   2.024 1.00 . A A . 86 GLU OE2  1 1 
        6  6941 1 1  1 GLY C    C -14.311  -3.440  -0.326 1.00 . A A . -2 GLY C    1 1 
        6  6942 1 1  1 GLY CA   C -14.386  -4.852   0.223 1.00 . A A . -2 GLY CA   1 1 
        6  6943 1 1  1 GLY H1   H -15.152  -6.728  -0.274 1.00 . A A . -2 GLY H1   1 1 
        6  6944 1 1  1 GLY H2   H -14.641  -5.821  -1.609 1.00 . A A . -2 GLY H2   1 1 
        6  6945 1 1  1 GLY H3   H -16.091  -5.432  -0.827 1.00 . A A . -2 GLY H3   1 1 
        6  6946 1 1  1 GLY HA2  H -14.897  -4.829   1.174 1.00 . A A . -2 GLY HA2  1 1 
        6  6947 1 1  1 GLY HA3  H -13.386  -5.229   0.375 1.00 . A A . -2 GLY HA3  1 1 
        6  6948 1 1  1 GLY N    N -15.117  -5.773  -0.686 1.00 . A A . -2 GLY N    1 1 
        6  6949 1 1  1 GLY O    O -15.327  -2.917  -0.802 1.00 . A A . -2 GLY O    1 1 
        6  6950 1 1  2 SER C    C -13.476  -0.402   0.128 1.00 . A A . -1 SER C    1 1 
        6  6951 1 1  2 SER CA   C -12.784  -1.489  -0.733 1.00 . A A . -1 SER CA   1 1 
        6  6952 1 1  2 SER CB   C -13.120  -1.369  -2.245 1.00 . A A . -1 SER CB   1 1 
        6  6953 1 1  2 SER H    H -12.383  -3.339   0.206 1.00 . A A . -1 SER H    1 1 
        6  6954 1 1  2 SER HA   H -11.720  -1.364  -0.613 1.00 . A A . -1 SER HA   1 1 
        6  6955 1 1  2 SER HB2  H -12.836  -2.279  -2.742 1.00 . A A . -1 SER HB2  1 1 
        6  6956 1 1  2 SER HB3  H -14.184  -1.217  -2.361 1.00 . A A . -1 SER HB3  1 1 
        6  6957 1 1  2 SER HG   H -12.456  -0.412  -3.822 1.00 . A A . -1 SER HG   1 1 
        6  6958 1 1  2 SER N    N -13.102  -2.843  -0.234 1.00 . A A . -1 SER N    1 1 
        6  6959 1 1  2 SER O    O -13.937  -0.702   1.239 1.00 . A A . -1 SER O    1 1 
        6  6960 1 1  2 SER OG   O -12.438  -0.288  -2.864 1.00 . A A . -1 SER OG   1 1 
        6  6961 1 1  3 HIS C    C -13.518   2.342   1.657 1.00 . A A .  0 HIS C    1 1 
        6  6962 1 1  3 HIS CA   C -14.145   2.013   0.274 1.00 . A A .  0 HIS CA   1 1 
        6  6963 1 1  3 HIS CB   C -15.677   1.723   0.336 1.00 . A A .  0 HIS CB   1 1 
        6  6964 1 1  3 HIS CD2  C -16.431   4.228   0.493 1.00 . A A .  0 HIS CD2  1 1 
        6  6965 1 1  3 HIS CE1  C -18.351   3.905   1.495 1.00 . A A .  0 HIS CE1  1 1 
        6  6966 1 1  3 HIS CG   C -16.576   2.891   0.682 1.00 . A A .  0 HIS CG   1 1 
        6  6967 1 1  3 HIS H    H -12.955   1.022  -1.190 1.00 . A A .  0 HIS H    1 1 
        6  6968 1 1  3 HIS HA   H -13.986   2.863  -0.370 1.00 . A A .  0 HIS HA   1 1 
        6  6969 1 1  3 HIS HB2  H -15.992   1.351  -0.626 1.00 . A A .  0 HIS HB2  1 1 
        6  6970 1 1  3 HIS HB3  H -15.843   0.949   1.072 1.00 . A A .  0 HIS HB3  1 1 
        6  6971 1 1  3 HIS HD1  H -18.194   1.866   1.555 1.00 . A A .  0 HIS HD1  1 1 
        6  6972 1 1  3 HIS HD2  H -15.595   4.720   0.010 1.00 . A A .  0 HIS HD2  1 1 
        6  6973 1 1  3 HIS HE1  H -19.306   4.080   1.967 1.00 . A A .  0 HIS HE1  1 1 
        6  6974 1 1  3 HIS HE2  H -17.618   5.793   1.226 1.00 . A A .  0 HIS HE2  1 1 
        6  6975 1 1  3 HIS N    N -13.456   0.862  -0.357 1.00 . A A .  0 HIS N    1 1 
        6  6976 1 1  3 HIS ND1  N -17.790   2.728   1.306 1.00 . A A .  0 HIS ND1  1 1 
        6  6977 1 1  3 HIS NE2  N -17.546   4.839   1.016 1.00 . A A .  0 HIS NE2  1 1 
        6  6978 1 1  3 HIS O    O -14.203   2.714   2.613 1.00 . A A .  0 HIS O    1 1 
        6  6979 1 1  4 MET C    C -10.189   3.294   2.692 1.00 . A A .  1 MET C    1 1 
        6  6980 1 1  4 MET CA   C -11.436   2.449   2.972 1.00 . A A .  1 MET CA   1 1 
        6  6981 1 1  4 MET CB   C -11.001   1.111   3.598 1.00 . A A .  1 MET CB   1 1 
        6  6982 1 1  4 MET CE   C -13.125  -2.194   5.001 1.00 . A A .  1 MET CE   1 1 
        6  6983 1 1  4 MET CG   C -12.140   0.213   4.062 1.00 . A A .  1 MET CG   1 1 
        6  6984 1 1  4 MET H    H -11.684   2.021   0.912 1.00 . A A .  1 MET H    1 1 
        6  6985 1 1  4 MET HA   H -12.075   2.979   3.663 1.00 . A A .  1 MET HA   1 1 
        6  6986 1 1  4 MET HB2  H -10.425   0.562   2.868 1.00 . A A .  1 MET HB2  1 1 
        6  6987 1 1  4 MET HB3  H -10.371   1.318   4.450 1.00 . A A .  1 MET HB3  1 1 
        6  6988 1 1  4 MET HE1  H -12.942  -3.184   5.392 1.00 . A A .  1 MET HE1  1 1 
        6  6989 1 1  4 MET HE2  H -13.720  -2.267   4.102 1.00 . A A .  1 MET HE2  1 1 
        6  6990 1 1  4 MET HE3  H -13.655  -1.609   5.737 1.00 . A A .  1 MET HE3  1 1 
        6  6991 1 1  4 MET HG2  H -12.654   0.697   4.877 1.00 . A A .  1 MET HG2  1 1 
        6  6992 1 1  4 MET HG3  H -12.824   0.071   3.239 1.00 . A A .  1 MET HG3  1 1 
        6  6993 1 1  4 MET N    N -12.184   2.233   1.728 1.00 . A A .  1 MET N    1 1 
        6  6994 1 1  4 MET O    O  -9.492   3.071   1.695 1.00 . A A .  1 MET O    1 1 
        6  6995 1 1  4 MET SD   S -11.565  -1.400   4.620 1.00 . A A .  1 MET SD   1 1 
        6  6996 1 1  5 VAL C    C  -8.151   5.519   4.787 1.00 . A A .  2 VAL C    1 1 
        6  6997 1 1  5 VAL CA   C  -8.736   5.123   3.411 1.00 . A A .  2 VAL CA   1 1 
        6  6998 1 1  5 VAL CB   C  -9.058   6.360   2.491 1.00 . A A .  2 VAL CB   1 1 
        6  6999 1 1  5 VAL CG1  C -10.215   7.219   3.006 1.00 . A A .  2 VAL CG1  1 1 
        6  7000 1 1  5 VAL CG2  C  -7.821   7.216   2.251 1.00 . A A .  2 VAL CG2  1 1 
        6  7001 1 1  5 VAL H    H -10.485   4.381   4.351 1.00 . A A .  2 VAL H    1 1 
        6  7002 1 1  5 VAL HA   H  -7.983   4.534   2.906 1.00 . A A .  2 VAL HA   1 1 
        6  7003 1 1  5 VAL HB   H  -9.364   5.966   1.531 1.00 . A A .  2 VAL HB   1 1 
        6  7004 1 1  5 VAL HG11 H  -9.965   7.620   3.977 1.00 . A A .  2 VAL HG11 1 1 
        6  7005 1 1  5 VAL HG12 H -11.108   6.615   3.088 1.00 . A A .  2 VAL HG12 1 1 
        6  7006 1 1  5 VAL HG13 H -10.394   8.032   2.317 1.00 . A A .  2 VAL HG13 1 1 
        6  7007 1 1  5 VAL HG21 H  -7.475   7.616   3.190 1.00 . A A .  2 VAL HG21 1 1 
        6  7008 1 1  5 VAL HG22 H  -8.068   8.031   1.586 1.00 . A A .  2 VAL HG22 1 1 
        6  7009 1 1  5 VAL HG23 H  -7.042   6.611   1.808 1.00 . A A .  2 VAL HG23 1 1 
        6  7010 1 1  5 VAL N    N  -9.904   4.255   3.573 1.00 . A A .  2 VAL N    1 1 
        6  7011 1 1  5 VAL O    O  -8.806   6.156   5.618 1.00 . A A .  2 VAL O    1 1 
        6  7012 1 1  6 ILE C    C  -4.830   5.794   6.099 1.00 . A A .  3 ILE C    1 1 
        6  7013 1 1  6 ILE CA   C  -6.245   5.247   6.332 1.00 . A A .  3 ILE CA   1 1 
        6  7014 1 1  6 ILE CB   C  -6.208   3.878   7.124 1.00 . A A .  3 ILE CB   1 1 
        6  7015 1 1  6 ILE CD1  C  -7.910   1.970   7.294 1.00 . A A .  3 ILE CD1  1 1 
        6  7016 1 1  6 ILE CG1  C  -7.638   3.447   7.498 1.00 . A A .  3 ILE CG1  1 1 
        6  7017 1 1  6 ILE CG2  C  -5.325   3.925   8.394 1.00 . A A .  3 ILE CG2  1 1 
        6  7018 1 1  6 ILE H    H  -6.431   4.609   4.318 1.00 . A A .  3 ILE H    1 1 
        6  7019 1 1  6 ILE HA   H  -6.814   5.964   6.908 1.00 . A A .  3 ILE HA   1 1 
        6  7020 1 1  6 ILE HB   H  -5.787   3.136   6.466 1.00 . A A .  3 ILE HB   1 1 
        6  7021 1 1  6 ILE HD11 H  -7.180   1.388   7.834 1.00 . A A .  3 ILE HD11 1 1 
        6  7022 1 1  6 ILE HD12 H  -7.849   1.737   6.239 1.00 . A A .  3 ILE HD12 1 1 
        6  7023 1 1  6 ILE HD13 H  -8.899   1.738   7.657 1.00 . A A .  3 ILE HD13 1 1 
        6  7024 1 1  6 ILE HG12 H  -7.807   3.670   8.538 1.00 . A A .  3 ILE HG12 1 1 
        6  7025 1 1  6 ILE HG13 H  -8.353   3.999   6.891 1.00 . A A .  3 ILE HG13 1 1 
        6  7026 1 1  6 ILE HG21 H  -5.343   2.955   8.874 1.00 . A A .  3 ILE HG21 1 1 
        6  7027 1 1  6 ILE HG22 H  -5.699   4.668   9.088 1.00 . A A .  3 ILE HG22 1 1 
        6  7028 1 1  6 ILE HG23 H  -4.308   4.164   8.123 1.00 . A A .  3 ILE HG23 1 1 
        6  7029 1 1  6 ILE N    N  -6.917   5.068   5.035 1.00 . A A .  3 ILE N    1 1 
        6  7030 1 1  6 ILE O    O  -4.053   5.202   5.343 1.00 . A A .  3 ILE O    1 1 
        6  7031 1 1  7 ARG C    C  -2.377   7.202   7.882 1.00 . A A .  4 ARG C    1 1 
        6  7032 1 1  7 ARG CA   C  -3.168   7.528   6.613 1.00 . A A .  4 ARG CA   1 1 
        6  7033 1 1  7 ARG CB   C  -3.187   9.058   6.438 1.00 . A A .  4 ARG CB   1 1 
        6  7034 1 1  7 ARG CD   C  -5.383  10.113   5.800 1.00 . A A .  4 ARG CD   1 1 
        6  7035 1 1  7 ARG CG   C  -4.052   9.582   5.281 1.00 . A A .  4 ARG CG   1 1 
        6  7036 1 1  7 ARG CZ   C  -6.201  11.872   7.355 1.00 . A A .  4 ARG CZ   1 1 
        6  7037 1 1  7 ARG H    H  -5.200   7.432   7.223 1.00 . A A .  4 ARG H    1 1 
        6  7038 1 1  7 ARG HA   H  -2.690   7.074   5.766 1.00 . A A .  4 ARG HA   1 1 
        6  7039 1 1  7 ARG HB2  H  -3.570   9.492   7.352 1.00 . A A .  4 ARG HB2  1 1 
        6  7040 1 1  7 ARG HB3  H  -2.168   9.396   6.296 1.00 . A A .  4 ARG HB3  1 1 
        6  7041 1 1  7 ARG HD2  H  -5.973  10.459   4.966 1.00 . A A .  4 ARG HD2  1 1 
        6  7042 1 1  7 ARG HD3  H  -5.899   9.310   6.303 1.00 . A A .  4 ARG HD3  1 1 
        6  7043 1 1  7 ARG HE   H  -4.276  11.491   6.948 1.00 . A A .  4 ARG HE   1 1 
        6  7044 1 1  7 ARG HG2  H  -3.537  10.384   4.757 1.00 . A A .  4 ARG HG2  1 1 
        6  7045 1 1  7 ARG HG3  H  -4.246   8.770   4.601 1.00 . A A .  4 ARG HG3  1 1 
        6  7046 1 1  7 ARG HH11 H  -7.691  10.800   6.484 1.00 . A A .  4 ARG HH11 1 1 
        6  7047 1 1  7 ARG HH12 H  -8.216  12.042   7.572 1.00 . A A .  4 ARG HH12 1 1 
        6  7048 1 1  7 ARG HH21 H  -4.963  13.114   8.370 1.00 . A A .  4 ARG HH21 1 1 
        6  7049 1 1  7 ARG HH22 H  -6.653  13.363   8.652 1.00 . A A .  4 ARG HH22 1 1 
        6  7050 1 1  7 ARG N    N  -4.515   6.955   6.704 1.00 . A A .  4 ARG N    1 1 
        6  7051 1 1  7 ARG NE   N  -5.203  11.222   6.745 1.00 . A A .  4 ARG NE   1 1 
        6  7052 1 1  7 ARG NH1  N  -7.474  11.545   7.115 1.00 . A A .  4 ARG NH1  1 1 
        6  7053 1 1  7 ARG NH2  N  -5.919  12.862   8.192 1.00 . A A .  4 ARG NH2  1 1 
        6  7054 1 1  7 ARG O    O  -2.993   6.883   8.910 1.00 . A A .  4 ARG O    1 1 
        6  7055 1 1  8 GLU C    C   0.005   5.505   9.220 1.00 . A A .  5 GLU C    1 1 
        6  7056 1 1  8 GLU CA   C  -0.071   7.039   8.924 1.00 . A A .  5 GLU CA   1 1 
        6  7057 1 1  8 GLU CB   C  -0.438   7.933  10.185 1.00 . A A .  5 GLU CB   1 1 
        6  7058 1 1  8 GLU CD   C   0.084   8.854  12.494 1.00 . A A .  5 GLU CD   1 1 
        6  7059 1 1  8 GLU CG   C   0.505   7.881  11.411 1.00 . A A .  5 GLU CG   1 1 
        6  7060 1 1  8 GLU H    H  -0.627   7.473   6.904 1.00 . A A .  5 GLU H    1 1 
        6  7061 1 1  8 GLU HA   H   0.907   7.342   8.561 1.00 . A A .  5 GLU HA   1 1 
        6  7062 1 1  8 GLU HB2  H  -0.478   8.966   9.865 1.00 . A A .  5 GLU HB2  1 1 
        6  7063 1 1  8 GLU HB3  H  -1.436   7.654  10.514 1.00 . A A .  5 GLU HB3  1 1 
        6  7064 1 1  8 GLU HG2  H   0.487   6.885  11.835 1.00 . A A .  5 GLU HG2  1 1 
        6  7065 1 1  8 GLU HG3  H   1.514   8.127  11.112 1.00 . A A .  5 GLU HG3  1 1 
        6  7066 1 1  8 GLU N    N  -1.017   7.280   7.788 1.00 . A A .  5 GLU N    1 1 
        6  7067 1 1  8 GLU O    O  -0.784   4.728   8.658 1.00 . A A .  5 GLU O    1 1 
        6  7068 1 1  8 GLU OE1  O   0.406  10.062  12.374 1.00 . A A .  5 GLU OE1  1 1 
        6  7069 1 1  8 GLU OE2  O  -0.577   8.417  13.455 1.00 . A A .  5 GLU OE2  1 1 
        6  7070 1 1  9 SER C    C   1.924   2.864   9.293 1.00 . A A .  6 SER C    1 1 
        6  7071 1 1  9 SER CA   C   1.249   3.668  10.435 1.00 . A A .  6 SER CA   1 1 
        6  7072 1 1  9 SER CB   C  -0.085   2.982  10.969 1.00 . A A .  6 SER CB   1 1 
        6  7073 1 1  9 SER H    H   1.787   5.723  10.152 1.00 . A A .  6 SER H    1 1 
        6  7074 1 1  9 SER HA   H   1.956   3.719  11.253 1.00 . A A .  6 SER HA   1 1 
        6  7075 1 1  9 SER HB2  H  -0.627   3.651  11.616 1.00 . A A .  6 SER HB2  1 1 
        6  7076 1 1  9 SER HB3  H  -0.718   2.712  10.125 1.00 . A A .  6 SER HB3  1 1 
        6  7077 1 1  9 SER HG   H  -0.597   1.559  12.232 1.00 . A A .  6 SER HG   1 1 
        6  7078 1 1  9 SER N    N   1.057   5.076   9.970 1.00 . A A .  6 SER N    1 1 
        6  7079 1 1  9 SER O    O   2.463   3.454   8.350 1.00 . A A .  6 SER O    1 1 
        6  7080 1 1  9 SER OG   O   0.182   1.805  11.724 1.00 . A A .  6 SER OG   1 1 
        6  7081 1 1 10 VAL C    C   1.605  -0.405   7.959 1.00 . A A .  7 VAL C    1 1 
        6  7082 1 1 10 VAL CA   C   2.553   0.692   8.373 1.00 . A A .  7 VAL CA   1 1 
        6  7083 1 1 10 VAL CB   C   3.940   0.059   8.773 1.00 . A A .  7 VAL CB   1 1 
        6  7084 1 1 10 VAL CG1  C   5.067   0.798   8.079 1.00 . A A .  7 VAL CG1  1 1 
        6  7085 1 1 10 VAL CG2  C   4.213  -0.017  10.283 1.00 . A A .  7 VAL CG2  1 1 
        6  7086 1 1 10 VAL H    H   1.457   1.111  10.125 1.00 . A A .  7 VAL H    1 1 
        6  7087 1 1 10 VAL HA   H   2.710   1.323   7.490 1.00 . A A .  7 VAL HA   1 1 
        6  7088 1 1 10 VAL HB   H   3.958  -0.953   8.404 1.00 . A A .  7 VAL HB   1 1 
        6  7089 1 1 10 VAL HG11 H   4.981   0.667   7.008 1.00 . A A .  7 VAL HG11 1 1 
        6  7090 1 1 10 VAL HG12 H   6.014   0.409   8.418 1.00 . A A .  7 VAL HG12 1 1 
        6  7091 1 1 10 VAL HG13 H   5.000   1.847   8.316 1.00 . A A .  7 VAL HG13 1 1 
        6  7092 1 1 10 VAL HG21 H   5.121  -0.585  10.442 1.00 . A A .  7 VAL HG21 1 1 
        6  7093 1 1 10 VAL HG22 H   3.396  -0.527  10.785 1.00 . A A .  7 VAL HG22 1 1 
        6  7094 1 1 10 VAL HG23 H   4.339   0.969  10.692 1.00 . A A .  7 VAL HG23 1 1 
        6  7095 1 1 10 VAL N    N   1.932   1.536   9.390 1.00 . A A .  7 VAL N    1 1 
        6  7096 1 1 10 VAL O    O   0.909  -0.998   8.787 1.00 . A A .  7 VAL O    1 1 
        6  7097 1 1 11 SER C    C   1.491  -2.996   6.117 1.00 . A A .  8 SER C    1 1 
        6  7098 1 1 11 SER CA   C   0.739  -1.666   6.053 1.00 . A A .  8 SER CA   1 1 
        6  7099 1 1 11 SER CB   C   0.416  -1.289   4.592 1.00 . A A .  8 SER CB   1 1 
        6  7100 1 1 11 SER H    H   2.076  -0.010   6.066 1.00 . A A .  8 SER H    1 1 
        6  7101 1 1 11 SER HA   H  -0.183  -1.744   6.619 1.00 . A A .  8 SER HA   1 1 
        6  7102 1 1 11 SER HB2  H   0.396  -2.183   3.981 1.00 . A A .  8 SER HB2  1 1 
        6  7103 1 1 11 SER HB3  H  -0.559  -0.795   4.527 1.00 . A A .  8 SER HB3  1 1 
        6  7104 1 1 11 SER HG   H   2.275  -0.869   4.099 1.00 . A A .  8 SER HG   1 1 
        6  7105 1 1 11 SER N    N   1.544  -0.606   6.656 1.00 . A A .  8 SER N    1 1 
        6  7106 1 1 11 SER O    O   2.645  -3.069   5.695 1.00 . A A .  8 SER O    1 1 
        6  7107 1 1 11 SER OG   O   1.408  -0.430   4.050 1.00 . A A .  8 SER OG   1 1 
        6  7108 1 1 12 ARG C    C   0.663  -6.461   6.099 1.00 . A A .  9 ARG C    1 1 
        6  7109 1 1 12 ARG CA   C   1.514  -5.371   6.758 1.00 . A A .  9 ARG CA   1 1 
        6  7110 1 1 12 ARG CB   C   1.833  -5.813   8.218 1.00 . A A .  9 ARG CB   1 1 
        6  7111 1 1 12 ARG CD   C   0.469  -4.321   9.780 1.00 . A A .  9 ARG CD   1 1 
        6  7112 1 1 12 ARG CG   C   0.672  -5.724   9.234 1.00 . A A .  9 ARG CG   1 1 
        6  7113 1 1 12 ARG CZ   C  -0.949  -3.285  11.507 1.00 . A A .  9 ARG CZ   1 1 
        6  7114 1 1 12 ARG H    H  -0.109  -3.948   6.938 1.00 . A A .  9 ARG H    1 1 
        6  7115 1 1 12 ARG HA   H   2.448  -5.263   6.225 1.00 . A A .  9 ARG HA   1 1 
        6  7116 1 1 12 ARG HB2  H   2.148  -6.852   8.182 1.00 . A A .  9 ARG HB2  1 1 
        6  7117 1 1 12 ARG HB3  H   2.669  -5.228   8.594 1.00 . A A .  9 ARG HB3  1 1 
        6  7118 1 1 12 ARG HD2  H   1.301  -4.074  10.419 1.00 . A A .  9 ARG HD2  1 1 
        6  7119 1 1 12 ARG HD3  H   0.429  -3.625   8.953 1.00 . A A .  9 ARG HD3  1 1 
        6  7120 1 1 12 ARG HE   H  -1.476  -4.836  10.364 1.00 . A A .  9 ARG HE   1 1 
        6  7121 1 1 12 ARG HG2  H  -0.248  -6.047   8.765 1.00 . A A .  9 ARG HG2  1 1 
        6  7122 1 1 12 ARG HG3  H   0.891  -6.388  10.060 1.00 . A A .  9 ARG HG3  1 1 
        6  7123 1 1 12 ARG HH11 H   0.889  -2.420  11.305 1.00 . A A .  9 ARG HH11 1 1 
        6  7124 1 1 12 ARG HH12 H  -0.134  -1.716  12.519 1.00 . A A .  9 ARG HH12 1 1 
        6  7125 1 1 12 ARG HH21 H  -2.820  -3.928  11.942 1.00 . A A .  9 ARG HH21 1 1 
        6  7126 1 1 12 ARG HH22 H  -2.264  -2.580  12.880 1.00 . A A .  9 ARG HH22 1 1 
        6  7127 1 1 12 ARG N    N   0.848  -4.050   6.647 1.00 . A A .  9 ARG N    1 1 
        6  7128 1 1 12 ARG NE   N  -0.755  -4.201  10.560 1.00 . A A .  9 ARG NE   1 1 
        6  7129 1 1 12 ARG NH1  N   0.016  -2.406  11.807 1.00 . A A .  9 ARG NH1  1 1 
        6  7130 1 1 12 ARG NH2  N  -2.101  -3.264  12.164 1.00 . A A .  9 ARG NH2  1 1 
        6  7131 1 1 12 ARG O    O  -0.535  -6.312   6.103 1.00 . A A .  9 ARG O    1 1 
        6  7132 1 1 13 ILE C    C   0.502  -9.903   5.831 1.00 . A A . 10 ILE C    1 1 
        6  7133 1 1 13 ILE CA   C   0.377  -8.631   4.990 1.00 . A A . 10 ILE CA   1 1 
        6  7134 1 1 13 ILE CB   C   0.675  -8.877   3.422 1.00 . A A . 10 ILE CB   1 1 
        6  7135 1 1 13 ILE CD1  C   0.018  -7.898   1.050 1.00 . A A . 10 ILE CD1  1 1 
        6  7136 1 1 13 ILE CG1  C  -0.263  -7.980   2.562 1.00 . A A . 10 ILE CG1  1 1 
        6  7137 1 1 13 ILE CG2  C   0.513 -10.366   2.957 1.00 . A A . 10 ILE CG2  1 1 
        6  7138 1 1 13 ILE H    H   2.222  -7.730   5.636 1.00 . A A . 10 ILE H    1 1 
        6  7139 1 1 13 ILE HA   H  -0.642  -8.264   5.104 1.00 . A A . 10 ILE HA   1 1 
        6  7140 1 1 13 ILE HB   H   1.699  -8.591   3.248 1.00 . A A . 10 ILE HB   1 1 
        6  7141 1 1 13 ILE HD11 H   0.122  -8.893   0.634 1.00 . A A . 10 ILE HD11 1 1 
        6  7142 1 1 13 ILE HD12 H   0.906  -7.324   0.855 1.00 . A A . 10 ILE HD12 1 1 
        6  7143 1 1 13 ILE HD13 H  -0.821  -7.410   0.562 1.00 . A A . 10 ILE HD13 1 1 
        6  7144 1 1 13 ILE HG12 H  -1.242  -8.377   2.655 1.00 . A A . 10 ILE HG12 1 1 
        6  7145 1 1 13 ILE HG13 H  -0.277  -6.973   2.948 1.00 . A A . 10 ILE HG13 1 1 
        6  7146 1 1 13 ILE HG21 H   0.957 -11.041   3.681 1.00 . A A . 10 ILE HG21 1 1 
        6  7147 1 1 13 ILE HG22 H   1.007 -10.508   2.005 1.00 . A A . 10 ILE HG22 1 1 
        6  7148 1 1 13 ILE HG23 H  -0.537 -10.610   2.837 1.00 . A A . 10 ILE HG23 1 1 
        6  7149 1 1 13 ILE N    N   1.230  -7.583   5.587 1.00 . A A . 10 ILE N    1 1 
        6  7150 1 1 13 ILE O    O   1.579 -10.150   6.425 1.00 . A A . 10 ILE O    1 1 
        6  7151 1 1 14 TYR C    C  -0.694 -13.138   5.812 1.00 . A A . 11 TYR C    1 1 
        6  7152 1 1 14 TYR CA   C  -0.641 -11.892   6.756 1.00 . A A . 11 TYR CA   1 1 
        6  7153 1 1 14 TYR CB   C  -1.852 -11.886   7.733 1.00 . A A . 11 TYR CB   1 1 
        6  7154 1 1 14 TYR CD1  C  -0.891 -12.547   9.974 1.00 . A A . 11 TYR CD1  1 1 
        6  7155 1 1 14 TYR CD2  C  -2.429 -14.051   8.938 1.00 . A A . 11 TYR CD2  1 1 
        6  7156 1 1 14 TYR CE1  C  -0.765 -13.406  11.049 1.00 . A A . 11 TYR CE1  1 1 
        6  7157 1 1 14 TYR CE2  C  -2.307 -14.915  10.015 1.00 . A A . 11 TYR CE2  1 1 
        6  7158 1 1 14 TYR CG   C  -1.721 -12.853   8.898 1.00 . A A . 11 TYR CG   1 1 
        6  7159 1 1 14 TYR CZ   C  -1.473 -14.589  11.064 1.00 . A A . 11 TYR CZ   1 1 
        6  7160 1 1 14 TYR H    H  -1.471 -10.339   5.516 1.00 . A A . 11 TYR H    1 1 
        6  7161 1 1 14 TYR HA   H   0.268 -11.901   7.340 1.00 . A A . 11 TYR HA   1 1 
        6  7162 1 1 14 TYR HB2  H  -1.966 -10.894   8.156 1.00 . A A . 11 TYR HB2  1 1 
        6  7163 1 1 14 TYR HB3  H  -2.760 -12.139   7.194 1.00 . A A . 11 TYR HB3  1 1 
        6  7164 1 1 14 TYR HD1  H  -0.338 -11.621   9.959 1.00 . A A . 11 TYR HD1  1 1 
        6  7165 1 1 14 TYR HD2  H  -3.080 -14.307   8.116 1.00 . A A . 11 TYR HD2  1 1 
        6  7166 1 1 14 TYR HE1  H  -0.113 -13.152  11.870 1.00 . A A . 11 TYR HE1  1 1 
        6  7167 1 1 14 TYR HE2  H  -2.865 -15.837  10.032 1.00 . A A . 11 TYR HE2  1 1 
        6  7168 1 1 14 TYR HH   H  -1.117 -16.326  11.823 1.00 . A A . 11 TYR HH   1 1 
        6  7169 1 1 14 TYR N    N  -0.632 -10.647   5.962 1.00 . A A . 11 TYR N    1 1 
        6  7170 1 1 14 TYR O    O  -1.642 -13.243   5.019 1.00 . A A . 11 TYR O    1 1 
        6  7171 1 1 14 TYR OH   O  -1.351 -15.444  12.136 1.00 . A A . 11 TYR OH   1 1 
        6  7172 1 1 15 VAL C    C   0.323 -16.569   5.876 1.00 . A A . 12 VAL C    1 1 
        6  7173 1 1 15 VAL CA   C   0.217 -15.292   4.983 1.00 . A A . 12 VAL CA   1 1 
        6  7174 1 1 15 VAL CB   C   1.310 -15.249   3.778 1.00 . A A . 12 VAL CB   1 1 
        6  7175 1 1 15 VAL CG1  C   2.650 -14.778   4.280 1.00 . A A . 12 VAL CG1  1 1 
        6  7176 1 1 15 VAL CG2  C   1.550 -16.587   3.046 1.00 . A A . 12 VAL CG2  1 1 
        6  7177 1 1 15 VAL H    H   1.070 -14.013   6.492 1.00 . A A . 12 VAL H    1 1 
        6  7178 1 1 15 VAL HA   H  -0.779 -15.275   4.550 1.00 . A A . 12 VAL HA   1 1 
        6  7179 1 1 15 VAL HB   H   0.992 -14.517   3.024 1.00 . A A . 12 VAL HB   1 1 
        6  7180 1 1 15 VAL HG11 H   3.375 -14.837   3.480 1.00 . A A . 12 VAL HG11 1 1 
        6  7181 1 1 15 VAL HG12 H   2.961 -15.410   5.098 1.00 . A A . 12 VAL HG12 1 1 
        6  7182 1 1 15 VAL HG13 H   2.572 -13.755   4.618 1.00 . A A . 12 VAL HG13 1 1 
        6  7183 1 1 15 VAL HG21 H   1.866 -17.346   3.750 1.00 . A A . 12 VAL HG21 1 1 
        6  7184 1 1 15 VAL HG22 H   2.339 -16.443   2.315 1.00 . A A . 12 VAL HG22 1 1 
        6  7185 1 1 15 VAL HG23 H   0.670 -16.914   2.533 1.00 . A A . 12 VAL HG23 1 1 
        6  7186 1 1 15 VAL N    N   0.304 -14.085   5.850 1.00 . A A . 12 VAL N    1 1 
        6  7187 1 1 15 VAL O    O   1.395 -16.893   6.386 1.00 . A A . 12 VAL O    1 1 
        6  7188 1 1 16 GLY C    C  -1.089 -19.762   6.139 1.00 . A A . 13 GLY C    1 1 
        6  7189 1 1 16 GLY CA   C  -0.769 -18.499   6.917 1.00 . A A . 13 GLY CA   1 1 
        6  7190 1 1 16 GLY H    H  -1.689 -16.974   5.713 1.00 . A A . 13 GLY H    1 1 
        6  7191 1 1 16 GLY HA2  H   0.218 -18.598   7.337 1.00 . A A . 13 GLY HA2  1 1 
        6  7192 1 1 16 GLY HA3  H  -1.480 -18.395   7.717 1.00 . A A . 13 GLY HA3  1 1 
        6  7193 1 1 16 GLY N    N  -0.808 -17.282   6.097 1.00 . A A . 13 GLY N    1 1 
        6  7194 1 1 16 GLY O    O  -1.562 -19.668   5.016 1.00 . A A . 13 GLY O    1 1 
        6  7195 1 1 17 ASN C    C  -0.470 -22.440   4.659 1.00 . A A . 14 ASN C    1 1 
        6  7196 1 1 17 ASN CA   C  -1.046 -22.292   6.095 1.00 . A A . 14 ASN CA   1 1 
        6  7197 1 1 17 ASN CB   C  -2.543 -22.610   6.091 1.00 . A A . 14 ASN CB   1 1 
        6  7198 1 1 17 ASN CG   C  -3.052 -22.980   7.470 1.00 . A A . 14 ASN CG   1 1 
        6  7199 1 1 17 ASN H    H  -0.481 -20.953   7.692 1.00 . A A . 14 ASN H    1 1 
        6  7200 1 1 17 ASN HA   H  -0.561 -23.032   6.721 1.00 . A A . 14 ASN HA   1 1 
        6  7201 1 1 17 ASN HB2  H  -3.082 -21.738   5.752 1.00 . A A . 14 ASN HB2  1 1 
        6  7202 1 1 17 ASN HB3  H  -2.734 -23.432   5.420 1.00 . A A . 14 ASN HB3  1 1 
        6  7203 1 1 17 ASN HD21 H  -3.536 -21.093   7.842 1.00 . A A . 14 ASN HD21 1 1 
        6  7204 1 1 17 ASN HD22 H  -3.874 -22.215   9.110 1.00 . A A . 14 ASN HD22 1 1 
        6  7205 1 1 17 ASN N    N  -0.809 -20.958   6.742 1.00 . A A . 14 ASN N    1 1 
        6  7206 1 1 17 ASN ND2  N  -3.534 -21.996   8.214 1.00 . A A . 14 ASN ND2  1 1 
        6  7207 1 1 17 ASN O    O  -0.934 -23.263   3.889 1.00 . A A . 14 ASN O    1 1 
        6  7208 1 1 17 ASN OD1  O  -3.008 -24.143   7.859 1.00 . A A . 14 ASN OD1  1 1 
        6  7209 1 1 18 LEU C    C   2.143 -22.989   3.032 1.00 . A A . 15 LEU C    1 1 
        6  7210 1 1 18 LEU CA   C   1.268 -21.722   3.085 1.00 . A A . 15 LEU CA   1 1 
        6  7211 1 1 18 LEU CB   C   2.134 -20.443   2.920 1.00 . A A . 15 LEU CB   1 1 
        6  7212 1 1 18 LEU CD1  C   4.352 -19.313   3.233 1.00 . A A . 15 LEU CD1  1 1 
        6  7213 1 1 18 LEU CD2  C   3.037 -19.849   5.248 1.00 . A A . 15 LEU CD2  1 1 
        6  7214 1 1 18 LEU CG   C   3.382 -20.303   3.833 1.00 . A A . 15 LEU CG   1 1 
        6  7215 1 1 18 LEU H    H   0.787 -20.950   4.944 1.00 . A A . 15 LEU H    1 1 
        6  7216 1 1 18 LEU HA   H   0.544 -21.758   2.288 1.00 . A A . 15 LEU HA   1 1 
        6  7217 1 1 18 LEU HB2  H   2.469 -20.396   1.896 1.00 . A A . 15 LEU HB2  1 1 
        6  7218 1 1 18 LEU HB3  H   1.497 -19.583   3.107 1.00 . A A . 15 LEU HB3  1 1 
        6  7219 1 1 18 LEU HD11 H   4.816 -19.749   2.363 1.00 . A A . 15 LEU HD11 1 1 
        6  7220 1 1 18 LEU HD12 H   5.108 -19.068   3.969 1.00 . A A . 15 LEU HD12 1 1 
        6  7221 1 1 18 LEU HD13 H   3.823 -18.415   2.951 1.00 . A A . 15 LEU HD13 1 1 
        6  7222 1 1 18 LEU HD21 H   2.401 -20.585   5.714 1.00 . A A . 15 LEU HD21 1 1 
        6  7223 1 1 18 LEU HD22 H   2.524 -18.902   5.207 1.00 . A A . 15 LEU HD22 1 1 
        6  7224 1 1 18 LEU HD23 H   3.946 -19.741   5.822 1.00 . A A . 15 LEU HD23 1 1 
        6  7225 1 1 18 LEU HG   H   3.878 -21.260   3.898 1.00 . A A . 15 LEU HG   1 1 
        6  7226 1 1 18 LEU N    N   0.545 -21.651   4.337 1.00 . A A . 15 LEU N    1 1 
        6  7227 1 1 18 LEU O    O   2.700 -23.396   4.059 1.00 . A A . 15 LEU O    1 1 
        6  7228 1 1 19 PRO C    C   4.641 -24.286   1.629 1.00 . A A . 16 PRO C    1 1 
        6  7229 1 1 19 PRO CA   C   3.176 -24.779   1.699 1.00 . A A . 16 PRO CA   1 1 
        6  7230 1 1 19 PRO CB   C   2.747 -25.437   0.374 1.00 . A A . 16 PRO CB   1 1 
        6  7231 1 1 19 PRO CD   C   1.456 -23.402   0.629 1.00 . A A . 16 PRO CD   1 1 
        6  7232 1 1 19 PRO CG   C   1.938 -24.427  -0.364 1.00 . A A . 16 PRO CG   1 1 
        6  7233 1 1 19 PRO HA   H   3.048 -25.485   2.508 1.00 . A A . 16 PRO HA   1 1 
        6  7234 1 1 19 PRO HB2  H   3.621 -25.710  -0.203 1.00 . A A . 16 PRO HB2  1 1 
        6  7235 1 1 19 PRO HB3  H   2.150 -26.316   0.578 1.00 . A A . 16 PRO HB3  1 1 
        6  7236 1 1 19 PRO HD2  H   1.648 -22.410   0.246 1.00 . A A . 16 PRO HD2  1 1 
        6  7237 1 1 19 PRO HD3  H   0.403 -23.531   0.817 1.00 . A A . 16 PRO HD3  1 1 
        6  7238 1 1 19 PRO HG2  H   2.559 -23.956  -1.115 1.00 . A A . 16 PRO HG2  1 1 
        6  7239 1 1 19 PRO HG3  H   1.094 -24.910  -0.831 1.00 . A A . 16 PRO HG3  1 1 
        6  7240 1 1 19 PRO N    N   2.248 -23.658   1.858 1.00 . A A . 16 PRO N    1 1 
        6  7241 1 1 19 PRO O    O   4.866 -23.188   1.109 1.00 . A A . 16 PRO O    1 1 
        6  7242 1 1 20 SER C    C   7.634 -23.852   3.152 1.00 . A A . 17 SER C    1 1 
        6  7243 1 1 20 SER CA   C   7.079 -24.880   2.153 1.00 . A A . 17 SER CA   1 1 
        6  7244 1 1 20 SER CB   C   7.629 -24.581   0.715 1.00 . A A . 17 SER CB   1 1 
        6  7245 1 1 20 SER H    H   5.294 -25.740   2.893 1.00 . A A . 17 SER H    1 1 
        6  7246 1 1 20 SER HA   H   7.489 -25.839   2.457 1.00 . A A . 17 SER HA   1 1 
        6  7247 1 1 20 SER HB2  H   8.654 -24.916   0.661 1.00 . A A . 17 SER HB2  1 1 
        6  7248 1 1 20 SER HB3  H   7.043 -25.119  -0.017 1.00 . A A . 17 SER HB3  1 1 
        6  7249 1 1 20 SER HG   H   8.107 -23.057  -0.425 1.00 . A A . 17 SER HG   1 1 
        6  7250 1 1 20 SER N    N   5.596 -25.047   2.262 1.00 . A A . 17 SER N    1 1 
        6  7251 1 1 20 SER O    O   8.753 -24.047   3.647 1.00 . A A . 17 SER O    1 1 
        6  7252 1 1 20 SER OG   O   7.605 -23.200   0.380 1.00 . A A . 17 SER OG   1 1 
        6  7253 1 1 21 HIS C    C   8.275 -20.754   3.587 1.00 . A A . 18 HIS C    1 1 
        6  7254 1 1 21 HIS CA   C   7.226 -21.653   4.293 1.00 . A A . 18 HIS CA   1 1 
        6  7255 1 1 21 HIS CB   C   7.632 -22.116   5.733 1.00 . A A . 18 HIS CB   1 1 
        6  7256 1 1 21 HIS CD2  C   8.424 -20.076   7.148 1.00 . A A . 18 HIS CD2  1 1 
        6  7257 1 1 21 HIS CE1  C  10.546 -20.595   7.256 1.00 . A A . 18 HIS CE1  1 1 
        6  7258 1 1 21 HIS CG   C   8.599 -21.241   6.483 1.00 . A A . 18 HIS CG   1 1 
        6  7259 1 1 21 HIS H    H   5.954 -22.767   3.024 1.00 . A A . 18 HIS H    1 1 
        6  7260 1 1 21 HIS HA   H   6.330 -21.068   4.397 1.00 . A A . 18 HIS HA   1 1 
        6  7261 1 1 21 HIS HB2  H   6.740 -22.180   6.332 1.00 . A A . 18 HIS HB2  1 1 
        6  7262 1 1 21 HIS HB3  H   8.058 -23.097   5.660 1.00 . A A . 18 HIS HB3  1 1 
        6  7263 1 1 21 HIS HD1  H  10.378 -22.318   6.171 1.00 . A A . 18 HIS HD1  1 1 
        6  7264 1 1 21 HIS HD2  H   7.486 -19.545   7.279 1.00 . A A . 18 HIS HD2  1 1 
        6  7265 1 1 21 HIS HE1  H  11.588 -20.588   7.518 1.00 . A A . 18 HIS HE1  1 1 
        6  7266 1 1 21 HIS HE2  H   9.895 -18.761   7.846 1.00 . A A . 18 HIS HE2  1 1 
        6  7267 1 1 21 HIS N    N   6.841 -22.792   3.441 1.00 . A A . 18 HIS N    1 1 
        6  7268 1 1 21 HIS ND1  N   9.936 -21.535   6.574 1.00 . A A . 18 HIS ND1  1 1 
        6  7269 1 1 21 HIS NE2  N   9.661 -19.687   7.618 1.00 . A A . 18 HIS NE2  1 1 
        6  7270 1 1 21 HIS O    O   9.371 -21.197   3.217 1.00 . A A . 18 HIS O    1 1 
        6  7271 1 1 22 VAL C    C   9.894 -18.105   3.951 1.00 . A A . 19 VAL C    1 1 
        6  7272 1 1 22 VAL CA   C   8.821 -18.482   2.842 1.00 . A A . 19 VAL CA   1 1 
        6  7273 1 1 22 VAL CB   C   7.956 -17.233   2.287 1.00 . A A . 19 VAL CB   1 1 
        6  7274 1 1 22 VAL CG1  C   6.974 -17.665   1.201 1.00 . A A . 19 VAL CG1  1 1 
        6  7275 1 1 22 VAL CG2  C   7.163 -16.513   3.384 1.00 . A A . 19 VAL CG2  1 1 
        6  7276 1 1 22 VAL H    H   7.018 -19.204   3.722 1.00 . A A . 19 VAL H    1 1 
        6  7277 1 1 22 VAL HA   H   9.320 -18.955   2.004 1.00 . A A . 19 VAL HA   1 1 
        6  7278 1 1 22 VAL HB   H   8.596 -16.517   1.817 1.00 . A A . 19 VAL HB   1 1 
        6  7279 1 1 22 VAL HG11 H   6.350 -18.465   1.569 1.00 . A A . 19 VAL HG11 1 1 
        6  7280 1 1 22 VAL HG12 H   7.505 -17.992   0.320 1.00 . A A . 19 VAL HG12 1 1 
        6  7281 1 1 22 VAL HG13 H   6.347 -16.824   0.945 1.00 . A A . 19 VAL HG13 1 1 
        6  7282 1 1 22 VAL HG21 H   6.598 -15.698   2.950 1.00 . A A . 19 VAL HG21 1 1 
        6  7283 1 1 22 VAL HG22 H   7.843 -16.119   4.123 1.00 . A A . 19 VAL HG22 1 1 
        6  7284 1 1 22 VAL HG23 H   6.486 -17.211   3.854 1.00 . A A . 19 VAL HG23 1 1 
        6  7285 1 1 22 VAL N    N   7.914 -19.481   3.428 1.00 . A A . 19 VAL N    1 1 
        6  7286 1 1 22 VAL O    O   9.509 -17.668   5.046 1.00 . A A . 19 VAL O    1 1 
        6  7287 1 1 23 SER C    C  12.559 -16.476   4.669 1.00 . A A . 20 SER C    1 1 
        6  7288 1 1 23 SER CA   C  12.254 -17.997   4.751 1.00 . A A . 20 SER CA   1 1 
        6  7289 1 1 23 SER CB   C  13.513 -18.868   4.474 1.00 . A A . 20 SER CB   1 1 
        6  7290 1 1 23 SER H    H  11.561 -18.877   2.958 1.00 . A A . 20 SER H    1 1 
        6  7291 1 1 23 SER HA   H  11.855 -18.241   5.716 1.00 . A A . 20 SER HA   1 1 
        6  7292 1 1 23 SER HB2  H  14.181 -18.362   3.796 1.00 . A A . 20 SER HB2  1 1 
        6  7293 1 1 23 SER HB3  H  14.032 -19.084   5.396 1.00 . A A . 20 SER HB3  1 1 
        6  7294 1 1 23 SER HG   H  13.244 -20.046   2.931 1.00 . A A . 20 SER HG   1 1 
        6  7295 1 1 23 SER N    N  11.238 -18.351   3.738 1.00 . A A . 20 SER N    1 1 
        6  7296 1 1 23 SER O    O  12.266 -15.886   3.634 1.00 . A A . 20 SER O    1 1 
        6  7297 1 1 23 SER OG   O  13.136 -20.105   3.890 1.00 . A A . 20 SER OG   1 1 
        6  7298 1 1 24 SER C    C  14.027 -13.725   4.606 1.00 . A A . 21 SER C    1 1 
        6  7299 1 1 24 SER CA   C  13.287 -14.359   5.818 1.00 . A A . 21 SER CA   1 1 
        6  7300 1 1 24 SER CB   C  13.985 -13.967   7.130 1.00 . A A . 21 SER CB   1 1 
        6  7301 1 1 24 SER H    H  13.296 -16.326   6.589 1.00 . A A . 21 SER H    1 1 
        6  7302 1 1 24 SER HA   H  12.298 -13.934   5.848 1.00 . A A . 21 SER HA   1 1 
        6  7303 1 1 24 SER HB2  H  14.213 -12.910   7.109 1.00 . A A . 21 SER HB2  1 1 
        6  7304 1 1 24 SER HB3  H  13.323 -14.174   7.956 1.00 . A A . 21 SER HB3  1 1 
        6  7305 1 1 24 SER HG   H  15.726 -14.226   7.999 1.00 . A A . 21 SER HG   1 1 
        6  7306 1 1 24 SER N    N  13.088 -15.826   5.766 1.00 . A A . 21 SER N    1 1 
        6  7307 1 1 24 SER O    O  13.672 -12.621   4.197 1.00 . A A . 21 SER O    1 1 
        6  7308 1 1 24 SER OG   O  15.199 -14.685   7.332 1.00 . A A . 21 SER OG   1 1 
        6  7309 1 1 25 ARG C    C  14.855 -13.937   1.500 1.00 . A A . 22 ARG C    1 1 
        6  7310 1 1 25 ARG CA   C  15.732 -13.891   2.831 1.00 . A A . 22 ARG CA   1 1 
        6  7311 1 1 25 ARG CB   C  17.183 -14.509   2.638 1.00 . A A . 22 ARG CB   1 1 
        6  7312 1 1 25 ARG CD   C  17.725 -16.149   4.602 1.00 . A A . 22 ARG CD   1 1 
        6  7313 1 1 25 ARG CG   C  18.023 -14.789   3.930 1.00 . A A . 22 ARG CG   1 1 
        6  7314 1 1 25 ARG CZ   C  18.543 -16.600   6.934 1.00 . A A . 22 ARG CZ   1 1 
        6  7315 1 1 25 ARG H    H  15.393 -15.213   4.511 1.00 . A A . 22 ARG H    1 1 
        6  7316 1 1 25 ARG HA   H  15.866 -12.832   3.023 1.00 . A A . 22 ARG HA   1 1 
        6  7317 1 1 25 ARG HB2  H  17.141 -15.423   2.073 1.00 . A A . 22 ARG HB2  1 1 
        6  7318 1 1 25 ARG HB3  H  17.748 -13.798   2.049 1.00 . A A . 22 ARG HB3  1 1 
        6  7319 1 1 25 ARG HD2  H  16.778 -16.525   4.250 1.00 . A A . 22 ARG HD2  1 1 
        6  7320 1 1 25 ARG HD3  H  18.505 -16.841   4.330 1.00 . A A . 22 ARG HD3  1 1 
        6  7321 1 1 25 ARG HE   H  16.890 -15.574   6.449 1.00 . A A . 22 ARG HE   1 1 
        6  7322 1 1 25 ARG HG2  H  19.066 -14.794   3.645 1.00 . A A . 22 ARG HG2  1 1 
        6  7323 1 1 25 ARG HG3  H  17.871 -14.002   4.653 1.00 . A A . 22 ARG HG3  1 1 
        6  7324 1 1 25 ARG HH11 H  19.795 -17.373   5.529 1.00 . A A . 22 ARG HH11 1 1 
        6  7325 1 1 25 ARG HH12 H  20.268 -17.650   7.172 1.00 . A A . 22 ARG HH12 1 1 
        6  7326 1 1 25 ARG HH21 H  17.472 -16.067   8.567 1.00 . A A . 22 ARG HH21 1 1 
        6  7327 1 1 25 ARG HH22 H  18.947 -16.910   8.899 1.00 . A A . 22 ARG HH22 1 1 
        6  7328 1 1 25 ARG N    N  15.044 -14.409   4.046 1.00 . A A . 22 ARG N    1 1 
        6  7329 1 1 25 ARG NE   N  17.658 -16.064   6.074 1.00 . A A . 22 ARG NE   1 1 
        6  7330 1 1 25 ARG NH1  N  19.624 -17.260   6.509 1.00 . A A . 22 ARG NH1  1 1 
        6  7331 1 1 25 ARG NH2  N  18.302 -16.518   8.238 1.00 . A A . 22 ARG NH2  1 1 
        6  7332 1 1 25 ARG O    O  14.893 -12.957   0.703 1.00 . A A . 22 ARG O    1 1 
        6  7333 1 1 26 ASP C    C  11.964 -14.049   0.241 1.00 . A A . 23 ASP C    1 1 
        6  7334 1 1 26 ASP CA   C  13.144 -15.051   0.075 1.00 . A A . 23 ASP CA   1 1 
        6  7335 1 1 26 ASP CB   C  12.607 -16.504  -0.206 1.00 . A A . 23 ASP CB   1 1 
        6  7336 1 1 26 ASP CG   C  13.611 -17.584   0.168 1.00 . A A . 23 ASP CG   1 1 
        6  7337 1 1 26 ASP H    H  14.030 -15.792   1.828 1.00 . A A . 23 ASP H    1 1 
        6  7338 1 1 26 ASP HA   H  13.739 -14.739  -0.780 1.00 . A A . 23 ASP HA   1 1 
        6  7339 1 1 26 ASP HB2  H  11.696 -16.675   0.328 1.00 . A A . 23 ASP HB2  1 1 
        6  7340 1 1 26 ASP HB3  H  12.393 -16.623  -1.265 1.00 . A A . 23 ASP HB3  1 1 
        6  7341 1 1 26 ASP N    N  14.030 -15.007   1.250 1.00 . A A . 23 ASP N    1 1 
        6  7342 1 1 26 ASP O    O  11.549 -13.456  -0.771 1.00 . A A . 23 ASP O    1 1 
        6  7343 1 1 26 ASP OD1  O  13.706 -17.919   1.366 1.00 . A A . 23 ASP OD1  1 1 
        6  7344 1 1 26 ASP OD2  O  14.310 -18.093  -0.739 1.00 . A A . 23 ASP OD2  1 1 
        6  7345 1 1 27 VAL C    C  10.936 -11.417   1.635 1.00 . A A . 24 VAL C    1 1 
        6  7346 1 1 27 VAL CA   C  10.369 -12.840   1.745 1.00 . A A . 24 VAL CA   1 1 
        6  7347 1 1 27 VAL CB   C   9.552 -13.108   3.081 1.00 . A A . 24 VAL CB   1 1 
        6  7348 1 1 27 VAL CG1  C  10.388 -13.066   4.303 1.00 . A A . 24 VAL CG1  1 1 
        6  7349 1 1 27 VAL CG2  C   8.380 -12.177   3.339 1.00 . A A . 24 VAL CG2  1 1 
        6  7350 1 1 27 VAL H    H  11.884 -14.224   2.309 1.00 . A A . 24 VAL H    1 1 
        6  7351 1 1 27 VAL HA   H   9.686 -12.971   0.941 1.00 . A A . 24 VAL HA   1 1 
        6  7352 1 1 27 VAL HB   H   9.139 -14.100   2.999 1.00 . A A . 24 VAL HB   1 1 
        6  7353 1 1 27 VAL HG11 H  10.494 -14.065   4.696 1.00 . A A . 24 VAL HG11 1 1 
        6  7354 1 1 27 VAL HG12 H   9.898 -12.431   5.022 1.00 . A A . 24 VAL HG12 1 1 
        6  7355 1 1 27 VAL HG13 H  11.351 -12.656   4.055 1.00 . A A . 24 VAL HG13 1 1 
        6  7356 1 1 27 VAL HG21 H   8.389 -11.898   4.387 1.00 . A A . 24 VAL HG21 1 1 
        6  7357 1 1 27 VAL HG22 H   7.472 -12.700   3.137 1.00 . A A . 24 VAL HG22 1 1 
        6  7358 1 1 27 VAL HG23 H   8.449 -11.290   2.735 1.00 . A A . 24 VAL HG23 1 1 
        6  7359 1 1 27 VAL N    N  11.464 -13.804   1.516 1.00 . A A . 24 VAL N    1 1 
        6  7360 1 1 27 VAL O    O  10.264 -10.530   1.160 1.00 . A A . 24 VAL O    1 1 
        6  7361 1 1 28 GLU C    C  13.008  -9.646   0.207 1.00 . A A . 25 GLU C    1 1 
        6  7362 1 1 28 GLU CA   C  12.865  -9.934   1.750 1.00 . A A . 25 GLU CA   1 1 
        6  7363 1 1 28 GLU CB   C  14.186  -9.786   2.577 1.00 . A A . 25 GLU CB   1 1 
        6  7364 1 1 28 GLU CD   C  16.693  -9.975   2.858 1.00 . A A . 25 GLU CD   1 1 
        6  7365 1 1 28 GLU CG   C  15.540 -10.031   1.880 1.00 . A A . 25 GLU CG   1 1 
        6  7366 1 1 28 GLU H    H  12.603 -11.835   2.656 1.00 . A A . 25 GLU H    1 1 
        6  7367 1 1 28 GLU HA   H  12.185  -9.170   2.118 1.00 . A A . 25 GLU HA   1 1 
        6  7368 1 1 28 GLU HB2  H  14.217  -8.790   2.957 1.00 . A A . 25 GLU HB2  1 1 
        6  7369 1 1 28 GLU HB3  H  14.122 -10.454   3.440 1.00 . A A . 25 GLU HB3  1 1 
        6  7370 1 1 28 GLU HG2  H  15.544 -10.998   1.403 1.00 . A A . 25 GLU HG2  1 1 
        6  7371 1 1 28 GLU HG3  H  15.694  -9.260   1.132 1.00 . A A . 25 GLU HG3  1 1 
        6  7372 1 1 28 GLU N    N  12.192 -11.203   2.054 1.00 . A A . 25 GLU N    1 1 
        6  7373 1 1 28 GLU O    O  12.470  -8.612  -0.231 1.00 . A A . 25 GLU O    1 1 
        6  7374 1 1 28 GLU OE1  O  17.148  -8.858   3.174 1.00 . A A . 25 GLU OE1  1 1 
        6  7375 1 1 28 GLU OE2  O  17.139 -11.047   3.317 1.00 . A A . 25 GLU OE2  1 1 
        6  7376 1 1 29 ASN C    C  12.288 -10.188  -2.831 1.00 . A A . 26 ASN C    1 1 
        6  7377 1 1 29 ASN CA   C  13.704 -10.228  -2.120 1.00 . A A . 26 ASN CA   1 1 
        6  7378 1 1 29 ASN CB   C  14.663 -11.208  -2.909 1.00 . A A . 26 ASN CB   1 1 
        6  7379 1 1 29 ASN CG   C  14.816 -10.823  -4.376 1.00 . A A . 26 ASN CG   1 1 
        6  7380 1 1 29 ASN H    H  14.107 -11.300  -0.282 1.00 . A A . 26 ASN H    1 1 
        6  7381 1 1 29 ASN HA   H  14.130  -9.246  -2.185 1.00 . A A . 26 ASN HA   1 1 
        6  7382 1 1 29 ASN HB2  H  15.673 -11.208  -2.474 1.00 . A A . 26 ASN HB2  1 1 
        6  7383 1 1 29 ASN HB3  H  14.257 -12.210  -2.880 1.00 . A A . 26 ASN HB3  1 1 
        6  7384 1 1 29 ASN HD21 H  14.751 -12.737  -4.908 1.00 . A A . 26 ASN HD21 1 1 
        6  7385 1 1 29 ASN HD22 H  14.916 -11.598  -6.197 1.00 . A A . 26 ASN HD22 1 1 
        6  7386 1 1 29 ASN N    N  13.625 -10.543  -0.644 1.00 . A A . 26 ASN N    1 1 
        6  7387 1 1 29 ASN ND2  N  14.834 -11.820  -5.248 1.00 . A A . 26 ASN ND2  1 1 
        6  7388 1 1 29 ASN O    O  11.862  -9.075  -3.347 1.00 . A A . 26 ASN O    1 1 
        6  7389 1 1 29 ASN OD1  O  14.895  -9.644  -4.723 1.00 . A A . 26 ASN OD1  1 1 
        6  7390 1 1 30 GLU C    C   9.231 -10.232  -2.848 1.00 . A A . 27 GLU C    1 1 
        6  7391 1 1 30 GLU CA   C  10.155 -11.337  -3.424 1.00 . A A . 27 GLU CA   1 1 
        6  7392 1 1 30 GLU CB   C   9.428 -12.726  -3.338 1.00 . A A . 27 GLU CB   1 1 
        6  7393 1 1 30 GLU CD   C   7.377 -14.141  -3.958 1.00 . A A . 27 GLU CD   1 1 
        6  7394 1 1 30 GLU CG   C   8.296 -12.999  -4.378 1.00 . A A . 27 GLU CG   1 1 
        6  7395 1 1 30 GLU H    H  11.875 -12.193  -2.456 1.00 . A A . 27 GLU H    1 1 
        6  7396 1 1 30 GLU HA   H  10.339 -11.111  -4.465 1.00 . A A . 27 GLU HA   1 1 
        6  7397 1 1 30 GLU HB2  H  10.162 -13.501  -3.454 1.00 . A A . 27 GLU HB2  1 1 
        6  7398 1 1 30 GLU HB3  H   8.988 -12.822  -2.362 1.00 . A A . 27 GLU HB3  1 1 
        6  7399 1 1 30 GLU HG2  H   7.682 -12.116  -4.521 1.00 . A A . 27 GLU HG2  1 1 
        6  7400 1 1 30 GLU HG3  H   8.747 -13.277  -5.327 1.00 . A A . 27 GLU HG3  1 1 
        6  7401 1 1 30 GLU N    N  11.501 -11.327  -2.790 1.00 . A A . 27 GLU N    1 1 
        6  7402 1 1 30 GLU O    O   8.620  -9.524  -3.641 1.00 . A A . 27 GLU O    1 1 
        6  7403 1 1 30 GLU OE1  O   7.684 -15.305  -4.258 1.00 . A A . 27 GLU OE1  1 1 
        6  7404 1 1 30 GLU OE2  O   6.336 -13.865  -3.326 1.00 . A A . 27 GLU OE2  1 1 
        6  7405 1 1 31 PHE C    C   8.729  -7.545  -1.086 1.00 . A A . 28 PHE C    1 1 
        6  7406 1 1 31 PHE CA   C   8.222  -9.025  -0.974 1.00 . A A . 28 PHE CA   1 1 
        6  7407 1 1 31 PHE CB   C   7.676  -9.381   0.442 1.00 . A A . 28 PHE CB   1 1 
        6  7408 1 1 31 PHE CD1  C   6.072 -11.398   0.219 1.00 . A A . 28 PHE CD1  1 1 
        6  7409 1 1 31 PHE CD2  C   5.194  -9.239   0.792 1.00 . A A . 28 PHE CD2  1 1 
        6  7410 1 1 31 PHE CE1  C   4.784 -11.929   0.263 1.00 . A A . 28 PHE CE1  1 1 
        6  7411 1 1 31 PHE CE2  C   3.914  -9.778   0.846 1.00 . A A . 28 PHE CE2  1 1 
        6  7412 1 1 31 PHE CG   C   6.294 -10.027   0.483 1.00 . A A . 28 PHE CG   1 1 
        6  7413 1 1 31 PHE CZ   C   3.717 -11.118   0.582 1.00 . A A . 28 PHE CZ   1 1 
        6  7414 1 1 31 PHE H    H   9.747 -10.530  -0.859 1.00 . A A . 28 PHE H    1 1 
        6  7415 1 1 31 PHE HA   H   7.374  -9.083  -1.643 1.00 . A A . 28 PHE HA   1 1 
        6  7416 1 1 31 PHE HB2  H   8.361 -10.072   0.915 1.00 . A A . 28 PHE HB2  1 1 
        6  7417 1 1 31 PHE HB3  H   7.634  -8.480   1.035 1.00 . A A . 28 PHE HB3  1 1 
        6  7418 1 1 31 PHE HD1  H   6.908 -12.058   0.011 1.00 . A A . 28 PHE HD1  1 1 
        6  7419 1 1 31 PHE HD2  H   5.349  -8.188   1.004 1.00 . A A . 28 PHE HD2  1 1 
        6  7420 1 1 31 PHE HE1  H   4.606 -12.972   0.026 1.00 . A A . 28 PHE HE1  1 1 
        6  7421 1 1 31 PHE HE2  H   3.070  -9.152   1.095 1.00 . A A . 28 PHE HE2  1 1 
        6  7422 1 1 31 PHE HZ   H   2.722 -11.530   0.613 1.00 . A A . 28 PHE HZ   1 1 
        6  7423 1 1 31 PHE N    N   9.162 -10.023  -1.501 1.00 . A A . 28 PHE N    1 1 
        6  7424 1 1 31 PHE O    O   7.894  -6.648  -0.914 1.00 . A A . 28 PHE O    1 1 
        6  7425 1 1 32 ARG C    C   9.770  -5.311  -2.898 1.00 . A A . 29 ARG C    1 1 
        6  7426 1 1 32 ARG CA   C  10.454  -5.786  -1.623 1.00 . A A . 29 ARG CA   1 1 
        6  7427 1 1 32 ARG CB   C  11.956  -5.333  -1.824 1.00 . A A . 29 ARG CB   1 1 
        6  7428 1 1 32 ARG CD   C  14.434  -5.262  -1.138 1.00 . A A . 29 ARG CD   1 1 
        6  7429 1 1 32 ARG CG   C  12.990  -5.568  -0.685 1.00 . A A . 29 ARG CG   1 1 
        6  7430 1 1 32 ARG CZ   C  15.511  -3.418  -2.424 1.00 . A A . 29 ARG CZ   1 1 
        6  7431 1 1 32 ARG H    H  10.752  -7.940  -1.210 1.00 . A A . 29 ARG H    1 1 
        6  7432 1 1 32 ARG HA   H  10.041  -5.194  -0.817 1.00 . A A . 29 ARG HA   1 1 
        6  7433 1 1 32 ARG HB2  H  12.343  -5.737  -2.748 1.00 . A A . 29 ARG HB2  1 1 
        6  7434 1 1 32 ARG HB3  H  11.903  -4.244  -1.962 1.00 . A A . 29 ARG HB3  1 1 
        6  7435 1 1 32 ARG HD2  H  15.112  -5.445  -0.306 1.00 . A A . 29 ARG HD2  1 1 
        6  7436 1 1 32 ARG HD3  H  14.711  -5.911  -1.963 1.00 . A A . 29 ARG HD3  1 1 
        6  7437 1 1 32 ARG HE   H  13.987  -3.203  -1.140 1.00 . A A . 29 ARG HE   1 1 
        6  7438 1 1 32 ARG HG2  H  12.769  -4.902   0.137 1.00 . A A . 29 ARG HG2  1 1 
        6  7439 1 1 32 ARG HG3  H  12.942  -6.592  -0.341 1.00 . A A . 29 ARG HG3  1 1 
        6  7440 1 1 32 ARG HH11 H  16.300  -5.247  -2.780 1.00 . A A . 29 ARG HH11 1 1 
        6  7441 1 1 32 ARG HH12 H  17.033  -3.944  -3.655 1.00 . A A . 29 ARG HH12 1 1 
        6  7442 1 1 32 ARG HH21 H  14.982  -1.466  -2.240 1.00 . A A . 29 ARG HH21 1 1 
        6  7443 1 1 32 ARG HH22 H  16.278  -1.776  -3.343 1.00 . A A . 29 ARG HH22 1 1 
        6  7444 1 1 32 ARG N    N  10.071  -7.238  -1.303 1.00 . A A . 29 ARG N    1 1 
        6  7445 1 1 32 ARG NE   N  14.596  -3.858  -1.547 1.00 . A A . 29 ARG NE   1 1 
        6  7446 1 1 32 ARG NH1  N  16.352  -4.272  -2.999 1.00 . A A . 29 ARG NH1  1 1 
        6  7447 1 1 32 ARG NH2  N  15.598  -2.116  -2.690 1.00 . A A . 29 ARG NH2  1 1 
        6  7448 1 1 32 ARG O    O   9.512  -4.109  -3.006 1.00 . A A . 29 ARG O    1 1 
        6  7449 1 1 33 LYS C    C   7.324  -5.137  -4.739 1.00 . A A . 30 LYS C    1 1 
        6  7450 1 1 33 LYS CA   C   8.733  -5.702  -5.090 1.00 . A A . 30 LYS CA   1 1 
        6  7451 1 1 33 LYS CB   C   8.765  -6.736  -6.309 1.00 . A A . 30 LYS CB   1 1 
        6  7452 1 1 33 LYS CD   C   6.733  -6.063  -7.848 1.00 . A A . 30 LYS CD   1 1 
        6  7453 1 1 33 LYS CE   C   5.273  -6.429  -8.138 1.00 . A A . 30 LYS CE   1 1 
        6  7454 1 1 33 LYS CG   C   7.466  -7.177  -7.080 1.00 . A A . 30 LYS CG   1 1 
        6  7455 1 1 33 LYS H    H   9.944  -7.141  -3.875 1.00 . A A . 30 LYS H    1 1 
        6  7456 1 1 33 LYS HA   H   9.282  -4.831  -5.403 1.00 . A A . 30 LYS HA   1 1 
        6  7457 1 1 33 LYS HB2  H   9.407  -6.306  -7.062 1.00 . A A . 30 LYS HB2  1 1 
        6  7458 1 1 33 LYS HB3  H   9.243  -7.637  -5.952 1.00 . A A . 30 LYS HB3  1 1 
        6  7459 1 1 33 LYS HD2  H   6.753  -5.156  -7.266 1.00 . A A . 30 LYS HD2  1 1 
        6  7460 1 1 33 LYS HD3  H   7.240  -5.897  -8.791 1.00 . A A . 30 LYS HD3  1 1 
        6  7461 1 1 33 LYS HE2  H   4.823  -6.823  -7.225 1.00 . A A . 30 LYS HE2  1 1 
        6  7462 1 1 33 LYS HE3  H   4.742  -5.531  -8.425 1.00 . A A . 30 LYS HE3  1 1 
        6  7463 1 1 33 LYS HG2  H   7.783  -7.899  -7.812 1.00 . A A . 30 LYS HG2  1 1 
        6  7464 1 1 33 LYS HG3  H   6.770  -7.664  -6.415 1.00 . A A . 30 LYS HG3  1 1 
        6  7465 1 1 33 LYS HZ1  H   5.588  -7.090 -10.098 1.00 . A A . 30 LYS HZ1  1 1 
        6  7466 1 1 33 LYS HZ2  H   4.137  -7.628  -9.412 1.00 . A A . 30 LYS HZ2  1 1 
        6  7467 1 1 33 LYS HZ3  H   5.603  -8.327  -8.942 1.00 . A A . 30 LYS HZ3  1 1 
        6  7468 1 1 33 LYS N    N   9.514  -6.195  -3.897 1.00 . A A . 30 LYS N    1 1 
        6  7469 1 1 33 LYS NZ   N   5.140  -7.441  -9.221 1.00 . A A . 30 LYS NZ   1 1 
        6  7470 1 1 33 LYS O    O   6.853  -4.231  -5.432 1.00 . A A . 30 LYS O    1 1 
        6  7471 1 1 34 TYR C    C   5.123  -3.841  -2.805 1.00 . A A . 31 TYR C    1 1 
        6  7472 1 1 34 TYR CA   C   5.341  -5.266  -3.340 1.00 . A A . 31 TYR CA   1 1 
        6  7473 1 1 34 TYR CB   C   4.790  -6.282  -2.336 1.00 . A A . 31 TYR CB   1 1 
        6  7474 1 1 34 TYR CD1  C   5.659  -8.416  -3.473 1.00 . A A . 31 TYR CD1  1 1 
        6  7475 1 1 34 TYR CD2  C   3.574  -8.481  -2.336 1.00 . A A . 31 TYR CD2  1 1 
        6  7476 1 1 34 TYR CE1  C   5.545  -9.749  -3.750 1.00 . A A . 31 TYR CE1  1 1 
        6  7477 1 1 34 TYR CE2  C   3.478  -9.829  -2.599 1.00 . A A . 31 TYR CE2  1 1 
        6  7478 1 1 34 TYR CG   C   4.670  -7.744  -2.755 1.00 . A A . 31 TYR CG   1 1 
        6  7479 1 1 34 TYR CZ   C   4.479 -10.444  -3.306 1.00 . A A . 31 TYR CZ   1 1 
        6  7480 1 1 34 TYR H    H   7.308  -5.827  -2.844 1.00 . A A . 31 TYR H    1 1 
        6  7481 1 1 34 TYR HA   H   4.812  -5.372  -4.277 1.00 . A A . 31 TYR HA   1 1 
        6  7482 1 1 34 TYR HB2  H   5.424  -6.278  -1.496 1.00 . A A . 31 TYR HB2  1 1 
        6  7483 1 1 34 TYR HB3  H   3.820  -5.948  -2.026 1.00 . A A . 31 TYR HB3  1 1 
        6  7484 1 1 34 TYR HD1  H   6.521  -7.882  -3.844 1.00 . A A . 31 TYR HD1  1 1 
        6  7485 1 1 34 TYR HD2  H   2.802  -7.989  -1.766 1.00 . A A . 31 TYR HD2  1 1 
        6  7486 1 1 34 TYR HE1  H   6.315 -10.254  -4.309 1.00 . A A . 31 TYR HE1  1 1 
        6  7487 1 1 34 TYR HE2  H   2.611 -10.390  -2.260 1.00 . A A . 31 TYR HE2  1 1 
        6  7488 1 1 34 TYR HH   H   5.333 -12.114  -3.472 1.00 . A A . 31 TYR HH   1 1 
        6  7489 1 1 34 TYR N    N   6.752  -5.501  -3.587 1.00 . A A . 31 TYR N    1 1 
        6  7490 1 1 34 TYR O    O   4.063  -3.256  -3.000 1.00 . A A . 31 TYR O    1 1 
        6  7491 1 1 34 TYR OH   O   4.437 -11.761  -3.547 1.00 . A A . 31 TYR OH   1 1 
        6  7492 1 1 35 GLY C    C   7.219  -1.459  -0.871 1.00 . A A . 32 GLY C    1 1 
        6  7493 1 1 35 GLY CA   C   6.051  -1.903  -1.709 1.00 . A A . 32 GLY CA   1 1 
        6  7494 1 1 35 GLY H    H   6.933  -3.778  -1.937 1.00 . A A . 32 GLY H    1 1 
        6  7495 1 1 35 GLY HA2  H   6.021  -1.292  -2.582 1.00 . A A . 32 GLY HA2  1 1 
        6  7496 1 1 35 GLY HA3  H   5.143  -1.761  -1.149 1.00 . A A . 32 GLY HA3  1 1 
        6  7497 1 1 35 GLY N    N   6.134  -3.274  -2.131 1.00 . A A . 32 GLY N    1 1 
        6  7498 1 1 35 GLY O    O   7.034  -0.619   0.000 1.00 . A A . 32 GLY O    1 1 
        6  7499 1 1 36 ASN C    C   9.546  -1.973   1.054 1.00 . A A . 33 ASN C    1 1 
        6  7500 1 1 36 ASN CA   C   9.681  -1.711  -0.466 1.00 . A A . 33 ASN CA   1 1 
        6  7501 1 1 36 ASN CB   C  10.158  -0.268  -0.758 1.00 . A A . 33 ASN CB   1 1 
        6  7502 1 1 36 ASN CG   C  11.672  -0.141  -0.803 1.00 . A A . 33 ASN CG   1 1 
        6  7503 1 1 36 ASN H    H   8.454  -2.698  -1.882 1.00 . A A . 33 ASN H    1 1 
        6  7504 1 1 36 ASN HA   H  10.431  -2.387  -0.860 1.00 . A A . 33 ASN HA   1 1 
        6  7505 1 1 36 ASN HB2  H   9.758   0.064  -1.700 1.00 . A A . 33 ASN HB2  1 1 
        6  7506 1 1 36 ASN HB3  H   9.800   0.377   0.013 1.00 . A A . 33 ASN HB3  1 1 
        6  7507 1 1 36 ASN HD21 H  11.524   1.694  -0.059 1.00 . A A . 33 ASN HD21 1 1 
        6  7508 1 1 36 ASN HD22 H  13.133   1.136  -0.388 1.00 . A A . 33 ASN HD22 1 1 
        6  7509 1 1 36 ASN N    N   8.418  -2.024  -1.162 1.00 . A A . 33 ASN N    1 1 
        6  7510 1 1 36 ASN ND2  N  12.163   1.011  -0.375 1.00 . A A . 33 ASN ND2  1 1 
        6  7511 1 1 36 ASN O    O   9.266  -1.069   1.844 1.00 . A A . 33 ASN O    1 1 
        6  7512 1 1 36 ASN OD1  O  12.391  -1.067  -1.206 1.00 . A A . 33 ASN OD1  1 1 
        6  7513 1 1 37 ILE C    C  10.586  -3.184   3.820 1.00 . A A . 34 ILE C    1 1 
        6  7514 1 1 37 ILE CA   C   9.479  -3.697   2.834 1.00 . A A . 34 ILE CA   1 1 
        6  7515 1 1 37 ILE CB   C   9.271  -5.283   2.975 1.00 . A A . 34 ILE CB   1 1 
        6  7516 1 1 37 ILE CD1  C  11.342  -6.395   4.179 1.00 . A A . 34 ILE CD1  1 1 
        6  7517 1 1 37 ILE CG1  C   9.880  -5.917   4.273 1.00 . A A . 34 ILE CG1  1 1 
        6  7518 1 1 37 ILE CG2  C   9.799  -6.013   1.771 1.00 . A A . 34 ILE CG2  1 1 
        6  7519 1 1 37 ILE H    H   9.780  -3.903   0.695 1.00 . A A . 34 ILE H    1 1 
        6  7520 1 1 37 ILE HA   H   8.559  -3.243   3.106 1.00 . A A . 34 ILE HA   1 1 
        6  7521 1 1 37 ILE HB   H   8.198  -5.461   2.994 1.00 . A A . 34 ILE HB   1 1 
        6  7522 1 1 37 ILE HD11 H  11.441  -7.057   3.341 1.00 . A A . 34 ILE HD11 1 1 
        6  7523 1 1 37 ILE HD12 H  11.608  -6.921   5.071 1.00 . A A . 34 ILE HD12 1 1 
        6  7524 1 1 37 ILE HD13 H  11.998  -5.547   4.055 1.00 . A A . 34 ILE HD13 1 1 
        6  7525 1 1 37 ILE HG12 H   9.842  -5.180   5.062 1.00 . A A . 34 ILE HG12 1 1 
        6  7526 1 1 37 ILE HG13 H   9.273  -6.763   4.560 1.00 . A A . 34 ILE HG13 1 1 
        6  7527 1 1 37 ILE HG21 H   9.792  -7.078   1.953 1.00 . A A . 34 ILE HG21 1 1 
        6  7528 1 1 37 ILE HG22 H  10.809  -5.682   1.572 1.00 . A A . 34 ILE HG22 1 1 
        6  7529 1 1 37 ILE HG23 H   9.171  -5.805   0.921 1.00 . A A . 34 ILE HG23 1 1 
        6  7530 1 1 37 ILE N    N   9.679  -3.243   1.417 1.00 . A A . 34 ILE N    1 1 
        6  7531 1 1 37 ILE O    O  11.763  -3.089   3.448 1.00 . A A . 34 ILE O    1 1 
        6  7532 1 1 38 LEU C    C  11.278  -3.464   7.216 1.00 . A A . 35 LEU C    1 1 
        6  7533 1 1 38 LEU CA   C  11.139  -2.374   6.122 1.00 . A A . 35 LEU CA   1 1 
        6  7534 1 1 38 LEU CB   C  10.839  -0.977   6.818 1.00 . A A . 35 LEU CB   1 1 
        6  7535 1 1 38 LEU CD1  C  10.279   0.417   4.708 1.00 . A A . 35 LEU CD1  1 1 
        6  7536 1 1 38 LEU CD2  C   8.440  -0.387   6.228 1.00 . A A . 35 LEU CD2  1 1 
        6  7537 1 1 38 LEU CG   C   9.888   0.067   6.143 1.00 . A A . 35 LEU CG   1 1 
        6  7538 1 1 38 LEU H    H   9.233  -2.876   5.315 1.00 . A A . 35 LEU H    1 1 
        6  7539 1 1 38 LEU HA   H  12.098  -2.291   5.627 1.00 . A A . 35 LEU HA   1 1 
        6  7540 1 1 38 LEU HB2  H  10.449  -1.164   7.811 1.00 . A A . 35 LEU HB2  1 1 
        6  7541 1 1 38 LEU HB3  H  11.799  -0.487   6.955 1.00 . A A . 35 LEU HB3  1 1 
        6  7542 1 1 38 LEU HD11 H   9.526   1.069   4.282 1.00 . A A . 35 LEU HD11 1 1 
        6  7543 1 1 38 LEU HD12 H  10.343  -0.485   4.118 1.00 . A A . 35 LEU HD12 1 1 
        6  7544 1 1 38 LEU HD13 H  11.235   0.922   4.697 1.00 . A A . 35 LEU HD13 1 1 
        6  7545 1 1 38 LEU HD21 H   7.793   0.448   6.046 1.00 . A A . 35 LEU HD21 1 1 
        6  7546 1 1 38 LEU HD22 H   8.242  -0.790   7.210 1.00 . A A . 35 LEU HD22 1 1 
        6  7547 1 1 38 LEU HD23 H   8.259  -1.149   5.486 1.00 . A A . 35 LEU HD23 1 1 
        6  7548 1 1 38 LEU HG   H   9.957   0.985   6.705 1.00 . A A . 35 LEU HG   1 1 
        6  7549 1 1 38 LEU N    N  10.176  -2.804   5.076 1.00 . A A . 35 LEU N    1 1 
        6  7550 1 1 38 LEU O    O  12.318  -3.562   7.868 1.00 . A A . 35 LEU O    1 1 
        6  7551 1 1 39 LYS C    C   9.583  -6.600   8.071 1.00 . A A . 36 LYS C    1 1 
        6  7552 1 1 39 LYS CA   C  10.135  -5.224   8.556 1.00 . A A . 36 LYS CA   1 1 
        6  7553 1 1 39 LYS CB   C   9.176  -4.570   9.577 1.00 . A A . 36 LYS CB   1 1 
        6  7554 1 1 39 LYS CD   C   8.389  -6.153  11.401 1.00 . A A . 36 LYS CD   1 1 
        6  7555 1 1 39 LYS CE   C   7.835  -6.040  12.814 1.00 . A A . 36 LYS CE   1 1 
        6  7556 1 1 39 LYS CG   C   9.320  -4.995  11.043 1.00 . A A . 36 LYS CG   1 1 
        6  7557 1 1 39 LYS H    H   9.513  -4.328   6.719 1.00 . A A . 36 LYS H    1 1 
        6  7558 1 1 39 LYS HA   H  11.114  -5.329   9.018 1.00 . A A . 36 LYS HA   1 1 
        6  7559 1 1 39 LYS HB2  H   9.306  -3.502   9.529 1.00 . A A . 36 LYS HB2  1 1 
        6  7560 1 1 39 LYS HB3  H   8.164  -4.805   9.275 1.00 . A A . 36 LYS HB3  1 1 
        6  7561 1 1 39 LYS HD2  H   7.559  -6.164  10.717 1.00 . A A . 36 LYS HD2  1 1 
        6  7562 1 1 39 LYS HD3  H   8.940  -7.074  11.323 1.00 . A A . 36 LYS HD3  1 1 
        6  7563 1 1 39 LYS HE2  H   7.275  -6.936  13.045 1.00 . A A . 36 LYS HE2  1 1 
        6  7564 1 1 39 LYS HE3  H   8.658  -5.943  13.501 1.00 . A A . 36 LYS HE3  1 1 
        6  7565 1 1 39 LYS HG2  H  10.341  -5.297  11.221 1.00 . A A . 36 LYS HG2  1 1 
        6  7566 1 1 39 LYS HG3  H   9.085  -4.152  11.673 1.00 . A A . 36 LYS HG3  1 1 
        6  7567 1 1 39 LYS HZ1  H   6.189  -4.883  12.219 1.00 . A A . 36 LYS HZ1  1 1 
        6  7568 1 1 39 LYS HZ2  H   7.479  -3.989  12.851 1.00 . A A . 36 LYS HZ2  1 1 
        6  7569 1 1 39 LYS HZ3  H   6.482  -4.861  13.889 1.00 . A A . 36 LYS HZ3  1 1 
        6  7570 1 1 39 LYS N    N  10.237  -4.310   7.392 1.00 . A A . 36 LYS N    1 1 
        6  7571 1 1 39 LYS NZ   N   6.935  -4.862  12.956 1.00 . A A . 36 LYS NZ   1 1 
        6  7572 1 1 39 LYS O    O   8.583  -6.629   7.349 1.00 . A A . 36 LYS O    1 1 
        6  7573 1 1 40 CYS C    C   9.969 -10.057   9.072 1.00 . A A . 37 CYS C    1 1 
        6  7574 1 1 40 CYS CA   C   9.844  -9.070   7.952 1.00 . A A . 37 CYS CA   1 1 
        6  7575 1 1 40 CYS CB   C  10.738  -9.513   6.784 1.00 . A A . 37 CYS CB   1 1 
        6  7576 1 1 40 CYS H    H  10.950  -7.678   9.119 1.00 . A A . 37 CYS H    1 1 
        6  7577 1 1 40 CYS HA   H   8.803  -9.046   7.633 1.00 . A A . 37 CYS HA   1 1 
        6  7578 1 1 40 CYS HB2  H  11.585  -8.869   6.751 1.00 . A A . 37 CYS HB2  1 1 
        6  7579 1 1 40 CYS HB3  H  11.090 -10.529   6.935 1.00 . A A . 37 CYS HB3  1 1 
        6  7580 1 1 40 CYS HG   H  10.855  -9.623   4.240 1.00 . A A . 37 CYS HG   1 1 
        6  7581 1 1 40 CYS N    N  10.228  -7.726   8.447 1.00 . A A . 37 CYS N    1 1 
        6  7582 1 1 40 CYS O    O  11.082 -10.325   9.542 1.00 . A A . 37 CYS O    1 1 
        6  7583 1 1 40 CYS SG   S   9.929  -9.449   5.171 1.00 . A A . 37 CYS SG   1 1 
        6  7584 1 1 41 ASP C    C   8.186 -12.823  10.458 1.00 . A A . 38 ASP C    1 1 
        6  7585 1 1 41 ASP CA   C   8.943 -11.507  10.686 1.00 . A A . 38 ASP CA   1 1 
        6  7586 1 1 41 ASP CB   C   8.453 -10.812  11.954 1.00 . A A . 38 ASP CB   1 1 
        6  7587 1 1 41 ASP CG   C   8.958 -11.455  13.237 1.00 . A A . 38 ASP CG   1 1 
        6  7588 1 1 41 ASP H    H   7.977 -10.274   9.156 1.00 . A A . 38 ASP H    1 1 
        6  7589 1 1 41 ASP HA   H  10.003 -11.743  10.823 1.00 . A A . 38 ASP HA   1 1 
        6  7590 1 1 41 ASP HB2  H   8.795  -9.777  11.928 1.00 . A A . 38 ASP HB2  1 1 
        6  7591 1 1 41 ASP HB3  H   7.365 -10.853  11.972 1.00 . A A . 38 ASP HB3  1 1 
        6  7592 1 1 41 ASP N    N   8.849 -10.565   9.543 1.00 . A A . 38 ASP N    1 1 
        6  7593 1 1 41 ASP O    O   7.102 -12.834   9.874 1.00 . A A . 38 ASP O    1 1 
        6  7594 1 1 41 ASP OD1  O  10.182 -11.664  13.363 1.00 . A A . 38 ASP OD1  1 1 
        6  7595 1 1 41 ASP OD2  O   8.126 -11.741  14.121 1.00 . A A . 38 ASP OD2  1 1 
        6  7596 1 1 42 VAL C    C   7.851 -15.726  12.322 1.00 . A A . 39 VAL C    1 1 
        6  7597 1 1 42 VAL CA   C   8.127 -15.249  10.897 1.00 . A A . 39 VAL CA   1 1 
        6  7598 1 1 42 VAL CB   C   9.002 -16.376  10.218 1.00 . A A . 39 VAL CB   1 1 
        6  7599 1 1 42 VAL CG1  C   8.160 -17.592   9.906 1.00 . A A . 39 VAL CG1  1 1 
        6  7600 1 1 42 VAL CG2  C   9.747 -15.970   8.952 1.00 . A A . 39 VAL CG2  1 1 
        6  7601 1 1 42 VAL H    H   9.602 -13.842  11.425 1.00 . A A . 39 VAL H    1 1 
        6  7602 1 1 42 VAL HA   H   7.187 -15.132  10.388 1.00 . A A . 39 VAL HA   1 1 
        6  7603 1 1 42 VAL HB   H   9.745 -16.695  10.943 1.00 . A A . 39 VAL HB   1 1 
        6  7604 1 1 42 VAL HG11 H   7.375 -17.327   9.219 1.00 . A A . 39 VAL HG11 1 1 
        6  7605 1 1 42 VAL HG12 H   7.735 -17.980  10.820 1.00 . A A . 39 VAL HG12 1 1 
        6  7606 1 1 42 VAL HG13 H   8.786 -18.343   9.452 1.00 . A A . 39 VAL HG13 1 1 
        6  7607 1 1 42 VAL HG21 H   9.071 -15.989   8.114 1.00 . A A . 39 VAL HG21 1 1 
        6  7608 1 1 42 VAL HG22 H  10.534 -16.687   8.776 1.00 . A A . 39 VAL HG22 1 1 
        6  7609 1 1 42 VAL HG23 H  10.172 -14.987   9.067 1.00 . A A . 39 VAL HG23 1 1 
        6  7610 1 1 42 VAL N    N   8.764 -13.930  10.957 1.00 . A A . 39 VAL N    1 1 
        6  7611 1 1 42 VAL O    O   8.789 -15.995  13.079 1.00 . A A . 39 VAL O    1 1 
        6  7612 1 1 43 LYS C    C   5.708 -17.747  14.005 1.00 . A A . 40 LYS C    1 1 
        6  7613 1 1 43 LYS CA   C   6.224 -16.284  14.034 1.00 . A A . 40 LYS CA   1 1 
        6  7614 1 1 43 LYS CB   C   5.157 -15.265  14.542 1.00 . A A . 40 LYS CB   1 1 
        6  7615 1 1 43 LYS CD   C   4.993 -12.870  15.324 1.00 . A A . 40 LYS CD   1 1 
        6  7616 1 1 43 LYS CE   C   4.671 -11.486  14.784 1.00 . A A . 40 LYS CE   1 1 
        6  7617 1 1 43 LYS CG   C   5.512 -13.803  14.244 1.00 . A A . 40 LYS CG   1 1 
        6  7618 1 1 43 LYS H    H   5.856 -15.605  12.064 1.00 . A A . 40 LYS H    1 1 
        6  7619 1 1 43 LYS HA   H   7.108 -16.234  14.634 1.00 . A A . 40 LYS HA   1 1 
        6  7620 1 1 43 LYS HB2  H   4.220 -15.467  14.032 1.00 . A A . 40 LYS HB2  1 1 
        6  7621 1 1 43 LYS HB3  H   5.009 -15.365  15.606 1.00 . A A . 40 LYS HB3  1 1 
        6  7622 1 1 43 LYS HD2  H   4.100 -13.295  15.756 1.00 . A A . 40 LYS HD2  1 1 
        6  7623 1 1 43 LYS HD3  H   5.752 -12.773  16.089 1.00 . A A . 40 LYS HD3  1 1 
        6  7624 1 1 43 LYS HE2  H   5.532 -11.100  14.263 1.00 . A A . 40 LYS HE2  1 1 
        6  7625 1 1 43 LYS HE3  H   3.837 -11.564  14.100 1.00 . A A . 40 LYS HE3  1 1 
        6  7626 1 1 43 LYS HG2  H   6.592 -13.702  14.174 1.00 . A A . 40 LYS HG2  1 1 
        6  7627 1 1 43 LYS HG3  H   5.074 -13.522  13.300 1.00 . A A . 40 LYS HG3  1 1 
        6  7628 1 1 43 LYS HZ1  H   3.552 -10.970  16.463 1.00 . A A . 40 LYS HZ1  1 1 
        6  7629 1 1 43 LYS HZ2  H   3.968  -9.654  15.483 1.00 . A A . 40 LYS HZ2  1 1 
        6  7630 1 1 43 LYS HZ3  H   5.133 -10.366  16.478 1.00 . A A . 40 LYS HZ3  1 1 
        6  7631 1 1 43 LYS N    N   6.580 -15.864  12.685 1.00 . A A . 40 LYS N    1 1 
        6  7632 1 1 43 LYS NZ   N   4.306 -10.553  15.878 1.00 . A A . 40 LYS NZ   1 1 
        6  7633 1 1 43 LYS O    O   4.870 -18.062  13.153 1.00 . A A . 40 LYS O    1 1 
        6  7634 1 1 44 LYS C    C   4.798 -20.514  15.788 1.00 . A A . 41 LYS C    1 1 
        6  7635 1 1 44 LYS CA   C   5.781 -20.084  14.720 1.00 . A A . 41 LYS CA   1 1 
        6  7636 1 1 44 LYS CB   C   6.984 -21.095  14.671 1.00 . A A . 41 LYS CB   1 1 
        6  7637 1 1 44 LYS CD   C   6.220 -21.779  12.345 1.00 . A A . 41 LYS CD   1 1 
        6  7638 1 1 44 LYS CE   C   6.919 -20.581  11.718 1.00 . A A . 41 LYS CE   1 1 
        6  7639 1 1 44 LYS CG   C   6.875 -22.230  13.638 1.00 . A A . 41 LYS CG   1 1 
        6  7640 1 1 44 LYS H    H   6.850 -18.442  15.619 1.00 . A A . 41 LYS H    1 1 
        6  7641 1 1 44 LYS HA   H   5.283 -20.105  13.781 1.00 . A A . 41 LYS HA   1 1 
        6  7642 1 1 44 LYS HB2  H   7.896 -20.563  14.464 1.00 . A A . 41 LYS HB2  1 1 
        6  7643 1 1 44 LYS HB3  H   7.063 -21.570  15.628 1.00 . A A . 41 LYS HB3  1 1 
        6  7644 1 1 44 LYS HD2  H   6.241 -22.594  11.646 1.00 . A A . 41 LYS HD2  1 1 
        6  7645 1 1 44 LYS HD3  H   5.201 -21.519  12.559 1.00 . A A . 41 LYS HD3  1 1 
        6  7646 1 1 44 LYS HE2  H   6.271 -20.147  10.978 1.00 . A A . 41 LYS HE2  1 1 
        6  7647 1 1 44 LYS HE3  H   7.090 -19.846  12.503 1.00 . A A . 41 LYS HE3  1 1 
        6  7648 1 1 44 LYS HG2  H   7.867 -22.584  13.405 1.00 . A A . 41 LYS HG2  1 1 
        6  7649 1 1 44 LYS HG3  H   6.301 -23.046  14.058 1.00 . A A . 41 LYS HG3  1 1 
        6  7650 1 1 44 LYS HZ1  H   8.659 -20.106  10.667 1.00 . A A . 41 LYS HZ1  1 1 
        6  7651 1 1 44 LYS HZ2  H   8.063 -21.660  10.361 1.00 . A A . 41 LYS HZ2  1 1 
        6  7652 1 1 44 LYS HZ3  H   8.859 -21.334  11.814 1.00 . A A . 41 LYS HZ3  1 1 
        6  7653 1 1 44 LYS N    N   6.210 -18.684  14.883 1.00 . A A . 41 LYS N    1 1 
        6  7654 1 1 44 LYS NZ   N   8.213 -20.946  11.095 1.00 . A A . 41 LYS NZ   1 1 
        6  7655 1 1 44 LYS O    O   5.070 -20.322  16.977 1.00 . A A . 41 LYS O    1 1 
        6  7656 1 1 45 THR C    C   3.120 -23.192  16.535 1.00 . A A . 42 THR C    1 1 
        6  7657 1 1 45 THR CA   C   2.785 -21.688  16.354 1.00 . A A . 42 THR CA   1 1 
        6  7658 1 1 45 THR CB   C   1.256 -21.464  16.060 1.00 . A A . 42 THR CB   1 1 
        6  7659 1 1 45 THR CG2  C   0.654 -22.465  15.054 1.00 . A A . 42 THR CG2  1 1 
        6  7660 1 1 45 THR H    H   3.355 -21.029  14.456 1.00 . A A . 42 THR H    1 1 
        6  7661 1 1 45 THR HA   H   3.033 -21.168  17.249 1.00 . A A . 42 THR HA   1 1 
        6  7662 1 1 45 THR HB   H   1.131 -20.473  15.674 1.00 . A A . 42 THR HB   1 1 
        6  7663 1 1 45 THR HG1  H  -0.421 -21.433  17.107 1.00 . A A . 42 THR HG1  1 1 
        6  7664 1 1 45 THR HG21 H   1.084 -23.437  15.214 1.00 . A A . 42 THR HG21 1 1 
        6  7665 1 1 45 THR HG22 H   0.841 -22.152  14.036 1.00 . A A . 42 THR HG22 1 1 
        6  7666 1 1 45 THR HG23 H  -0.415 -22.523  15.214 1.00 . A A . 42 THR HG23 1 1 
        6  7667 1 1 45 THR N    N   3.643 -21.080  15.382 1.00 . A A . 42 THR N    1 1 
        6  7668 1 1 45 THR O    O   3.755 -23.806  15.669 1.00 . A A . 42 THR O    1 1 
        6  7669 1 1 45 THR OG1  O   0.515 -21.558  17.285 1.00 . A A . 42 THR OG1  1 1 
        6  7670 1 1 46 VAL C    C   1.981 -26.155  17.239 1.00 . A A . 43 VAL C    1 1 
        6  7671 1 1 46 VAL CA   C   2.928 -25.191  18.022 1.00 . A A . 43 VAL CA   1 1 
        6  7672 1 1 46 VAL CB   C   2.816 -25.464  19.583 1.00 . A A . 43 VAL CB   1 1 
        6  7673 1 1 46 VAL CG1  C   3.605 -26.701  19.989 1.00 . A A . 43 VAL CG1  1 1 
        6  7674 1 1 46 VAL CG2  C   3.262 -24.267  20.439 1.00 . A A . 43 VAL CG2  1 1 
        6  7675 1 1 46 VAL H    H   2.223 -23.203  18.322 1.00 . A A . 43 VAL H    1 1 
        6  7676 1 1 46 VAL HA   H   3.943 -25.430  17.716 1.00 . A A . 43 VAL HA   1 1 
        6  7677 1 1 46 VAL HB   H   1.782 -25.671  19.825 1.00 . A A . 43 VAL HB   1 1 
        6  7678 1 1 46 VAL HG11 H   3.514 -26.850  21.055 1.00 . A A . 43 VAL HG11 1 1 
        6  7679 1 1 46 VAL HG12 H   4.646 -26.568  19.733 1.00 . A A . 43 VAL HG12 1 1 
        6  7680 1 1 46 VAL HG13 H   3.215 -27.566  19.470 1.00 . A A . 43 VAL HG13 1 1 
        6  7681 1 1 46 VAL HG21 H   3.155 -24.523  21.486 1.00 . A A . 43 VAL HG21 1 1 
        6  7682 1 1 46 VAL HG22 H   2.647 -23.407  20.223 1.00 . A A . 43 VAL HG22 1 1 
        6  7683 1 1 46 VAL HG23 H   4.298 -24.030  20.241 1.00 . A A . 43 VAL HG23 1 1 
        6  7684 1 1 46 VAL N    N   2.694 -23.764  17.677 1.00 . A A . 43 VAL N    1 1 
        6  7685 1 1 46 VAL O    O   2.197 -27.368  17.225 1.00 . A A . 43 VAL O    1 1 
        6  7686 1 1 47 SER C    C   0.496 -26.830  14.409 1.00 . A A . 44 SER C    1 1 
        6  7687 1 1 47 SER CA   C  -0.031 -26.409  15.811 1.00 . A A . 44 SER CA   1 1 
        6  7688 1 1 47 SER CB   C  -1.356 -25.598  15.671 1.00 . A A . 44 SER CB   1 1 
        6  7689 1 1 47 SER H    H   0.898 -24.634  16.492 1.00 . A A . 44 SER H    1 1 
        6  7690 1 1 47 SER HA   H  -0.212 -27.303  16.401 1.00 . A A . 44 SER HA   1 1 
        6  7691 1 1 47 SER HB2  H  -1.222 -24.803  14.946 1.00 . A A . 44 SER HB2  1 1 
        6  7692 1 1 47 SER HB3  H  -2.165 -26.241  15.332 1.00 . A A . 44 SER HB3  1 1 
        6  7693 1 1 47 SER HG   H  -2.697 -24.984  16.979 1.00 . A A . 44 SER HG   1 1 
        6  7694 1 1 47 SER N    N   0.967 -25.603  16.538 1.00 . A A . 44 SER N    1 1 
        6  7695 1 1 47 SER O    O  -0.253 -27.385  13.600 1.00 . A A . 44 SER O    1 1 
        6  7696 1 1 47 SER OG   O  -1.737 -25.012  16.913 1.00 . A A . 44 SER OG   1 1 
        6  7697 1 1 48 GLY C    C   2.177 -25.905  11.712 1.00 . A A . 45 GLY C    1 1 
        6  7698 1 1 48 GLY CA   C   2.418 -26.901  12.856 1.00 . A A . 45 GLY CA   1 1 
        6  7699 1 1 48 GLY H    H   2.352 -26.172  14.861 1.00 . A A . 45 GLY H    1 1 
        6  7700 1 1 48 GLY HA2  H   3.484 -26.970  13.012 1.00 . A A . 45 GLY HA2  1 1 
        6  7701 1 1 48 GLY HA3  H   2.058 -27.873  12.548 1.00 . A A . 45 GLY HA3  1 1 
        6  7702 1 1 48 GLY N    N   1.791 -26.557  14.138 1.00 . A A . 45 GLY N    1 1 
        6  7703 1 1 48 GLY O    O   2.738 -26.076  10.629 1.00 . A A . 45 GLY O    1 1 
        6  7704 1 1 49 ALA C    C   2.196 -22.700  11.065 1.00 . A A . 46 ALA C    1 1 
        6  7705 1 1 49 ALA CA   C   1.132 -23.834  10.934 1.00 . A A . 46 ALA CA   1 1 
        6  7706 1 1 49 ALA CB   C  -0.319 -23.295  11.010 1.00 . A A . 46 ALA CB   1 1 
        6  7707 1 1 49 ALA H    H   0.877 -24.838  12.782 1.00 . A A . 46 ALA H    1 1 
        6  7708 1 1 49 ALA HA   H   1.245 -24.311   9.968 1.00 . A A . 46 ALA HA   1 1 
        6  7709 1 1 49 ALA HB1  H  -0.501 -22.815  11.960 1.00 . A A . 46 ALA HB1  1 1 
        6  7710 1 1 49 ALA HB2  H  -1.017 -24.116  10.889 1.00 . A A . 46 ALA HB2  1 1 
        6  7711 1 1 49 ALA HB3  H  -0.487 -22.583  10.221 1.00 . A A . 46 ALA HB3  1 1 
        6  7712 1 1 49 ALA N    N   1.356 -24.875  11.939 1.00 . A A . 46 ALA N    1 1 
        6  7713 1 1 49 ALA O    O   2.507 -22.252  12.173 1.00 . A A . 46 ALA O    1 1 
        6  7714 1 1 50 ALA C    C   2.989 -19.930   9.328 1.00 . A A . 47 ALA C    1 1 
        6  7715 1 1 50 ALA CA   C   3.732 -21.146   9.880 1.00 . A A . 47 ALA CA   1 1 
        6  7716 1 1 50 ALA CB   C   4.955 -21.476   8.978 1.00 . A A . 47 ALA CB   1 1 
        6  7717 1 1 50 ALA H    H   2.516 -22.693   9.085 1.00 . A A . 47 ALA H    1 1 
        6  7718 1 1 50 ALA HA   H   4.106 -20.951  10.897 1.00 . A A . 47 ALA HA   1 1 
        6  7719 1 1 50 ALA HB1  H   5.618 -20.613   8.918 1.00 . A A . 47 ALA HB1  1 1 
        6  7720 1 1 50 ALA HB2  H   4.640 -21.734   7.986 1.00 . A A . 47 ALA HB2  1 1 
        6  7721 1 1 50 ALA HB3  H   5.504 -22.308   9.404 1.00 . A A . 47 ALA HB3  1 1 
        6  7722 1 1 50 ALA N    N   2.770 -22.266   9.926 1.00 . A A . 47 ALA N    1 1 
        6  7723 1 1 50 ALA O    O   2.104 -20.103   8.485 1.00 . A A . 47 ALA O    1 1 
        6  7724 1 1 51 PHE C    C   3.762 -16.483   8.927 1.00 . A A . 48 PHE C    1 1 
        6  7725 1 1 51 PHE CA   C   2.671 -17.515   9.206 1.00 . A A . 48 PHE CA   1 1 
        6  7726 1 1 51 PHE CB   C   1.666 -16.861  10.200 1.00 . A A . 48 PHE CB   1 1 
        6  7727 1 1 51 PHE CD1  C  -0.167 -18.508  10.583 1.00 . A A . 48 PHE CD1  1 1 
        6  7728 1 1 51 PHE CD2  C   1.368 -18.071  12.335 1.00 . A A . 48 PHE CD2  1 1 
        6  7729 1 1 51 PHE CE1  C  -0.820 -19.412  11.374 1.00 . A A . 48 PHE CE1  1 1 
        6  7730 1 1 51 PHE CE2  C   0.733 -18.966  13.135 1.00 . A A . 48 PHE CE2  1 1 
        6  7731 1 1 51 PHE CG   C   0.930 -17.829  11.058 1.00 . A A . 48 PHE CG   1 1 
        6  7732 1 1 51 PHE CZ   C  -0.370 -19.653  12.663 1.00 . A A . 48 PHE CZ   1 1 
        6  7733 1 1 51 PHE H    H   3.844 -18.604  10.605 1.00 . A A . 48 PHE H    1 1 
        6  7734 1 1 51 PHE HA   H   2.159 -17.815   8.295 1.00 . A A . 48 PHE HA   1 1 
        6  7735 1 1 51 PHE HB2  H   2.201 -16.195  10.867 1.00 . A A . 48 PHE HB2  1 1 
        6  7736 1 1 51 PHE HB3  H   0.930 -16.291   9.646 1.00 . A A . 48 PHE HB3  1 1 
        6  7737 1 1 51 PHE HD1  H  -0.514 -18.317   9.583 1.00 . A A . 48 PHE HD1  1 1 
        6  7738 1 1 51 PHE HD2  H   2.226 -17.544  12.703 1.00 . A A . 48 PHE HD2  1 1 
        6  7739 1 1 51 PHE HE1  H  -1.665 -19.937  10.984 1.00 . A A . 48 PHE HE1  1 1 
        6  7740 1 1 51 PHE HE2  H   1.105 -19.133  14.125 1.00 . A A . 48 PHE HE2  1 1 
        6  7741 1 1 51 PHE HZ   H  -0.877 -20.367  13.294 1.00 . A A . 48 PHE HZ   1 1 
        6  7742 1 1 51 PHE N    N   3.295 -18.708   9.793 1.00 . A A . 48 PHE N    1 1 
        6  7743 1 1 51 PHE O    O   4.772 -16.463   9.642 1.00 . A A . 48 PHE O    1 1 
        6  7744 1 1 52 ALA C    C   3.779 -13.170   7.864 1.00 . A A . 49 ALA C    1 1 
        6  7745 1 1 52 ALA CA   C   4.513 -14.504   7.752 1.00 . A A . 49 ALA CA   1 1 
        6  7746 1 1 52 ALA CB   C   5.366 -14.616   6.472 1.00 . A A . 49 ALA CB   1 1 
        6  7747 1 1 52 ALA H    H   2.874 -15.779   7.232 1.00 . A A . 49 ALA H    1 1 
        6  7748 1 1 52 ALA HA   H   5.178 -14.553   8.576 1.00 . A A . 49 ALA HA   1 1 
        6  7749 1 1 52 ALA HB1  H   5.690 -15.637   6.343 1.00 . A A . 49 ALA HB1  1 1 
        6  7750 1 1 52 ALA HB2  H   6.242 -13.986   6.561 1.00 . A A . 49 ALA HB2  1 1 
        6  7751 1 1 52 ALA HB3  H   4.788 -14.313   5.610 1.00 . A A . 49 ALA HB3  1 1 
        6  7752 1 1 52 ALA N    N   3.593 -15.634   7.900 1.00 . A A . 49 ALA N    1 1 
        6  7753 1 1 52 ALA O    O   2.658 -13.011   7.350 1.00 . A A . 49 ALA O    1 1 
        6  7754 1 1 53 PHE C    C   4.916  -9.970   7.981 1.00 . A A . 50 PHE C    1 1 
        6  7755 1 1 53 PHE CA   C   3.993 -10.898   8.820 1.00 . A A . 50 PHE CA   1 1 
        6  7756 1 1 53 PHE CB   C   4.194 -10.622  10.327 1.00 . A A . 50 PHE CB   1 1 
        6  7757 1 1 53 PHE CD1  C   1.954  -9.910  11.192 1.00 . A A . 50 PHE CD1  1 1 
        6  7758 1 1 53 PHE CD2  C   3.730  -8.318  11.260 1.00 . A A . 50 PHE CD2  1 1 
        6  7759 1 1 53 PHE CE1  C   1.101  -8.993  11.774 1.00 . A A . 50 PHE CE1  1 1 
        6  7760 1 1 53 PHE CE2  C   2.879  -7.395  11.841 1.00 . A A . 50 PHE CE2  1 1 
        6  7761 1 1 53 PHE CG   C   3.275  -9.588  10.926 1.00 . A A . 50 PHE CG   1 1 
        6  7762 1 1 53 PHE CZ   C   1.564  -7.733  12.100 1.00 . A A . 50 PHE CZ   1 1 
        6  7763 1 1 53 PHE H    H   5.213 -12.517   9.106 1.00 . A A . 50 PHE H    1 1 
        6  7764 1 1 53 PHE HA   H   2.950 -10.813   8.559 1.00 . A A . 50 PHE HA   1 1 
        6  7765 1 1 53 PHE HB2  H   4.042 -11.551  10.875 1.00 . A A . 50 PHE HB2  1 1 
        6  7766 1 1 53 PHE HB3  H   5.224 -10.300  10.489 1.00 . A A . 50 PHE HB3  1 1 
        6  7767 1 1 53 PHE HD1  H   1.588 -10.892  10.936 1.00 . A A . 50 PHE HD1  1 1 
        6  7768 1 1 53 PHE HD2  H   4.758  -8.051  11.058 1.00 . A A . 50 PHE HD2  1 1 
        6  7769 1 1 53 PHE HE1  H   0.072  -9.259  11.977 1.00 . A A . 50 PHE HE1  1 1 
        6  7770 1 1 53 PHE HE2  H   3.243  -6.409  12.095 1.00 . A A . 50 PHE HE2  1 1 
        6  7771 1 1 53 PHE HZ   H   0.900  -7.014  12.558 1.00 . A A . 50 PHE HZ   1 1 
        6  7772 1 1 53 PHE N    N   4.426 -12.250   8.612 1.00 . A A . 50 PHE N    1 1 
        6  7773 1 1 53 PHE O    O   6.159  -9.969   8.233 1.00 . A A . 50 PHE O    1 1 
        6  7774 1 1 54 ILE C    C   4.895  -6.914   6.077 1.00 . A A . 51 ILE C    1 1 
        6  7775 1 1 54 ILE CA   C   5.275  -8.389   6.097 1.00 . A A . 51 ILE CA   1 1 
        6  7776 1 1 54 ILE CB   C   5.362  -8.796   4.569 1.00 . A A . 51 ILE CB   1 1 
        6  7777 1 1 54 ILE CD1  C   4.051 -11.087   4.539 1.00 . A A . 51 ILE CD1  1 1 
        6  7778 1 1 54 ILE CG1  C   5.354 -10.327   4.260 1.00 . A A . 51 ILE CG1  1 1 
        6  7779 1 1 54 ILE CG2  C   6.679  -8.251   4.019 1.00 . A A . 51 ILE CG2  1 1 
        6  7780 1 1 54 ILE H    H   3.365  -9.144   6.878 1.00 . A A . 51 ILE H    1 1 
        6  7781 1 1 54 ILE HA   H   6.272  -8.469   6.514 1.00 . A A . 51 ILE HA   1 1 
        6  7782 1 1 54 ILE HB   H   4.559  -8.271   4.021 1.00 . A A . 51 ILE HB   1 1 
        6  7783 1 1 54 ILE HD11 H   4.100 -12.073   4.102 1.00 . A A . 51 ILE HD11 1 1 
        6  7784 1 1 54 ILE HD12 H   3.208 -10.556   4.116 1.00 . A A . 51 ILE HD12 1 1 
        6  7785 1 1 54 ILE HD13 H   3.904 -11.183   5.607 1.00 . A A . 51 ILE HD13 1 1 
        6  7786 1 1 54 ILE HG12 H   5.571 -10.454   3.213 1.00 . A A . 51 ILE HG12 1 1 
        6  7787 1 1 54 ILE HG13 H   6.161 -10.805   4.809 1.00 . A A . 51 ILE HG13 1 1 
        6  7788 1 1 54 ILE HG21 H   7.506  -8.695   4.554 1.00 . A A . 51 ILE HG21 1 1 
        6  7789 1 1 54 ILE HG22 H   6.704  -7.180   4.142 1.00 . A A . 51 ILE HG22 1 1 
        6  7790 1 1 54 ILE HG23 H   6.759  -8.494   2.970 1.00 . A A . 51 ILE HG23 1 1 
        6  7791 1 1 54 ILE N    N   4.364  -9.193   6.992 1.00 . A A . 51 ILE N    1 1 
        6  7792 1 1 54 ILE O    O   3.924  -6.528   5.440 1.00 . A A . 51 ILE O    1 1 
        6  7793 1 1 55 GLU C    C   6.168  -3.812   5.713 1.00 . A A . 52 GLU C    1 1 
        6  7794 1 1 55 GLU CA   C   5.467  -4.661   6.813 1.00 . A A . 52 GLU CA   1 1 
        6  7795 1 1 55 GLU CB   C   5.966  -4.230   8.178 1.00 . A A . 52 GLU CB   1 1 
        6  7796 1 1 55 GLU CD   C   4.453  -3.816  10.164 1.00 . A A . 52 GLU CD   1 1 
        6  7797 1 1 55 GLU CG   C   5.095  -3.235   8.915 1.00 . A A . 52 GLU CG   1 1 
        6  7798 1 1 55 GLU H    H   6.603  -6.476   6.965 1.00 . A A . 52 GLU H    1 1 
        6  7799 1 1 55 GLU HA   H   4.399  -4.524   6.776 1.00 . A A . 52 GLU HA   1 1 
        6  7800 1 1 55 GLU HB2  H   6.063  -5.106   8.800 1.00 . A A . 52 GLU HB2  1 1 
        6  7801 1 1 55 GLU HB3  H   6.932  -3.782   8.050 1.00 . A A . 52 GLU HB3  1 1 
        6  7802 1 1 55 GLU HG2  H   5.707  -2.398   9.208 1.00 . A A . 52 GLU HG2  1 1 
        6  7803 1 1 55 GLU HG3  H   4.316  -2.885   8.257 1.00 . A A . 52 GLU HG3  1 1 
        6  7804 1 1 55 GLU N    N   5.753  -6.097   6.650 1.00 . A A . 52 GLU N    1 1 
        6  7805 1 1 55 GLU O    O   7.402  -3.669   5.728 1.00 . A A . 52 GLU O    1 1 
        6  7806 1 1 55 GLU OE1  O   5.023  -4.764  10.754 1.00 . A A . 52 GLU OE1  1 1 
        6  7807 1 1 55 GLU OE2  O   3.393  -3.304  10.580 1.00 . A A . 52 GLU OE2  1 1 
        6  7808 1 1 56 PHE C    C   5.474  -1.019   3.596 1.00 . A A . 53 PHE C    1 1 
        6  7809 1 1 56 PHE CA   C   5.964  -2.493   3.625 1.00 . A A . 53 PHE CA   1 1 
        6  7810 1 1 56 PHE CB   C   5.730  -3.208   2.279 1.00 . A A . 53 PHE CB   1 1 
        6  7811 1 1 56 PHE CD1  C   3.252  -3.108   2.072 1.00 . A A . 53 PHE CD1  1 1 
        6  7812 1 1 56 PHE CD2  C   4.271  -5.256   2.304 1.00 . A A . 53 PHE CD2  1 1 
        6  7813 1 1 56 PHE CE1  C   2.016  -3.692   2.034 1.00 . A A . 53 PHE CE1  1 1 
        6  7814 1 1 56 PHE CE2  C   3.036  -5.845   2.267 1.00 . A A . 53 PHE CE2  1 1 
        6  7815 1 1 56 PHE CG   C   4.391  -3.874   2.209 1.00 . A A . 53 PHE CG   1 1 
        6  7816 1 1 56 PHE CZ   C   1.904  -5.060   2.135 1.00 . A A . 53 PHE CZ   1 1 
        6  7817 1 1 56 PHE H    H   4.418  -3.504   4.726 1.00 . A A . 53 PHE H    1 1 
        6  7818 1 1 56 PHE HA   H   7.014  -2.465   3.817 1.00 . A A . 53 PHE HA   1 1 
        6  7819 1 1 56 PHE HB2  H   5.786  -2.491   1.471 1.00 . A A . 53 PHE HB2  1 1 
        6  7820 1 1 56 PHE HB3  H   6.492  -3.960   2.133 1.00 . A A . 53 PHE HB3  1 1 
        6  7821 1 1 56 PHE HD1  H   3.346  -2.028   1.986 1.00 . A A . 53 PHE HD1  1 1 
        6  7822 1 1 56 PHE HD2  H   5.155  -5.870   2.431 1.00 . A A . 53 PHE HD2  1 1 
        6  7823 1 1 56 PHE HE1  H   1.133  -3.082   1.938 1.00 . A A . 53 PHE HE1  1 1 
        6  7824 1 1 56 PHE HE2  H   2.954  -6.918   2.315 1.00 . A A . 53 PHE HE2  1 1 
        6  7825 1 1 56 PHE HZ   H   0.928  -5.522   2.117 1.00 . A A . 53 PHE HZ   1 1 
        6  7826 1 1 56 PHE N    N   5.396  -3.309   4.728 1.00 . A A . 53 PHE N    1 1 
        6  7827 1 1 56 PHE O    O   4.503  -0.674   4.281 1.00 . A A . 53 PHE O    1 1 
        6  7828 1 1 57 GLU C    C   4.620   1.611   1.727 1.00 . A A . 54 GLU C    1 1 
        6  7829 1 1 57 GLU CA   C   5.807   1.301   2.675 1.00 . A A . 54 GLU CA   1 1 
        6  7830 1 1 57 GLU CB   C   7.056   2.211   2.387 1.00 . A A . 54 GLU CB   1 1 
        6  7831 1 1 57 GLU CD   C   8.631   3.462   0.835 1.00 . A A . 54 GLU CD   1 1 
        6  7832 1 1 57 GLU CG   C   7.342   2.651   0.929 1.00 . A A . 54 GLU CG   1 1 
        6  7833 1 1 57 GLU H    H   6.928  -0.490   2.263 1.00 . A A . 54 GLU H    1 1 
        6  7834 1 1 57 GLU HA   H   5.454   1.573   3.655 1.00 . A A . 54 GLU HA   1 1 
        6  7835 1 1 57 GLU HB2  H   6.957   3.109   2.978 1.00 . A A . 54 GLU HB2  1 1 
        6  7836 1 1 57 GLU HB3  H   7.932   1.690   2.738 1.00 . A A . 54 GLU HB3  1 1 
        6  7837 1 1 57 GLU HG2  H   7.442   1.777   0.306 1.00 . A A . 54 GLU HG2  1 1 
        6  7838 1 1 57 GLU HG3  H   6.519   3.270   0.554 1.00 . A A . 54 GLU HG3  1 1 
        6  7839 1 1 57 GLU N    N   6.161  -0.149   2.786 1.00 . A A . 54 GLU N    1 1 
        6  7840 1 1 57 GLU O    O   3.925   2.596   1.960 1.00 . A A . 54 GLU O    1 1 
        6  7841 1 1 57 GLU OE1  O   8.643   4.625   1.304 1.00 . A A . 54 GLU OE1  1 1 
        6  7842 1 1 57 GLU OE2  O   9.646   2.931   0.327 1.00 . A A . 54 GLU OE2  1 1 
        6  7843 1 1 58 ASP C    C   2.192  -0.148  -0.068 1.00 . A A . 55 ASP C    1 1 
        6  7844 1 1 58 ASP CA   C   3.174   1.026  -0.143 1.00 . A A . 55 ASP CA   1 1 
        6  7845 1 1 58 ASP CB   C   3.610   1.183  -1.601 1.00 . A A . 55 ASP CB   1 1 
        6  7846 1 1 58 ASP CG   C   3.526   2.612  -2.083 1.00 . A A . 55 ASP CG   1 1 
        6  7847 1 1 58 ASP H    H   4.980   0.088   0.457 1.00 . A A . 55 ASP H    1 1 
        6  7848 1 1 58 ASP HA   H   2.712   1.942   0.182 1.00 . A A . 55 ASP HA   1 1 
        6  7849 1 1 58 ASP HB2  H   4.622   0.859  -1.686 1.00 . A A . 55 ASP HB2  1 1 
        6  7850 1 1 58 ASP HB3  H   3.001   0.560  -2.233 1.00 . A A . 55 ASP HB3  1 1 
        6  7851 1 1 58 ASP N    N   4.355   0.796   0.695 1.00 . A A . 55 ASP N    1 1 
        6  7852 1 1 58 ASP O    O   2.544  -1.262  -0.458 1.00 . A A . 55 ASP O    1 1 
        6  7853 1 1 58 ASP OD1  O   2.414   3.054  -2.449 1.00 . A A . 55 ASP OD1  1 1 
        6  7854 1 1 58 ASP OD2  O   4.564   3.303  -2.090 1.00 . A A . 55 ASP OD2  1 1 
        6  7855 1 1 59 ALA C    C  -0.762  -1.192  -1.037 1.00 . A A . 56 ALA C    1 1 
        6  7856 1 1 59 ALA CA   C  -0.089  -0.962   0.342 1.00 . A A . 56 ALA CA   1 1 
        6  7857 1 1 59 ALA CB   C  -1.141  -0.837   1.461 1.00 . A A . 56 ALA CB   1 1 
        6  7858 1 1 59 ALA H    H   0.771   0.917   0.929 1.00 . A A . 56 ALA H    1 1 
        6  7859 1 1 59 ALA HA   H   0.442  -1.877   0.549 1.00 . A A . 56 ALA HA   1 1 
        6  7860 1 1 59 ALA HB1  H  -2.009  -1.436   1.209 1.00 . A A . 56 ALA HB1  1 1 
        6  7861 1 1 59 ALA HB2  H  -1.438   0.180   1.618 1.00 . A A . 56 ALA HB2  1 1 
        6  7862 1 1 59 ALA HB3  H  -0.726  -1.228   2.381 1.00 . A A . 56 ALA HB3  1 1 
        6  7863 1 1 59 ALA N    N   0.946   0.088   0.410 1.00 . A A . 56 ALA N    1 1 
        6  7864 1 1 59 ALA O    O  -1.114  -2.344  -1.309 1.00 . A A . 56 ALA O    1 1 
        6  7865 1 1 60 ARG C    C  -1.037  -1.162  -4.250 1.00 . A A . 57 ARG C    1 1 
        6  7866 1 1 60 ARG CA   C  -1.829  -0.454  -3.101 1.00 . A A . 57 ARG CA   1 1 
        6  7867 1 1 60 ARG CB   C  -2.698   0.743  -3.642 1.00 . A A . 57 ARG CB   1 1 
        6  7868 1 1 60 ARG CD   C  -0.845   2.567  -4.152 1.00 . A A . 57 ARG CD   1 1 
        6  7869 1 1 60 ARG CG   C  -2.031   1.716  -4.661 1.00 . A A . 57 ARG CG   1 1 
        6  7870 1 1 60 ARG CZ   C  -0.501   4.872  -5.008 1.00 . A A . 57 ARG CZ   1 1 
        6  7871 1 1 60 ARG H    H  -0.535   0.710  -1.803 1.00 . A A . 57 ARG H    1 1 
        6  7872 1 1 60 ARG HA   H  -2.546  -1.199  -2.738 1.00 . A A . 57 ARG HA   1 1 
        6  7873 1 1 60 ARG HB2  H  -3.547   0.290  -4.159 1.00 . A A . 57 ARG HB2  1 1 
        6  7874 1 1 60 ARG HB3  H  -3.115   1.313  -2.811 1.00 . A A . 57 ARG HB3  1 1 
        6  7875 1 1 60 ARG HD2  H  -0.600   2.320  -3.131 1.00 . A A . 57 ARG HD2  1 1 
        6  7876 1 1 60 ARG HD3  H   0.007   2.370  -4.780 1.00 . A A . 57 ARG HD3  1 1 
        6  7877 1 1 60 ARG HE   H  -1.869   4.333  -3.639 1.00 . A A . 57 ARG HE   1 1 
        6  7878 1 1 60 ARG HG2  H  -1.677   1.124  -5.493 1.00 . A A . 57 ARG HG2  1 1 
        6  7879 1 1 60 ARG HG3  H  -2.795   2.392  -5.029 1.00 . A A . 57 ARG HG3  1 1 
        6  7880 1 1 60 ARG HH11 H   0.728   3.527  -5.908 1.00 . A A . 57 ARG HH11 1 1 
        6  7881 1 1 60 ARG HH12 H   0.914   5.162  -6.440 1.00 . A A . 57 ARG HH12 1 1 
        6  7882 1 1 60 ARG HH21 H  -1.503   6.462  -4.239 1.00 . A A . 57 ARG HH21 1 1 
        6  7883 1 1 60 ARG HH22 H  -0.347   6.827  -5.488 1.00 . A A . 57 ARG HH22 1 1 
        6  7884 1 1 60 ARG N    N  -0.990  -0.167  -1.907 1.00 . A A . 57 ARG N    1 1 
        6  7885 1 1 60 ARG NE   N  -1.131   3.996  -4.214 1.00 . A A . 57 ARG NE   1 1 
        6  7886 1 1 60 ARG NH1  N   0.459   4.487  -5.851 1.00 . A A . 57 ARG NH1  1 1 
        6  7887 1 1 60 ARG NH2  N  -0.801   6.157  -4.908 1.00 . A A . 57 ARG NH2  1 1 
        6  7888 1 1 60 ARG O    O  -1.650  -1.897  -5.021 1.00 . A A . 57 ARG O    1 1 
        6  7889 1 1 61 ASP C    C   1.208  -3.187  -5.219 1.00 . A A . 58 ASP C    1 1 
        6  7890 1 1 61 ASP CA   C   1.133  -1.638  -5.418 1.00 . A A . 58 ASP CA   1 1 
        6  7891 1 1 61 ASP CB   C   2.569  -1.052  -5.542 1.00 . A A . 58 ASP CB   1 1 
        6  7892 1 1 61 ASP CG   C   2.994  -0.959  -6.994 1.00 . A A . 58 ASP CG   1 1 
        6  7893 1 1 61 ASP H    H   0.721  -0.193  -3.851 1.00 . A A . 58 ASP H    1 1 
        6  7894 1 1 61 ASP HA   H   0.631  -1.468  -6.362 1.00 . A A . 58 ASP HA   1 1 
        6  7895 1 1 61 ASP HB2  H   2.600  -0.061  -5.115 1.00 . A A . 58 ASP HB2  1 1 
        6  7896 1 1 61 ASP HB3  H   3.292  -1.694  -5.036 1.00 . A A . 58 ASP HB3  1 1 
        6  7897 1 1 61 ASP N    N   0.304  -0.925  -4.382 1.00 . A A . 58 ASP N    1 1 
        6  7898 1 1 61 ASP O    O   1.190  -3.937  -6.200 1.00 . A A . 58 ASP O    1 1 
        6  7899 1 1 61 ASP OD1  O   2.392  -0.146  -7.728 1.00 . A A . 58 ASP OD1  1 1 
        6  7900 1 1 61 ASP OD2  O   3.920  -1.690  -7.405 1.00 . A A . 58 ASP OD2  1 1 
        6  7901 1 1 62 ALA C    C   0.006  -5.870  -4.146 1.00 . A A . 59 ALA C    1 1 
        6  7902 1 1 62 ALA CA   C   1.239  -5.081  -3.604 1.00 . A A . 59 ALA CA   1 1 
        6  7903 1 1 62 ALA CB   C   1.415  -5.257  -2.094 1.00 . A A . 59 ALA CB   1 1 
        6  7904 1 1 62 ALA H    H   1.507  -3.051  -3.249 1.00 . A A . 59 ALA H    1 1 
        6  7905 1 1 62 ALA HA   H   2.125  -5.509  -4.049 1.00 . A A . 59 ALA HA   1 1 
        6  7906 1 1 62 ALA HB1  H   0.588  -4.842  -1.557 1.00 . A A . 59 ALA HB1  1 1 
        6  7907 1 1 62 ALA HB2  H   2.327  -4.750  -1.785 1.00 . A A . 59 ALA HB2  1 1 
        6  7908 1 1 62 ALA HB3  H   1.503  -6.308  -1.872 1.00 . A A . 59 ALA HB3  1 1 
        6  7909 1 1 62 ALA N    N   1.292  -3.660  -3.959 1.00 . A A . 59 ALA N    1 1 
        6  7910 1 1 62 ALA O    O   0.088  -7.083  -4.212 1.00 . A A . 59 ALA O    1 1 
        6  7911 1 1 63 ALA C    C  -2.220  -6.801  -6.188 1.00 . A A . 60 ALA C    1 1 
        6  7912 1 1 63 ALA CA   C  -2.397  -5.799  -4.976 1.00 . A A . 60 ALA CA   1 1 
        6  7913 1 1 63 ALA CB   C  -3.487  -4.697  -5.250 1.00 . A A . 60 ALA CB   1 1 
        6  7914 1 1 63 ALA H    H  -1.093  -4.229  -4.384 1.00 . A A . 60 ALA H    1 1 
        6  7915 1 1 63 ALA HA   H  -2.781  -6.377  -4.153 1.00 . A A . 60 ALA HA   1 1 
        6  7916 1 1 63 ALA HB1  H  -3.758  -4.205  -4.317 1.00 . A A . 60 ALA HB1  1 1 
        6  7917 1 1 63 ALA HB2  H  -4.376  -5.150  -5.661 1.00 . A A . 60 ALA HB2  1 1 
        6  7918 1 1 63 ALA HB3  H  -3.127  -3.938  -5.942 1.00 . A A . 60 ALA HB3  1 1 
        6  7919 1 1 63 ALA N    N  -1.123  -5.182  -4.478 1.00 . A A . 60 ALA N    1 1 
        6  7920 1 1 63 ALA O    O  -2.803  -7.905  -6.110 1.00 . A A . 60 ALA O    1 1 
        6  7921 1 1 64 ASP C    C  -0.454  -8.743  -7.806 1.00 . A A . 61 ASP C    1 1 
        6  7922 1 1 64 ASP CA   C  -1.023  -7.427  -8.366 1.00 . A A . 61 ASP CA   1 1 
        6  7923 1 1 64 ASP CB   C   0.048  -6.866  -9.332 1.00 . A A . 61 ASP CB   1 1 
        6  7924 1 1 64 ASP CG   C  -0.402  -5.613 -10.062 1.00 . A A . 61 ASP CG   1 1 
        6  7925 1 1 64 ASP H    H  -1.162  -5.492  -7.389 1.00 . A A . 61 ASP H    1 1 
        6  7926 1 1 64 ASP HA   H  -1.902  -7.647  -8.960 1.00 . A A . 61 ASP HA   1 1 
        6  7927 1 1 64 ASP HB2  H   0.974  -6.665  -8.809 1.00 . A A . 61 ASP HB2  1 1 
        6  7928 1 1 64 ASP HB3  H   0.243  -7.621 -10.082 1.00 . A A . 61 ASP HB3  1 1 
        6  7929 1 1 64 ASP N    N  -1.412  -6.446  -7.266 1.00 . A A . 61 ASP N    1 1 
        6  7930 1 1 64 ASP O    O  -0.902  -9.849  -8.144 1.00 . A A . 61 ASP O    1 1 
        6  7931 1 1 64 ASP OD1  O  -0.491  -4.548  -9.424 1.00 . A A . 61 ASP OD1  1 1 
        6  7932 1 1 64 ASP OD2  O  -0.676  -5.709 -11.279 1.00 . A A . 61 ASP OD2  1 1 
        6  7933 1 1 65 ALA C    C   0.263 -10.585  -5.400 1.00 . A A . 62 ALA C    1 1 
        6  7934 1 1 65 ALA CA   C   1.157  -9.841  -6.432 1.00 . A A . 62 ALA CA   1 1 
        6  7935 1 1 65 ALA CB   C   2.591  -9.566  -5.956 1.00 . A A . 62 ALA CB   1 1 
        6  7936 1 1 65 ALA H    H   0.816  -7.763  -6.633 1.00 . A A . 62 ALA H    1 1 
        6  7937 1 1 65 ALA HA   H   1.240 -10.491  -7.287 1.00 . A A . 62 ALA HA   1 1 
        6  7938 1 1 65 ALA HB1  H   2.594  -8.959  -5.060 1.00 . A A . 62 ALA HB1  1 1 
        6  7939 1 1 65 ALA HB2  H   3.149  -9.055  -6.733 1.00 . A A . 62 ALA HB2  1 1 
        6  7940 1 1 65 ALA HB3  H   3.080 -10.503  -5.739 1.00 . A A . 62 ALA HB3  1 1 
        6  7941 1 1 65 ALA N    N   0.522  -8.642  -6.934 1.00 . A A . 62 ALA N    1 1 
        6  7942 1 1 65 ALA O    O   0.229 -11.816  -5.370 1.00 . A A . 62 ALA O    1 1 
        6  7943 1 1 66 ILE C    C  -2.543 -11.319  -4.354 1.00 . A A . 63 ILE C    1 1 
        6  7944 1 1 66 ILE CA   C  -1.382 -10.583  -3.691 1.00 . A A . 63 ILE CA   1 1 
        6  7945 1 1 66 ILE CB   C  -1.792  -9.775  -2.432 1.00 . A A . 63 ILE CB   1 1 
        6  7946 1 1 66 ILE CD1  C  -2.129 -10.468   0.017 1.00 . A A . 63 ILE CD1  1 1 
        6  7947 1 1 66 ILE CG1  C  -1.329 -10.627  -1.241 1.00 . A A . 63 ILE CG1  1 1 
        6  7948 1 1 66 ILE CG2  C  -3.298  -9.444  -2.343 1.00 . A A . 63 ILE CG2  1 1 
        6  7949 1 1 66 ILE H    H  -0.598  -8.916  -4.698 1.00 . A A . 63 ILE H    1 1 
        6  7950 1 1 66 ILE HA   H  -0.740 -11.371  -3.329 1.00 . A A . 63 ILE HA   1 1 
        6  7951 1 1 66 ILE HB   H  -1.234  -8.847  -2.424 1.00 . A A . 63 ILE HB   1 1 
        6  7952 1 1 66 ILE HD11 H  -2.940 -11.167  -0.003 1.00 . A A . 63 ILE HD11 1 1 
        6  7953 1 1 66 ILE HD12 H  -2.521  -9.466   0.060 1.00 . A A . 63 ILE HD12 1 1 
        6  7954 1 1 66 ILE HD13 H  -1.494 -10.657   0.869 1.00 . A A . 63 ILE HD13 1 1 
        6  7955 1 1 66 ILE HG12 H  -1.392 -11.668  -1.522 1.00 . A A . 63 ILE HG12 1 1 
        6  7956 1 1 66 ILE HG13 H  -0.302 -10.387  -1.017 1.00 . A A . 63 ILE HG13 1 1 
        6  7957 1 1 66 ILE HG21 H  -3.835 -10.317  -1.982 1.00 . A A . 63 ILE HG21 1 1 
        6  7958 1 1 66 ILE HG22 H  -3.670  -9.169  -3.309 1.00 . A A . 63 ILE HG22 1 1 
        6  7959 1 1 66 ILE HG23 H  -3.435  -8.631  -1.651 1.00 . A A . 63 ILE HG23 1 1 
        6  7960 1 1 66 ILE N    N  -0.552  -9.879  -4.628 1.00 . A A . 63 ILE N    1 1 
        6  7961 1 1 66 ILE O    O  -2.808 -12.401  -3.926 1.00 . A A . 63 ILE O    1 1 
        6  7962 1 1 67 LYS C    C  -3.383 -12.688  -6.984 1.00 . A A . 64 LYS C    1 1 
        6  7963 1 1 67 LYS CA   C  -4.111 -11.528  -6.240 1.00 . A A . 64 LYS CA   1 1 
        6  7964 1 1 67 LYS CB   C  -4.923 -10.639  -7.239 1.00 . A A . 64 LYS CB   1 1 
        6  7965 1 1 67 LYS CD   C  -3.524 -10.650  -9.432 1.00 . A A . 64 LYS CD   1 1 
        6  7966 1 1 67 LYS CE   C  -3.067  -9.821 -10.611 1.00 . A A . 64 LYS CE   1 1 
        6  7967 1 1 67 LYS CG   C  -4.122  -9.811  -8.295 1.00 . A A . 64 LYS CG   1 1 
        6  7968 1 1 67 LYS H    H  -3.357  -9.779  -5.315 1.00 . A A . 64 LYS H    1 1 
        6  7969 1 1 67 LYS HA   H  -4.835 -12.003  -5.585 1.00 . A A . 64 LYS HA   1 1 
        6  7970 1 1 67 LYS HB2  H  -5.605 -11.286  -7.766 1.00 . A A . 64 LYS HB2  1 1 
        6  7971 1 1 67 LYS HB3  H  -5.527  -9.945  -6.658 1.00 . A A . 64 LYS HB3  1 1 
        6  7972 1 1 67 LYS HD2  H  -2.637 -11.154  -9.035 1.00 . A A . 64 LYS HD2  1 1 
        6  7973 1 1 67 LYS HD3  H  -4.238 -11.385  -9.758 1.00 . A A . 64 LYS HD3  1 1 
        6  7974 1 1 67 LYS HE2  H  -2.910  -8.812 -10.278 1.00 . A A . 64 LYS HE2  1 1 
        6  7975 1 1 67 LYS HE3  H  -2.133 -10.231 -10.967 1.00 . A A . 64 LYS HE3  1 1 
        6  7976 1 1 67 LYS HG2  H  -4.762  -9.066  -8.723 1.00 . A A . 64 LYS HG2  1 1 
        6  7977 1 1 67 LYS HG3  H  -3.288  -9.324  -7.783 1.00 . A A . 64 LYS HG3  1 1 
        6  7978 1 1 67 LYS HZ1  H  -4.974  -9.481 -11.378 1.00 . A A . 64 LYS HZ1  1 1 
        6  7979 1 1 67 LYS HZ2  H  -4.150 -10.766 -12.106 1.00 . A A . 64 LYS HZ2  1 1 
        6  7980 1 1 67 LYS HZ3  H  -3.720  -9.173 -12.470 1.00 . A A . 64 LYS HZ3  1 1 
        6  7981 1 1 67 LYS N    N  -3.249 -10.731  -5.337 1.00 . A A . 64 LYS N    1 1 
        6  7982 1 1 67 LYS NZ   N  -4.048  -9.810 -11.714 1.00 . A A . 64 LYS NZ   1 1 
        6  7983 1 1 67 LYS O    O  -4.023 -13.696  -7.271 1.00 . A A . 64 LYS O    1 1 
        6  7984 1 1 68 GLU C    C  -1.206 -14.869  -6.879 1.00 . A A . 65 GLU C    1 1 
        6  7985 1 1 68 GLU CA   C  -1.351 -13.724  -7.919 1.00 . A A . 65 GLU CA   1 1 
        6  7986 1 1 68 GLU CB   C   0.016 -13.324  -8.542 1.00 . A A . 65 GLU CB   1 1 
        6  7987 1 1 68 GLU CD   C   2.253 -14.437  -8.012 1.00 . A A . 65 GLU CD   1 1 
        6  7988 1 1 68 GLU CG   C   1.199 -13.420  -7.601 1.00 . A A . 65 GLU CG   1 1 
        6  7989 1 1 68 GLU H    H  -1.665 -11.649  -7.382 1.00 . A A . 65 GLU H    1 1 
        6  7990 1 1 68 GLU HA   H  -1.968 -14.140  -8.711 1.00 . A A . 65 GLU HA   1 1 
        6  7991 1 1 68 GLU HB2  H   0.213 -13.968  -9.381 1.00 . A A . 65 GLU HB2  1 1 
        6  7992 1 1 68 GLU HB3  H  -0.050 -12.307  -8.889 1.00 . A A . 65 GLU HB3  1 1 
        6  7993 1 1 68 GLU HG2  H   1.656 -12.459  -7.490 1.00 . A A . 65 GLU HG2  1 1 
        6  7994 1 1 68 GLU HG3  H   0.798 -13.686  -6.653 1.00 . A A . 65 GLU HG3  1 1 
        6  7995 1 1 68 GLU N    N  -2.080 -12.545  -7.364 1.00 . A A . 65 GLU N    1 1 
        6  7996 1 1 68 GLU O    O  -1.231 -16.039  -7.275 1.00 . A A . 65 GLU O    1 1 
        6  7997 1 1 68 GLU OE1  O   2.927 -14.203  -9.041 1.00 . A A . 65 GLU OE1  1 1 
        6  7998 1 1 68 GLU OE2  O   2.402 -15.457  -7.309 1.00 . A A . 65 GLU OE2  1 1 
        6  7999 1 1 69 LYS C    C  -2.617 -15.715  -3.799 1.00 . A A . 66 LYS C    1 1 
        6  8000 1 1 69 LYS CA   C  -1.250 -15.701  -4.593 1.00 . A A . 66 LYS CA   1 1 
        6  8001 1 1 69 LYS CB   C   0.013 -15.917  -3.677 1.00 . A A . 66 LYS CB   1 1 
        6  8002 1 1 69 LYS CD   C   0.991 -13.602  -3.051 1.00 . A A . 66 LYS CD   1 1 
        6  8003 1 1 69 LYS CE   C   2.312 -13.874  -3.764 1.00 . A A . 66 LYS CE   1 1 
        6  8004 1 1 69 LYS CG   C   0.311 -14.879  -2.559 1.00 . A A . 66 LYS CG   1 1 
        6  8005 1 1 69 LYS H    H  -0.780 -13.675  -5.267 1.00 . A A . 66 LYS H    1 1 
        6  8006 1 1 69 LYS HA   H  -1.301 -16.582  -5.232 1.00 . A A . 66 LYS HA   1 1 
        6  8007 1 1 69 LYS HB2  H  -0.084 -16.881  -3.195 1.00 . A A . 66 LYS HB2  1 1 
        6  8008 1 1 69 LYS HB3  H   0.891 -15.974  -4.334 1.00 . A A . 66 LYS HB3  1 1 
        6  8009 1 1 69 LYS HD2  H   0.329 -13.079  -3.729 1.00 . A A . 66 LYS HD2  1 1 
        6  8010 1 1 69 LYS HD3  H   1.188 -12.966  -2.190 1.00 . A A . 66 LYS HD3  1 1 
        6  8011 1 1 69 LYS HE2  H   2.143 -14.498  -4.630 1.00 . A A . 66 LYS HE2  1 1 
        6  8012 1 1 69 LYS HE3  H   2.718 -12.935  -4.103 1.00 . A A . 66 LYS HE3  1 1 
        6  8013 1 1 69 LYS HG2  H  -0.617 -14.603  -2.074 1.00 . A A . 66 LYS HG2  1 1 
        6  8014 1 1 69 LYS HG3  H   0.963 -15.339  -1.817 1.00 . A A . 66 LYS HG3  1 1 
        6  8015 1 1 69 LYS HZ1  H   3.357 -14.007  -1.967 1.00 . A A . 66 LYS HZ1  1 1 
        6  8016 1 1 69 LYS HZ2  H   4.249 -14.506  -3.312 1.00 . A A . 66 LYS HZ2  1 1 
        6  8017 1 1 69 LYS HZ3  H   3.036 -15.509  -2.680 1.00 . A A . 66 LYS HZ3  1 1 
        6  8018 1 1 69 LYS N    N  -1.078 -14.575  -5.562 1.00 . A A . 66 LYS N    1 1 
        6  8019 1 1 69 LYS NZ   N   3.306 -14.524  -2.865 1.00 . A A . 66 LYS NZ   1 1 
        6  8020 1 1 69 LYS O    O  -2.723 -16.413  -2.790 1.00 . A A . 66 LYS O    1 1 
        6  8021 1 1 70 ASP C    C  -5.884 -16.061  -3.799 1.00 . A A . 67 ASP C    1 1 
        6  8022 1 1 70 ASP CA   C  -4.985 -14.857  -3.552 1.00 . A A . 67 ASP CA   1 1 
        6  8023 1 1 70 ASP CB   C  -5.760 -13.524  -3.621 1.00 . A A . 67 ASP CB   1 1 
        6  8024 1 1 70 ASP CG   C  -6.918 -13.482  -4.615 1.00 . A A . 67 ASP CG   1 1 
        6  8025 1 1 70 ASP H    H  -3.603 -14.566  -5.162 1.00 . A A . 67 ASP H    1 1 
        6  8026 1 1 70 ASP HA   H  -4.706 -14.932  -2.536 1.00 . A A . 67 ASP HA   1 1 
        6  8027 1 1 70 ASP HB2  H  -6.157 -13.367  -2.626 1.00 . A A . 67 ASP HB2  1 1 
        6  8028 1 1 70 ASP HB3  H  -5.085 -12.723  -3.820 1.00 . A A . 67 ASP HB3  1 1 
        6  8029 1 1 70 ASP N    N  -3.664 -14.960  -4.261 1.00 . A A . 67 ASP N    1 1 
        6  8030 1 1 70 ASP O    O  -5.683 -16.784  -4.783 1.00 . A A . 67 ASP O    1 1 
        6  8031 1 1 70 ASP OD1  O  -6.668 -13.390  -5.830 1.00 . A A . 67 ASP OD1  1 1 
        6  8032 1 1 70 ASP OD2  O  -8.085 -13.516  -4.166 1.00 . A A . 67 ASP OD2  1 1 
        6  8033 1 1 71 GLY C    C  -7.293 -18.400  -1.699 1.00 . A A . 68 GLY C    1 1 
        6  8034 1 1 71 GLY CA   C  -7.501 -17.598  -2.959 1.00 . A A . 68 GLY CA   1 1 
        6  8035 1 1 71 GLY H    H  -7.177 -15.605  -2.312 1.00 . A A . 68 GLY H    1 1 
        6  8036 1 1 71 GLY HA2  H  -8.562 -17.470  -3.112 1.00 . A A . 68 GLY HA2  1 1 
        6  8037 1 1 71 GLY HA3  H  -7.099 -18.152  -3.797 1.00 . A A . 68 GLY HA3  1 1 
        6  8038 1 1 71 GLY N    N  -6.880 -16.304  -2.933 1.00 . A A . 68 GLY N    1 1 
        6  8039 1 1 71 GLY O    O  -7.134 -19.622  -1.792 1.00 . A A . 68 GLY O    1 1 
        6  8040 1 1 72 CYS C    C  -7.755 -19.509   1.041 1.00 . A A . 69 CYS C    1 1 
        6  8041 1 1 72 CYS CA   C  -6.851 -18.306   0.751 1.00 . A A . 69 CYS CA   1 1 
        6  8042 1 1 72 CYS CB   C  -7.093 -17.238   1.864 1.00 . A A . 69 CYS CB   1 1 
        6  8043 1 1 72 CYS H    H  -7.298 -16.723  -0.537 1.00 . A A . 69 CYS H    1 1 
        6  8044 1 1 72 CYS HA   H  -5.810 -18.593   0.740 1.00 . A A . 69 CYS HA   1 1 
        6  8045 1 1 72 CYS HB2  H  -7.671 -17.677   2.661 1.00 . A A . 69 CYS HB2  1 1 
        6  8046 1 1 72 CYS HB3  H  -6.144 -16.908   2.257 1.00 . A A . 69 CYS HB3  1 1 
        6  8047 1 1 72 CYS HG   H  -8.426 -15.128   2.393 1.00 . A A . 69 CYS HG   1 1 
        6  8048 1 1 72 CYS N    N  -7.183 -17.689  -0.529 1.00 . A A . 69 CYS N    1 1 
        6  8049 1 1 72 CYS O    O  -8.985 -19.394   1.074 1.00 . A A . 69 CYS O    1 1 
        6  8050 1 1 72 CYS SG   S  -8.000 -15.764   1.315 1.00 . A A . 69 CYS SG   1 1 
        6  8051 1 1 73 ASP C    C  -7.329 -22.685   2.679 1.00 . A A . 70 ASP C    1 1 
        6  8052 1 1 73 ASP CA   C  -7.827 -21.906   1.442 1.00 . A A . 70 ASP CA   1 1 
        6  8053 1 1 73 ASP CB   C  -7.708 -22.741   0.157 1.00 . A A . 70 ASP CB   1 1 
        6  8054 1 1 73 ASP CG   C  -8.943 -23.582  -0.131 1.00 . A A . 70 ASP CG   1 1 
        6  8055 1 1 73 ASP H    H  -6.119 -20.688   1.325 1.00 . A A . 70 ASP H    1 1 
        6  8056 1 1 73 ASP HA   H  -8.864 -21.630   1.591 1.00 . A A . 70 ASP HA   1 1 
        6  8057 1 1 73 ASP HB2  H  -7.544 -22.075  -0.685 1.00 . A A . 70 ASP HB2  1 1 
        6  8058 1 1 73 ASP HB3  H  -6.858 -23.407   0.248 1.00 . A A . 70 ASP HB3  1 1 
        6  8059 1 1 73 ASP N    N  -7.104 -20.666   1.294 1.00 . A A . 70 ASP N    1 1 
        6  8060 1 1 73 ASP O    O  -6.142 -22.575   3.063 1.00 . A A . 70 ASP O    1 1 
        6  8061 1 1 73 ASP OD1  O  -9.190 -24.562   0.598 1.00 . A A . 70 ASP OD1  1 1 
        6  8062 1 1 73 ASP OD2  O  -9.656 -23.277  -1.113 1.00 . A A . 70 ASP OD2  1 1 
        6  8063 1 1 74 PHE C    C  -8.989 -25.419   4.374 1.00 . A A . 71 PHE C    1 1 
        6  8064 1 1 74 PHE CA   C  -8.125 -24.154   4.517 1.00 . A A . 71 PHE CA   1 1 
        6  8065 1 1 74 PHE CB   C  -8.560 -23.248   5.684 1.00 . A A . 71 PHE CB   1 1 
        6  8066 1 1 74 PHE CD1  C  -6.808 -24.112   7.272 1.00 . A A . 71 PHE CD1  1 1 
        6  8067 1 1 74 PHE CD2  C  -9.032 -23.811   8.080 1.00 . A A . 71 PHE CD2  1 1 
        6  8068 1 1 74 PHE CE1  C  -6.414 -24.558   8.513 1.00 . A A . 71 PHE CE1  1 1 
        6  8069 1 1 74 PHE CE2  C  -8.641 -24.255   9.325 1.00 . A A . 71 PHE CE2  1 1 
        6  8070 1 1 74 PHE CG   C  -8.126 -23.733   7.040 1.00 . A A . 71 PHE CG   1 1 
        6  8071 1 1 74 PHE CZ   C  -7.329 -24.630   9.543 1.00 . A A . 71 PHE CZ   1 1 
        6  8072 1 1 74 PHE H    H  -9.060 -23.698   2.755 1.00 . A A . 71 PHE H    1 1 
        6  8073 1 1 74 PHE HA   H  -7.091 -24.447   4.641 1.00 . A A . 71 PHE HA   1 1 
        6  8074 1 1 74 PHE HB2  H  -8.133 -22.271   5.540 1.00 . A A . 71 PHE HB2  1 1 
        6  8075 1 1 74 PHE HB3  H  -9.635 -23.171   5.687 1.00 . A A . 71 PHE HB3  1 1 
        6  8076 1 1 74 PHE HD1  H  -6.089 -24.053   6.470 1.00 . A A . 71 PHE HD1  1 1 
        6  8077 1 1 74 PHE HD2  H -10.057 -23.511   7.913 1.00 . A A . 71 PHE HD2  1 1 
        6  8078 1 1 74 PHE HE1  H  -5.388 -24.848   8.684 1.00 . A A . 71 PHE HE1  1 1 
        6  8079 1 1 74 PHE HE2  H  -9.362 -24.311  10.130 1.00 . A A . 71 PHE HE2  1 1 
        6  8080 1 1 74 PHE HZ   H  -7.021 -24.972  10.520 1.00 . A A . 71 PHE HZ   1 1 
        6  8081 1 1 74 PHE N    N  -8.253 -23.468   3.262 1.00 . A A . 71 PHE N    1 1 
        6  8082 1 1 74 PHE O    O -10.012 -25.349   3.684 1.00 . A A . 71 PHE O    1 1 
        6  8083 1 1 75 GLU C    C  -9.099 -28.509   3.382 1.00 . A A . 72 GLU C    1 1 
        6  8084 1 1 75 GLU CA   C  -9.253 -27.877   4.799 1.00 . A A . 72 GLU CA   1 1 
        6  8085 1 1 75 GLU CB   C -10.799 -27.878   5.178 1.00 . A A . 72 GLU CB   1 1 
        6  8086 1 1 75 GLU CD   C -12.781 -27.313   6.697 1.00 . A A . 72 GLU CD   1 1 
        6  8087 1 1 75 GLU CG   C -11.287 -27.142   6.461 1.00 . A A . 72 GLU CG   1 1 
        6  8088 1 1 75 GLU H    H  -7.697 -26.521   5.444 1.00 . A A . 72 GLU H    1 1 
        6  8089 1 1 75 GLU HA   H  -8.736 -28.550   5.476 1.00 . A A . 72 GLU HA   1 1 
        6  8090 1 1 75 GLU HB2  H -11.337 -27.450   4.350 1.00 . A A . 72 GLU HB2  1 1 
        6  8091 1 1 75 GLU HB3  H -11.104 -28.912   5.263 1.00 . A A . 72 GLU HB3  1 1 
        6  8092 1 1 75 GLU HG2  H -10.774 -27.512   7.334 1.00 . A A . 72 GLU HG2  1 1 
        6  8093 1 1 75 GLU HG3  H -11.106 -26.085   6.349 1.00 . A A . 72 GLU HG3  1 1 
        6  8094 1 1 75 GLU N    N  -8.546 -26.559   4.934 1.00 . A A . 72 GLU N    1 1 
        6  8095 1 1 75 GLU O    O -10.056 -28.607   2.610 1.00 . A A . 72 GLU O    1 1 
        6  8096 1 1 75 GLU OE1  O -13.564 -26.514   6.141 1.00 . A A . 72 GLU OE1  1 1 
        6  8097 1 1 75 GLU OE2  O -13.168 -28.227   7.460 1.00 . A A . 72 GLU OE2  1 1 
        6  8098 1 1 76 GLY C    C  -7.054 -28.951   0.616 1.00 . A A . 73 GLY C    1 1 
        6  8099 1 1 76 GLY CA   C  -7.556 -29.694   1.853 1.00 . A A . 73 GLY CA   1 1 
        6  8100 1 1 76 GLY H    H  -7.118 -28.643   3.652 1.00 . A A . 73 GLY H    1 1 
        6  8101 1 1 76 GLY HA2  H  -6.804 -30.419   2.123 1.00 . A A . 73 GLY HA2  1 1 
        6  8102 1 1 76 GLY HA3  H  -8.450 -30.231   1.580 1.00 . A A . 73 GLY HA3  1 1 
        6  8103 1 1 76 GLY N    N  -7.853 -28.884   3.053 1.00 . A A . 73 GLY N    1 1 
        6  8104 1 1 76 GLY O    O  -6.535 -29.595  -0.301 1.00 . A A . 73 GLY O    1 1 
        6  8105 1 1 77 ASN C    C  -5.444 -26.000   0.857 1.00 . A A . 74 ASN C    1 1 
        6  8106 1 1 77 ASN CA   C  -6.168 -26.837  -0.190 1.00 . A A . 74 ASN CA   1 1 
        6  8107 1 1 77 ASN CB   C  -6.734 -25.942  -1.372 1.00 . A A . 74 ASN CB   1 1 
        6  8108 1 1 77 ASN CG   C  -7.675 -26.671  -2.324 1.00 . A A . 74 ASN CG   1 1 
        6  8109 1 1 77 ASN H    H  -7.944 -27.201   1.013 1.00 . A A . 74 ASN H    1 1 
        6  8110 1 1 77 ASN HA   H  -5.451 -27.540  -0.594 1.00 . A A . 74 ASN HA   1 1 
        6  8111 1 1 77 ASN HB2  H  -7.247 -25.045  -1.016 1.00 . A A . 74 ASN HB2  1 1 
        6  8112 1 1 77 ASN HB3  H  -5.896 -25.611  -1.962 1.00 . A A . 74 ASN HB3  1 1 
        6  8113 1 1 77 ASN HD21 H  -8.766 -25.022  -2.514 1.00 . A A . 74 ASN HD21 1 1 
        6  8114 1 1 77 ASN HD22 H  -9.308 -26.392  -3.425 1.00 . A A . 74 ASN HD22 1 1 
        6  8115 1 1 77 ASN N    N  -7.171 -27.631   0.566 1.00 . A A . 74 ASN N    1 1 
        6  8116 1 1 77 ASN ND2  N  -8.686 -25.960  -2.805 1.00 . A A . 74 ASN ND2  1 1 
        6  8117 1 1 77 ASN O    O  -6.087 -25.282   1.606 1.00 . A A . 74 ASN O    1 1 
        6  8118 1 1 77 ASN OD1  O  -7.498 -27.844  -2.626 1.00 . A A . 74 ASN OD1  1 1 
        6  8119 1 1 78 LYS C    C  -2.823 -24.109   1.510 1.00 . A A . 75 LYS C    1 1 
        6  8120 1 1 78 LYS CA   C  -3.427 -25.420   2.090 1.00 . A A . 75 LYS CA   1 1 
        6  8121 1 1 78 LYS CB   C  -2.333 -26.315   2.807 1.00 . A A . 75 LYS CB   1 1 
        6  8122 1 1 78 LYS CD   C  -3.536 -26.334   5.140 1.00 . A A . 75 LYS CD   1 1 
        6  8123 1 1 78 LYS CE   C  -4.183 -27.734   5.047 1.00 . A A . 75 LYS CE   1 1 
        6  8124 1 1 78 LYS CG   C  -2.211 -26.152   4.341 1.00 . A A . 75 LYS CG   1 1 
        6  8125 1 1 78 LYS H    H  -3.607 -26.693   0.312 1.00 . A A . 75 LYS H    1 1 
        6  8126 1 1 78 LYS HA   H  -4.186 -25.162   2.808 1.00 . A A . 75 LYS HA   1 1 
        6  8127 1 1 78 LYS HB2  H  -2.524 -27.364   2.627 1.00 . A A . 75 LYS HB2  1 1 
        6  8128 1 1 78 LYS HB3  H  -1.361 -26.065   2.383 1.00 . A A . 75 LYS HB3  1 1 
        6  8129 1 1 78 LYS HD2  H  -3.326 -26.137   6.180 1.00 . A A . 75 LYS HD2  1 1 
        6  8130 1 1 78 LYS HD3  H  -4.251 -25.604   4.792 1.00 . A A . 75 LYS HD3  1 1 
        6  8131 1 1 78 LYS HE2  H  -4.980 -27.778   5.779 1.00 . A A . 75 LYS HE2  1 1 
        6  8132 1 1 78 LYS HE3  H  -4.617 -27.871   4.078 1.00 . A A . 75 LYS HE3  1 1 
        6  8133 1 1 78 LYS HG2  H  -1.495 -26.882   4.703 1.00 . A A . 75 LYS HG2  1 1 
        6  8134 1 1 78 LYS HG3  H  -1.813 -25.164   4.548 1.00 . A A . 75 LYS HG3  1 1 
        6  8135 1 1 78 LYS HZ1  H  -2.867 -28.783   6.297 1.00 . A A . 75 LYS HZ1  1 1 
        6  8136 1 1 78 LYS HZ2  H  -2.431 -28.818   4.661 1.00 . A A . 75 LYS HZ2  1 1 
        6  8137 1 1 78 LYS HZ3  H  -3.716 -29.770   5.214 1.00 . A A . 75 LYS HZ3  1 1 
        6  8138 1 1 78 LYS N    N  -4.122 -26.154   0.993 1.00 . A A . 75 LYS N    1 1 
        6  8139 1 1 78 LYS NZ   N  -3.233 -28.851   5.327 1.00 . A A . 75 LYS NZ   1 1 
        6  8140 1 1 78 LYS O    O  -1.770 -24.199   0.870 1.00 . A A . 75 LYS O    1 1 
        6  8141 1 1 79 LEU C    C  -3.631 -20.349   1.549 1.00 . A A . 76 LEU C    1 1 
        6  8142 1 1 79 LEU CA   C  -2.924 -21.658   1.045 1.00 . A A . 76 LEU CA   1 1 
        6  8143 1 1 79 LEU CB   C  -3.105 -21.769  -0.515 1.00 . A A . 76 LEU CB   1 1 
        6  8144 1 1 79 LEU CD1  C  -0.995 -20.856  -1.542 1.00 . A A . 76 LEU CD1  1 1 
        6  8145 1 1 79 LEU CD2  C  -3.218 -20.453  -2.663 1.00 . A A . 76 LEU CD2  1 1 
        6  8146 1 1 79 LEU CG   C  -2.483 -20.640  -1.338 1.00 . A A . 76 LEU CG   1 1 
        6  8147 1 1 79 LEU H    H  -4.238 -22.812   2.303 1.00 . A A . 76 LEU H    1 1 
        6  8148 1 1 79 LEU HA   H  -1.862 -21.603   1.247 1.00 . A A . 76 LEU HA   1 1 
        6  8149 1 1 79 LEU HB2  H  -2.667 -22.700  -0.845 1.00 . A A . 76 LEU HB2  1 1 
        6  8150 1 1 79 LEU HB3  H  -4.159 -21.792  -0.743 1.00 . A A . 76 LEU HB3  1 1 
        6  8151 1 1 79 LEU HD11 H  -0.591 -20.026  -2.099 1.00 . A A . 76 LEU HD11 1 1 
        6  8152 1 1 79 LEU HD12 H  -0.832 -21.770  -2.087 1.00 . A A . 76 LEU HD12 1 1 
        6  8153 1 1 79 LEU HD13 H  -0.503 -20.915  -0.580 1.00 . A A . 76 LEU HD13 1 1 
        6  8154 1 1 79 LEU HD21 H  -3.170 -21.364  -3.237 1.00 . A A . 76 LEU HD21 1 1 
        6  8155 1 1 79 LEU HD22 H  -2.759 -19.649  -3.218 1.00 . A A . 76 LEU HD22 1 1 
        6  8156 1 1 79 LEU HD23 H  -4.253 -20.204  -2.464 1.00 . A A . 76 LEU HD23 1 1 
        6  8157 1 1 79 LEU HG   H  -2.603 -19.735  -0.774 1.00 . A A . 76 LEU HG   1 1 
        6  8158 1 1 79 LEU N    N  -3.448 -22.888   1.714 1.00 . A A . 76 LEU N    1 1 
        6  8159 1 1 79 LEU O    O  -4.370 -19.768   0.790 1.00 . A A . 76 LEU O    1 1 
        6  8160 1 1 80 ARG C    C  -3.384 -17.372   3.055 1.00 . A A . 77 ARG C    1 1 
        6  8161 1 1 80 ARG CA   C  -4.211 -18.684   3.271 1.00 . A A . 77 ARG CA   1 1 
        6  8162 1 1 80 ARG CB   C  -4.560 -18.958   4.781 1.00 . A A . 77 ARG CB   1 1 
        6  8163 1 1 80 ARG CD   C  -4.488 -16.685   6.072 1.00 . A A . 77 ARG CD   1 1 
        6  8164 1 1 80 ARG CG   C  -5.331 -17.898   5.625 1.00 . A A . 77 ARG CG   1 1 
        6  8165 1 1 80 ARG CZ   C  -6.246 -15.273   7.173 1.00 . A A . 77 ARG CZ   1 1 
        6  8166 1 1 80 ARG H    H  -2.755 -20.228   3.398 1.00 . A A . 77 ARG H    1 1 
        6  8167 1 1 80 ARG HA   H  -5.127 -18.664   2.688 1.00 . A A . 77 ARG HA   1 1 
        6  8168 1 1 80 ARG HB2  H  -5.155 -19.865   4.808 1.00 . A A . 77 ARG HB2  1 1 
        6  8169 1 1 80 ARG HB3  H  -3.635 -19.165   5.295 1.00 . A A . 77 ARG HB3  1 1 
        6  8170 1 1 80 ARG HD2  H  -3.501 -17.030   6.340 1.00 . A A . 77 ARG HD2  1 1 
        6  8171 1 1 80 ARG HD3  H  -4.404 -15.989   5.254 1.00 . A A . 77 ARG HD3  1 1 
        6  8172 1 1 80 ARG HE   H  -4.594 -15.973   8.050 1.00 . A A . 77 ARG HE   1 1 
        6  8173 1 1 80 ARG HG2  H  -6.169 -17.531   5.061 1.00 . A A . 77 ARG HG2  1 1 
        6  8174 1 1 80 ARG HG3  H  -5.705 -18.390   6.517 1.00 . A A . 77 ARG HG3  1 1 
        6  8175 1 1 80 ARG HH11 H  -6.652 -15.688   5.226 1.00 . A A . 77 ARG HH11 1 1 
        6  8176 1 1 80 ARG HH12 H  -7.840 -14.702   6.019 1.00 . A A . 77 ARG HH12 1 1 
        6  8177 1 1 80 ARG HH21 H  -6.146 -14.637   9.098 1.00 . A A . 77 ARG HH21 1 1 
        6  8178 1 1 80 ARG HH22 H  -7.545 -14.104   8.222 1.00 . A A . 77 ARG HH22 1 1 
        6  8179 1 1 80 ARG N    N  -3.429 -19.847   2.794 1.00 . A A . 77 ARG N    1 1 
        6  8180 1 1 80 ARG NE   N  -5.090 -15.967   7.215 1.00 . A A . 77 ARG NE   1 1 
        6  8181 1 1 80 ARG NH1  N  -6.968 -15.223   6.050 1.00 . A A . 77 ARG NH1  1 1 
        6  8182 1 1 80 ARG NH2  N  -6.677 -14.625   8.256 1.00 . A A . 77 ARG NH2  1 1 
        6  8183 1 1 80 ARG O    O  -2.347 -17.204   3.693 1.00 . A A . 77 ARG O    1 1 
        6  8184 1 1 81 VAL C    C  -4.097 -13.967   2.158 1.00 . A A . 78 VAL C    1 1 
        6  8185 1 1 81 VAL CA   C  -3.075 -15.146   2.058 1.00 . A A . 78 VAL CA   1 1 
        6  8186 1 1 81 VAL CB   C  -2.149 -15.020   0.761 1.00 . A A . 78 VAL CB   1 1 
        6  8187 1 1 81 VAL CG1  C  -1.276 -13.799   0.917 1.00 . A A . 78 VAL CG1  1 1 
        6  8188 1 1 81 VAL CG2  C  -1.207 -16.226   0.598 1.00 . A A . 78 VAL CG2  1 1 
        6  8189 1 1 81 VAL H    H  -4.617 -16.578   1.602 1.00 . A A . 78 VAL H    1 1 
        6  8190 1 1 81 VAL HA   H  -2.417 -15.111   2.922 1.00 . A A . 78 VAL HA   1 1 
        6  8191 1 1 81 VAL HB   H  -2.747 -14.894  -0.174 1.00 . A A . 78 VAL HB   1 1 
        6  8192 1 1 81 VAL HG11 H  -1.876 -12.912   0.825 1.00 . A A . 78 VAL HG11 1 1 
        6  8193 1 1 81 VAL HG12 H  -0.506 -13.801   0.153 1.00 . A A . 78 VAL HG12 1 1 
        6  8194 1 1 81 VAL HG13 H  -0.821 -13.819   1.894 1.00 . A A . 78 VAL HG13 1 1 
        6  8195 1 1 81 VAL HG21 H  -1.043 -16.695   1.563 1.00 . A A . 78 VAL HG21 1 1 
        6  8196 1 1 81 VAL HG22 H  -0.260 -15.870   0.215 1.00 . A A . 78 VAL HG22 1 1 
        6  8197 1 1 81 VAL HG23 H  -1.613 -16.948  -0.086 1.00 . A A . 78 VAL HG23 1 1 
        6  8198 1 1 81 VAL N    N  -3.799 -16.434   2.160 1.00 . A A . 78 VAL N    1 1 
        6  8199 1 1 81 VAL O    O  -4.993 -13.886   1.318 1.00 . A A . 78 VAL O    1 1 
        6  8200 1 1 82 GLU C    C  -4.246 -10.683   3.690 1.00 . A A . 79 GLU C    1 1 
        6  8201 1 1 82 GLU CA   C  -4.971 -12.008   3.395 1.00 . A A . 79 GLU CA   1 1 
        6  8202 1 1 82 GLU CB   C  -5.886 -12.492   4.566 1.00 . A A . 79 GLU CB   1 1 
        6  8203 1 1 82 GLU CD   C  -8.043 -12.265   5.921 1.00 . A A . 79 GLU CD   1 1 
        6  8204 1 1 82 GLU CG   C  -6.936 -11.528   5.187 1.00 . A A . 79 GLU CG   1 1 
        6  8205 1 1 82 GLU H    H  -3.285 -13.135   3.844 1.00 . A A . 79 GLU H    1 1 
        6  8206 1 1 82 GLU HA   H  -5.566 -11.907   2.506 1.00 . A A . 79 GLU HA   1 1 
        6  8207 1 1 82 GLU HB2  H  -6.433 -13.348   4.194 1.00 . A A . 79 GLU HB2  1 1 
        6  8208 1 1 82 GLU HB3  H  -5.241 -12.835   5.366 1.00 . A A . 79 GLU HB3  1 1 
        6  8209 1 1 82 GLU HG2  H  -6.449 -10.894   5.925 1.00 . A A . 79 GLU HG2  1 1 
        6  8210 1 1 82 GLU HG3  H  -7.386 -10.930   4.419 1.00 . A A . 79 GLU HG3  1 1 
        6  8211 1 1 82 GLU N    N  -3.998 -13.073   3.196 1.00 . A A . 79 GLU N    1 1 
        6  8212 1 1 82 GLU O    O  -3.224 -10.652   4.432 1.00 . A A . 79 GLU O    1 1 
        6  8213 1 1 82 GLU OE1  O  -8.817 -12.995   5.267 1.00 . A A . 79 GLU OE1  1 1 
        6  8214 1 1 82 GLU OE2  O  -8.114 -12.150   7.162 1.00 . A A . 79 GLU OE2  1 1 
        6  8215 1 1 83 VAL C    C  -5.281  -7.974   4.800 1.00 . A A . 80 VAL C    1 1 
        6  8216 1 1 83 VAL CA   C  -4.447  -8.258   3.523 1.00 . A A . 80 VAL CA   1 1 
        6  8217 1 1 83 VAL CB   C  -4.720  -7.167   2.431 1.00 . A A . 80 VAL CB   1 1 
        6  8218 1 1 83 VAL CG1  C  -3.744  -7.307   1.280 1.00 . A A . 80 VAL CG1  1 1 
        6  8219 1 1 83 VAL CG2  C  -6.134  -7.235   1.869 1.00 . A A . 80 VAL CG2  1 1 
        6  8220 1 1 83 VAL H    H  -5.144  -9.699   2.140 1.00 . A A . 80 VAL H    1 1 
        6  8221 1 1 83 VAL HA   H  -3.399  -8.217   3.782 1.00 . A A . 80 VAL HA   1 1 
        6  8222 1 1 83 VAL HB   H  -4.579  -6.190   2.876 1.00 . A A . 80 VAL HB   1 1 
        6  8223 1 1 83 VAL HG11 H  -3.811  -6.441   0.636 1.00 . A A . 80 VAL HG11 1 1 
        6  8224 1 1 83 VAL HG12 H  -3.995  -8.192   0.713 1.00 . A A . 80 VAL HG12 1 1 
        6  8225 1 1 83 VAL HG13 H  -2.745  -7.396   1.664 1.00 . A A . 80 VAL HG13 1 1 
        6  8226 1 1 83 VAL HG21 H  -6.844  -7.112   2.672 1.00 . A A . 80 VAL HG21 1 1 
        6  8227 1 1 83 VAL HG22 H  -6.286  -8.195   1.396 1.00 . A A . 80 VAL HG22 1 1 
        6  8228 1 1 83 VAL HG23 H  -6.270  -6.451   1.140 1.00 . A A . 80 VAL HG23 1 1 
        6  8229 1 1 83 VAL N    N  -4.716  -9.597   3.034 1.00 . A A . 80 VAL N    1 1 
        6  8230 1 1 83 VAL O    O  -6.505  -8.121   4.815 1.00 . A A . 80 VAL O    1 1 
        6  8231 1 1 84 PRO C    C  -5.415  -5.540   7.077 1.00 . A A . 81 PRO C    1 1 
        6  8232 1 1 84 PRO CA   C  -5.314  -7.074   7.091 1.00 . A A . 81 PRO CA   1 1 
        6  8233 1 1 84 PRO CB   C  -4.438  -7.571   8.248 1.00 . A A . 81 PRO CB   1 1 
        6  8234 1 1 84 PRO CD   C  -3.195  -7.788   6.178 1.00 . A A . 81 PRO CD   1 1 
        6  8235 1 1 84 PRO CG   C  -3.065  -7.709   7.684 1.00 . A A . 81 PRO CG   1 1 
        6  8236 1 1 84 PRO HA   H  -6.306  -7.488   7.186 1.00 . A A . 81 PRO HA   1 1 
        6  8237 1 1 84 PRO HB2  H  -4.454  -6.852   9.058 1.00 . A A . 81 PRO HB2  1 1 
        6  8238 1 1 84 PRO HB3  H  -4.792  -8.530   8.597 1.00 . A A . 81 PRO HB3  1 1 
        6  8239 1 1 84 PRO HD2  H  -2.619  -7.004   5.713 1.00 . A A . 81 PRO HD2  1 1 
        6  8240 1 1 84 PRO HD3  H  -2.865  -8.756   5.827 1.00 . A A . 81 PRO HD3  1 1 
        6  8241 1 1 84 PRO HG2  H  -2.476  -6.844   7.962 1.00 . A A . 81 PRO HG2  1 1 
        6  8242 1 1 84 PRO HG3  H  -2.599  -8.607   8.060 1.00 . A A . 81 PRO HG3  1 1 
        6  8243 1 1 84 PRO N    N  -4.625  -7.603   5.918 1.00 . A A . 81 PRO N    1 1 
        6  8244 1 1 84 PRO O    O  -5.578  -4.914   8.127 1.00 . A A . 81 PRO O    1 1 
        6  8245 1 1 85 PHE C    C  -6.639  -3.155   4.792 1.00 . A A . 82 PHE C    1 1 
        6  8246 1 1 85 PHE CA   C  -5.486  -3.495   5.748 1.00 . A A . 82 PHE CA   1 1 
        6  8247 1 1 85 PHE CB   C  -4.144  -2.778   5.365 1.00 . A A . 82 PHE CB   1 1 
        6  8248 1 1 85 PHE CD1  C  -3.575  -3.297   2.942 1.00 . A A . 82 PHE CD1  1 1 
        6  8249 1 1 85 PHE CD2  C  -2.106  -4.091   4.633 1.00 . A A . 82 PHE CD2  1 1 
        6  8250 1 1 85 PHE CE1  C  -2.764  -3.836   1.974 1.00 . A A . 82 PHE CE1  1 1 
        6  8251 1 1 85 PHE CE2  C  -1.284  -4.636   3.666 1.00 . A A . 82 PHE CE2  1 1 
        6  8252 1 1 85 PHE CG   C  -3.266  -3.415   4.289 1.00 . A A . 82 PHE CG   1 1 
        6  8253 1 1 85 PHE CZ   C  -1.614  -4.509   2.338 1.00 . A A . 82 PHE CZ   1 1 
        6  8254 1 1 85 PHE H    H  -5.195  -5.478   5.076 1.00 . A A . 82 PHE H    1 1 
        6  8255 1 1 85 PHE HA   H  -5.779  -3.143   6.729 1.00 . A A . 82 PHE HA   1 1 
        6  8256 1 1 85 PHE HB2  H  -4.385  -1.787   5.013 1.00 . A A . 82 PHE HB2  1 1 
        6  8257 1 1 85 PHE HB3  H  -3.540  -2.682   6.258 1.00 . A A . 82 PHE HB3  1 1 
        6  8258 1 1 85 PHE HD1  H  -4.480  -2.775   2.651 1.00 . A A . 82 PHE HD1  1 1 
        6  8259 1 1 85 PHE HD2  H  -1.841  -4.198   5.678 1.00 . A A . 82 PHE HD2  1 1 
        6  8260 1 1 85 PHE HE1  H  -3.025  -3.731   0.929 1.00 . A A . 82 PHE HE1  1 1 
        6  8261 1 1 85 PHE HE2  H  -0.363  -5.164   3.966 1.00 . A A . 82 PHE HE2  1 1 
        6  8262 1 1 85 PHE HZ   H  -0.974  -4.935   1.581 1.00 . A A . 82 PHE HZ   1 1 
        6  8263 1 1 85 PHE N    N  -5.331  -4.936   5.882 1.00 . A A . 82 PHE N    1 1 
        6  8264 1 1 85 PHE O    O  -7.597  -2.485   5.194 1.00 . A A . 82 PHE O    1 1 
        6  8265 1 1 86 ASN C    C  -7.766  -1.862   2.223 1.00 . A A . 83 ASN C    1 1 
        6  8266 1 1 86 ASN CA   C  -7.470  -3.394   2.416 1.00 . A A . 83 ASN CA   1 1 
        6  8267 1 1 86 ASN CB   C  -8.816  -4.188   2.555 1.00 . A A . 83 ASN CB   1 1 
        6  8268 1 1 86 ASN CG   C  -9.397  -4.617   1.208 1.00 . A A . 83 ASN CG   1 1 
        6  8269 1 1 86 ASN H    H  -5.750  -4.253   3.376 1.00 . A A . 83 ASN H    1 1 
        6  8270 1 1 86 ASN HA   H  -6.967  -3.746   1.529 1.00 . A A . 83 ASN HA   1 1 
        6  8271 1 1 86 ASN HB2  H  -8.678  -5.085   3.150 1.00 . A A . 83 ASN HB2  1 1 
        6  8272 1 1 86 ASN HB3  H  -9.541  -3.557   3.045 1.00 . A A . 83 ASN HB3  1 1 
        6  8273 1 1 86 ASN HD21 H -10.305  -2.866   0.995 1.00 . A A . 83 ASN HD21 1 1 
        6  8274 1 1 86 ASN HD22 H -10.536  -4.000  -0.296 1.00 . A A . 83 ASN HD22 1 1 
        6  8275 1 1 86 ASN N    N  -6.533  -3.664   3.550 1.00 . A A . 83 ASN N    1 1 
        6  8276 1 1 86 ASN ND2  N -10.160  -3.742   0.573 1.00 . A A . 83 ASN ND2  1 1 
        6  8277 1 1 86 ASN O    O  -8.915  -1.474   1.973 1.00 . A A . 83 ASN O    1 1 
        6  8278 1 1 86 ASN OD1  O  -9.147  -5.722   0.736 1.00 . A A . 83 ASN OD1  1 1 
        6  8279 1 1 87 ALA C    C  -5.662   1.233   1.921 1.00 . A A . 84 ALA C    1 1 
        6  8280 1 1 87 ALA CA   C  -6.949   0.471   2.313 1.00 . A A . 84 ALA CA   1 1 
        6  8281 1 1 87 ALA CB   C  -7.399   0.931   3.709 1.00 . A A . 84 ALA CB   1 1 
        6  8282 1 1 87 ALA H    H  -5.808  -1.325   2.263 1.00 . A A . 84 ALA H    1 1 
        6  8283 1 1 87 ALA HA   H  -7.746   0.676   1.610 1.00 . A A . 84 ALA HA   1 1 
        6  8284 1 1 87 ALA HB1  H  -7.707   1.966   3.670 1.00 . A A . 84 ALA HB1  1 1 
        6  8285 1 1 87 ALA HB2  H  -6.581   0.829   4.408 1.00 . A A . 84 ALA HB2  1 1 
        6  8286 1 1 87 ALA HB3  H  -8.233   0.324   4.043 1.00 . A A . 84 ALA HB3  1 1 
        6  8287 1 1 87 ALA N    N  -6.729  -0.990   2.289 1.00 . A A . 84 ALA N    1 1 
        6  8288 1 1 87 ALA O    O  -4.573   0.799   2.329 1.00 . A A . 84 ALA O    1 1 
        6  8289 1 1 88 ARG C    C  -5.179   4.259  -0.320 1.00 . A A . 85 ARG C    1 1 
        6  8290 1 1 88 ARG CA   C  -4.656   3.226   0.689 1.00 . A A . 85 ARG CA   1 1 
        6  8291 1 1 88 ARG CB   C  -3.523   2.386   0.008 1.00 . A A . 85 ARG CB   1 1 
        6  8292 1 1 88 ARG CD   C  -1.445   3.657   0.732 1.00 . A A . 85 ARG CD   1 1 
        6  8293 1 1 88 ARG CG   C  -2.285   3.172  -0.438 1.00 . A A . 85 ARG CG   1 1 
        6  8294 1 1 88 ARG CZ   C   1.000   3.983   0.912 1.00 . A A . 85 ARG CZ   1 1 
        6  8295 1 1 88 ARG H    H  -6.712   2.718   0.983 1.00 . A A . 85 ARG H    1 1 
        6  8296 1 1 88 ARG HA   H  -4.252   3.757   1.539 1.00 . A A . 85 ARG HA   1 1 
        6  8297 1 1 88 ARG HB2  H  -3.192   1.633   0.708 1.00 . A A . 85 ARG HB2  1 1 
        6  8298 1 1 88 ARG HB3  H  -3.925   1.887  -0.864 1.00 . A A . 85 ARG HB3  1 1 
        6  8299 1 1 88 ARG HD2  H  -1.981   4.449   1.238 1.00 . A A . 85 ARG HD2  1 1 
        6  8300 1 1 88 ARG HD3  H  -1.282   2.837   1.411 1.00 . A A . 85 ARG HD3  1 1 
        6  8301 1 1 88 ARG HE   H  -0.157   4.717  -0.547 1.00 . A A . 85 ARG HE   1 1 
        6  8302 1 1 88 ARG HG2  H  -1.676   2.551  -1.071 1.00 . A A . 85 ARG HG2  1 1 
        6  8303 1 1 88 ARG HG3  H  -2.613   4.035  -1.005 1.00 . A A . 85 ARG HG3  1 1 
        6  8304 1 1 88 ARG HH11 H   0.226   2.893   2.443 1.00 . A A . 85 ARG HH11 1 1 
        6  8305 1 1 88 ARG HH12 H   1.939   3.146   2.513 1.00 . A A . 85 ARG HH12 1 1 
        6  8306 1 1 88 ARG HH21 H   2.097   4.983  -0.463 1.00 . A A . 85 ARG HH21 1 1 
        6  8307 1 1 88 ARG HH22 H   2.992   4.327   0.866 1.00 . A A . 85 ARG HH22 1 1 
        6  8308 1 1 88 ARG N    N  -5.798   2.386   1.181 1.00 . A A . 85 ARG N    1 1 
        6  8309 1 1 88 ARG NE   N  -0.159   4.180   0.281 1.00 . A A . 85 ARG NE   1 1 
        6  8310 1 1 88 ARG NH1  N   1.055   3.283   2.050 1.00 . A A . 85 ARG NH1  1 1 
        6  8311 1 1 88 ARG NH2  N   2.118   4.468   0.396 1.00 . A A . 85 ARG NH2  1 1 
        6  8312 1 1 88 ARG O    O  -6.187   4.024  -0.991 1.00 . A A . 85 ARG O    1 1 
        6  8313 1 1 89 GLU C    C  -3.500   6.222  -2.422 1.00 . A A . 86 GLU C    1 1 
        6  8314 1 1 89 GLU CA   C  -4.695   6.366  -1.464 1.00 . A A . 86 GLU CA   1 1 
        6  8315 1 1 89 GLU CB   C  -4.808   7.792  -0.887 1.00 . A A . 86 GLU CB   1 1 
        6  8316 1 1 89 GLU CD   C  -4.996   9.271  -2.991 1.00 . A A . 86 GLU CD   1 1 
        6  8317 1 1 89 GLU CG   C  -5.663   8.779  -1.713 1.00 . A A . 86 GLU CG   1 1 
        6  8318 1 1 89 GLU H    H  -3.833   5.622   0.298 1.00 . A A . 86 GLU H    1 1 
        6  8319 1 1 89 GLU HA   H  -5.606   6.110  -1.985 1.00 . A A . 86 GLU HA   1 1 
        6  8320 1 1 89 GLU HB2  H  -5.231   7.725   0.109 1.00 . A A . 86 GLU HB2  1 1 
        6  8321 1 1 89 GLU HB3  H  -3.809   8.203  -0.807 1.00 . A A . 86 GLU HB3  1 1 
        6  8322 1 1 89 GLU HG2  H  -6.595   8.297  -1.984 1.00 . A A . 86 GLU HG2  1 1 
        6  8323 1 1 89 GLU HG3  H  -5.885   9.641  -1.097 1.00 . A A . 86 GLU HG3  1 1 
        6  8324 1 1 89 GLU N    N  -4.501   5.410  -0.387 1.00 . A A . 86 GLU N    1 1 
        6  8325 1 1 89 GLU O    O  -2.404   6.730  -2.103 1.00 . A A . 86 GLU O    1 1 
        6  8326 1 1 89 GLU OXT  O  -3.645   5.527  -3.443 1.00 . A A . 86 GLU OXT  1 1 
        6  8327 1 1 89 GLU OE1  O  -4.150  10.181  -2.899 1.00 . A A . 86 GLU OE1  1 1 
        6  8328 1 1 89 GLU OE2  O  -5.345   8.778  -4.089 1.00 . A A . 86 GLU OE2  1 1 
        7  8329 1 1  1 GLY C    C -13.850   0.232  -0.303 1.00 . A A . -2 GLY C    1 1 
        7  8330 1 1  1 GLY CA   C -13.287  -1.109  -0.751 1.00 . A A . -2 GLY CA   1 1 
        7  8331 1 1  1 GLY H1   H -13.893  -2.879  -1.680 1.00 . A A . -2 GLY H1   1 1 
        7  8332 1 1  1 GLY H2   H -14.725  -1.506  -2.215 1.00 . A A . -2 GLY H2   1 1 
        7  8333 1 1  1 GLY H3   H -15.080  -2.175  -0.703 1.00 . A A . -2 GLY H3   1 1 
        7  8334 1 1  1 GLY HA2  H -12.883  -1.620   0.108 1.00 . A A . -2 GLY HA2  1 1 
        7  8335 1 1  1 GLY HA3  H -12.492  -0.942  -1.460 1.00 . A A . -2 GLY HA3  1 1 
        7  8336 1 1  1 GLY N    N -14.319  -1.977  -1.381 1.00 . A A . -2 GLY N    1 1 
        7  8337 1 1  1 GLY O    O -14.452   0.321   0.770 1.00 . A A . -2 GLY O    1 1 
        7  8338 1 1  2 SER C    C -13.824   3.372   0.283 1.00 . A A . -1 SER C    1 1 
        7  8339 1 1  2 SER CA   C -14.221   2.611  -1.006 1.00 . A A . -1 SER CA   1 1 
        7  8340 1 1  2 SER CB   C -15.751   2.504  -1.144 1.00 . A A . -1 SER CB   1 1 
        7  8341 1 1  2 SER H    H -12.987   1.122  -1.873 1.00 . A A . -1 SER H    1 1 
        7  8342 1 1  2 SER HA   H -13.859   3.183  -1.845 1.00 . A A . -1 SER HA   1 1 
        7  8343 1 1  2 SER HB2  H -16.141   1.901  -0.342 1.00 . A A . -1 SER HB2  1 1 
        7  8344 1 1  2 SER HB3  H -16.188   3.492  -1.103 1.00 . A A . -1 SER HB3  1 1 
        7  8345 1 1  2 SER HG   H -16.979   2.186  -2.647 1.00 . A A . -1 SER HG   1 1 
        7  8346 1 1  2 SER N    N -13.607   1.267  -1.131 1.00 . A A . -1 SER N    1 1 
        7  8347 1 1  2 SER O    O -14.648   4.060   0.892 1.00 . A A . -1 SER O    1 1 
        7  8348 1 1  2 SER OG   O -16.097   1.900  -2.383 1.00 . A A . -1 SER OG   1 1 
        7  8349 1 1  3 HIS C    C -10.536   4.328   1.567 1.00 . A A .  0 HIS C    1 1 
        7  8350 1 1  3 HIS CA   C -12.007   4.016   1.811 1.00 . A A .  0 HIS CA   1 1 
        7  8351 1 1  3 HIS CB   C -12.140   3.232   3.124 1.00 . A A .  0 HIS CB   1 1 
        7  8352 1 1  3 HIS CD2  C -13.429   4.908   4.632 1.00 . A A .  0 HIS CD2  1 1 
        7  8353 1 1  3 HIS CE1  C -15.113   3.618   5.173 1.00 . A A .  0 HIS CE1  1 1 
        7  8354 1 1  3 HIS CG   C -13.252   3.718   4.007 1.00 . A A .  0 HIS CG   1 1 
        7  8355 1 1  3 HIS H    H -11.953   2.666   0.180 1.00 . A A .  0 HIS H    1 1 
        7  8356 1 1  3 HIS HA   H -12.555   4.943   1.895 1.00 . A A .  0 HIS HA   1 1 
        7  8357 1 1  3 HIS HB2  H -12.333   2.195   2.895 1.00 . A A .  0 HIS HB2  1 1 
        7  8358 1 1  3 HIS HB3  H -11.217   3.310   3.671 1.00 . A A .  0 HIS HB3  1 1 
        7  8359 1 1  3 HIS HD1  H -14.470   2.005   4.089 1.00 . A A .  0 HIS HD1  1 1 
        7  8360 1 1  3 HIS HD2  H -12.781   5.773   4.562 1.00 . A A .  0 HIS HD2  1 1 
        7  8361 1 1  3 HIS HE1  H -16.026   3.254   5.618 1.00 . A A .  0 HIS HE1  1 1 
        7  8362 1 1  3 HIS HE2  H -14.892   5.466   6.026 1.00 . A A .  0 HIS HE2  1 1 
        7  8363 1 1  3 HIS N    N -12.553   3.262   0.674 1.00 . A A .  0 HIS N    1 1 
        7  8364 1 1  3 HIS ND1  N -14.313   2.927   4.381 1.00 . A A .  0 HIS ND1  1 1 
        7  8365 1 1  3 HIS NE2  N -14.597   4.819   5.348 1.00 . A A .  0 HIS NE2  1 1 
        7  8366 1 1  3 HIS O    O  -9.915   3.696   0.716 1.00 . A A .  0 HIS O    1 1 
        7  8367 1 1  4 MET C    C  -8.168   6.484   3.521 1.00 . A A .  1 MET C    1 1 
        7  8368 1 1  4 MET CA   C  -8.564   5.656   2.281 1.00 . A A .  1 MET CA   1 1 
        7  8369 1 1  4 MET CB   C  -8.148   6.378   0.963 1.00 . A A .  1 MET CB   1 1 
        7  8370 1 1  4 MET CE   C  -9.089   6.933  -2.178 1.00 . A A .  1 MET CE   1 1 
        7  8371 1 1  4 MET CG   C  -9.039   7.551   0.543 1.00 . A A .  1 MET CG   1 1 
        7  8372 1 1  4 MET H    H -10.600   5.866   2.857 1.00 . A A .  1 MET H    1 1 
        7  8373 1 1  4 MET HA   H  -8.032   4.714   2.332 1.00 . A A .  1 MET HA   1 1 
        7  8374 1 1  4 MET HB2  H  -7.144   6.756   1.086 1.00 . A A .  1 MET HB2  1 1 
        7  8375 1 1  4 MET HB3  H  -8.147   5.655   0.162 1.00 . A A .  1 MET HB3  1 1 
        7  8376 1 1  4 MET HE1  H -10.136   6.718  -2.027 1.00 . A A .  1 MET HE1  1 1 
        7  8377 1 1  4 MET HE2  H  -8.505   6.046  -1.982 1.00 . A A .  1 MET HE2  1 1 
        7  8378 1 1  4 MET HE3  H  -8.931   7.248  -3.200 1.00 . A A .  1 MET HE3  1 1 
        7  8379 1 1  4 MET HG2  H -10.059   7.207   0.491 1.00 . A A .  1 MET HG2  1 1 
        7  8380 1 1  4 MET HG3  H  -8.963   8.329   1.290 1.00 . A A .  1 MET HG3  1 1 
        7  8381 1 1  4 MET N    N -10.004   5.324   2.298 1.00 . A A .  1 MET N    1 1 
        7  8382 1 1  4 MET O    O  -8.373   7.703   3.566 1.00 . A A .  1 MET O    1 1 
        7  8383 1 1  4 MET SD   S  -8.586   8.249  -1.061 1.00 . A A .  1 MET SD   1 1 
        7  8384 1 1  5 VAL C    C  -6.242   5.531   6.601 1.00 . A A .  2 VAL C    1 1 
        7  8385 1 1  5 VAL CA   C  -7.167   6.471   5.775 1.00 . A A .  2 VAL CA   1 1 
        7  8386 1 1  5 VAL CB   C  -8.370   7.036   6.634 1.00 . A A .  2 VAL CB   1 1 
        7  8387 1 1  5 VAL CG1  C  -9.397   5.966   7.017 1.00 . A A .  2 VAL CG1  1 1 
        7  8388 1 1  5 VAL CG2  C  -7.867   7.757   7.875 1.00 . A A .  2 VAL CG2  1 1 
        7  8389 1 1  5 VAL H    H  -7.561   4.832   4.488 1.00 . A A .  2 VAL H    1 1 
        7  8390 1 1  5 VAL HA   H  -6.569   7.319   5.457 1.00 . A A .  2 VAL HA   1 1 
        7  8391 1 1  5 VAL HB   H  -8.885   7.771   6.021 1.00 . A A .  2 VAL HB   1 1 
        7  8392 1 1  5 VAL HG11 H  -8.913   5.207   7.612 1.00 . A A .  2 VAL HG11 1 1 
        7  8393 1 1  5 VAL HG12 H  -9.808   5.518   6.123 1.00 . A A .  2 VAL HG12 1 1 
        7  8394 1 1  5 VAL HG13 H -10.192   6.420   7.590 1.00 . A A .  2 VAL HG13 1 1 
        7  8395 1 1  5 VAL HG21 H  -8.707   8.147   8.430 1.00 . A A .  2 VAL HG21 1 1 
        7  8396 1 1  5 VAL HG22 H  -7.218   8.569   7.583 1.00 . A A .  2 VAL HG22 1 1 
        7  8397 1 1  5 VAL HG23 H  -7.322   7.061   8.488 1.00 . A A .  2 VAL HG23 1 1 
        7  8398 1 1  5 VAL N    N  -7.635   5.804   4.548 1.00 . A A .  2 VAL N    1 1 
        7  8399 1 1  5 VAL O    O  -6.665   4.477   7.087 1.00 . A A .  2 VAL O    1 1 
        7  8400 1 1  6 ILE C    C  -2.696   5.986   7.788 1.00 . A A .  3 ILE C    1 1 
        7  8401 1 1  6 ILE CA   C  -3.971   5.139   7.503 1.00 . A A .  3 ILE CA   1 1 
        7  8402 1 1  6 ILE CB   C  -3.610   3.746   6.836 1.00 . A A .  3 ILE CB   1 1 
        7  8403 1 1  6 ILE CD1  C  -2.345   1.555   7.264 1.00 . A A .  3 ILE CD1  1 1 
        7  8404 1 1  6 ILE CG1  C  -2.604   2.976   7.717 1.00 . A A .  3 ILE CG1  1 1 
        7  8405 1 1  6 ILE CG2  C  -3.102   3.880   5.378 1.00 . A A .  3 ILE CG2  1 1 
        7  8406 1 1  6 ILE H    H  -4.643   6.698   6.226 1.00 . A A .  3 ILE H    1 1 
        7  8407 1 1  6 ILE HA   H  -4.446   4.930   8.454 1.00 . A A .  3 ILE HA   1 1 
        7  8408 1 1  6 ILE HB   H  -4.523   3.168   6.791 1.00 . A A .  3 ILE HB   1 1 
        7  8409 1 1  6 ILE HD11 H  -3.279   1.010   7.241 1.00 . A A .  3 ILE HD11 1 1 
        7  8410 1 1  6 ILE HD12 H  -1.666   1.076   7.955 1.00 . A A .  3 ILE HD12 1 1 
        7  8411 1 1  6 ILE HD13 H  -1.909   1.566   6.276 1.00 . A A .  3 ILE HD13 1 1 
        7  8412 1 1  6 ILE HG12 H  -1.659   3.499   7.709 1.00 . A A .  3 ILE HG12 1 1 
        7  8413 1 1  6 ILE HG13 H  -2.979   2.938   8.734 1.00 . A A .  3 ILE HG13 1 1 
        7  8414 1 1  6 ILE HG21 H  -2.924   2.896   4.961 1.00 . A A .  3 ILE HG21 1 1 
        7  8415 1 1  6 ILE HG22 H  -2.182   4.446   5.354 1.00 . A A .  3 ILE HG22 1 1 
        7  8416 1 1  6 ILE HG23 H  -3.847   4.390   4.778 1.00 . A A .  3 ILE HG23 1 1 
        7  8417 1 1  6 ILE N    N  -4.947   5.900   6.703 1.00 . A A .  3 ILE N    1 1 
        7  8418 1 1  6 ILE O    O  -2.089   6.534   6.865 1.00 . A A .  3 ILE O    1 1 
        7  8419 1 1  7 ARG C    C  -0.531   5.989  10.679 1.00 . A A .  4 ARG C    1 1 
        7  8420 1 1  7 ARG CA   C  -1.062   6.758   9.480 1.00 . A A .  4 ARG CA   1 1 
        7  8421 1 1  7 ARG CB   C  -1.238   8.219   9.920 1.00 . A A .  4 ARG CB   1 1 
        7  8422 1 1  7 ARG CD   C  -2.646   9.980   8.825 1.00 . A A .  4 ARG CD   1 1 
        7  8423 1 1  7 ARG CG   C  -1.320   9.245   8.787 1.00 . A A .  4 ARG CG   1 1 
        7  8424 1 1  7 ARG CZ   C  -2.444  12.448   8.718 1.00 . A A .  4 ARG CZ   1 1 
        7  8425 1 1  7 ARG H    H  -2.924   5.827   9.809 1.00 . A A .  4 ARG H    1 1 
        7  8426 1 1  7 ARG HA   H  -0.377   6.705   8.644 1.00 . A A .  4 ARG HA   1 1 
        7  8427 1 1  7 ARG HB2  H  -2.149   8.284  10.499 1.00 . A A .  4 ARG HB2  1 1 
        7  8428 1 1  7 ARG HB3  H  -0.406   8.477  10.567 1.00 . A A .  4 ARG HB3  1 1 
        7  8429 1 1  7 ARG HD2  H  -3.401   9.361   8.362 1.00 . A A .  4 ARG HD2  1 1 
        7  8430 1 1  7 ARG HD3  H  -2.915  10.165   9.854 1.00 . A A .  4 ARG HD3  1 1 
        7  8431 1 1  7 ARG HE   H  -2.619  11.222   7.136 1.00 . A A .  4 ARG HE   1 1 
        7  8432 1 1  7 ARG HG2  H  -0.517   9.973   8.878 1.00 . A A .  4 ARG HG2  1 1 
        7  8433 1 1  7 ARG HG3  H  -1.230   8.731   7.841 1.00 . A A .  4 ARG HG3  1 1 
        7  8434 1 1  7 ARG HH11 H  -2.372  11.718  10.617 1.00 . A A .  4 ARG HH11 1 1 
        7  8435 1 1  7 ARG HH12 H  -2.250  13.440  10.480 1.00 . A A .  4 ARG HH12 1 1 
        7  8436 1 1  7 ARG HH21 H  -2.524  13.509   6.997 1.00 . A A .  4 ARG HH21 1 1 
        7  8437 1 1  7 ARG HH22 H  -2.332  14.449   8.441 1.00 . A A .  4 ARG HH22 1 1 
        7  8438 1 1  7 ARG N    N  -2.331   6.143   9.083 1.00 . A A .  4 ARG N    1 1 
        7  8439 1 1  7 ARG NE   N  -2.578  11.255   8.114 1.00 . A A .  4 ARG NE   1 1 
        7  8440 1 1  7 ARG NH1  N  -2.349  12.541  10.045 1.00 . A A .  4 ARG NH1  1 1 
        7  8441 1 1  7 ARG NH2  N  -2.435  13.555   7.992 1.00 . A A .  4 ARG NH2  1 1 
        7  8442 1 1  7 ARG O    O  -1.348   5.622  11.534 1.00 . A A .  4 ARG O    1 1 
        7  8443 1 1  8 GLU C    C   1.114   3.711  12.281 1.00 . A A .  5 GLU C    1 1 
        7  8444 1 1  8 GLU CA   C   1.489   5.173  11.935 1.00 . A A .  5 GLU CA   1 1 
        7  8445 1 1  8 GLU CB   C   1.200   6.084  13.171 1.00 . A A .  5 GLU CB   1 1 
        7  8446 1 1  8 GLU CD   C   1.811   8.020  14.686 1.00 . A A .  5 GLU CD   1 1 
        7  8447 1 1  8 GLU CG   C   2.268   7.151  13.532 1.00 . A A .  5 GLU CG   1 1 
        7  8448 1 1  8 GLU H    H   1.321   5.723   9.870 1.00 . A A .  5 GLU H    1 1 
        7  8449 1 1  8 GLU HA   H   2.549   5.201  11.729 1.00 . A A .  5 GLU HA   1 1 
        7  8450 1 1  8 GLU HB2  H   0.263   6.608  12.992 1.00 . A A .  5 GLU HB2  1 1 
        7  8451 1 1  8 GLU HB3  H   1.051   5.441  14.025 1.00 . A A .  5 GLU HB3  1 1 
        7  8452 1 1  8 GLU HG2  H   3.186   6.659  13.825 1.00 . A A .  5 GLU HG2  1 1 
        7  8453 1 1  8 GLU HG3  H   2.464   7.801  12.686 1.00 . A A .  5 GLU HG3  1 1 
        7  8454 1 1  8 GLU N    N   0.795   5.672  10.709 1.00 . A A .  5 GLU N    1 1 
        7  8455 1 1  8 GLU O    O   1.552   3.179  13.306 1.00 . A A .  5 GLU O    1 1 
        7  8456 1 1  8 GLU OE1  O   0.989   8.931  14.453 1.00 . A A .  5 GLU OE1  1 1 
        7  8457 1 1  8 GLU OE2  O   2.274   7.794  15.828 1.00 . A A .  5 GLU OE2  1 1 
        7  8458 1 1  9 SER C    C   0.590   0.592  11.113 1.00 . A A .  6 SER C    1 1 
        7  8459 1 1  9 SER CA   C  -0.221   1.739  11.748 1.00 . A A .  6 SER CA   1 1 
        7  8460 1 1  9 SER CB   C  -1.701   1.671  11.330 1.00 . A A .  6 SER CB   1 1 
        7  8461 1 1  9 SER H    H   0.112   3.472  10.563 1.00 . A A .  6 SER H    1 1 
        7  8462 1 1  9 SER HA   H  -0.161   1.642  12.816 1.00 . A A .  6 SER HA   1 1 
        7  8463 1 1  9 SER HB2  H  -2.211   2.561  11.669 1.00 . A A .  6 SER HB2  1 1 
        7  8464 1 1  9 SER HB3  H  -1.771   1.602  10.256 1.00 . A A .  6 SER HB3  1 1 
        7  8465 1 1  9 SER HG   H  -1.758   0.123  12.531 1.00 . A A .  6 SER HG   1 1 
        7  8466 1 1  9 SER N    N   0.335   3.052  11.421 1.00 . A A .  6 SER N    1 1 
        7  8467 1 1  9 SER O    O   0.401  -0.568  11.476 1.00 . A A .  6 SER O    1 1 
        7  8468 1 1  9 SER OG   O  -2.352   0.543  11.895 1.00 . A A .  6 SER OG   1 1 
        7  8469 1 1 10 VAL C    C   1.668  -0.920   8.463 1.00 . A A .  7 VAL C    1 1 
        7  8470 1 1 10 VAL CA   C   2.413   0.073   9.400 1.00 . A A .  7 VAL CA   1 1 
        7  8471 1 1 10 VAL CB   C   3.583  -0.636  10.247 1.00 . A A .  7 VAL CB   1 1 
        7  8472 1 1 10 VAL CG1  C   4.251   0.377  11.164 1.00 . A A .  7 VAL CG1  1 1 
        7  8473 1 1 10 VAL CG2  C   3.241  -1.947  11.042 1.00 . A A .  7 VAL CG2  1 1 
        7  8474 1 1 10 VAL H    H   1.529   1.939   9.990 1.00 . A A .  7 VAL H    1 1 
        7  8475 1 1 10 VAL HA   H   2.922   0.767   8.729 1.00 . A A .  7 VAL HA   1 1 
        7  8476 1 1 10 VAL HB   H   4.346  -0.907   9.526 1.00 . A A .  7 VAL HB   1 1 
        7  8477 1 1 10 VAL HG11 H   5.034  -0.109  11.723 1.00 . A A .  7 VAL HG11 1 1 
        7  8478 1 1 10 VAL HG12 H   3.518   0.781  11.846 1.00 . A A .  7 VAL HG12 1 1 
        7  8479 1 1 10 VAL HG13 H   4.672   1.179  10.573 1.00 . A A .  7 VAL HG13 1 1 
        7  8480 1 1 10 VAL HG21 H   3.299  -2.804  10.381 1.00 . A A .  7 VAL HG21 1 1 
        7  8481 1 1 10 VAL HG22 H   2.255  -1.910  11.476 1.00 . A A .  7 VAL HG22 1 1 
        7  8482 1 1 10 VAL HG23 H   3.969  -2.076  11.833 1.00 . A A .  7 VAL HG23 1 1 
        7  8483 1 1 10 VAL N    N   1.487   0.972  10.181 1.00 . A A .  7 VAL N    1 1 
        7  8484 1 1 10 VAL O    O   0.886  -1.771   8.896 1.00 . A A .  7 VAL O    1 1 
        7  8485 1 1 11 SER C    C   1.837  -3.022   6.101 1.00 . A A .  8 SER C    1 1 
        7  8486 1 1 11 SER CA   C   1.229  -1.600   6.133 1.00 . A A .  8 SER CA   1 1 
        7  8487 1 1 11 SER CB   C   1.378  -0.884   4.763 1.00 . A A .  8 SER CB   1 1 
        7  8488 1 1 11 SER H    H   2.523  -0.073   6.834 1.00 . A A .  8 SER H    1 1 
        7  8489 1 1 11 SER HA   H   0.186  -1.663   6.392 1.00 . A A .  8 SER HA   1 1 
        7  8490 1 1 11 SER HB2  H   2.423  -0.682   4.578 1.00 . A A .  8 SER HB2  1 1 
        7  8491 1 1 11 SER HB3  H   0.994  -1.489   3.955 1.00 . A A .  8 SER HB3  1 1 
        7  8492 1 1 11 SER HG   H   0.574   0.647   5.678 1.00 . A A .  8 SER HG   1 1 
        7  8493 1 1 11 SER N    N   1.894  -0.767   7.141 1.00 . A A .  8 SER N    1 1 
        7  8494 1 1 11 SER O    O   3.011  -3.184   5.796 1.00 . A A .  8 SER O    1 1 
        7  8495 1 1 11 SER OG   O   0.683   0.349   4.771 1.00 . A A .  8 SER OG   1 1 
        7  8496 1 1 12 ARG C    C   0.599  -6.521   5.785 1.00 . A A .  9 ARG C    1 1 
        7  8497 1 1 12 ARG CA   C   1.548  -5.463   6.418 1.00 . A A .  9 ARG CA   1 1 
        7  8498 1 1 12 ARG CB   C   1.967  -5.913   7.861 1.00 . A A .  9 ARG CB   1 1 
        7  8499 1 1 12 ARG CD   C  -0.380  -5.606   8.947 1.00 . A A .  9 ARG CD   1 1 
        7  8500 1 1 12 ARG CG   C   1.141  -5.391   9.067 1.00 . A A .  9 ARG CG   1 1 
        7  8501 1 1 12 ARG CZ   C  -1.575  -4.497  10.836 1.00 . A A .  9 ARG CZ   1 1 
        7  8502 1 1 12 ARG H    H   0.023  -3.905   6.488 1.00 . A A .  9 ARG H    1 1 
        7  8503 1 1 12 ARG HA   H   2.443  -5.436   5.816 1.00 . A A .  9 ARG HA   1 1 
        7  8504 1 1 12 ARG HB2  H   1.951  -6.996   7.893 1.00 . A A .  9 ARG HB2  1 1 
        7  8505 1 1 12 ARG HB3  H   2.994  -5.605   8.017 1.00 . A A .  9 ARG HB3  1 1 
        7  8506 1 1 12 ARG HD2  H  -0.789  -4.816   8.334 1.00 . A A .  9 ARG HD2  1 1 
        7  8507 1 1 12 ARG HD3  H  -0.569  -6.553   8.469 1.00 . A A .  9 ARG HD3  1 1 
        7  8508 1 1 12 ARG HE   H  -1.157  -6.451  10.707 1.00 . A A .  9 ARG HE   1 1 
        7  8509 1 1 12 ARG HG2  H   1.489  -5.900   9.964 1.00 . A A .  9 ARG HG2  1 1 
        7  8510 1 1 12 ARG HG3  H   1.333  -4.330   9.172 1.00 . A A .  9 ARG HG3  1 1 
        7  8511 1 1 12 ARG HH11 H  -1.023  -3.187   9.381 1.00 . A A .  9 ARG HH11 1 1 
        7  8512 1 1 12 ARG HH12 H  -1.870  -2.484  10.718 1.00 . A A .  9 ARG HH12 1 1 
        7  8513 1 1 12 ARG HH21 H  -2.273  -5.534  12.435 1.00 . A A .  9 ARG HH21 1 1 
        7  8514 1 1 12 ARG HH22 H  -2.587  -3.830  12.467 1.00 . A A .  9 ARG HH22 1 1 
        7  8515 1 1 12 ARG N    N   1.011  -4.068   6.368 1.00 . A A .  9 ARG N    1 1 
        7  8516 1 1 12 ARG NE   N  -1.065  -5.586  10.245 1.00 . A A .  9 ARG NE   1 1 
        7  8517 1 1 12 ARG NH1  N  -1.479  -3.292  10.266 1.00 . A A .  9 ARG NH1  1 1 
        7  8518 1 1 12 ARG NH2  N  -2.199  -4.629  12.004 1.00 . A A .  9 ARG NH2  1 1 
        7  8519 1 1 12 ARG O    O  -0.585  -6.279   5.711 1.00 . A A .  9 ARG O    1 1 
        7  8520 1 1 13 ILE C    C   0.199  -9.909   5.839 1.00 . A A . 10 ILE C    1 1 
        7  8521 1 1 13 ILE CA   C   0.226  -8.771   4.833 1.00 . A A . 10 ILE CA   1 1 
        7  8522 1 1 13 ILE CB   C   0.702  -9.384   3.435 1.00 . A A . 10 ILE CB   1 1 
        7  8523 1 1 13 ILE CD1  C   0.878  -8.923   0.866 1.00 . A A . 10 ILE CD1  1 1 
        7  8524 1 1 13 ILE CG1  C   0.759  -8.342   2.292 1.00 . A A . 10 ILE CG1  1 1 
        7  8525 1 1 13 ILE CG2  C  -0.146 -10.611   2.990 1.00 . A A . 10 ILE CG2  1 1 
        7  8526 1 1 13 ILE H    H   2.073  -7.925   5.487 1.00 . A A . 10 ILE H    1 1 
        7  8527 1 1 13 ILE HA   H  -0.762  -8.351   4.744 1.00 . A A . 10 ILE HA   1 1 
        7  8528 1 1 13 ILE HB   H   1.702  -9.744   3.607 1.00 . A A . 10 ILE HB   1 1 
        7  8529 1 1 13 ILE HD11 H  -0.094  -9.252   0.520 1.00 . A A . 10 ILE HD11 1 1 
        7  8530 1 1 13 ILE HD12 H   1.538  -9.763   0.878 1.00 . A A . 10 ILE HD12 1 1 
        7  8531 1 1 13 ILE HD13 H   1.254  -8.167   0.198 1.00 . A A . 10 ILE HD13 1 1 
        7  8532 1 1 13 ILE HG12 H  -0.130  -7.745   2.320 1.00 . A A . 10 ILE HG12 1 1 
        7  8533 1 1 13 ILE HG13 H   1.611  -7.697   2.447 1.00 . A A . 10 ILE HG13 1 1 
        7  8534 1 1 13 ILE HG21 H   0.351 -11.120   2.176 1.00 . A A . 10 ILE HG21 1 1 
        7  8535 1 1 13 ILE HG22 H  -1.120 -10.288   2.656 1.00 . A A . 10 ILE HG22 1 1 
        7  8536 1 1 13 ILE HG23 H  -0.261 -11.299   3.818 1.00 . A A . 10 ILE HG23 1 1 
        7  8537 1 1 13 ILE N    N   1.104  -7.728   5.391 1.00 . A A . 10 ILE N    1 1 
        7  8538 1 1 13 ILE O    O   1.265 -10.271   6.402 1.00 . A A . 10 ILE O    1 1 
        7  8539 1 1 14 TYR C    C  -1.243 -12.892   6.130 1.00 . A A . 11 TYR C    1 1 
        7  8540 1 1 14 TYR CA   C  -1.279 -11.565   6.959 1.00 . A A . 11 TYR CA   1 1 
        7  8541 1 1 14 TYR CB   C  -2.681 -11.379   7.603 1.00 . A A . 11 TYR CB   1 1 
        7  8542 1 1 14 TYR CD1  C  -3.598 -13.564   8.535 1.00 . A A . 11 TYR CD1  1 1 
        7  8543 1 1 14 TYR CD2  C  -2.753 -11.937  10.065 1.00 . A A . 11 TYR CD2  1 1 
        7  8544 1 1 14 TYR CE1  C  -3.917 -14.396   9.591 1.00 . A A . 11 TYR CE1  1 1 
        7  8545 1 1 14 TYR CE2  C  -3.074 -12.767  11.127 1.00 . A A . 11 TYR CE2  1 1 
        7  8546 1 1 14 TYR CG   C  -3.006 -12.318   8.753 1.00 . A A . 11 TYR CG   1 1 
        7  8547 1 1 14 TYR CZ   C  -3.656 -13.996  10.883 1.00 . A A . 11 TYR CZ   1 1 
        7  8548 1 1 14 TYR H    H  -1.815 -10.035   5.571 1.00 . A A . 11 TYR H    1 1 
        7  8549 1 1 14 TYR HA   H  -0.524 -11.555   7.734 1.00 . A A . 11 TYR HA   1 1 
        7  8550 1 1 14 TYR HB2  H  -2.762 -10.369   7.985 1.00 . A A . 11 TYR HB2  1 1 
        7  8551 1 1 14 TYR HB3  H  -3.443 -11.521   6.843 1.00 . A A . 11 TYR HB3  1 1 
        7  8552 1 1 14 TYR HD1  H  -3.800 -13.880   7.525 1.00 . A A . 11 TYR HD1  1 1 
        7  8553 1 1 14 TYR HD2  H  -2.296 -10.976  10.252 1.00 . A A . 11 TYR HD2  1 1 
        7  8554 1 1 14 TYR HE1  H  -4.374 -15.355   9.401 1.00 . A A . 11 TYR HE1  1 1 
        7  8555 1 1 14 TYR HE2  H  -2.869 -12.449  12.140 1.00 . A A . 11 TYR HE2  1 1 
        7  8556 1 1 14 TYR HH   H  -4.388 -14.319  12.638 1.00 . A A . 11 TYR HH   1 1 
        7  8557 1 1 14 TYR N    N  -1.032 -10.432   6.060 1.00 . A A . 11 TYR N    1 1 
        7  8558 1 1 14 TYR O    O  -2.107 -13.076   5.248 1.00 . A A . 11 TYR O    1 1 
        7  8559 1 1 14 TYR OH   O  -3.978 -14.830  11.933 1.00 . A A . 11 TYR OH   1 1 
        7  8560 1 1 15 VAL C    C  -0.261 -16.250   6.588 1.00 . A A . 12 VAL C    1 1 
        7  8561 1 1 15 VAL CA   C  -0.225 -15.069   5.609 1.00 . A A . 12 VAL CA   1 1 
        7  8562 1 1 15 VAL CB   C   1.053 -15.151   4.648 1.00 . A A . 12 VAL CB   1 1 
        7  8563 1 1 15 VAL CG1  C   1.333 -16.552   4.093 1.00 . A A . 12 VAL CG1  1 1 
        7  8564 1 1 15 VAL CG2  C   0.909 -14.194   3.486 1.00 . A A . 12 VAL CG2  1 1 
        7  8565 1 1 15 VAL H    H   0.428 -13.686   7.081 1.00 . A A . 12 VAL H    1 1 
        7  8566 1 1 15 VAL HA   H  -1.134 -15.100   5.014 1.00 . A A . 12 VAL HA   1 1 
        7  8567 1 1 15 VAL HB   H   1.945 -14.842   5.204 1.00 . A A . 12 VAL HB   1 1 
        7  8568 1 1 15 VAL HG11 H   1.461 -17.243   4.916 1.00 . A A . 12 VAL HG11 1 1 
        7  8569 1 1 15 VAL HG12 H   2.243 -16.525   3.512 1.00 . A A . 12 VAL HG12 1 1 
        7  8570 1 1 15 VAL HG13 H   0.523 -16.882   3.464 1.00 . A A . 12 VAL HG13 1 1 
        7  8571 1 1 15 VAL HG21 H   0.889 -13.182   3.850 1.00 . A A . 12 VAL HG21 1 1 
        7  8572 1 1 15 VAL HG22 H  -0.004 -14.405   2.955 1.00 . A A . 12 VAL HG22 1 1 
        7  8573 1 1 15 VAL HG23 H   1.748 -14.320   2.817 1.00 . A A . 12 VAL HG23 1 1 
        7  8574 1 1 15 VAL N    N  -0.267 -13.818   6.368 1.00 . A A . 12 VAL N    1 1 
        7  8575 1 1 15 VAL O    O   0.635 -16.393   7.408 1.00 . A A . 12 VAL O    1 1 
        7  8576 1 1 16 GLY C    C  -1.511 -19.560   6.556 1.00 . A A . 13 GLY C    1 1 
        7  8577 1 1 16 GLY CA   C  -1.335 -18.275   7.365 1.00 . A A . 13 GLY CA   1 1 
        7  8578 1 1 16 GLY H    H  -2.127 -16.829   5.970 1.00 . A A . 13 GLY H    1 1 
        7  8579 1 1 16 GLY HA2  H  -0.390 -18.330   7.887 1.00 . A A . 13 GLY HA2  1 1 
        7  8580 1 1 16 GLY HA3  H  -2.126 -18.200   8.100 1.00 . A A . 13 GLY HA3  1 1 
        7  8581 1 1 16 GLY N    N  -1.329 -17.062   6.549 1.00 . A A . 13 GLY N    1 1 
        7  8582 1 1 16 GLY O    O  -1.785 -19.496   5.358 1.00 . A A . 13 GLY O    1 1 
        7  8583 1 1 17 ASN C    C  -0.822 -22.313   5.235 1.00 . A A . 14 ASN C    1 1 
        7  8584 1 1 17 ASN CA   C  -1.554 -22.084   6.597 1.00 . A A . 14 ASN CA   1 1 
        7  8585 1 1 17 ASN CB   C  -3.067 -22.292   6.408 1.00 . A A . 14 ASN CB   1 1 
        7  8586 1 1 17 ASN CG   C  -3.828 -22.426   7.722 1.00 . A A . 14 ASN CG   1 1 
        7  8587 1 1 17 ASN H    H  -1.109 -20.710   8.200 1.00 . A A . 14 ASN H    1 1 
        7  8588 1 1 17 ASN HA   H  -1.206 -22.831   7.287 1.00 . A A . 14 ASN HA   1 1 
        7  8589 1 1 17 ASN HB2  H  -3.463 -21.448   5.871 1.00 . A A . 14 ASN HB2  1 1 
        7  8590 1 1 17 ASN HB3  H  -3.227 -23.188   5.830 1.00 . A A . 14 ASN HB3  1 1 
        7  8591 1 1 17 ASN HD21 H  -5.333 -21.360   6.991 1.00 . A A . 14 ASN HD21 1 1 
        7  8592 1 1 17 ASN HD22 H  -5.515 -21.882   8.629 1.00 . A A . 14 ASN HD22 1 1 
        7  8593 1 1 17 ASN N    N  -1.338 -20.740   7.224 1.00 . A A . 14 ASN N    1 1 
        7  8594 1 1 17 ASN ND2  N  -5.016 -21.836   7.783 1.00 . A A . 14 ASN ND2  1 1 
        7  8595 1 1 17 ASN O    O  -1.230 -23.165   4.478 1.00 . A A . 14 ASN O    1 1 
        7  8596 1 1 17 ASN OD1  O  -3.350 -23.045   8.679 1.00 . A A . 14 ASN OD1  1 1 
        7  8597 1 1 18 LEU C    C   1.751 -22.900   3.384 1.00 . A A . 15 LEU C    1 1 
        7  8598 1 1 18 LEU CA   C   0.910 -21.621   3.635 1.00 . A A . 15 LEU CA   1 1 
        7  8599 1 1 18 LEU CB   C   1.763 -20.342   3.447 1.00 . A A . 15 LEU CB   1 1 
        7  8600 1 1 18 LEU CD1  C   4.163 -20.080   2.823 1.00 . A A . 15 LEU CD1  1 1 
        7  8601 1 1 18 LEU CD2  C   3.428 -19.408   5.095 1.00 . A A . 15 LEU CD2  1 1 
        7  8602 1 1 18 LEU CG   C   3.209 -20.390   3.956 1.00 . A A . 15 LEU CG   1 1 
        7  8603 1 1 18 LEU H    H   0.691 -21.074   5.657 1.00 . A A . 15 LEU H    1 1 
        7  8604 1 1 18 LEU HA   H   0.104 -21.602   2.915 1.00 . A A . 15 LEU HA   1 1 
        7  8605 1 1 18 LEU HB2  H   1.784 -20.104   2.390 1.00 . A A . 15 LEU HB2  1 1 
        7  8606 1 1 18 LEU HB3  H   1.256 -19.531   3.961 1.00 . A A . 15 LEU HB3  1 1 
        7  8607 1 1 18 LEU HD11 H   4.006 -19.066   2.483 1.00 . A A . 15 LEU HD11 1 1 
        7  8608 1 1 18 LEU HD12 H   3.997 -20.766   2.004 1.00 . A A . 15 LEU HD12 1 1 
        7  8609 1 1 18 LEU HD13 H   5.177 -20.187   3.176 1.00 . A A . 15 LEU HD13 1 1 
        7  8610 1 1 18 LEU HD21 H   3.290 -18.404   4.726 1.00 . A A . 15 LEU HD21 1 1 
        7  8611 1 1 18 LEU HD22 H   4.433 -19.515   5.477 1.00 . A A . 15 LEU HD22 1 1 
        7  8612 1 1 18 LEU HD23 H   2.718 -19.601   5.885 1.00 . A A . 15 LEU HD23 1 1 
        7  8613 1 1 18 LEU HG   H   3.426 -21.386   4.316 1.00 . A A . 15 LEU HG   1 1 
        7  8614 1 1 18 LEU N    N   0.293 -21.614   4.966 1.00 . A A . 15 LEU N    1 1 
        7  8615 1 1 18 LEU O    O   2.400 -23.423   4.303 1.00 . A A . 15 LEU O    1 1 
        7  8616 1 1 19 PRO C    C   4.003 -24.126   1.428 1.00 . A A . 16 PRO C    1 1 
        7  8617 1 1 19 PRO CA   C   2.550 -24.578   1.731 1.00 . A A . 16 PRO CA   1 1 
        7  8618 1 1 19 PRO CB   C   1.847 -25.109   0.463 1.00 . A A . 16 PRO CB   1 1 
        7  8619 1 1 19 PRO CD   C   0.740 -23.069   1.089 1.00 . A A . 16 PRO CD   1 1 
        7  8620 1 1 19 PRO CG   C   1.047 -23.975  -0.068 1.00 . A A . 16 PRO CG   1 1 
        7  8621 1 1 19 PRO HA   H   2.546 -25.345   2.490 1.00 . A A . 16 PRO HA   1 1 
        7  8622 1 1 19 PRO HB2  H   2.574 -25.428  -0.273 1.00 . A A . 16 PRO HB2  1 1 
        7  8623 1 1 19 PRO HB3  H   1.197 -25.928   0.724 1.00 . A A . 16 PRO HB3  1 1 
        7  8624 1 1 19 PRO HD2  H   0.886 -22.039   0.797 1.00 . A A . 16 PRO HD2  1 1 
        7  8625 1 1 19 PRO HD3  H  -0.275 -23.224   1.417 1.00 . A A . 16 PRO HD3  1 1 
        7  8626 1 1 19 PRO HG2  H   1.625 -23.445  -0.815 1.00 . A A . 16 PRO HG2  1 1 
        7  8627 1 1 19 PRO HG3  H   0.130 -24.345  -0.497 1.00 . A A . 16 PRO HG3  1 1 
        7  8628 1 1 19 PRO N    N   1.694 -23.455   2.146 1.00 . A A . 16 PRO N    1 1 
        7  8629 1 1 19 PRO O    O   4.181 -23.007   0.955 1.00 . A A . 16 PRO O    1 1 
        7  8630 1 1 20 SER C    C   7.188 -24.001   2.611 1.00 . A A . 17 SER C    1 1 
        7  8631 1 1 20 SER CA   C   6.486 -24.804   1.512 1.00 . A A . 17 SER CA   1 1 
        7  8632 1 1 20 SER CB   C   6.855 -24.237   0.100 1.00 . A A . 17 SER CB   1 1 
        7  8633 1 1 20 SER H    H   4.800 -25.767   2.344 1.00 . A A . 17 SER H    1 1 
        7  8634 1 1 20 SER HA   H   6.908 -25.798   1.571 1.00 . A A . 17 SER HA   1 1 
        7  8635 1 1 20 SER HB2  H   7.846 -24.576  -0.163 1.00 . A A . 17 SER HB2  1 1 
        7  8636 1 1 20 SER HB3  H   6.154 -24.607  -0.635 1.00 . A A . 17 SER HB3  1 1 
        7  8637 1 1 20 SER HG   H   7.756 -22.494  -0.039 1.00 . A A . 17 SER HG   1 1 
        7  8638 1 1 20 SER N    N   5.024 -24.981   1.794 1.00 . A A . 17 SER N    1 1 
        7  8639 1 1 20 SER O    O   8.366 -24.265   2.884 1.00 . A A . 17 SER O    1 1 
        7  8640 1 1 20 SER OG   O   6.850 -22.813   0.050 1.00 . A A . 17 SER OG   1 1 
        7  8641 1 1 21 HIS C    C   7.979 -21.175   3.822 1.00 . A A . 18 HIS C    1 1 
        7  8642 1 1 21 HIS CA   C   6.923 -22.182   4.327 1.00 . A A . 18 HIS CA   1 1 
        7  8643 1 1 21 HIS CB   C   7.403 -23.030   5.529 1.00 . A A . 18 HIS CB   1 1 
        7  8644 1 1 21 HIS CD2  C   9.319 -22.241   7.083 1.00 . A A . 18 HIS CD2  1 1 
        7  8645 1 1 21 HIS CE1  C   8.156 -20.958   8.418 1.00 . A A . 18 HIS CE1  1 1 
        7  8646 1 1 21 HIS CG   C   8.035 -22.273   6.663 1.00 . A A . 18 HIS CG   1 1 
        7  8647 1 1 21 HIS H    H   5.535 -22.902   2.904 1.00 . A A . 18 HIS H    1 1 
        7  8648 1 1 21 HIS HA   H   6.071 -21.615   4.659 1.00 . A A . 18 HIS HA   1 1 
        7  8649 1 1 21 HIS HB2  H   6.558 -23.566   5.938 1.00 . A A . 18 HIS HB2  1 1 
        7  8650 1 1 21 HIS HB3  H   8.115 -23.735   5.161 1.00 . A A . 18 HIS HB3  1 1 
        7  8651 1 1 21 HIS HD1  H   6.365 -21.277   7.478 1.00 . A A . 18 HIS HD1  1 1 
        7  8652 1 1 21 HIS HD2  H  10.151 -22.760   6.636 1.00 . A A . 18 HIS HD2  1 1 
        7  8653 1 1 21 HIS HE1  H   7.880 -20.289   9.224 1.00 . A A . 18 HIS HE1  1 1 
        7  8654 1 1 21 HIS HE2  H  10.184 -21.144   8.649 1.00 . A A . 18 HIS HE2  1 1 
        7  8655 1 1 21 HIS N    N   6.444 -23.046   3.232 1.00 . A A . 18 HIS N    1 1 
        7  8656 1 1 21 HIS ND1  N   7.327 -21.465   7.524 1.00 . A A . 18 HIS ND1  1 1 
        7  8657 1 1 21 HIS NE2  N   9.366 -21.418   8.176 1.00 . A A . 18 HIS NE2  1 1 
        7  8658 1 1 21 HIS O    O   9.132 -21.522   3.573 1.00 . A A . 18 HIS O    1 1 
        7  8659 1 1 22 VAL C    C   9.454 -18.415   4.261 1.00 . A A . 19 VAL C    1 1 
        7  8660 1 1 22 VAL CA   C   8.443 -18.870   3.145 1.00 . A A . 19 VAL CA   1 1 
        7  8661 1 1 22 VAL CB   C   7.565 -17.682   2.528 1.00 . A A . 19 VAL CB   1 1 
        7  8662 1 1 22 VAL CG1  C   6.919 -18.111   1.206 1.00 . A A . 19 VAL CG1  1 1 
        7  8663 1 1 22 VAL CG2  C   6.475 -17.221   3.489 1.00 . A A . 19 VAL CG2  1 1 
        7  8664 1 1 22 VAL H    H   6.659 -19.677   3.992 1.00 . A A . 19 VAL H    1 1 
        7  8665 1 1 22 VAL HA   H   8.991 -19.323   2.334 1.00 . A A . 19 VAL HA   1 1 
        7  8666 1 1 22 VAL HB   H   8.176 -16.829   2.309 1.00 . A A . 19 VAL HB   1 1 
        7  8667 1 1 22 VAL HG11 H   6.285 -17.314   0.840 1.00 . A A . 19 VAL HG11 1 1 
        7  8668 1 1 22 VAL HG12 H   6.322 -18.995   1.362 1.00 . A A . 19 VAL HG12 1 1 
        7  8669 1 1 22 VAL HG13 H   7.684 -18.317   0.474 1.00 . A A . 19 VAL HG13 1 1 
        7  8670 1 1 22 VAL HG21 H   5.909 -16.411   3.047 1.00 . A A . 19 VAL HG21 1 1 
        7  8671 1 1 22 VAL HG22 H   6.930 -16.876   4.406 1.00 . A A . 19 VAL HG22 1 1 
        7  8672 1 1 22 VAL HG23 H   5.817 -18.046   3.706 1.00 . A A . 19 VAL HG23 1 1 
        7  8673 1 1 22 VAL N    N   7.561 -19.913   3.690 1.00 . A A . 19 VAL N    1 1 
        7  8674 1 1 22 VAL O    O   9.022 -17.959   5.329 1.00 . A A . 19 VAL O    1 1 
        7  8675 1 1 23 SER C    C  12.089 -16.667   4.973 1.00 . A A . 20 SER C    1 1 
        7  8676 1 1 23 SER CA   C  11.825 -18.192   5.050 1.00 . A A . 20 SER CA   1 1 
        7  8677 1 1 23 SER CB   C  13.138 -19.023   4.825 1.00 . A A . 20 SER CB   1 1 
        7  8678 1 1 23 SER H    H  11.115 -19.145   3.273 1.00 . A A . 20 SER H    1 1 
        7  8679 1 1 23 SER HA   H  11.436 -18.427   6.017 1.00 . A A . 20 SER HA   1 1 
        7  8680 1 1 23 SER HB2  H  13.975 -18.384   4.556 1.00 . A A . 20 SER HB2  1 1 
        7  8681 1 1 23 SER HB3  H  13.383 -19.546   5.741 1.00 . A A . 20 SER HB3  1 1 
        7  8682 1 1 23 SER HG   H  13.106 -19.586   2.932 1.00 . A A . 20 SER HG   1 1 
        7  8683 1 1 23 SER N    N  10.802 -18.609   4.049 1.00 . A A . 20 SER N    1 1 
        7  8684 1 1 23 SER O    O  11.822 -16.085   3.926 1.00 . A A . 20 SER O    1 1 
        7  8685 1 1 23 SER OG   O  12.972 -19.994   3.798 1.00 . A A . 20 SER OG   1 1 
        7  8686 1 1 24 SER C    C  13.614 -13.990   4.964 1.00 . A A . 21 SER C    1 1 
        7  8687 1 1 24 SER CA   C  12.797 -14.557   6.144 1.00 . A A . 21 SER CA   1 1 
        7  8688 1 1 24 SER CB   C  13.448 -14.174   7.486 1.00 . A A . 21 SER CB   1 1 
        7  8689 1 1 24 SER H    H  12.687 -16.517   6.943 1.00 . A A . 21 SER H    1 1 
        7  8690 1 1 24 SER HA   H  11.835 -14.099   6.113 1.00 . A A . 21 SER HA   1 1 
        7  8691 1 1 24 SER HB2  H  12.837 -14.547   8.296 1.00 . A A . 21 SER HB2  1 1 
        7  8692 1 1 24 SER HB3  H  14.429 -14.619   7.548 1.00 . A A . 21 SER HB3  1 1 
        7  8693 1 1 24 SER HG   H  12.709 -12.390   7.819 1.00 . A A . 21 SER HG   1 1 
        7  8694 1 1 24 SER N    N  12.565 -16.019   6.094 1.00 . A A . 21 SER N    1 1 
        7  8695 1 1 24 SER O    O  13.215 -12.957   4.419 1.00 . A A . 21 SER O    1 1 
        7  8696 1 1 24 SER OG   O  13.573 -12.773   7.629 1.00 . A A . 21 SER OG   1 1 
        7  8697 1 1 25 ARG C    C  14.613 -14.199   2.029 1.00 . A A . 22 ARG C    1 1 
        7  8698 1 1 25 ARG CA   C  15.477 -14.215   3.361 1.00 . A A . 22 ARG CA   1 1 
        7  8699 1 1 25 ARG CB   C  16.891 -14.910   3.251 1.00 . A A . 22 ARG CB   1 1 
        7  8700 1 1 25 ARG CD   C  17.024 -16.836   1.647 1.00 . A A . 22 ARG CD   1 1 
        7  8701 1 1 25 ARG CG   C  17.376 -15.383   1.877 1.00 . A A . 22 ARG CG   1 1 
        7  8702 1 1 25 ARG CZ   C  18.558 -18.721   2.146 1.00 . A A . 22 ARG CZ   1 1 
        7  8703 1 1 25 ARG H    H  15.143 -15.294   5.202 1.00 . A A . 22 ARG H    1 1 
        7  8704 1 1 25 ARG HA   H  15.700 -13.191   3.559 1.00 . A A . 22 ARG HA   1 1 
        7  8705 1 1 25 ARG HB2  H  17.600 -14.184   3.568 1.00 . A A . 22 ARG HB2  1 1 
        7  8706 1 1 25 ARG HB3  H  16.969 -15.747   3.941 1.00 . A A . 22 ARG HB3  1 1 
        7  8707 1 1 25 ARG HD2  H  16.506 -17.205   2.516 1.00 . A A . 22 ARG HD2  1 1 
        7  8708 1 1 25 ARG HD3  H  16.381 -16.908   0.785 1.00 . A A . 22 ARG HD3  1 1 
        7  8709 1 1 25 ARG HE   H  18.804 -17.373   0.687 1.00 . A A . 22 ARG HE   1 1 
        7  8710 1 1 25 ARG HG2  H  16.938 -14.779   1.101 1.00 . A A . 22 ARG HG2  1 1 
        7  8711 1 1 25 ARG HG3  H  18.451 -15.287   1.838 1.00 . A A . 22 ARG HG3  1 1 
        7  8712 1 1 25 ARG HH11 H  16.965 -18.651   3.409 1.00 . A A . 22 ARG HH11 1 1 
        7  8713 1 1 25 ARG HH12 H  18.069 -19.943   3.699 1.00 . A A . 22 ARG HH12 1 1 
        7  8714 1 1 25 ARG HH21 H  20.233 -19.072   1.066 1.00 . A A . 22 ARG HH21 1 1 
        7  8715 1 1 25 ARG HH22 H  19.944 -20.192   2.355 1.00 . A A . 22 ARG HH22 1 1 
        7  8716 1 1 25 ARG N    N  14.744 -14.629   4.588 1.00 . A A . 22 ARG N    1 1 
        7  8717 1 1 25 ARG NE   N  18.215 -17.647   1.425 1.00 . A A . 22 ARG NE   1 1 
        7  8718 1 1 25 ARG NH1  N  17.802 -19.139   3.169 1.00 . A A . 22 ARG NH1  1 1 
        7  8719 1 1 25 ARG NH2  N  19.667 -19.380   1.832 1.00 . A A . 22 ARG NH2  1 1 
        7  8720 1 1 25 ARG O    O  14.686 -13.192   1.260 1.00 . A A . 22 ARG O    1 1 
        7  8721 1 1 26 ASP C    C  11.813 -14.104   0.667 1.00 . A A . 23 ASP C    1 1 
        7  8722 1 1 26 ASP CA   C  12.871 -15.246   0.577 1.00 . A A . 23 ASP CA   1 1 
        7  8723 1 1 26 ASP CB   C  12.160 -16.628   0.257 1.00 . A A . 23 ASP CB   1 1 
        7  8724 1 1 26 ASP CG   C  13.037 -17.872   0.413 1.00 . A A . 23 ASP CG   1 1 
        7  8725 1 1 26 ASP H    H  13.723 -16.007   2.376 1.00 . A A . 23 ASP H    1 1 
        7  8726 1 1 26 ASP HA   H  13.511 -15.018  -0.263 1.00 . A A . 23 ASP HA   1 1 
        7  8727 1 1 26 ASP HB2  H  11.295 -16.741   0.867 1.00 . A A . 23 ASP HB2  1 1 
        7  8728 1 1 26 ASP HB3  H  11.821 -16.622  -0.789 1.00 . A A . 23 ASP HB3  1 1 
        7  8729 1 1 26 ASP N    N  13.751 -15.243   1.774 1.00 . A A . 23 ASP N    1 1 
        7  8730 1 1 26 ASP O    O  11.553 -13.462  -0.377 1.00 . A A . 23 ASP O    1 1 
        7  8731 1 1 26 ASP OD1  O  14.275 -17.755   0.475 1.00 . A A . 23 ASP OD1  1 1 
        7  8732 1 1 26 ASP OD2  O  12.476 -18.990   0.444 1.00 . A A . 23 ASP OD2  1 1 
        7  8733 1 1 27 VAL C    C  11.002 -11.340   1.758 1.00 . A A . 24 VAL C    1 1 
        7  8734 1 1 27 VAL CA   C  10.297 -12.676   2.041 1.00 . A A . 24 VAL CA   1 1 
        7  8735 1 1 27 VAL CB   C   9.518 -12.592   3.421 1.00 . A A . 24 VAL CB   1 1 
        7  8736 1 1 27 VAL CG1  C   8.190 -11.966   3.204 1.00 . A A . 24 VAL CG1  1 1 
        7  8737 1 1 27 VAL CG2  C   9.270 -13.917   4.148 1.00 . A A . 24 VAL CG2  1 1 
        7  8738 1 1 27 VAL H    H  11.429 -14.323   2.718 1.00 . A A . 24 VAL H    1 1 
        7  8739 1 1 27 VAL HA   H   9.572 -12.786   1.264 1.00 . A A . 24 VAL HA   1 1 
        7  8740 1 1 27 VAL HB   H  10.042 -11.932   4.080 1.00 . A A . 24 VAL HB   1 1 
        7  8741 1 1 27 VAL HG11 H   8.305 -11.039   2.669 1.00 . A A . 24 VAL HG11 1 1 
        7  8742 1 1 27 VAL HG12 H   7.725 -11.777   4.164 1.00 . A A . 24 VAL HG12 1 1 
        7  8743 1 1 27 VAL HG13 H   7.576 -12.645   2.636 1.00 . A A . 24 VAL HG13 1 1 
        7  8744 1 1 27 VAL HG21 H   9.322 -14.750   3.465 1.00 . A A . 24 VAL HG21 1 1 
        7  8745 1 1 27 VAL HG22 H   8.274 -13.874   4.574 1.00 . A A . 24 VAL HG22 1 1 
        7  8746 1 1 27 VAL HG23 H   9.984 -14.047   4.946 1.00 . A A . 24 VAL HG23 1 1 
        7  8747 1 1 27 VAL N    N  11.234 -13.793   1.907 1.00 . A A . 24 VAL N    1 1 
        7  8748 1 1 27 VAL O    O  10.431 -10.521   1.008 1.00 . A A . 24 VAL O    1 1 
        7  8749 1 1 28 GLU C    C  13.237  -9.755   0.519 1.00 . A A . 25 GLU C    1 1 
        7  8750 1 1 28 GLU CA   C  13.021  -9.933   2.023 1.00 . A A . 25 GLU CA   1 1 
        7  8751 1 1 28 GLU CB   C  14.384  -9.896   2.787 1.00 . A A . 25 GLU CB   1 1 
        7  8752 1 1 28 GLU CD   C  14.702  -8.548   4.892 1.00 . A A . 25 GLU CD   1 1 
        7  8753 1 1 28 GLU CG   C  14.768  -8.523   3.378 1.00 . A A . 25 GLU CG   1 1 
        7  8754 1 1 28 GLU H    H  12.629 -11.756   2.912 1.00 . A A . 25 GLU H    1 1 
        7  8755 1 1 28 GLU HA   H  12.413  -9.105   2.359 1.00 . A A . 25 GLU HA   1 1 
        7  8756 1 1 28 GLU HB2  H  14.338 -10.587   3.613 1.00 . A A . 25 GLU HB2  1 1 
        7  8757 1 1 28 GLU HB3  H  15.175 -10.208   2.115 1.00 . A A . 25 GLU HB3  1 1 
        7  8758 1 1 28 GLU HG2  H  15.780  -8.250   3.085 1.00 . A A . 25 GLU HG2  1 1 
        7  8759 1 1 28 GLU HG3  H  14.086  -7.768   3.019 1.00 . A A . 25 GLU HG3  1 1 
        7  8760 1 1 28 GLU N    N  12.250 -11.128   2.302 1.00 . A A . 25 GLU N    1 1 
        7  8761 1 1 28 GLU O    O  12.864  -8.717   0.050 1.00 . A A . 25 GLU O    1 1 
        7  8762 1 1 28 GLU OE1  O  13.586  -8.525   5.440 1.00 . A A . 25 GLU OE1  1 1 
        7  8763 1 1 28 GLU OE2  O  15.776  -8.609   5.532 1.00 . A A . 25 GLU OE2  1 1 
        7  8764 1 1 29 ASN C    C  12.691 -10.496  -2.630 1.00 . A A . 26 ASN C    1 1 
        7  8765 1 1 29 ASN CA   C  13.963 -10.460  -1.722 1.00 . A A . 26 ASN CA   1 1 
        7  8766 1 1 29 ASN CB   C  15.080 -11.323  -2.330 1.00 . A A . 26 ASN CB   1 1 
        7  8767 1 1 29 ASN CG   C  16.346 -10.520  -2.509 1.00 . A A . 26 ASN CG   1 1 
        7  8768 1 1 29 ASN H    H  14.047 -11.588   0.091 1.00 . A A . 26 ASN H    1 1 
        7  8769 1 1 29 ASN HA   H  14.322  -9.453  -1.749 1.00 . A A . 26 ASN HA   1 1 
        7  8770 1 1 29 ASN HB2  H  15.306 -12.160  -1.689 1.00 . A A . 26 ASN HB2  1 1 
        7  8771 1 1 29 ASN HB3  H  14.771 -11.687  -3.300 1.00 . A A . 26 ASN HB3  1 1 
        7  8772 1 1 29 ASN HD21 H  16.829 -11.605  -4.093 1.00 . A A . 26 ASN HD21 1 1 
        7  8773 1 1 29 ASN HD22 H  17.951 -10.367  -3.660 1.00 . A A . 26 ASN HD22 1 1 
        7  8774 1 1 29 ASN N    N  13.757 -10.743  -0.277 1.00 . A A . 26 ASN N    1 1 
        7  8775 1 1 29 ASN ND2  N  17.119 -10.866  -3.522 1.00 . A A . 26 ASN ND2  1 1 
        7  8776 1 1 29 ASN O    O  12.379  -9.447  -3.331 1.00 . A A . 26 ASN O    1 1 
        7  8777 1 1 29 ASN OD1  O  16.622  -9.581  -1.761 1.00 . A A . 26 ASN OD1  1 1 
        7  8778 1 1 30 GLU C    C   9.700 -10.598  -3.079 1.00 . A A . 27 GLU C    1 1 
        7  8779 1 1 30 GLU CA   C  10.713 -11.693  -3.462 1.00 . A A . 27 GLU CA   1 1 
        7  8780 1 1 30 GLU CB   C  10.092 -13.113  -3.474 1.00 . A A . 27 GLU CB   1 1 
        7  8781 1 1 30 GLU CD   C   8.618 -14.875  -4.581 1.00 . A A . 27 GLU CD   1 1 
        7  8782 1 1 30 GLU CG   C   9.214 -13.483  -4.698 1.00 . A A . 27 GLU CG   1 1 
        7  8783 1 1 30 GLU H    H  12.213 -12.457  -2.157 1.00 . A A . 27 GLU H    1 1 
        7  8784 1 1 30 GLU HA   H  11.040 -11.461  -4.465 1.00 . A A . 27 GLU HA   1 1 
        7  8785 1 1 30 GLU HB2  H  10.893 -13.826  -3.428 1.00 . A A . 27 GLU HB2  1 1 
        7  8786 1 1 30 GLU HB3  H   9.484 -13.225  -2.601 1.00 . A A . 27 GLU HB3  1 1 
        7  8787 1 1 30 GLU HG2  H   8.395 -12.782  -4.799 1.00 . A A . 27 GLU HG2  1 1 
        7  8788 1 1 30 GLU HG3  H   9.815 -13.459  -5.599 1.00 . A A . 27 GLU HG3  1 1 
        7  8789 1 1 30 GLU N    N  11.919 -11.629  -2.633 1.00 . A A . 27 GLU N    1 1 
        7  8790 1 1 30 GLU O    O   9.181  -9.974  -3.987 1.00 . A A . 27 GLU O    1 1 
        7  8791 1 1 30 GLU OE1  O   7.592 -15.030  -3.892 1.00 . A A . 27 GLU OE1  1 1 
        7  8792 1 1 30 GLU OE2  O   9.160 -15.815  -5.206 1.00 . A A . 27 GLU OE2  1 1 
        7  8793 1 1 31 PHE C    C   9.294  -7.720  -1.645 1.00 . A A . 28 PHE C    1 1 
        7  8794 1 1 31 PHE CA   C   8.584  -9.121  -1.533 1.00 . A A . 28 PHE CA   1 1 
        7  8795 1 1 31 PHE CB   C   7.705  -9.289  -0.244 1.00 . A A . 28 PHE CB   1 1 
        7  8796 1 1 31 PHE CD1  C   5.340  -9.963  -0.943 1.00 . A A . 28 PHE CD1  1 1 
        7  8797 1 1 31 PHE CD2  C   6.666 -11.619   0.157 1.00 . A A . 28 PHE CD2  1 1 
        7  8798 1 1 31 PHE CE1  C   4.304 -10.868  -1.036 1.00 . A A . 28 PHE CE1  1 1 
        7  8799 1 1 31 PHE CE2  C   5.609 -12.511   0.057 1.00 . A A . 28 PHE CE2  1 1 
        7  8800 1 1 31 PHE CG   C   6.555 -10.312  -0.345 1.00 . A A . 28 PHE CG   1 1 
        7  8801 1 1 31 PHE CZ   C   4.440 -12.136  -0.542 1.00 . A A . 28 PHE CZ   1 1 
        7  8802 1 1 31 PHE H    H   9.875 -10.744  -1.020 1.00 . A A . 28 PHE H    1 1 
        7  8803 1 1 31 PHE HA   H   7.911  -9.148  -2.359 1.00 . A A . 28 PHE HA   1 1 
        7  8804 1 1 31 PHE HB2  H   8.326  -9.588   0.574 1.00 . A A . 28 PHE HB2  1 1 
        7  8805 1 1 31 PHE HB3  H   7.260  -8.330  -0.004 1.00 . A A . 28 PHE HB3  1 1 
        7  8806 1 1 31 PHE HD1  H   5.196  -8.976  -1.326 1.00 . A A . 28 PHE HD1  1 1 
        7  8807 1 1 31 PHE HD2  H   7.579 -11.942   0.651 1.00 . A A . 28 PHE HD2  1 1 
        7  8808 1 1 31 PHE HE1  H   3.390 -10.594  -1.533 1.00 . A A . 28 PHE HE1  1 1 
        7  8809 1 1 31 PHE HE2  H   5.711 -13.511   0.433 1.00 . A A . 28 PHE HE2  1 1 
        7  8810 1 1 31 PHE HZ   H   3.615 -12.831  -0.607 1.00 . A A . 28 PHE HZ   1 1 
        7  8811 1 1 31 PHE N    N   9.467 -10.255  -1.783 1.00 . A A . 28 PHE N    1 1 
        7  8812 1 1 31 PHE O    O   8.579  -6.737  -1.853 1.00 . A A . 28 PHE O    1 1 
        7  8813 1 1 32 ARG C    C  11.229  -5.878  -3.292 1.00 . A A . 29 ARG C    1 1 
        7  8814 1 1 32 ARG CA   C  11.418  -6.307  -1.843 1.00 . A A . 29 ARG CA   1 1 
        7  8815 1 1 32 ARG CB   C  12.957  -6.200  -1.480 1.00 . A A . 29 ARG CB   1 1 
        7  8816 1 1 32 ARG CD   C  14.611  -6.257  -3.529 1.00 . A A . 29 ARG CD   1 1 
        7  8817 1 1 32 ARG CG   C  13.986  -6.998  -2.327 1.00 . A A . 29 ARG CG   1 1 
        7  8818 1 1 32 ARG CZ   C  16.741  -5.109  -4.106 1.00 . A A . 29 ARG CZ   1 1 
        7  8819 1 1 32 ARG H    H  11.163  -8.327  -1.088 1.00 . A A . 29 ARG H    1 1 
        7  8820 1 1 32 ARG HA   H  10.933  -5.552  -1.248 1.00 . A A . 29 ARG HA   1 1 
        7  8821 1 1 32 ARG HB2  H  13.234  -5.162  -1.561 1.00 . A A . 29 ARG HB2  1 1 
        7  8822 1 1 32 ARG HB3  H  13.084  -6.490  -0.437 1.00 . A A . 29 ARG HB3  1 1 
        7  8823 1 1 32 ARG HD2  H  14.665  -6.939  -4.353 1.00 . A A . 29 ARG HD2  1 1 
        7  8824 1 1 32 ARG HD3  H  13.998  -5.401  -3.812 1.00 . A A . 29 ARG HD3  1 1 
        7  8825 1 1 32 ARG HE   H  16.330  -5.989  -2.345 1.00 . A A . 29 ARG HE   1 1 
        7  8826 1 1 32 ARG HG2  H  14.808  -7.283  -1.675 1.00 . A A . 29 ARG HG2  1 1 
        7  8827 1 1 32 ARG HG3  H  13.497  -7.894  -2.690 1.00 . A A . 29 ARG HG3  1 1 
        7  8828 1 1 32 ARG HH11 H  15.374  -5.103  -5.608 1.00 . A A . 29 ARG HH11 1 1 
        7  8829 1 1 32 ARG HH12 H  16.873  -4.315  -5.979 1.00 . A A . 29 ARG HH12 1 1 
        7  8830 1 1 32 ARG HH21 H  18.329  -4.978  -2.842 1.00 . A A . 29 ARG HH21 1 1 
        7  8831 1 1 32 ARG HH22 H  18.565  -4.251  -4.398 1.00 . A A . 29 ARG HH22 1 1 
        7  8832 1 1 32 ARG N    N  10.680  -7.606  -1.510 1.00 . A A . 29 ARG N    1 1 
        7  8833 1 1 32 ARG NE   N  15.968  -5.781  -3.234 1.00 . A A . 29 ARG NE   1 1 
        7  8834 1 1 32 ARG NH1  N  16.295  -4.818  -5.330 1.00 . A A . 29 ARG NH1  1 1 
        7  8835 1 1 32 ARG NH2  N  17.976  -4.750  -3.750 1.00 . A A . 29 ARG NH2  1 1 
        7  8836 1 1 32 ARG O    O  11.321  -4.670  -3.560 1.00 . A A . 29 ARG O    1 1 
        7  8837 1 1 33 LYS C    C   9.157  -5.747  -5.636 1.00 . A A . 30 LYS C    1 1 
        7  8838 1 1 33 LYS CA   C  10.610  -6.231  -5.591 1.00 . A A . 30 LYS CA   1 1 
        7  8839 1 1 33 LYS CB   C  10.898  -7.041  -6.915 1.00 . A A . 30 LYS CB   1 1 
        7  8840 1 1 33 LYS CD   C   9.188  -8.198  -8.484 1.00 . A A . 30 LYS CD   1 1 
        7  8841 1 1 33 LYS CE   C   7.982  -7.232  -8.434 1.00 . A A . 30 LYS CE   1 1 
        7  8842 1 1 33 LYS CG   C  10.049  -8.294  -7.189 1.00 . A A . 30 LYS CG   1 1 
        7  8843 1 1 33 LYS H    H  11.142  -7.778  -4.075 1.00 . A A . 30 LYS H    1 1 
        7  8844 1 1 33 LYS HA   H  11.185  -5.315  -5.642 1.00 . A A . 30 LYS HA   1 1 
        7  8845 1 1 33 LYS HB2  H  10.706  -6.365  -7.734 1.00 . A A . 30 LYS HB2  1 1 
        7  8846 1 1 33 LYS HB3  H  11.947  -7.313  -6.972 1.00 . A A . 30 LYS HB3  1 1 
        7  8847 1 1 33 LYS HD2  H   9.825  -7.876  -9.290 1.00 . A A . 30 LYS HD2  1 1 
        7  8848 1 1 33 LYS HD3  H   8.817  -9.190  -8.708 1.00 . A A . 30 LYS HD3  1 1 
        7  8849 1 1 33 LYS HE2  H   7.247  -7.565  -7.678 1.00 . A A . 30 LYS HE2  1 1 
        7  8850 1 1 33 LYS HE3  H   8.308  -6.230  -8.177 1.00 . A A . 30 LYS HE3  1 1 
        7  8851 1 1 33 LYS HG2  H  10.737  -9.136  -7.302 1.00 . A A . 30 LYS HG2  1 1 
        7  8852 1 1 33 LYS HG3  H   9.396  -8.481  -6.357 1.00 . A A . 30 LYS HG3  1 1 
        7  8853 1 1 33 LYS HZ1  H   6.501  -6.546  -9.735 1.00 . A A . 30 LYS HZ1  1 1 
        7  8854 1 1 33 LYS HZ2  H   6.962  -8.148 -10.002 1.00 . A A . 30 LYS HZ2  1 1 
        7  8855 1 1 33 LYS HZ3  H   7.974  -6.888 -10.500 1.00 . A A . 30 LYS HZ3  1 1 
        7  8856 1 1 33 LYS N    N  11.004  -6.803  -4.255 1.00 . A A . 30 LYS N    1 1 
        7  8857 1 1 33 LYS NZ   N   7.308  -7.199  -9.763 1.00 . A A . 30 LYS NZ   1 1 
        7  8858 1 1 33 LYS O    O   8.882  -4.749  -6.292 1.00 . A A . 30 LYS O    1 1 
        7  8859 1 1 34 TYR C    C   6.275  -4.906  -4.600 1.00 . A A . 31 TYR C    1 1 
        7  8860 1 1 34 TYR CA   C   6.823  -6.225  -5.236 1.00 . A A . 31 TYR CA   1 1 
        7  8861 1 1 34 TYR CB   C   6.058  -7.484  -4.762 1.00 . A A . 31 TYR CB   1 1 
        7  8862 1 1 34 TYR CD1  C   5.132  -8.615  -6.914 1.00 . A A . 31 TYR CD1  1 1 
        7  8863 1 1 34 TYR CD2  C   6.782  -9.790  -5.645 1.00 . A A . 31 TYR CD2  1 1 
        7  8864 1 1 34 TYR CE1  C   5.131  -9.659  -7.842 1.00 . A A . 31 TYR CE1  1 1 
        7  8865 1 1 34 TYR CE2  C   6.752 -10.825  -6.556 1.00 . A A . 31 TYR CE2  1 1 
        7  8866 1 1 34 TYR CG   C   5.976  -8.648  -5.787 1.00 . A A . 31 TYR CG   1 1 
        7  8867 1 1 34 TYR CZ   C   5.943 -10.747  -7.643 1.00 . A A . 31 TYR CZ   1 1 
        7  8868 1 1 34 TYR H    H   8.509  -7.055  -4.274 1.00 . A A . 31 TYR H    1 1 
        7  8869 1 1 34 TYR HA   H   6.740  -6.133  -6.312 1.00 . A A . 31 TYR HA   1 1 
        7  8870 1 1 34 TYR HB2  H   6.578  -7.862  -3.888 1.00 . A A . 31 TYR HB2  1 1 
        7  8871 1 1 34 TYR HB3  H   5.076  -7.212  -4.475 1.00 . A A . 31 TYR HB3  1 1 
        7  8872 1 1 34 TYR HD1  H   4.471  -7.775  -7.076 1.00 . A A . 31 TYR HD1  1 1 
        7  8873 1 1 34 TYR HD2  H   7.418  -9.878  -4.791 1.00 . A A . 31 TYR HD2  1 1 
        7  8874 1 1 34 TYR HE1  H   4.464  -9.642  -8.705 1.00 . A A . 31 TYR HE1  1 1 
        7  8875 1 1 34 TYR HE2  H   7.372 -11.704  -6.407 1.00 . A A . 31 TYR HE2  1 1 
        7  8876 1 1 34 TYR HH   H   5.642 -12.570  -8.186 1.00 . A A . 31 TYR HH   1 1 
        7  8877 1 1 34 TYR N    N   8.240  -6.432  -4.967 1.00 . A A . 31 TYR N    1 1 
        7  8878 1 1 34 TYR O    O   5.571  -4.168  -5.273 1.00 . A A . 31 TYR O    1 1 
        7  8879 1 1 34 TYR OH   O   5.976 -11.748  -8.578 1.00 . A A . 31 TYR OH   1 1 
        7  8880 1 1 35 GLY C    C   8.014  -2.961  -2.146 1.00 . A A . 32 GLY C    1 1 
        7  8881 1 1 35 GLY CA   C   6.707  -3.204  -2.899 1.00 . A A . 32 GLY CA   1 1 
        7  8882 1 1 35 GLY H    H   6.711  -5.290  -2.695 1.00 . A A . 32 GLY H    1 1 
        7  8883 1 1 35 GLY HA2  H   6.671  -2.565  -3.764 1.00 . A A . 32 GLY HA2  1 1 
        7  8884 1 1 35 GLY HA3  H   5.877  -2.985  -2.243 1.00 . A A . 32 GLY HA3  1 1 
        7  8885 1 1 35 GLY N    N   6.624  -4.594  -3.349 1.00 . A A . 32 GLY N    1 1 
        7  8886 1 1 35 GLY O    O   8.825  -3.874  -2.055 1.00 . A A . 32 GLY O    1 1 
        7  8887 1 1 36 ASN C    C   9.322  -2.014   0.620 1.00 . A A . 33 ASN C    1 1 
        7  8888 1 1 36 ASN CA   C   9.506  -1.563  -0.834 1.00 . A A . 33 ASN CA   1 1 
        7  8889 1 1 36 ASN CB   C  10.062  -0.114  -0.865 1.00 . A A . 33 ASN CB   1 1 
        7  8890 1 1 36 ASN CG   C  10.349   0.397  -2.260 1.00 . A A . 33 ASN CG   1 1 
        7  8891 1 1 36 ASN H    H   7.574  -1.038  -1.630 1.00 . A A . 33 ASN H    1 1 
        7  8892 1 1 36 ASN HA   H  10.232  -2.203  -1.307 1.00 . A A . 33 ASN HA   1 1 
        7  8893 1 1 36 ASN HB2  H   9.386   0.567  -0.389 1.00 . A A . 33 ASN HB2  1 1 
        7  8894 1 1 36 ASN HB3  H  10.991  -0.102  -0.316 1.00 . A A . 33 ASN HB3  1 1 
        7  8895 1 1 36 ASN HD21 H   8.540   1.230  -2.368 1.00 . A A . 33 ASN HD21 1 1 
        7  8896 1 1 36 ASN HD22 H   9.554   1.420  -3.757 1.00 . A A . 33 ASN HD22 1 1 
        7  8897 1 1 36 ASN N    N   8.247  -1.762  -1.577 1.00 . A A . 33 ASN N    1 1 
        7  8898 1 1 36 ASN ND2  N   9.388   1.085  -2.858 1.00 . A A . 33 ASN ND2  1 1 
        7  8899 1 1 36 ASN O    O   8.745  -1.274   1.417 1.00 . A A . 33 ASN O    1 1 
        7  8900 1 1 36 ASN OD1  O  11.442   0.203  -2.790 1.00 . A A . 33 ASN OD1  1 1 
        7  8901 1 1 37 ILE C    C  10.585  -3.158   3.369 1.00 . A A . 34 ILE C    1 1 
        7  8902 1 1 37 ILE CA   C   9.583  -3.776   2.349 1.00 . A A . 34 ILE CA   1 1 
        7  8903 1 1 37 ILE CB   C   9.514  -5.368   2.463 1.00 . A A . 34 ILE CB   1 1 
        7  8904 1 1 37 ILE CD1  C  11.628  -6.245   3.785 1.00 . A A . 34 ILE CD1  1 1 
        7  8905 1 1 37 ILE CG1  C  10.118  -5.944   3.775 1.00 . A A . 34 ILE CG1  1 1 
        7  8906 1 1 37 ILE CG2  C  10.141  -6.030   1.271 1.00 . A A . 34 ILE CG2  1 1 
        7  8907 1 1 37 ILE H    H  10.121  -3.836   0.245 1.00 . A A . 34 ILE H    1 1 
        7  8908 1 1 37 ILE HA   H   8.617  -3.421   2.618 1.00 . A A . 34 ILE HA   1 1 
        7  8909 1 1 37 ILE HB   H   8.455  -5.651   2.450 1.00 . A A . 34 ILE HB   1 1 
        7  8910 1 1 37 ILE HD11 H  11.890  -6.789   2.900 1.00 . A A . 34 ILE HD11 1 1 
        7  8911 1 1 37 ILE HD12 H  11.849  -6.849   4.648 1.00 . A A . 34 ILE HD12 1 1 
        7  8912 1 1 37 ILE HD13 H  12.194  -5.325   3.834 1.00 . A A . 34 ILE HD13 1 1 
        7  8913 1 1 37 ILE HG12 H   9.944  -5.228   4.565 1.00 . A A . 34 ILE HG12 1 1 
        7  8914 1 1 37 ILE HG13 H   9.598  -6.858   4.024 1.00 . A A . 34 ILE HG13 1 1 
        7  8915 1 1 37 ILE HG21 H  10.172  -7.101   1.421 1.00 . A A . 34 ILE HG21 1 1 
        7  8916 1 1 37 ILE HG22 H  11.148  -5.659   1.132 1.00 . A A . 34 ILE HG22 1 1 
        7  8917 1 1 37 ILE HG23 H   9.554  -5.815   0.390 1.00 . A A . 34 ILE HG23 1 1 
        7  8918 1 1 37 ILE N    N   9.754  -3.251   0.956 1.00 . A A . 34 ILE N    1 1 
        7  8919 1 1 37 ILE O    O  11.758  -2.929   3.046 1.00 . A A . 34 ILE O    1 1 
        7  8920 1 1 38 LEU C    C  11.190  -3.363   6.767 1.00 . A A . 35 LEU C    1 1 
        7  8921 1 1 38 LEU CA   C  10.911  -2.303   5.668 1.00 . A A . 35 LEU CA   1 1 
        7  8922 1 1 38 LEU CB   C  10.301  -0.980   6.237 1.00 . A A . 35 LEU CB   1 1 
        7  8923 1 1 38 LEU CD1  C  10.139   0.314   4.005 1.00 . A A . 35 LEU CD1  1 1 
        7  8924 1 1 38 LEU CD2  C  10.069   1.527   6.154 1.00 . A A . 35 LEU CD2  1 1 
        7  8925 1 1 38 LEU CG   C  10.636   0.321   5.446 1.00 . A A . 35 LEU CG   1 1 
        7  8926 1 1 38 LEU H    H   9.200  -3.177   4.839 1.00 . A A . 35 LEU H    1 1 
        7  8927 1 1 38 LEU HA   H  11.864  -2.051   5.216 1.00 . A A . 35 LEU HA   1 1 
        7  8928 1 1 38 LEU HB2  H   9.224  -1.070   6.291 1.00 . A A . 35 LEU HB2  1 1 
        7  8929 1 1 38 LEU HB3  H  10.675  -0.852   7.244 1.00 . A A . 35 LEU HB3  1 1 
        7  8930 1 1 38 LEU HD11 H   9.065   0.213   3.985 1.00 . A A . 35 LEU HD11 1 1 
        7  8931 1 1 38 LEU HD12 H  10.589  -0.510   3.469 1.00 . A A . 35 LEU HD12 1 1 
        7  8932 1 1 38 LEU HD13 H  10.422   1.243   3.528 1.00 . A A . 35 LEU HD13 1 1 
        7  8933 1 1 38 LEU HD21 H   8.997   1.424   6.240 1.00 . A A . 35 LEU HD21 1 1 
        7  8934 1 1 38 LEU HD22 H  10.300   2.411   5.580 1.00 . A A . 35 LEU HD22 1 1 
        7  8935 1 1 38 LEU HD23 H  10.505   1.605   7.136 1.00 . A A . 35 LEU HD23 1 1 
        7  8936 1 1 38 LEU HG   H  11.704   0.439   5.415 1.00 . A A . 35 LEU HG   1 1 
        7  8937 1 1 38 LEU N    N  10.094  -2.881   4.604 1.00 . A A . 35 LEU N    1 1 
        7  8938 1 1 38 LEU O    O  12.195  -3.267   7.484 1.00 . A A . 35 LEU O    1 1 
        7  8939 1 1 39 LYS C    C   9.594  -6.716   7.528 1.00 . A A . 36 LYS C    1 1 
        7  8940 1 1 39 LYS CA   C  10.301  -5.378   7.981 1.00 . A A . 36 LYS CA   1 1 
        7  8941 1 1 39 LYS CB   C   9.557  -4.707   9.162 1.00 . A A . 36 LYS CB   1 1 
        7  8942 1 1 39 LYS CD   C   8.918  -6.391  10.962 1.00 . A A . 36 LYS CD   1 1 
        7  8943 1 1 39 LYS CE   C   8.509  -6.327  12.434 1.00 . A A . 36 LYS CE   1 1 
        7  8944 1 1 39 LYS CG   C   9.834  -5.232  10.573 1.00 . A A . 36 LYS CG   1 1 
        7  8945 1 1 39 LYS H    H   9.623  -4.488   6.169 1.00 . A A . 36 LYS H    1 1 
        7  8946 1 1 39 LYS HA   H  11.323  -5.570   8.272 1.00 . A A . 36 LYS HA   1 1 
        7  8947 1 1 39 LYS HB2  H   9.813  -3.660   9.159 1.00 . A A . 36 LYS HB2  1 1 
        7  8948 1 1 39 LYS HB3  H   8.493  -4.793   8.986 1.00 . A A . 36 LYS HB3  1 1 
        7  8949 1 1 39 LYS HD2  H   8.026  -6.357  10.360 1.00 . A A . 36 LYS HD2  1 1 
        7  8950 1 1 39 LYS HD3  H   9.445  -7.314  10.787 1.00 . A A . 36 LYS HD3  1 1 
        7  8951 1 1 39 LYS HE2  H   7.919  -7.202  12.676 1.00 . A A . 36 LYS HE2  1 1 
        7  8952 1 1 39 LYS HE3  H   9.399  -6.318  13.044 1.00 . A A . 36 LYS HE3  1 1 
        7  8953 1 1 39 LYS HG2  H  10.861  -5.565  10.623 1.00 . A A . 36 LYS HG2  1 1 
        7  8954 1 1 39 LYS HG3  H   9.692  -4.423  11.274 1.00 . A A . 36 LYS HG3  1 1 
        7  8955 1 1 39 LYS HZ1  H   6.949  -4.985  12.007 1.00 . A A . 36 LYS HZ1  1 1 
        7  8956 1 1 39 LYS HZ2  H   8.309  -4.264  12.714 1.00 . A A . 36 LYS HZ2  1 1 
        7  8957 1 1 39 LYS HZ3  H   7.259  -5.187  13.661 1.00 . A A . 36 LYS HZ3  1 1 
        7  8958 1 1 39 LYS N    N  10.300  -4.388   6.869 1.00 . A A . 36 LYS N    1 1 
        7  8959 1 1 39 LYS NZ   N   7.703  -5.106  12.726 1.00 . A A . 36 LYS NZ   1 1 
        7  8960 1 1 39 LYS O    O   8.574  -6.653   6.842 1.00 . A A . 36 LYS O    1 1 
        7  8961 1 1 40 CYS C    C   9.587 -10.127   8.771 1.00 . A A . 37 CYS C    1 1 
        7  8962 1 1 40 CYS CA   C   9.488  -9.237   7.557 1.00 . A A . 37 CYS CA   1 1 
        7  8963 1 1 40 CYS CB   C  10.191 -10.014   6.397 1.00 . A A . 37 CYS CB   1 1 
        7  8964 1 1 40 CYS H    H  10.927  -7.930   8.493 1.00 . A A . 37 CYS H    1 1 
        7  8965 1 1 40 CYS HA   H   8.438  -9.081   7.313 1.00 . A A . 37 CYS HA   1 1 
        7  8966 1 1 40 CYS HB2  H  11.172 -10.336   6.713 1.00 . A A . 37 CYS HB2  1 1 
        7  8967 1 1 40 CYS HB3  H   9.633 -10.909   6.177 1.00 . A A . 37 CYS HB3  1 1 
        7  8968 1 1 40 CYS HG   H  11.267  -9.774   4.122 1.00 . A A . 37 CYS HG   1 1 
        7  8969 1 1 40 CYS N    N  10.125  -7.917   7.906 1.00 . A A . 37 CYS N    1 1 
        7  8970 1 1 40 CYS O    O  10.700 -10.505   9.154 1.00 . A A . 37 CYS O    1 1 
        7  8971 1 1 40 CYS SG   S  10.352  -9.139   4.843 1.00 . A A . 37 CYS SG   1 1 
        7  8972 1 1 41 ASP C    C   7.849 -12.712  10.297 1.00 . A A . 38 ASP C    1 1 
        7  8973 1 1 41 ASP CA   C   8.624 -11.413  10.543 1.00 . A A . 38 ASP CA   1 1 
        7  8974 1 1 41 ASP CB   C   8.204 -10.782  11.861 1.00 . A A . 38 ASP CB   1 1 
        7  8975 1 1 41 ASP CG   C   9.004 -11.319  13.031 1.00 . A A . 38 ASP CG   1 1 
        7  8976 1 1 41 ASP H    H   7.580 -10.045   9.163 1.00 . A A . 38 ASP H    1 1 
        7  8977 1 1 41 ASP HA   H   9.687 -11.659  10.616 1.00 . A A . 38 ASP HA   1 1 
        7  8978 1 1 41 ASP HB2  H   8.368  -9.710  11.809 1.00 . A A . 38 ASP HB2  1 1 
        7  8979 1 1 41 ASP HB3  H   7.153 -11.006  12.033 1.00 . A A . 38 ASP HB3  1 1 
        7  8980 1 1 41 ASP N    N   8.475 -10.461   9.413 1.00 . A A . 38 ASP N    1 1 
        7  8981 1 1 41 ASP O    O   6.731 -12.687   9.811 1.00 . A A . 38 ASP O    1 1 
        7  8982 1 1 41 ASP OD1  O   8.619 -12.356  13.596 1.00 . A A . 38 ASP OD1  1 1 
        7  8983 1 1 41 ASP OD2  O  10.019 -10.692  13.391 1.00 . A A . 38 ASP OD2  1 1 
        7  8984 1 1 42 VAL C    C   7.789 -15.914  11.732 1.00 . A A . 39 VAL C    1 1 
        7  8985 1 1 42 VAL CA   C   7.819 -15.152  10.406 1.00 . A A . 39 VAL CA   1 1 
        7  8986 1 1 42 VAL CB   C   8.464 -15.966   9.164 1.00 . A A . 39 VAL CB   1 1 
        7  8987 1 1 42 VAL CG1  C   9.971 -15.776   9.091 1.00 . A A . 39 VAL CG1  1 1 
        7  8988 1 1 42 VAL CG2  C   8.232 -17.501   9.130 1.00 . A A . 39 VAL CG2  1 1 
        7  8989 1 1 42 VAL H    H   9.307 -13.824  11.072 1.00 . A A . 39 VAL H    1 1 
        7  8990 1 1 42 VAL HA   H   6.792 -14.891  10.186 1.00 . A A . 39 VAL HA   1 1 
        7  8991 1 1 42 VAL HB   H   8.050 -15.554   8.246 1.00 . A A . 39 VAL HB   1 1 
        7  8992 1 1 42 VAL HG11 H  10.360 -16.430   8.335 1.00 . A A . 39 VAL HG11 1 1 
        7  8993 1 1 42 VAL HG12 H  10.418 -16.024  10.042 1.00 . A A . 39 VAL HG12 1 1 
        7  8994 1 1 42 VAL HG13 H  10.196 -14.754   8.832 1.00 . A A . 39 VAL HG13 1 1 
        7  8995 1 1 42 VAL HG21 H   8.585 -17.887   8.178 1.00 . A A . 39 VAL HG21 1 1 
        7  8996 1 1 42 VAL HG22 H   7.197 -17.762   9.243 1.00 . A A . 39 VAL HG22 1 1 
        7  8997 1 1 42 VAL HG23 H   8.810 -17.979   9.909 1.00 . A A . 39 VAL HG23 1 1 
        7  8998 1 1 42 VAL N    N   8.462 -13.857  10.609 1.00 . A A . 39 VAL N    1 1 
        7  8999 1 1 42 VAL O    O   8.819 -16.322  12.272 1.00 . A A . 39 VAL O    1 1 
        7  9000 1 1 43 LYS C    C   5.591 -17.986  13.460 1.00 . A A . 40 LYS C    1 1 
        7  9001 1 1 43 LYS CA   C   6.358 -16.634  13.583 1.00 . A A . 40 LYS CA   1 1 
        7  9002 1 1 43 LYS CB   C   5.576 -15.561  14.377 1.00 . A A . 40 LYS CB   1 1 
        7  9003 1 1 43 LYS CD   C   6.173 -13.857  16.149 1.00 . A A . 40 LYS CD   1 1 
        7  9004 1 1 43 LYS CE   C   6.542 -12.392  16.373 1.00 . A A . 40 LYS CE   1 1 
        7  9005 1 1 43 LYS CG   C   6.397 -14.310  14.704 1.00 . A A . 40 LYS CG   1 1 
        7  9006 1 1 43 LYS H    H   5.789 -15.786  11.737 1.00 . A A . 40 LYS H    1 1 
        7  9007 1 1 43 LYS HA   H   7.326 -16.794  14.041 1.00 . A A . 40 LYS HA   1 1 
        7  9008 1 1 43 LYS HB2  H   4.736 -15.228  13.760 1.00 . A A . 40 LYS HB2  1 1 
        7  9009 1 1 43 LYS HB3  H   5.208 -15.974  15.300 1.00 . A A . 40 LYS HB3  1 1 
        7  9010 1 1 43 LYS HD2  H   5.130 -13.987  16.384 1.00 . A A . 40 LYS HD2  1 1 
        7  9011 1 1 43 LYS HD3  H   6.770 -14.461  16.820 1.00 . A A . 40 LYS HD3  1 1 
        7  9012 1 1 43 LYS HE2  H   7.468 -12.164  15.859 1.00 . A A . 40 LYS HE2  1 1 
        7  9013 1 1 43 LYS HE3  H   5.747 -11.770  15.980 1.00 . A A . 40 LYS HE3  1 1 
        7  9014 1 1 43 LYS HG2  H   7.452 -14.526  14.542 1.00 . A A . 40 LYS HG2  1 1 
        7  9015 1 1 43 LYS HG3  H   6.103 -13.509  14.037 1.00 . A A . 40 LYS HG3  1 1 
        7  9016 1 1 43 LYS HZ1  H   5.853 -12.389  18.348 1.00 . A A . 40 LYS HZ1  1 1 
        7  9017 1 1 43 LYS HZ2  H   6.853 -11.082  17.963 1.00 . A A . 40 LYS HZ2  1 1 
        7  9018 1 1 43 LYS HZ3  H   7.527 -12.615  18.200 1.00 . A A . 40 LYS HZ3  1 1 
        7  9019 1 1 43 LYS N    N   6.578 -16.079  12.254 1.00 . A A . 40 LYS N    1 1 
        7  9020 1 1 43 LYS NZ   N   6.704 -12.099  17.821 1.00 . A A . 40 LYS NZ   1 1 
        7  9021 1 1 43 LYS O    O   4.862 -18.160  12.481 1.00 . A A . 40 LYS O    1 1 
        7  9022 1 1 44 LYS C    C   4.245 -20.679  15.419 1.00 . A A . 41 LYS C    1 1 
        7  9023 1 1 44 LYS CA   C   5.112 -20.296  14.174 1.00 . A A . 41 LYS CA   1 1 
        7  9024 1 1 44 LYS CB   C   6.200 -21.422  13.771 1.00 . A A . 41 LYS CB   1 1 
        7  9025 1 1 44 LYS CD   C   7.537 -21.343  15.969 1.00 . A A . 41 LYS CD   1 1 
        7  9026 1 1 44 LYS CE   C   8.617 -20.440  15.373 1.00 . A A . 41 LYS CE   1 1 
        7  9027 1 1 44 LYS CG   C   6.853 -22.228  14.924 1.00 . A A . 41 LYS CG   1 1 
        7  9028 1 1 44 LYS H    H   6.153 -18.771  15.301 1.00 . A A . 41 LYS H    1 1 
        7  9029 1 1 44 LYS HA   H   4.455 -20.139  13.346 1.00 . A A . 41 LYS HA   1 1 
        7  9030 1 1 44 LYS HB2  H   5.739 -22.138  13.111 1.00 . A A . 41 LYS HB2  1 1 
        7  9031 1 1 44 LYS HB3  H   7.018 -20.967  13.211 1.00 . A A . 41 LYS HB3  1 1 
        7  9032 1 1 44 LYS HD2  H   6.769 -20.713  16.402 1.00 . A A . 41 LYS HD2  1 1 
        7  9033 1 1 44 LYS HD3  H   7.968 -21.967  16.735 1.00 . A A . 41 LYS HD3  1 1 
        7  9034 1 1 44 LYS HE2  H   9.086 -20.951  14.552 1.00 . A A . 41 LYS HE2  1 1 
        7  9035 1 1 44 LYS HE3  H   8.137 -19.533  15.009 1.00 . A A . 41 LYS HE3  1 1 
        7  9036 1 1 44 LYS HG2  H   6.089 -22.818  15.418 1.00 . A A . 41 LYS HG2  1 1 
        7  9037 1 1 44 LYS HG3  H   7.592 -22.906  14.506 1.00 . A A . 41 LYS HG3  1 1 
        7  9038 1 1 44 LYS HZ1  H  10.339 -19.415  15.935 1.00 . A A . 41 LYS HZ1  1 1 
        7  9039 1 1 44 LYS HZ2  H  10.152 -20.908  16.702 1.00 . A A . 41 LYS HZ2  1 1 
        7  9040 1 1 44 LYS HZ3  H   9.213 -19.585  17.187 1.00 . A A . 41 LYS HZ3  1 1 
        7  9041 1 1 44 LYS N    N   5.729 -18.963  14.410 1.00 . A A . 41 LYS N    1 1 
        7  9042 1 1 44 LYS NZ   N   9.649 -20.060  16.370 1.00 . A A . 41 LYS NZ   1 1 
        7  9043 1 1 44 LYS O    O   4.588 -20.253  16.525 1.00 . A A . 41 LYS O    1 1 
        7  9044 1 1 45 THR C    C   2.666 -23.348  16.772 1.00 . A A . 42 THR C    1 1 
        7  9045 1 1 45 THR CA   C   2.365 -21.846  16.460 1.00 . A A . 42 THR CA   1 1 
        7  9046 1 1 45 THR CB   C   0.817 -21.578  16.352 1.00 . A A . 42 THR CB   1 1 
        7  9047 1 1 45 THR CG2  C   0.085 -22.555  15.416 1.00 . A A . 42 THR CG2  1 1 
        7  9048 1 1 45 THR H    H   2.731 -21.605  14.390 1.00 . A A . 42 THR H    1 1 
        7  9049 1 1 45 THR HA   H   2.765 -21.232  17.268 1.00 . A A . 42 THR HA   1 1 
        7  9050 1 1 45 THR HB   H   0.674 -20.582  15.970 1.00 . A A . 42 THR HB   1 1 
        7  9051 1 1 45 THR HG1  H  -0.514 -21.005  17.692 1.00 . A A . 42 THR HG1  1 1 
        7  9052 1 1 45 THR HG21 H   0.528 -23.532  15.495 1.00 . A A . 42 THR HG21 1 1 
        7  9053 1 1 45 THR HG22 H   0.134 -22.215  14.394 1.00 . A A . 42 THR HG22 1 1 
        7  9054 1 1 45 THR HG23 H  -0.953 -22.617  15.718 1.00 . A A . 42 THR HG23 1 1 
        7  9055 1 1 45 THR N    N   3.099 -21.403  15.273 1.00 . A A . 42 THR N    1 1 
        7  9056 1 1 45 THR O    O   3.360 -24.008  15.994 1.00 . A A . 42 THR O    1 1 
        7  9057 1 1 45 THR OG1  O   0.205 -21.648  17.648 1.00 . A A . 42 THR OG1  1 1 
        7  9058 1 1 46 VAL C    C   1.578 -26.331  17.588 1.00 . A A . 43 VAL C    1 1 
        7  9059 1 1 46 VAL CA   C   2.405 -25.266  18.370 1.00 . A A . 43 VAL CA   1 1 
        7  9060 1 1 46 VAL CB   C   2.196 -25.425  19.935 1.00 . A A . 43 VAL CB   1 1 
        7  9061 1 1 46 VAL CG1  C   3.091 -26.527  20.492 1.00 . A A . 43 VAL CG1  1 1 
        7  9062 1 1 46 VAL CG2  C   2.449 -24.115  20.708 1.00 . A A . 43 VAL CG2  1 1 
        7  9063 1 1 46 VAL H    H   1.508 -23.336  18.441 1.00 . A A . 43 VAL H    1 1 
        7  9064 1 1 46 VAL HA   H   3.450 -25.467  18.155 1.00 . A A . 43 VAL HA   1 1 
        7  9065 1 1 46 VAL HB   H   1.172 -25.728  20.122 1.00 . A A . 43 VAL HB   1 1 
        7  9066 1 1 46 VAL HG11 H   4.123 -26.277  20.310 1.00 . A A . 43 VAL HG11 1 1 
        7  9067 1 1 46 VAL HG12 H   2.853 -27.463  20.002 1.00 . A A . 43 VAL HG12 1 1 
        7  9068 1 1 46 VAL HG13 H   2.923 -26.623  21.553 1.00 . A A . 43 VAL HG13 1 1 
        7  9069 1 1 46 VAL HG21 H   2.319 -24.294  21.765 1.00 . A A . 43 VAL HG21 1 1 
        7  9070 1 1 46 VAL HG22 H   1.746 -23.357  20.390 1.00 . A A . 43 VAL HG22 1 1 
        7  9071 1 1 46 VAL HG23 H   3.457 -23.766  20.527 1.00 . A A . 43 VAL HG23 1 1 
        7  9072 1 1 46 VAL N    N   2.130 -23.882  17.905 1.00 . A A . 43 VAL N    1 1 
        7  9073 1 1 46 VAL O    O   1.825 -27.536  17.713 1.00 . A A . 43 VAL O    1 1 
        7  9074 1 1 47 SER C    C   0.326 -27.175  14.665 1.00 . A A . 44 SER C    1 1 
        7  9075 1 1 47 SER CA   C  -0.289 -26.771  16.026 1.00 . A A . 44 SER CA   1 1 
        7  9076 1 1 47 SER CB   C  -1.654 -26.060  15.813 1.00 . A A . 44 SER CB   1 1 
        7  9077 1 1 47 SER H    H   0.567 -24.925  16.582 1.00 . A A . 44 SER H    1 1 
        7  9078 1 1 47 SER HA   H  -0.432 -27.666  16.617 1.00 . A A . 44 SER HA   1 1 
        7  9079 1 1 47 SER HB2  H  -1.945 -25.532  16.716 1.00 . A A . 44 SER HB2  1 1 
        7  9080 1 1 47 SER HB3  H  -1.558 -25.344  15.007 1.00 . A A . 44 SER HB3  1 1 
        7  9081 1 1 47 SER HG   H  -3.110 -27.286  16.276 1.00 . A A . 44 SER HG   1 1 
        7  9082 1 1 47 SER N    N   0.625 -25.879  16.753 1.00 . A A . 44 SER N    1 1 
        7  9083 1 1 47 SER O    O  -0.304 -27.870  13.864 1.00 . A A . 44 SER O    1 1 
        7  9084 1 1 47 SER OG   O  -2.688 -26.969  15.471 1.00 . A A . 44 SER OG   1 1 
        7  9085 1 1 48 GLY C    C   1.902 -26.073  12.010 1.00 . A A . 45 GLY C    1 1 
        7  9086 1 1 48 GLY CA   C   2.257 -27.028  13.157 1.00 . A A . 45 GLY CA   1 1 
        7  9087 1 1 48 GLY H    H   2.077 -26.291  15.150 1.00 . A A . 45 GLY H    1 1 
        7  9088 1 1 48 GLY HA2  H   3.323 -26.978  13.322 1.00 . A A . 45 GLY HA2  1 1 
        7  9089 1 1 48 GLY HA3  H   2.006 -28.036  12.855 1.00 . A A . 45 GLY HA3  1 1 
        7  9090 1 1 48 GLY N    N   1.580 -26.748  14.425 1.00 . A A . 45 GLY N    1 1 
        7  9091 1 1 48 GLY O    O   2.518 -26.142  10.945 1.00 . A A . 45 GLY O    1 1 
        7  9092 1 1 49 ALA C    C   1.631 -22.967  11.394 1.00 . A A . 46 ALA C    1 1 
        7  9093 1 1 49 ALA CA   C   0.609 -24.131  11.248 1.00 . A A . 46 ALA CA   1 1 
        7  9094 1 1 49 ALA CB   C  -0.859 -23.668  11.425 1.00 . A A . 46 ALA CB   1 1 
        7  9095 1 1 49 ALA H    H   0.368 -25.276  13.007 1.00 . A A . 46 ALA H    1 1 
        7  9096 1 1 49 ALA HA   H   0.698 -24.566  10.257 1.00 . A A . 46 ALA HA   1 1 
        7  9097 1 1 49 ALA HB1  H  -1.040 -23.347  12.441 1.00 . A A . 46 ALA HB1  1 1 
        7  9098 1 1 49 ALA HB2  H  -1.523 -24.490  11.193 1.00 . A A . 46 ALA HB2  1 1 
        7  9099 1 1 49 ALA HB3  H  -1.074 -22.854  10.755 1.00 . A A . 46 ALA HB3  1 1 
        7  9100 1 1 49 ALA N    N   0.920 -25.186  12.215 1.00 . A A . 46 ALA N    1 1 
        7  9101 1 1 49 ALA O    O   1.889 -22.497  12.506 1.00 . A A . 46 ALA O    1 1 
        7  9102 1 1 50 ALA C    C   2.820 -20.237   9.595 1.00 . A A . 47 ALA C    1 1 
        7  9103 1 1 50 ALA CA   C   3.300 -21.514  10.297 1.00 . A A . 47 ALA CA   1 1 
        7  9104 1 1 50 ALA CB   C   4.609 -22.074   9.677 1.00 . A A . 47 ALA CB   1 1 
        7  9105 1 1 50 ALA H    H   1.871 -22.809   9.408 1.00 . A A . 47 ALA H    1 1 
        7  9106 1 1 50 ALA HA   H   3.499 -21.291  11.324 1.00 . A A . 47 ALA HA   1 1 
        7  9107 1 1 50 ALA HB1  H   5.452 -21.515  10.048 1.00 . A A . 47 ALA HB1  1 1 
        7  9108 1 1 50 ALA HB2  H   4.590 -21.991   8.596 1.00 . A A . 47 ALA HB2  1 1 
        7  9109 1 1 50 ALA HB3  H   4.738 -23.115   9.954 1.00 . A A . 47 ALA HB3  1 1 
        7  9110 1 1 50 ALA N    N   2.216 -22.513  10.273 1.00 . A A . 47 ALA N    1 1 
        7  9111 1 1 50 ALA O    O   2.042 -20.342   8.640 1.00 . A A . 47 ALA O    1 1 
        7  9112 1 1 51 PHE C    C   3.774 -16.842   8.976 1.00 . A A . 48 PHE C    1 1 
        7  9113 1 1 51 PHE CA   C   2.679 -17.802   9.460 1.00 . A A . 48 PHE CA   1 1 
        7  9114 1 1 51 PHE CB   C   1.908 -17.054  10.567 1.00 . A A . 48 PHE CB   1 1 
        7  9115 1 1 51 PHE CD1  C  -0.242 -18.251  10.937 1.00 . A A . 48 PHE CD1  1 1 
        7  9116 1 1 51 PHE CD2  C   1.426 -18.382  12.623 1.00 . A A . 48 PHE CD2  1 1 
        7  9117 1 1 51 PHE CE1  C  -1.063 -19.051  11.684 1.00 . A A . 48 PHE CE1  1 1 
        7  9118 1 1 51 PHE CE2  C   0.620 -19.172  13.373 1.00 . A A . 48 PHE CE2  1 1 
        7  9119 1 1 51 PHE CG   C   1.013 -17.915  11.391 1.00 . A A . 48 PHE CG   1 1 
        7  9120 1 1 51 PHE CZ   C  -0.637 -19.517  12.912 1.00 . A A . 48 PHE CZ   1 1 
        7  9121 1 1 51 PHE H    H   3.832 -18.938  10.849 1.00 . A A . 48 PHE H    1 1 
        7  9122 1 1 51 PHE HA   H   1.998 -18.077   8.665 1.00 . A A . 48 PHE HA   1 1 
        7  9123 1 1 51 PHE HB2  H   2.618 -16.597  11.238 1.00 . A A . 48 PHE HB2  1 1 
        7  9124 1 1 51 PHE HB3  H   1.298 -16.282  10.121 1.00 . A A . 48 PHE HB3  1 1 
        7  9125 1 1 51 PHE HD1  H  -0.573 -17.883   9.981 1.00 . A A . 48 PHE HD1  1 1 
        7  9126 1 1 51 PHE HD2  H   2.411 -18.145  12.991 1.00 . A A . 48 PHE HD2  1 1 
        7  9127 1 1 51 PHE HE1  H  -2.029 -19.314  11.303 1.00 . A A . 48 PHE HE1  1 1 
        7  9128 1 1 51 PHE HE2  H   0.969 -19.505  14.322 1.00 . A A . 48 PHE HE2  1 1 
        7  9129 1 1 51 PHE HZ   H  -1.277 -20.150  13.511 1.00 . A A . 48 PHE HZ   1 1 
        7  9130 1 1 51 PHE N    N   3.252 -19.025  10.035 1.00 . A A . 48 PHE N    1 1 
        7  9131 1 1 51 PHE O    O   4.863 -16.817   9.555 1.00 . A A . 48 PHE O    1 1 
        7  9132 1 1 52 ALA C    C   3.693 -13.602   7.483 1.00 . A A . 49 ALA C    1 1 
        7  9133 1 1 52 ALA CA   C   4.395 -14.952   7.538 1.00 . A A . 49 ALA CA   1 1 
        7  9134 1 1 52 ALA CB   C   5.223 -15.247   6.271 1.00 . A A . 49 ALA CB   1 1 
        7  9135 1 1 52 ALA H    H   2.688 -16.240   7.371 1.00 . A A . 49 ALA H    1 1 
        7  9136 1 1 52 ALA HA   H   5.075 -14.863   8.335 1.00 . A A . 49 ALA HA   1 1 
        7  9137 1 1 52 ALA HB1  H   5.333 -16.313   6.142 1.00 . A A . 49 ALA HB1  1 1 
        7  9138 1 1 52 ALA HB2  H   6.223 -14.817   6.376 1.00 . A A . 49 ALA HB2  1 1 
        7  9139 1 1 52 ALA HB3  H   4.740 -14.830   5.400 1.00 . A A . 49 ALA HB3  1 1 
        7  9140 1 1 52 ALA N    N   3.496 -16.058   7.913 1.00 . A A . 49 ALA N    1 1 
        7  9141 1 1 52 ALA O    O   2.514 -13.502   7.144 1.00 . A A . 49 ALA O    1 1 
        7  9142 1 1 53 PHE C    C   4.783 -10.267   7.400 1.00 . A A . 50 PHE C    1 1 
        7  9143 1 1 53 PHE CA   C   3.908 -11.270   8.159 1.00 . A A . 50 PHE CA   1 1 
        7  9144 1 1 53 PHE CB   C   4.018 -11.053   9.691 1.00 . A A . 50 PHE CB   1 1 
        7  9145 1 1 53 PHE CD1  C   2.033  -9.469   9.614 1.00 . A A . 50 PHE CD1  1 1 
        7  9146 1 1 53 PHE CD2  C   2.740 -10.350  11.713 1.00 . A A . 50 PHE CD2  1 1 
        7  9147 1 1 53 PHE CE1  C   1.025  -8.772  10.250 1.00 . A A . 50 PHE CE1  1 1 
        7  9148 1 1 53 PHE CE2  C   1.735  -9.651  12.350 1.00 . A A . 50 PHE CE2  1 1 
        7  9149 1 1 53 PHE CG   C   2.908 -10.267  10.340 1.00 . A A . 50 PHE CG   1 1 
        7  9150 1 1 53 PHE CZ   C   0.875  -8.864  11.618 1.00 . A A . 50 PHE CZ   1 1 
        7  9151 1 1 53 PHE H    H   5.419 -12.649   7.811 1.00 . A A . 50 PHE H    1 1 
        7  9152 1 1 53 PHE HA   H   2.877 -11.243   7.846 1.00 . A A . 50 PHE HA   1 1 
        7  9153 1 1 53 PHE HB2  H   4.036 -12.024  10.174 1.00 . A A . 50 PHE HB2  1 1 
        7  9154 1 1 53 PHE HB3  H   4.962 -10.550   9.911 1.00 . A A . 50 PHE HB3  1 1 
        7  9155 1 1 53 PHE HD1  H   2.148  -9.391   8.543 1.00 . A A . 50 PHE HD1  1 1 
        7  9156 1 1 53 PHE HD2  H   3.411 -10.966  12.291 1.00 . A A . 50 PHE HD2  1 1 
        7  9157 1 1 53 PHE HE1  H   0.352  -8.152   9.676 1.00 . A A . 50 PHE HE1  1 1 
        7  9158 1 1 53 PHE HE2  H   1.622  -9.724  13.422 1.00 . A A . 50 PHE HE2  1 1 
        7  9159 1 1 53 PHE HZ   H   0.086  -8.320  12.114 1.00 . A A . 50 PHE HZ   1 1 
        7  9160 1 1 53 PHE N    N   4.447 -12.566   7.848 1.00 . A A . 50 PHE N    1 1 
        7  9161 1 1 53 PHE O    O   5.999 -10.146   7.735 1.00 . A A . 50 PHE O    1 1 
        7  9162 1 1 54 ILE C    C   4.804  -7.246   5.568 1.00 . A A . 51 ILE C    1 1 
        7  9163 1 1 54 ILE CA   C   5.124  -8.730   5.505 1.00 . A A . 51 ILE CA   1 1 
        7  9164 1 1 54 ILE CB   C   5.119  -9.160   3.984 1.00 . A A . 51 ILE CB   1 1 
        7  9165 1 1 54 ILE CD1  C   3.658 -11.333   3.809 1.00 . A A . 51 ILE CD1  1 1 
        7  9166 1 1 54 ILE CG1  C   5.043 -10.701   3.775 1.00 . A A . 51 ILE CG1  1 1 
        7  9167 1 1 54 ILE CG2  C   6.394  -8.648   3.320 1.00 . A A . 51 ILE CG2  1 1 
        7  9168 1 1 54 ILE H    H   3.223  -9.511   6.293 1.00 . A A . 51 ILE H    1 1 
        7  9169 1 1 54 ILE HA   H   6.137  -8.853   5.871 1.00 . A A . 51 ILE HA   1 1 
        7  9170 1 1 54 ILE HB   H   4.304  -8.671   3.474 1.00 . A A . 51 ILE HB   1 1 
        7  9171 1 1 54 ILE HD11 H   3.103 -11.036   2.934 1.00 . A A . 51 ILE HD11 1 1 
        7  9172 1 1 54 ILE HD12 H   3.122 -11.021   4.699 1.00 . A A . 51 ILE HD12 1 1 
        7  9173 1 1 54 ILE HD13 H   3.757 -12.406   3.815 1.00 . A A . 51 ILE HD13 1 1 
        7  9174 1 1 54 ILE HG12 H   5.468 -10.940   2.818 1.00 . A A . 51 ILE HG12 1 1 
        7  9175 1 1 54 ILE HG13 H   5.644 -11.176   4.529 1.00 . A A . 51 ILE HG13 1 1 
        7  9176 1 1 54 ILE HG21 H   6.393  -8.917   2.274 1.00 . A A . 51 ILE HG21 1 1 
        7  9177 1 1 54 ILE HG22 H   7.250  -9.094   3.802 1.00 . A A . 51 ILE HG22 1 1 
        7  9178 1 1 54 ILE HG23 H   6.449  -7.571   3.416 1.00 . A A . 51 ILE HG23 1 1 
        7  9179 1 1 54 ILE N    N   4.218  -9.527   6.411 1.00 . A A . 51 ILE N    1 1 
        7  9180 1 1 54 ILE O    O   3.808  -6.803   5.014 1.00 . A A . 51 ILE O    1 1 
        7  9181 1 1 55 GLU C    C   6.257  -4.134   5.427 1.00 . A A . 52 GLU C    1 1 
        7  9182 1 1 55 GLU CA   C   5.464  -5.049   6.417 1.00 . A A . 52 GLU CA   1 1 
        7  9183 1 1 55 GLU CB   C   5.775  -4.760   7.910 1.00 . A A . 52 GLU CB   1 1 
        7  9184 1 1 55 GLU CD   C   6.411  -3.105   9.724 1.00 . A A . 52 GLU CD   1 1 
        7  9185 1 1 55 GLU CG   C   5.878  -3.285   8.309 1.00 . A A . 52 GLU CG   1 1 
        7  9186 1 1 55 GLU H    H   6.576  -6.876   6.420 1.00 . A A . 52 GLU H    1 1 
        7  9187 1 1 55 GLU HA   H   4.412  -4.894   6.271 1.00 . A A . 52 GLU HA   1 1 
        7  9188 1 1 55 GLU HB2  H   4.977  -5.189   8.502 1.00 . A A . 52 GLU HB2  1 1 
        7  9189 1 1 55 GLU HB3  H   6.683  -5.262   8.177 1.00 . A A . 52 GLU HB3  1 1 
        7  9190 1 1 55 GLU HG2  H   6.551  -2.785   7.621 1.00 . A A . 52 GLU HG2  1 1 
        7  9191 1 1 55 GLU HG3  H   4.901  -2.828   8.248 1.00 . A A . 52 GLU HG3  1 1 
        7  9192 1 1 55 GLU N    N   5.715  -6.475   6.161 1.00 . A A . 52 GLU N    1 1 
        7  9193 1 1 55 GLU O    O   7.485  -3.993   5.522 1.00 . A A . 52 GLU O    1 1 
        7  9194 1 1 55 GLU OE1  O   6.021  -3.888  10.623 1.00 . A A . 52 GLU OE1  1 1 
        7  9195 1 1 55 GLU OE2  O   7.233  -2.195   9.934 1.00 . A A . 52 GLU OE2  1 1 
        7  9196 1 1 56 PHE C    C   5.571  -1.237   3.396 1.00 . A A . 53 PHE C    1 1 
        7  9197 1 1 56 PHE CA   C   6.131  -2.687   3.392 1.00 . A A . 53 PHE CA   1 1 
        7  9198 1 1 56 PHE CB   C   6.054  -3.312   1.972 1.00 . A A . 53 PHE CB   1 1 
        7  9199 1 1 56 PHE CD1  C   3.572  -3.625   1.816 1.00 . A A . 53 PHE CD1  1 1 
        7  9200 1 1 56 PHE CD2  C   4.990  -5.469   1.275 1.00 . A A . 53 PHE CD2  1 1 
        7  9201 1 1 56 PHE CE1  C   2.470  -4.391   1.541 1.00 . A A . 53 PHE CE1  1 1 
        7  9202 1 1 56 PHE CE2  C   3.893  -6.241   0.999 1.00 . A A . 53 PHE CE2  1 1 
        7  9203 1 1 56 PHE CG   C   4.843  -4.147   1.684 1.00 . A A . 53 PHE CG   1 1 
        7  9204 1 1 56 PHE CZ   C   2.627  -5.697   1.140 1.00 . A A . 53 PHE CZ   1 1 
        7  9205 1 1 56 PHE H    H   4.547  -3.721   4.410 1.00 . A A . 53 PHE H    1 1 
        7  9206 1 1 56 PHE HA   H   7.169  -2.612   3.676 1.00 . A A . 53 PHE HA   1 1 
        7  9207 1 1 56 PHE HB2  H   6.066  -2.522   1.245 1.00 . A A . 53 PHE HB2  1 1 
        7  9208 1 1 56 PHE HB3  H   6.921  -3.935   1.819 1.00 . A A . 53 PHE HB3  1 1 
        7  9209 1 1 56 PHE HD1  H   3.452  -2.600   2.129 1.00 . A A . 53 PHE HD1  1 1 
        7  9210 1 1 56 PHE HD2  H   5.978  -5.892   1.154 1.00 . A A . 53 PHE HD2  1 1 
        7  9211 1 1 56 PHE HE1  H   1.481  -3.971   1.647 1.00 . A A . 53 PHE HE1  1 1 
        7  9212 1 1 56 PHE HE2  H   4.022  -7.274   0.672 1.00 . A A . 53 PHE HE2  1 1 
        7  9213 1 1 56 PHE HZ   H   1.758  -6.294   0.919 1.00 . A A . 53 PHE HZ   1 1 
        7  9214 1 1 56 PHE N    N   5.533  -3.573   4.428 1.00 . A A . 53 PHE N    1 1 
        7  9215 1 1 56 PHE O    O   4.583  -0.968   4.075 1.00 . A A . 53 PHE O    1 1 
        7  9216 1 1 57 GLU C    C   4.580   1.241   1.453 1.00 . A A . 54 GLU C    1 1 
        7  9217 1 1 57 GLU CA   C   5.712   1.083   2.512 1.00 . A A . 54 GLU CA   1 1 
        7  9218 1 1 57 GLU CB   C   6.889   2.091   2.284 1.00 . A A . 54 GLU CB   1 1 
        7  9219 1 1 57 GLU CD   C   7.623   4.415   1.566 1.00 . A A . 54 GLU CD   1 1 
        7  9220 1 1 57 GLU CG   C   6.639   3.295   1.337 1.00 . A A . 54 GLU CG   1 1 
        7  9221 1 1 57 GLU H    H   7.059  -0.534   2.175 1.00 . A A . 54 GLU H    1 1 
        7  9222 1 1 57 GLU HA   H   5.276   1.300   3.482 1.00 . A A . 54 GLU HA   1 1 
        7  9223 1 1 57 GLU HB2  H   7.172   2.495   3.245 1.00 . A A . 54 GLU HB2  1 1 
        7  9224 1 1 57 GLU HB3  H   7.728   1.545   1.900 1.00 . A A . 54 GLU HB3  1 1 
        7  9225 1 1 57 GLU HG2  H   6.753   2.963   0.314 1.00 . A A . 54 GLU HG2  1 1 
        7  9226 1 1 57 GLU HG3  H   5.640   3.685   1.463 1.00 . A A . 54 GLU HG3  1 1 
        7  9227 1 1 57 GLU N    N   6.221  -0.298   2.645 1.00 . A A . 54 GLU N    1 1 
        7  9228 1 1 57 GLU O    O   3.646   2.021   1.680 1.00 . A A . 54 GLU O    1 1 
        7  9229 1 1 57 GLU OE1  O   8.735   4.341   1.017 1.00 . A A . 54 GLU OE1  1 1 
        7  9230 1 1 57 GLU OE2  O   7.280   5.372   2.299 1.00 . A A . 54 GLU OE2  1 1 
        7  9231 1 1 58 ASP C    C   2.697  -0.612  -0.674 1.00 . A A . 55 ASP C    1 1 
        7  9232 1 1 58 ASP CA   C   3.565   0.645  -0.688 1.00 . A A . 55 ASP CA   1 1 
        7  9233 1 1 58 ASP CB   C   4.227   0.748  -2.097 1.00 . A A . 55 ASP CB   1 1 
        7  9234 1 1 58 ASP CG   C   5.343   1.770  -2.171 1.00 . A A . 55 ASP CG   1 1 
        7  9235 1 1 58 ASP H    H   5.319  -0.154   0.186 1.00 . A A . 55 ASP H    1 1 
        7  9236 1 1 58 ASP HA   H   2.995   1.536  -0.478 1.00 . A A . 55 ASP HA   1 1 
        7  9237 1 1 58 ASP HB2  H   4.647  -0.215  -2.349 1.00 . A A . 55 ASP HB2  1 1 
        7  9238 1 1 58 ASP HB3  H   3.480   1.007  -2.850 1.00 . A A . 55 ASP HB3  1 1 
        7  9239 1 1 58 ASP N    N   4.596   0.477   0.341 1.00 . A A . 55 ASP N    1 1 
        7  9240 1 1 58 ASP O    O   3.200  -1.705  -0.962 1.00 . A A . 55 ASP O    1 1 
        7  9241 1 1 58 ASP OD1  O   5.048   2.958  -2.424 1.00 . A A . 55 ASP OD1  1 1 
        7  9242 1 1 58 ASP OD2  O   6.517   1.379  -1.977 1.00 . A A . 55 ASP OD2  1 1 
        7  9243 1 1 59 ALA C    C  -0.003  -2.097  -1.692 1.00 . A A . 56 ALA C    1 1 
        7  9244 1 1 59 ALA CA   C   0.542  -1.678  -0.315 1.00 . A A . 56 ALA CA   1 1 
        7  9245 1 1 59 ALA CB   C  -0.546  -1.610   0.772 1.00 . A A . 56 ALA CB   1 1 
        7  9246 1 1 59 ALA H    H   1.013   0.388  -0.051 1.00 . A A . 56 ALA H    1 1 
        7  9247 1 1 59 ALA HA   H   1.201  -2.479  -0.013 1.00 . A A . 56 ALA HA   1 1 
        7  9248 1 1 59 ALA HB1  H  -1.232  -0.801   0.610 1.00 . A A . 56 ALA HB1  1 1 
        7  9249 1 1 59 ALA HB2  H  -0.081  -1.489   1.744 1.00 . A A . 56 ALA HB2  1 1 
        7  9250 1 1 59 ALA HB3  H  -1.098  -2.544   0.779 1.00 . A A . 56 ALA HB3  1 1 
        7  9251 1 1 59 ALA N    N   1.392  -0.490  -0.332 1.00 . A A . 56 ALA N    1 1 
        7  9252 1 1 59 ALA O    O  -0.242  -3.286  -1.900 1.00 . A A . 56 ALA O    1 1 
        7  9253 1 1 60 ARG C    C  -0.054  -2.284  -4.914 1.00 . A A . 57 ARG C    1 1 
        7  9254 1 1 60 ARG CA   C  -0.909  -1.474  -3.872 1.00 . A A . 57 ARG CA   1 1 
        7  9255 1 1 60 ARG CB   C  -1.618  -0.203  -4.468 1.00 . A A . 57 ARG CB   1 1 
        7  9256 1 1 60 ARG CD   C  -1.538   0.284  -6.987 1.00 . A A . 57 ARG CD   1 1 
        7  9257 1 1 60 ARG CG   C  -2.307  -0.388  -5.850 1.00 . A A . 57 ARG CG   1 1 
        7  9258 1 1 60 ARG CZ   C  -1.018   2.633  -7.562 1.00 . A A . 57 ARG CZ   1 1 
        7  9259 1 1 60 ARG H    H   0.135  -0.237  -2.509 1.00 . A A . 57 ARG H    1 1 
        7  9260 1 1 60 ARG HA   H  -1.700  -2.142  -3.533 1.00 . A A . 57 ARG HA   1 1 
        7  9261 1 1 60 ARG HB2  H  -2.387   0.095  -3.761 1.00 . A A . 57 ARG HB2  1 1 
        7  9262 1 1 60 ARG HB3  H  -0.913   0.612  -4.545 1.00 . A A . 57 ARG HB3  1 1 
        7  9263 1 1 60 ARG HD2  H  -0.471   0.162  -6.834 1.00 . A A . 57 ARG HD2  1 1 
        7  9264 1 1 60 ARG HD3  H  -1.818  -0.184  -7.922 1.00 . A A . 57 ARG HD3  1 1 
        7  9265 1 1 60 ARG HE   H  -2.730   1.998  -6.736 1.00 . A A . 57 ARG HE   1 1 
        7  9266 1 1 60 ARG HG2  H  -2.411  -1.434  -6.081 1.00 . A A . 57 ARG HG2  1 1 
        7  9267 1 1 60 ARG HG3  H  -3.296   0.059  -5.810 1.00 . A A . 57 ARG HG3  1 1 
        7  9268 1 1 60 ARG HH11 H   0.475   1.319  -7.984 1.00 . A A . 57 ARG HH11 1 1 
        7  9269 1 1 60 ARG HH12 H   0.803   2.969  -8.390 1.00 . A A . 57 ARG HH12 1 1 
        7  9270 1 1 60 ARG HH21 H  -2.321   4.172  -7.303 1.00 . A A . 57 ARG HH21 1 1 
        7  9271 1 1 60 ARG HH22 H  -0.794   4.605  -8.002 1.00 . A A . 57 ARG HH22 1 1 
        7  9272 1 1 60 ARG N    N  -0.198  -1.149  -2.637 1.00 . A A . 57 ARG N    1 1 
        7  9273 1 1 60 ARG NE   N  -1.845   1.714  -7.063 1.00 . A A . 57 ARG NE   1 1 
        7  9274 1 1 60 ARG NH1  N   0.182   2.282  -8.016 1.00 . A A . 57 ARG NH1  1 1 
        7  9275 1 1 60 ARG NH2  N  -1.407   3.907  -7.622 1.00 . A A . 57 ARG NH2  1 1 
        7  9276 1 1 60 ARG O    O  -0.596  -3.203  -5.515 1.00 . A A . 57 ARG O    1 1 
        7  9277 1 1 61 ASP C    C   2.385  -4.266  -5.712 1.00 . A A . 58 ASP C    1 1 
        7  9278 1 1 61 ASP CA   C   2.046  -2.782  -6.146 1.00 . A A . 58 ASP CA   1 1 
        7  9279 1 1 61 ASP CB   C   3.299  -2.006  -6.673 1.00 . A A . 58 ASP CB   1 1 
        7  9280 1 1 61 ASP CG   C   2.908  -0.736  -7.417 1.00 . A A . 58 ASP CG   1 1 
        7  9281 1 1 61 ASP H    H   1.677  -1.170  -4.751 1.00 . A A . 58 ASP H    1 1 
        7  9282 1 1 61 ASP HA   H   1.378  -2.878  -6.987 1.00 . A A . 58 ASP HA   1 1 
        7  9283 1 1 61 ASP HB2  H   3.963  -1.731  -5.865 1.00 . A A . 58 ASP HB2  1 1 
        7  9284 1 1 61 ASP HB3  H   3.838  -2.639  -7.367 1.00 . A A . 58 ASP HB3  1 1 
        7  9285 1 1 61 ASP N    N   1.264  -1.983  -5.147 1.00 . A A . 58 ASP N    1 1 
        7  9286 1 1 61 ASP O    O   2.519  -5.133  -6.577 1.00 . A A . 58 ASP O    1 1 
        7  9287 1 1 61 ASP OD1  O   2.434   0.227  -6.770 1.00 . A A . 58 ASP OD1  1 1 
        7  9288 1 1 61 ASP OD2  O   3.070  -0.698  -8.656 1.00 . A A . 58 ASP OD2  1 1 
        7  9289 1 1 62 ALA C    C   1.421  -6.888  -4.096 1.00 . A A . 59 ALA C    1 1 
        7  9290 1 1 62 ALA CA   C   2.664  -5.921  -3.835 1.00 . A A . 59 ALA CA   1 1 
        7  9291 1 1 62 ALA CB   C   3.091  -5.829  -2.368 1.00 . A A . 59 ALA CB   1 1 
        7  9292 1 1 62 ALA H    H   2.802  -3.834  -3.809 1.00 . A A . 59 ALA H    1 1 
        7  9293 1 1 62 ALA HA   H   3.501  -6.330  -4.335 1.00 . A A . 59 ALA HA   1 1 
        7  9294 1 1 62 ALA HB1  H   2.323  -5.361  -1.769 1.00 . A A . 59 ALA HB1  1 1 
        7  9295 1 1 62 ALA HB2  H   4.002  -5.234  -2.305 1.00 . A A . 59 ALA HB2  1 1 
        7  9296 1 1 62 ALA HB3  H   3.303  -6.810  -1.982 1.00 . A A . 59 ALA HB3  1 1 
        7  9297 1 1 62 ALA N    N   2.572  -4.550  -4.397 1.00 . A A . 59 ALA N    1 1 
        7  9298 1 1 62 ALA O    O   1.508  -8.152  -3.949 1.00 . A A . 59 ALA O    1 1 
        7  9299 1 1 63 ALA C    C  -0.768  -8.019  -5.993 1.00 . A A . 60 ALA C    1 1 
        7  9300 1 1 63 ALA CA   C  -0.977  -7.016  -4.799 1.00 . A A . 60 ALA CA   1 1 
        7  9301 1 1 63 ALA CB   C  -2.125  -6.005  -5.078 1.00 . A A . 60 ALA CB   1 1 
        7  9302 1 1 63 ALA H    H   0.178  -5.352  -4.232 1.00 . A A . 60 ALA H    1 1 
        7  9303 1 1 63 ALA HA   H  -1.283  -7.591  -3.950 1.00 . A A . 60 ALA HA   1 1 
        7  9304 1 1 63 ALA HB1  H  -2.318  -5.410  -4.188 1.00 . A A . 60 ALA HB1  1 1 
        7  9305 1 1 63 ALA HB2  H  -3.032  -6.520  -5.345 1.00 . A A . 60 ALA HB2  1 1 
        7  9306 1 1 63 ALA HB3  H  -1.850  -5.342  -5.886 1.00 . A A . 60 ALA HB3  1 1 
        7  9307 1 1 63 ALA N    N   0.245  -6.294  -4.374 1.00 . A A . 60 ALA N    1 1 
        7  9308 1 1 63 ALA O    O  -1.525  -9.003  -6.052 1.00 . A A . 60 ALA O    1 1 
        7  9309 1 1 64 ASP C    C   1.126 -10.155  -7.099 1.00 . A A . 61 ASP C    1 1 
        7  9310 1 1 64 ASP CA   C   0.721  -8.871  -7.854 1.00 . A A . 61 ASP CA   1 1 
        7  9311 1 1 64 ASP CB   C   1.888  -8.427  -8.777 1.00 . A A . 61 ASP CB   1 1 
        7  9312 1 1 64 ASP CG   C   1.457  -7.357  -9.762 1.00 . A A . 61 ASP CG   1 1 
        7  9313 1 1 64 ASP H    H   0.526  -6.861  -7.098 1.00 . A A . 61 ASP H    1 1 
        7  9314 1 1 64 ASP HA   H  -0.092  -9.126  -8.512 1.00 . A A . 61 ASP HA   1 1 
        7  9315 1 1 64 ASP HB2  H   2.737  -8.072  -8.201 1.00 . A A . 61 ASP HB2  1 1 
        7  9316 1 1 64 ASP HB3  H   2.209  -9.283  -9.355 1.00 . A A . 61 ASP HB3  1 1 
        7  9317 1 1 64 ASP N    N   0.227  -7.789  -6.933 1.00 . A A . 61 ASP N    1 1 
        7  9318 1 1 64 ASP O    O   0.610 -11.230  -7.410 1.00 . A A . 61 ASP O    1 1 
        7  9319 1 1 64 ASP OD1  O   1.423  -6.173  -9.384 1.00 . A A . 61 ASP OD1  1 1 
        7  9320 1 1 64 ASP OD2  O   1.121  -7.720 -10.920 1.00 . A A . 61 ASP OD2  1 1 
        7  9321 1 1 65 ALA C    C   1.119 -11.786  -4.515 1.00 . A A . 62 ALA C    1 1 
        7  9322 1 1 65 ALA CA   C   2.320 -11.283  -5.293 1.00 . A A . 62 ALA CA   1 1 
        7  9323 1 1 65 ALA CB   C   3.498 -11.160  -4.318 1.00 . A A . 62 ALA CB   1 1 
        7  9324 1 1 65 ALA H    H   2.498  -9.244  -5.953 1.00 . A A . 62 ALA H    1 1 
        7  9325 1 1 65 ALA HA   H   2.583 -12.059  -6.000 1.00 . A A . 62 ALA HA   1 1 
        7  9326 1 1 65 ALA HB1  H   3.632 -12.113  -3.811 1.00 . A A . 62 ALA HB1  1 1 
        7  9327 1 1 65 ALA HB2  H   3.320 -10.401  -3.567 1.00 . A A . 62 ALA HB2  1 1 
        7  9328 1 1 65 ALA HB3  H   4.393 -10.939  -4.853 1.00 . A A . 62 ALA HB3  1 1 
        7  9329 1 1 65 ALA N    N   2.017 -10.079  -6.101 1.00 . A A . 62 ALA N    1 1 
        7  9330 1 1 65 ALA O    O   1.001 -13.008  -4.345 1.00 . A A . 62 ALA O    1 1 
        7  9331 1 1 66 ILE C    C  -1.936 -12.262  -4.157 1.00 . A A . 63 ILE C    1 1 
        7  9332 1 1 66 ILE CA   C  -0.916 -11.472  -3.268 1.00 . A A . 63 ILE CA   1 1 
        7  9333 1 1 66 ILE CB   C  -1.598 -10.497  -2.249 1.00 . A A . 63 ILE CB   1 1 
        7  9334 1 1 66 ILE CD1  C  -3.273 -10.982  -0.343 1.00 . A A . 63 ILE CD1  1 1 
        7  9335 1 1 66 ILE CG1  C  -1.993 -11.356  -1.015 1.00 . A A . 63 ILE CG1  1 1 
        7  9336 1 1 66 ILE CG2  C  -2.791  -9.695  -2.827 1.00 . A A . 63 ILE CG2  1 1 
        7  9337 1 1 66 ILE H    H   0.293  -9.926  -4.208 1.00 . A A . 63 ILE H    1 1 
        7  9338 1 1 66 ILE HA   H  -0.453 -12.237  -2.662 1.00 . A A . 63 ILE HA   1 1 
        7  9339 1 1 66 ILE HB   H  -0.848  -9.791  -1.924 1.00 . A A . 63 ILE HB   1 1 
        7  9340 1 1 66 ILE HD11 H  -4.099 -11.393  -0.883 1.00 . A A . 63 ILE HD11 1 1 
        7  9341 1 1 66 ILE HD12 H  -3.357  -9.915  -0.323 1.00 . A A . 63 ILE HD12 1 1 
        7  9342 1 1 66 ILE HD13 H  -3.272 -11.348   0.669 1.00 . A A . 63 ILE HD13 1 1 
        7  9343 1 1 66 ILE HG12 H  -2.090 -12.388  -1.324 1.00 . A A . 63 ILE HG12 1 1 
        7  9344 1 1 66 ILE HG13 H  -1.206 -11.287  -0.264 1.00 . A A . 63 ILE HG13 1 1 
        7  9345 1 1 66 ILE HG21 H  -2.937  -8.798  -2.244 1.00 . A A . 63 ILE HG21 1 1 
        7  9346 1 1 66 ILE HG22 H  -3.687 -10.296  -2.768 1.00 . A A . 63 ILE HG22 1 1 
        7  9347 1 1 66 ILE HG23 H  -2.601  -9.438  -3.851 1.00 . A A . 63 ILE HG23 1 1 
        7  9348 1 1 66 ILE N    N   0.206 -10.907  -4.041 1.00 . A A . 63 ILE N    1 1 
        7  9349 1 1 66 ILE O    O  -2.333 -13.350  -3.754 1.00 . A A . 63 ILE O    1 1 
        7  9350 1 1 67 LYS C    C  -2.258 -13.768  -6.849 1.00 . A A . 64 LYS C    1 1 
        7  9351 1 1 67 LYS CA   C  -3.056 -12.532  -6.364 1.00 . A A . 64 LYS CA   1 1 
        7  9352 1 1 67 LYS CB   C  -3.471 -11.675  -7.616 1.00 . A A . 64 LYS CB   1 1 
        7  9353 1 1 67 LYS CD   C  -1.662 -11.747  -9.483 1.00 . A A . 64 LYS CD   1 1 
        7  9354 1 1 67 LYS CE   C  -0.988 -10.890 -10.544 1.00 . A A . 64 LYS CE   1 1 
        7  9355 1 1 67 LYS CG   C  -2.344 -10.914  -8.375 1.00 . A A . 64 LYS CG   1 1 
        7  9356 1 1 67 LYS H    H  -2.412 -10.775  -5.398 1.00 . A A . 64 LYS H    1 1 
        7  9357 1 1 67 LYS HA   H  -3.967 -12.891  -5.902 1.00 . A A . 64 LYS HA   1 1 
        7  9358 1 1 67 LYS HB2  H  -3.938 -12.339  -8.327 1.00 . A A . 64 LYS HB2  1 1 
        7  9359 1 1 67 LYS HB3  H  -4.216 -10.950  -7.317 1.00 . A A . 64 LYS HB3  1 1 
        7  9360 1 1 67 LYS HD2  H  -0.875 -12.358  -9.021 1.00 . A A . 64 LYS HD2  1 1 
        7  9361 1 1 67 LYS HD3  H  -2.389 -12.386  -9.939 1.00 . A A . 64 LYS HD3  1 1 
        7  9362 1 1 67 LYS HE2  H  -0.127 -10.411 -10.114 1.00 . A A . 64 LYS HE2  1 1 
        7  9363 1 1 67 LYS HE3  H  -0.670 -11.536 -11.347 1.00 . A A . 64 LYS HE3  1 1 
        7  9364 1 1 67 LYS HG2  H  -2.753 -10.027  -8.821 1.00 . A A . 64 LYS HG2  1 1 
        7  9365 1 1 67 LYS HG3  H  -1.576 -10.629  -7.655 1.00 . A A . 64 LYS HG3  1 1 
        7  9366 1 1 67 LYS HZ1  H  -2.773 -10.277 -11.457 1.00 . A A . 64 LYS HZ1  1 1 
        7  9367 1 1 67 LYS HZ2  H  -1.427  -9.354 -11.896 1.00 . A A . 64 LYS HZ2  1 1 
        7  9368 1 1 67 LYS HZ3  H  -2.133  -9.145 -10.374 1.00 . A A . 64 LYS HZ3  1 1 
        7  9369 1 1 67 LYS N    N  -2.376 -11.725  -5.321 1.00 . A A . 64 LYS N    1 1 
        7  9370 1 1 67 LYS NZ   N  -1.893  -9.845 -11.103 1.00 . A A . 64 LYS NZ   1 1 
        7  9371 1 1 67 LYS O    O  -2.861 -14.754  -7.237 1.00 . A A . 64 LYS O    1 1 
        7  9372 1 1 68 GLU C    C   0.039 -15.976  -6.367 1.00 . A A . 65 GLU C    1 1 
        7  9373 1 1 68 GLU CA   C  -0.162 -14.863  -7.418 1.00 . A A . 65 GLU CA   1 1 
        7  9374 1 1 68 GLU CB   C   1.121 -14.314  -8.066 1.00 . A A . 65 GLU CB   1 1 
        7  9375 1 1 68 GLU CD   C   3.547 -13.743  -7.818 1.00 . A A . 65 GLU CD   1 1 
        7  9376 1 1 68 GLU CG   C   2.419 -14.638  -7.386 1.00 . A A . 65 GLU CG   1 1 
        7  9377 1 1 68 GLU H    H  -0.435 -12.909  -6.596 1.00 . A A . 65 GLU H    1 1 
        7  9378 1 1 68 GLU HA   H  -0.765 -15.313  -8.203 1.00 . A A . 65 GLU HA   1 1 
        7  9379 1 1 68 GLU HB2  H   1.182 -14.684  -9.077 1.00 . A A . 65 GLU HB2  1 1 
        7  9380 1 1 68 GLU HB3  H   1.039 -13.240  -8.105 1.00 . A A . 65 GLU HB3  1 1 
        7  9381 1 1 68 GLU HG2  H   2.306 -14.579  -6.316 1.00 . A A . 65 GLU HG2  1 1 
        7  9382 1 1 68 GLU HG3  H   2.661 -15.616  -7.675 1.00 . A A . 65 GLU HG3  1 1 
        7  9383 1 1 68 GLU N    N  -0.920 -13.721  -6.887 1.00 . A A . 65 GLU N    1 1 
        7  9384 1 1 68 GLU O    O   0.336 -17.121  -6.716 1.00 . A A . 65 GLU O    1 1 
        7  9385 1 1 68 GLU OE1  O   3.274 -12.668  -8.384 1.00 . A A . 65 GLU OE1  1 1 
        7  9386 1 1 68 GLU OE2  O   4.717 -14.134  -7.611 1.00 . A A . 65 GLU OE2  1 1 
        7  9387 1 1 69 LYS C    C  -1.777 -16.854  -3.608 1.00 . A A . 66 LYS C    1 1 
        7  9388 1 1 69 LYS CA   C  -0.262 -16.649  -4.038 1.00 . A A . 66 LYS CA   1 1 
        7  9389 1 1 69 LYS CB   C   0.618 -16.273  -2.792 1.00 . A A . 66 LYS CB   1 1 
        7  9390 1 1 69 LYS CD   C   2.994 -16.626  -3.958 1.00 . A A . 66 LYS CD   1 1 
        7  9391 1 1 69 LYS CE   C   4.379 -15.976  -4.124 1.00 . A A . 66 LYS CE   1 1 
        7  9392 1 1 69 LYS CG   C   2.086 -15.782  -3.014 1.00 . A A . 66 LYS CG   1 1 
        7  9393 1 1 69 LYS H    H  -0.123 -14.703  -4.832 1.00 . A A . 66 LYS H    1 1 
        7  9394 1 1 69 LYS HA   H   0.092 -17.588  -4.449 1.00 . A A . 66 LYS HA   1 1 
        7  9395 1 1 69 LYS HB2  H   0.120 -15.468  -2.275 1.00 . A A . 66 LYS HB2  1 1 
        7  9396 1 1 69 LYS HB3  H   0.645 -17.124  -2.127 1.00 . A A . 66 LYS HB3  1 1 
        7  9397 1 1 69 LYS HD2  H   3.139 -17.616  -3.543 1.00 . A A . 66 LYS HD2  1 1 
        7  9398 1 1 69 LYS HD3  H   2.538 -16.704  -4.935 1.00 . A A . 66 LYS HD3  1 1 
        7  9399 1 1 69 LYS HE2  H   4.261 -14.991  -4.554 1.00 . A A . 66 LYS HE2  1 1 
        7  9400 1 1 69 LYS HE3  H   4.842 -15.885  -3.152 1.00 . A A . 66 LYS HE3  1 1 
        7  9401 1 1 69 LYS HG2  H   2.045 -14.769  -3.385 1.00 . A A . 66 LYS HG2  1 1 
        7  9402 1 1 69 LYS HG3  H   2.556 -15.748  -2.041 1.00 . A A . 66 LYS HG3  1 1 
        7  9403 1 1 69 LYS HZ1  H   6.240 -16.340  -5.003 1.00 . A A . 66 LYS HZ1  1 1 
        7  9404 1 1 69 LYS HZ2  H   4.924 -16.758  -5.988 1.00 . A A . 66 LYS HZ2  1 1 
        7  9405 1 1 69 LYS HZ3  H   5.348 -17.747  -4.682 1.00 . A A . 66 LYS HZ3  1 1 
        7  9406 1 1 69 LYS N    N  -0.131 -15.640  -5.084 1.00 . A A . 66 LYS N    1 1 
        7  9407 1 1 69 LYS NZ   N   5.283 -16.763  -5.010 1.00 . A A . 66 LYS NZ   1 1 
        7  9408 1 1 69 LYS O    O  -2.034 -17.472  -2.574 1.00 . A A . 66 LYS O    1 1 
        7  9409 1 1 70 ASP C    C  -5.001 -17.526  -3.991 1.00 . A A . 67 ASP C    1 1 
        7  9410 1 1 70 ASP CA   C  -4.204 -16.238  -3.980 1.00 . A A . 67 ASP CA   1 1 
        7  9411 1 1 70 ASP CB   C  -5.039 -15.082  -4.521 1.00 . A A . 67 ASP CB   1 1 
        7  9412 1 1 70 ASP CG   C  -5.891 -15.367  -5.777 1.00 . A A . 67 ASP CG   1 1 
        7  9413 1 1 70 ASP H    H  -2.581 -16.204  -5.373 1.00 . A A . 67 ASP H    1 1 
        7  9414 1 1 70 ASP HA   H  -4.102 -15.992  -2.952 1.00 . A A . 67 ASP HA   1 1 
        7  9415 1 1 70 ASP HB2  H  -5.711 -14.825  -3.703 1.00 . A A . 67 ASP HB2  1 1 
        7  9416 1 1 70 ASP HB3  H  -4.403 -14.250  -4.682 1.00 . A A . 67 ASP HB3  1 1 
        7  9417 1 1 70 ASP N    N  -2.774 -16.356  -4.418 1.00 . A A . 67 ASP N    1 1 
        7  9418 1 1 70 ASP O    O  -4.597 -18.517  -4.618 1.00 . A A . 67 ASP O    1 1 
        7  9419 1 1 70 ASP OD1  O  -5.365 -15.881  -6.781 1.00 . A A . 67 ASP OD1  1 1 
        7  9420 1 1 70 ASP OD2  O  -7.112 -15.087  -5.739 1.00 . A A . 67 ASP OD2  1 1 
        7  9421 1 1 71 GLY C    C  -6.965 -19.235  -1.683 1.00 . A A . 68 GLY C    1 1 
        7  9422 1 1 71 GLY CA   C  -6.849 -18.769  -3.109 1.00 . A A . 68 GLY CA   1 1 
        7  9423 1 1 71 GLY H    H  -6.538 -16.679  -2.998 1.00 . A A . 68 GLY H    1 1 
        7  9424 1 1 71 GLY HA2  H  -7.841 -18.673  -3.497 1.00 . A A . 68 GLY HA2  1 1 
        7  9425 1 1 71 GLY HA3  H  -6.328 -19.528  -3.684 1.00 . A A . 68 GLY HA3  1 1 
        7  9426 1 1 71 GLY N    N  -6.159 -17.529  -3.301 1.00 . A A . 68 GLY N    1 1 
        7  9427 1 1 71 GLY O    O  -6.950 -20.447  -1.485 1.00 . A A . 68 GLY O    1 1 
        7  9428 1 1 72 CYS C    C  -7.910 -19.731   1.108 1.00 . A A . 69 CYS C    1 1 
        7  9429 1 1 72 CYS CA   C  -6.915 -18.628   0.723 1.00 . A A . 69 CYS CA   1 1 
        7  9430 1 1 72 CYS CB   C  -7.199 -17.343   1.552 1.00 . A A . 69 CYS CB   1 1 
        7  9431 1 1 72 CYS H    H  -7.079 -17.333  -0.919 1.00 . A A . 69 CYS H    1 1 
        7  9432 1 1 72 CYS HA   H  -5.908 -18.953   0.915 1.00 . A A . 69 CYS HA   1 1 
        7  9433 1 1 72 CYS HB2  H  -7.742 -17.603   2.452 1.00 . A A . 69 CYS HB2  1 1 
        7  9434 1 1 72 CYS HB3  H  -6.264 -16.881   1.842 1.00 . A A . 69 CYS HB3  1 1 
        7  9435 1 1 72 CYS HG   H  -9.294 -16.699   0.279 1.00 . A A . 69 CYS HG   1 1 
        7  9436 1 1 72 CYS N    N  -7.020 -18.281  -0.684 1.00 . A A . 69 CYS N    1 1 
        7  9437 1 1 72 CYS O    O  -9.126 -19.592   0.939 1.00 . A A . 69 CYS O    1 1 
        7  9438 1 1 72 CYS SG   S  -8.192 -16.100   0.703 1.00 . A A . 69 CYS SG   1 1 
        7  9439 1 1 73 ASP C    C  -7.902 -22.626   3.289 1.00 . A A . 70 ASP C    1 1 
        7  9440 1 1 73 ASP CA   C  -8.138 -22.030   1.885 1.00 . A A . 70 ASP CA   1 1 
        7  9441 1 1 73 ASP CB   C  -7.857 -23.061   0.792 1.00 . A A . 70 ASP CB   1 1 
        7  9442 1 1 73 ASP CG   C  -9.117 -23.793   0.378 1.00 . A A . 70 ASP CG   1 1 
        7  9443 1 1 73 ASP H    H  -6.365 -20.862   1.850 1.00 . A A . 70 ASP H    1 1 
        7  9444 1 1 73 ASP HA   H  -9.179 -21.716   1.806 1.00 . A A . 70 ASP HA   1 1 
        7  9445 1 1 73 ASP HB2  H  -7.445 -22.560  -0.078 1.00 . A A . 70 ASP HB2  1 1 
        7  9446 1 1 73 ASP HB3  H  -7.144 -23.783   1.164 1.00 . A A . 70 ASP HB3  1 1 
        7  9447 1 1 73 ASP N    N  -7.342 -20.836   1.660 1.00 . A A . 70 ASP N    1 1 
        7  9448 1 1 73 ASP O    O  -6.766 -22.531   3.820 1.00 . A A . 70 ASP O    1 1 
        7  9449 1 1 73 ASP OD1  O  -9.495 -24.770   1.057 1.00 . A A . 70 ASP OD1  1 1 
        7  9450 1 1 73 ASP OD2  O  -9.737 -23.377  -0.623 1.00 . A A . 70 ASP OD2  1 1 
        7  9451 1 1 74 PHE C    C  -9.938 -25.014   5.186 1.00 . A A . 71 PHE C    1 1 
        7  9452 1 1 74 PHE CA   C  -9.154 -23.698   5.192 1.00 . A A . 71 PHE CA   1 1 
        7  9453 1 1 74 PHE CB   C  -9.871 -22.600   6.022 1.00 . A A . 71 PHE CB   1 1 
        7  9454 1 1 74 PHE CD1  C -11.553 -21.345   4.599 1.00 . A A . 71 PHE CD1  1 1 
        7  9455 1 1 74 PHE CD2  C -12.375 -22.840   6.272 1.00 . A A . 71 PHE CD2  1 1 
        7  9456 1 1 74 PHE CE1  C -12.850 -21.020   4.245 1.00 . A A . 71 PHE CE1  1 1 
        7  9457 1 1 74 PHE CE2  C -13.675 -22.511   5.925 1.00 . A A . 71 PHE CE2  1 1 
        7  9458 1 1 74 PHE CG   C -11.296 -22.263   5.614 1.00 . A A . 71 PHE CG   1 1 
        7  9459 1 1 74 PHE CZ   C -13.910 -21.603   4.910 1.00 . A A . 71 PHE CZ   1 1 
        7  9460 1 1 74 PHE H    H  -9.596 -23.714   3.186 1.00 . A A . 71 PHE H    1 1 
        7  9461 1 1 74 PHE HA   H  -8.174 -23.891   5.618 1.00 . A A . 71 PHE HA   1 1 
        7  9462 1 1 74 PHE HB2  H  -9.906 -22.912   7.057 1.00 . A A . 71 PHE HB2  1 1 
        7  9463 1 1 74 PHE HB3  H  -9.290 -21.690   5.961 1.00 . A A . 71 PHE HB3  1 1 
        7  9464 1 1 74 PHE HD1  H -10.732 -20.888   4.077 1.00 . A A . 71 PHE HD1  1 1 
        7  9465 1 1 74 PHE HD2  H -12.198 -23.564   7.065 1.00 . A A . 71 PHE HD2  1 1 
        7  9466 1 1 74 PHE HE1  H -13.032 -20.314   3.449 1.00 . A A . 71 PHE HE1  1 1 
        7  9467 1 1 74 PHE HE2  H -14.506 -22.966   6.445 1.00 . A A . 71 PHE HE2  1 1 
        7  9468 1 1 74 PHE HZ   H -14.924 -21.342   4.641 1.00 . A A . 71 PHE HZ   1 1 
        7  9469 1 1 74 PHE N    N  -8.957 -23.314   3.806 1.00 . A A . 71 PHE N    1 1 
        7  9470 1 1 74 PHE O    O -10.733 -25.214   4.267 1.00 . A A . 71 PHE O    1 1 
        7  9471 1 1 75 GLU C    C  -9.997 -28.251   5.132 1.00 . A A . 72 GLU C    1 1 
        7  9472 1 1 75 GLU CA   C -10.366 -27.239   6.260 1.00 . A A . 72 GLU CA   1 1 
        7  9473 1 1 75 GLU CB   C -11.927 -27.045   6.336 1.00 . A A . 72 GLU CB   1 1 
        7  9474 1 1 75 GLU CD   C -14.188 -27.471   7.442 1.00 . A A . 72 GLU CD   1 1 
        7  9475 1 1 75 GLU CG   C -12.699 -27.789   7.445 1.00 . A A . 72 GLU CG   1 1 
        7  9476 1 1 75 GLU H    H  -9.039 -25.667   6.861 1.00 . A A . 72 GLU H    1 1 
        7  9477 1 1 75 GLU HA   H -10.018 -27.662   7.190 1.00 . A A . 72 GLU HA   1 1 
        7  9478 1 1 75 GLU HB2  H -12.128 -25.991   6.451 1.00 . A A . 72 GLU HB2  1 1 
        7  9479 1 1 75 GLU HB3  H -12.335 -27.359   5.386 1.00 . A A . 72 GLU HB3  1 1 
        7  9480 1 1 75 GLU HG2  H -12.597 -28.859   7.307 1.00 . A A . 72 GLU HG2  1 1 
        7  9481 1 1 75 GLU HG3  H -12.304 -27.494   8.404 1.00 . A A . 72 GLU HG3  1 1 
        7  9482 1 1 75 GLU N    N  -9.663 -25.921   6.153 1.00 . A A . 72 GLU N    1 1 
        7  9483 1 1 75 GLU O    O -10.833 -28.616   4.302 1.00 . A A . 72 GLU O    1 1 
        7  9484 1 1 75 GLU OE1  O -14.554 -26.322   7.780 1.00 . A A . 72 GLU OE1  1 1 
        7  9485 1 1 75 GLU OE2  O -14.995 -28.376   7.132 1.00 . A A . 72 GLU OE2  1 1 
        7  9486 1 1 76 GLY C    C  -7.589 -29.308   2.900 1.00 . A A . 73 GLY C    1 1 
        7  9487 1 1 76 GLY CA   C  -8.277 -29.746   4.194 1.00 . A A . 73 GLY CA   1 1 
        7  9488 1 1 76 GLY H    H  -8.075 -28.271   5.716 1.00 . A A . 73 GLY H    1 1 
        7  9489 1 1 76 GLY HA2  H  -7.594 -30.380   4.735 1.00 . A A . 73 GLY HA2  1 1 
        7  9490 1 1 76 GLY HA3  H  -9.143 -30.337   3.930 1.00 . A A . 73 GLY HA3  1 1 
        7  9491 1 1 76 GLY N    N  -8.723 -28.670   5.100 1.00 . A A . 73 GLY N    1 1 
        7  9492 1 1 76 GLY O    O  -6.952 -30.141   2.246 1.00 . A A . 73 GLY O    1 1 
        7  9493 1 1 77 ASN C    C  -6.025 -26.309   2.511 1.00 . A A . 74 ASN C    1 1 
        7  9494 1 1 77 ASN CA   C  -6.618 -27.436   1.689 1.00 . A A . 74 ASN CA   1 1 
        7  9495 1 1 77 ASN CB   C  -7.061 -26.964   0.239 1.00 . A A . 74 ASN CB   1 1 
        7  9496 1 1 77 ASN CG   C  -7.754 -28.058  -0.551 1.00 . A A . 74 ASN CG   1 1 
        7  9497 1 1 77 ASN H    H  -8.467 -27.511   2.810 1.00 . A A . 74 ASN H    1 1 
        7  9498 1 1 77 ASN HA   H  -5.851 -28.189   1.581 1.00 . A A . 74 ASN HA   1 1 
        7  9499 1 1 77 ASN HB2  H  -7.706 -26.079   0.249 1.00 . A A . 74 ASN HB2  1 1 
        7  9500 1 1 77 ASN HB3  H  -6.170 -26.705  -0.310 1.00 . A A . 74 ASN HB3  1 1 
        7  9501 1 1 77 ASN HD21 H  -6.033 -28.537  -1.425 1.00 . A A . 74 ASN HD21 1 1 
        7  9502 1 1 77 ASN HD22 H  -7.406 -29.468  -1.901 1.00 . A A . 74 ASN HD22 1 1 
        7  9503 1 1 77 ASN N    N  -7.679 -28.038   2.529 1.00 . A A . 74 ASN N    1 1 
        7  9504 1 1 77 ASN ND2  N  -6.986 -28.762  -1.373 1.00 . A A . 74 ASN ND2  1 1 
        7  9505 1 1 77 ASN O    O  -6.751 -25.442   2.962 1.00 . A A . 74 ASN O    1 1 
        7  9506 1 1 77 ASN OD1  O  -8.963 -28.260  -0.442 1.00 . A A . 74 ASN OD1  1 1 
        7  9507 1 1 78 LYS C    C  -3.447 -24.254   2.717 1.00 . A A . 75 LYS C    1 1 
        7  9508 1 1 78 LYS CA   C  -4.108 -25.308   3.627 1.00 . A A . 75 LYS CA   1 1 
        7  9509 1 1 78 LYS CB   C  -3.095 -25.831   4.716 1.00 . A A . 75 LYS CB   1 1 
        7  9510 1 1 78 LYS CD   C  -4.255 -27.428   6.457 1.00 . A A . 75 LYS CD   1 1 
        7  9511 1 1 78 LYS CE   C  -5.449 -27.329   7.408 1.00 . A A . 75 LYS CE   1 1 
        7  9512 1 1 78 LYS CG   C  -3.703 -26.022   6.128 1.00 . A A . 75 LYS CG   1 1 
        7  9513 1 1 78 LYS H    H  -4.154 -27.076   2.376 1.00 . A A . 75 LYS H    1 1 
        7  9514 1 1 78 LYS HA   H  -4.926 -24.831   4.146 1.00 . A A . 75 LYS HA   1 1 
        7  9515 1 1 78 LYS HB2  H  -2.641 -26.759   4.408 1.00 . A A . 75 LYS HB2  1 1 
        7  9516 1 1 78 LYS HB3  H  -2.310 -25.093   4.804 1.00 . A A . 75 LYS HB3  1 1 
        7  9517 1 1 78 LYS HD2  H  -4.563 -27.941   5.570 1.00 . A A . 75 LYS HD2  1 1 
        7  9518 1 1 78 LYS HD3  H  -3.476 -28.003   6.945 1.00 . A A . 75 LYS HD3  1 1 
        7  9519 1 1 78 LYS HE2  H  -6.268 -26.823   6.902 1.00 . A A . 75 LYS HE2  1 1 
        7  9520 1 1 78 LYS HE3  H  -5.764 -28.328   7.681 1.00 . A A . 75 LYS HE3  1 1 
        7  9521 1 1 78 LYS HG2  H  -2.932 -25.801   6.850 1.00 . A A . 75 LYS HG2  1 1 
        7  9522 1 1 78 LYS HG3  H  -4.499 -25.303   6.259 1.00 . A A . 75 LYS HG3  1 1 
        7  9523 1 1 78 LYS HZ1  H  -4.747 -25.631   8.404 1.00 . A A . 75 LYS HZ1  1 1 
        7  9524 1 1 78 LYS HZ2  H  -4.399 -27.084   9.204 1.00 . A A . 75 LYS HZ2  1 1 
        7  9525 1 1 78 LYS HZ3  H  -5.969 -26.457   9.232 1.00 . A A . 75 LYS HZ3  1 1 
        7  9526 1 1 78 LYS N    N  -4.721 -26.369   2.800 1.00 . A A . 75 LYS N    1 1 
        7  9527 1 1 78 LYS NZ   N  -5.116 -26.572   8.649 1.00 . A A . 75 LYS NZ   1 1 
        7  9528 1 1 78 LYS O    O  -2.401 -24.561   2.138 1.00 . A A . 75 LYS O    1 1 
        7  9529 1 1 79 LEU C    C  -3.917 -20.563   2.016 1.00 . A A . 76 LEU C    1 1 
        7  9530 1 1 79 LEU CA   C  -3.356 -21.988   1.721 1.00 . A A . 76 LEU CA   1 1 
        7  9531 1 1 79 LEU CB   C  -3.531 -22.373   0.192 1.00 . A A . 76 LEU CB   1 1 
        7  9532 1 1 79 LEU CD1  C  -1.578 -21.285  -1.005 1.00 . A A . 76 LEU CD1  1 1 
        7  9533 1 1 79 LEU CD2  C  -3.749 -21.665  -2.186 1.00 . A A . 76 LEU CD2  1 1 
        7  9534 1 1 79 LEU CG   C  -3.081 -21.361  -0.865 1.00 . A A . 76 LEU CG   1 1 
        7  9535 1 1 79 LEU H    H  -4.882 -22.791   2.996 1.00 . A A . 76 LEU H    1 1 
        7  9536 1 1 79 LEU HA   H  -2.303 -22.012   1.940 1.00 . A A . 76 LEU HA   1 1 
        7  9537 1 1 79 LEU HB2  H  -2.986 -23.285   0.009 1.00 . A A . 76 LEU HB2  1 1 
        7  9538 1 1 79 LEU HB3  H  -4.575 -22.570   0.005 1.00 . A A . 76 LEU HB3  1 1 
        7  9539 1 1 79 LEU HD11 H  -1.141 -21.015  -0.055 1.00 . A A . 76 LEU HD11 1 1 
        7  9540 1 1 79 LEU HD12 H  -1.330 -20.537  -1.739 1.00 . A A . 76 LEU HD12 1 1 
        7  9541 1 1 79 LEU HD13 H  -1.193 -22.242  -1.319 1.00 . A A . 76 LEU HD13 1 1 
        7  9542 1 1 79 LEU HD21 H  -3.542 -22.685  -2.464 1.00 . A A . 76 LEU HD21 1 1 
        7  9543 1 1 79 LEU HD22 H  -3.379 -20.995  -2.946 1.00 . A A . 76 LEU HD22 1 1 
        7  9544 1 1 79 LEU HD23 H  -4.816 -21.532  -2.076 1.00 . A A . 76 LEU HD23 1 1 
        7  9545 1 1 79 LEU HG   H  -3.421 -20.388  -0.554 1.00 . A A . 76 LEU HG   1 1 
        7  9546 1 1 79 LEU N    N  -4.022 -23.014   2.567 1.00 . A A . 76 LEU N    1 1 
        7  9547 1 1 79 LEU O    O  -4.587 -20.036   1.183 1.00 . A A . 76 LEU O    1 1 
        7  9548 1 1 80 ARG C    C  -3.467 -17.424   3.197 1.00 . A A . 77 ARG C    1 1 
        7  9549 1 1 80 ARG CA   C  -4.381 -18.650   3.486 1.00 . A A . 77 ARG CA   1 1 
        7  9550 1 1 80 ARG CB   C  -4.821 -18.727   4.981 1.00 . A A . 77 ARG CB   1 1 
        7  9551 1 1 80 ARG CD   C  -6.700 -16.883   5.270 1.00 . A A . 77 ARG CD   1 1 
        7  9552 1 1 80 ARG CG   C  -5.325 -17.425   5.702 1.00 . A A . 77 ARG CG   1 1 
        7  9553 1 1 80 ARG CZ   C  -7.895 -15.592   7.054 1.00 . A A . 77 ARG CZ   1 1 
        7  9554 1 1 80 ARG H    H  -2.969 -20.205   3.800 1.00 . A A . 77 ARG H    1 1 
        7  9555 1 1 80 ARG HA   H  -5.258 -18.624   2.857 1.00 . A A . 77 ARG HA   1 1 
        7  9556 1 1 80 ARG HB2  H  -5.573 -19.495   5.069 1.00 . A A . 77 ARG HB2  1 1 
        7  9557 1 1 80 ARG HB3  H  -3.952 -19.073   5.527 1.00 . A A . 77 ARG HB3  1 1 
        7  9558 1 1 80 ARG HD2  H  -6.666 -16.659   4.212 1.00 . A A . 77 ARG HD2  1 1 
        7  9559 1 1 80 ARG HD3  H  -7.488 -17.607   5.472 1.00 . A A . 77 ARG HD3  1 1 
        7  9560 1 1 80 ARG HE   H  -6.617 -14.823   5.703 1.00 . A A . 77 ARG HE   1 1 
        7  9561 1 1 80 ARG HG2  H  -5.375 -17.629   6.762 1.00 . A A . 77 ARG HG2  1 1 
        7  9562 1 1 80 ARG HG3  H  -4.585 -16.648   5.540 1.00 . A A . 77 ARG HG3  1 1 
        7  9563 1 1 80 ARG HH11 H  -8.324 -17.561   7.056 1.00 . A A . 77 ARG HH11 1 1 
        7  9564 1 1 80 ARG HH12 H  -9.134 -16.651   8.275 1.00 . A A . 77 ARG HH12 1 1 
        7  9565 1 1 80 ARG HH21 H  -7.683 -13.571   7.333 1.00 . A A . 77 ARG HH21 1 1 
        7  9566 1 1 80 ARG HH22 H  -8.763 -14.374   8.430 1.00 . A A . 77 ARG HH22 1 1 
        7  9567 1 1 80 ARG N    N  -3.665 -19.905   3.176 1.00 . A A . 77 ARG N    1 1 
        7  9568 1 1 80 ARG NE   N  -7.036 -15.651   6.007 1.00 . A A . 77 ARG NE   1 1 
        7  9569 1 1 80 ARG NH1  N  -8.501 -16.691   7.490 1.00 . A A . 77 ARG NH1  1 1 
        7  9570 1 1 80 ARG NH2  N  -8.128 -14.425   7.656 1.00 . A A . 77 ARG NH2  1 1 
        7  9571 1 1 80 ARG O    O  -2.502 -17.193   3.919 1.00 . A A . 77 ARG O    1 1 
        7  9572 1 1 81 VAL C    C  -3.841 -14.160   1.831 1.00 . A A . 78 VAL C    1 1 
        7  9573 1 1 81 VAL CA   C  -2.905 -15.419   1.893 1.00 . A A . 78 VAL CA   1 1 
        7  9574 1 1 81 VAL CB   C  -2.024 -15.604   0.559 1.00 . A A . 78 VAL CB   1 1 
        7  9575 1 1 81 VAL CG1  C  -1.219 -14.361   0.279 1.00 . A A . 78 VAL CG1  1 1 
        7  9576 1 1 81 VAL CG2  C  -1.015 -16.773   0.657 1.00 . A A . 78 VAL CG2  1 1 
        7  9577 1 1 81 VAL H    H  -4.573 -16.726   1.590 1.00 . A A . 78 VAL H    1 1 
        7  9578 1 1 81 VAL HA   H  -2.233 -15.326   2.739 1.00 . A A . 78 VAL HA   1 1 
        7  9579 1 1 81 VAL HB   H  -2.676 -15.792  -0.316 1.00 . A A . 78 VAL HB   1 1 
        7  9580 1 1 81 VAL HG11 H  -0.953 -14.335  -0.765 1.00 . A A . 78 VAL HG11 1 1 
        7  9581 1 1 81 VAL HG12 H  -0.321 -14.368   0.876 1.00 . A A . 78 VAL HG12 1 1 
        7  9582 1 1 81 VAL HG13 H  -1.810 -13.492   0.523 1.00 . A A . 78 VAL HG13 1 1 
        7  9583 1 1 81 VAL HG21 H  -0.518 -16.754   1.615 1.00 . A A . 78 VAL HG21 1 1 
        7  9584 1 1 81 VAL HG22 H  -0.270 -16.653  -0.116 1.00 . A A . 78 VAL HG22 1 1 
        7  9585 1 1 81 VAL HG23 H  -1.510 -17.719   0.518 1.00 . A A . 78 VAL HG23 1 1 
        7  9586 1 1 81 VAL N    N  -3.757 -16.592   2.156 1.00 . A A . 78 VAL N    1 1 
        7  9587 1 1 81 VAL O    O  -4.720 -14.131   0.968 1.00 . A A . 78 VAL O    1 1 
        7  9588 1 1 82 GLU C    C  -4.052 -10.673   3.151 1.00 . A A . 79 GLU C    1 1 
        7  9589 1 1 82 GLU CA   C  -4.702 -12.036   2.819 1.00 . A A . 79 GLU CA   1 1 
        7  9590 1 1 82 GLU CB   C  -5.754 -12.482   3.896 1.00 . A A . 79 GLU CB   1 1 
        7  9591 1 1 82 GLU CD   C  -7.802 -12.070   5.332 1.00 . A A . 79 GLU CD   1 1 
        7  9592 1 1 82 GLU CG   C  -6.663 -11.427   4.573 1.00 . A A . 79 GLU CG   1 1 
        7  9593 1 1 82 GLU H    H  -2.904 -13.061   3.320 1.00 . A A . 79 GLU H    1 1 
        7  9594 1 1 82 GLU HA   H  -5.192 -11.967   1.861 1.00 . A A . 79 GLU HA   1 1 
        7  9595 1 1 82 GLU HB2  H  -6.411 -13.210   3.426 1.00 . A A . 79 GLU HB2  1 1 
        7  9596 1 1 82 GLU HB3  H  -5.212 -12.981   4.683 1.00 . A A . 79 GLU HB3  1 1 
        7  9597 1 1 82 GLU HG2  H  -6.079 -10.876   5.311 1.00 . A A . 79 GLU HG2  1 1 
        7  9598 1 1 82 GLU HG3  H  -7.074 -10.750   3.845 1.00 . A A . 79 GLU HG3  1 1 
        7  9599 1 1 82 GLU N    N  -3.692 -13.122   2.738 1.00 . A A . 79 GLU N    1 1 
        7  9600 1 1 82 GLU O    O  -3.254 -10.541   4.102 1.00 . A A . 79 GLU O    1 1 
        7  9601 1 1 82 GLU OE1  O  -8.550 -12.877   4.741 1.00 . A A . 79 GLU OE1  1 1 
        7  9602 1 1 82 GLU OE2  O  -7.936 -11.775   6.536 1.00 . A A . 79 GLU OE2  1 1 
        7  9603 1 1 83 VAL C    C  -5.252  -7.663   3.610 1.00 . A A . 80 VAL C    1 1 
        7  9604 1 1 83 VAL CA   C  -4.142  -8.269   2.751 1.00 . A A . 80 VAL CA   1 1 
        7  9605 1 1 83 VAL CB   C  -3.878  -7.338   1.533 1.00 . A A . 80 VAL CB   1 1 
        7  9606 1 1 83 VAL CG1  C  -2.548  -7.694   0.892 1.00 . A A . 80 VAL CG1  1 1 
        7  9607 1 1 83 VAL CG2  C  -4.998  -7.411   0.512 1.00 . A A . 80 VAL CG2  1 1 
        7  9608 1 1 83 VAL H    H  -4.775  -9.812   1.449 1.00 . A A . 80 VAL H    1 1 
        7  9609 1 1 83 VAL HA   H  -3.236  -8.302   3.339 1.00 . A A . 80 VAL HA   1 1 
        7  9610 1 1 83 VAL HB   H  -3.818  -6.316   1.897 1.00 . A A . 80 VAL HB   1 1 
        7  9611 1 1 83 VAL HG11 H  -1.940  -6.812   0.789 1.00 . A A . 80 VAL HG11 1 1 
        7  9612 1 1 83 VAL HG12 H  -2.719  -8.103  -0.079 1.00 . A A . 80 VAL HG12 1 1 
        7  9613 1 1 83 VAL HG13 H  -2.038  -8.423   1.505 1.00 . A A . 80 VAL HG13 1 1 
        7  9614 1 1 83 VAL HG21 H  -5.916  -7.087   0.979 1.00 . A A . 80 VAL HG21 1 1 
        7  9615 1 1 83 VAL HG22 H  -5.105  -8.428   0.179 1.00 . A A . 80 VAL HG22 1 1 
        7  9616 1 1 83 VAL HG23 H  -4.772  -6.772  -0.325 1.00 . A A . 80 VAL HG23 1 1 
        7  9617 1 1 83 VAL N    N  -4.423  -9.641   2.365 1.00 . A A . 80 VAL N    1 1 
        7  9618 1 1 83 VAL O    O  -6.441  -7.818   3.313 1.00 . A A . 80 VAL O    1 1 
        7  9619 1 1 84 PRO C    C  -5.761  -4.651   4.700 1.00 . A A . 81 PRO C    1 1 
        7  9620 1 1 84 PRO CA   C  -5.781  -6.038   5.387 1.00 . A A . 81 PRO CA   1 1 
        7  9621 1 1 84 PRO CB   C  -5.219  -5.970   6.817 1.00 . A A . 81 PRO CB   1 1 
        7  9622 1 1 84 PRO CD   C  -3.604  -7.138   5.440 1.00 . A A . 81 PRO CD   1 1 
        7  9623 1 1 84 PRO CG   C  -3.781  -6.349   6.716 1.00 . A A . 81 PRO CG   1 1 
        7  9624 1 1 84 PRO HA   H  -6.801  -6.416   5.413 1.00 . A A . 81 PRO HA   1 1 
        7  9625 1 1 84 PRO HB2  H  -5.326  -4.965   7.205 1.00 . A A . 81 PRO HB2  1 1 
        7  9626 1 1 84 PRO HB3  H  -5.744  -6.669   7.458 1.00 . A A . 81 PRO HB3  1 1 
        7  9627 1 1 84 PRO HD2  H  -2.791  -6.733   4.864 1.00 . A A . 81 PRO HD2  1 1 
        7  9628 1 1 84 PRO HD3  H  -3.409  -8.182   5.668 1.00 . A A . 81 PRO HD3  1 1 
        7  9629 1 1 84 PRO HG2  H  -3.178  -5.453   6.691 1.00 . A A . 81 PRO HG2  1 1 
        7  9630 1 1 84 PRO HG3  H  -3.501  -6.957   7.570 1.00 . A A . 81 PRO HG3  1 1 
        7  9631 1 1 84 PRO N    N  -4.884  -6.979   4.714 1.00 . A A . 81 PRO N    1 1 
        7  9632 1 1 84 PRO O    O  -5.857  -3.611   5.359 1.00 . A A . 81 PRO O    1 1 
        7  9633 1 1 85 PHE C    C  -6.762  -3.478   1.538 1.00 . A A . 82 PHE C    1 1 
        7  9634 1 1 85 PHE CA   C  -5.653  -3.416   2.565 1.00 . A A . 82 PHE CA   1 1 
        7  9635 1 1 85 PHE CB   C  -4.323  -3.129   1.809 1.00 . A A . 82 PHE CB   1 1 
        7  9636 1 1 85 PHE CD1  C  -2.692  -2.762   3.659 1.00 . A A . 82 PHE CD1  1 1 
        7  9637 1 1 85 PHE CD2  C  -2.196  -4.392   2.010 1.00 . A A . 82 PHE CD2  1 1 
        7  9638 1 1 85 PHE CE1  C  -1.507  -3.032   4.271 1.00 . A A . 82 PHE CE1  1 1 
        7  9639 1 1 85 PHE CE2  C  -0.994  -4.662   2.621 1.00 . A A . 82 PHE CE2  1 1 
        7  9640 1 1 85 PHE CG   C  -3.056  -3.441   2.523 1.00 . A A . 82 PHE CG   1 1 
        7  9641 1 1 85 PHE CZ   C  -0.657  -3.977   3.747 1.00 . A A . 82 PHE CZ   1 1 
        7  9642 1 1 85 PHE H    H  -5.734  -5.523   2.891 1.00 . A A . 82 PHE H    1 1 
        7  9643 1 1 85 PHE HA   H  -5.859  -2.593   3.237 1.00 . A A . 82 PHE HA   1 1 
        7  9644 1 1 85 PHE HB2  H  -4.305  -3.661   0.866 1.00 . A A . 82 PHE HB2  1 1 
        7  9645 1 1 85 PHE HB3  H  -4.302  -2.072   1.589 1.00 . A A . 82 PHE HB3  1 1 
        7  9646 1 1 85 PHE HD1  H  -3.351  -2.017   4.079 1.00 . A A . 82 PHE HD1  1 1 
        7  9647 1 1 85 PHE HD2  H  -2.479  -4.919   1.117 1.00 . A A . 82 PHE HD2  1 1 
        7  9648 1 1 85 PHE HE1  H  -1.232  -2.494   5.159 1.00 . A A . 82 PHE HE1  1 1 
        7  9649 1 1 85 PHE HE2  H  -0.315  -5.415   2.219 1.00 . A A . 82 PHE HE2  1 1 
        7  9650 1 1 85 PHE HZ   H   0.288  -4.173   4.231 1.00 . A A . 82 PHE HZ   1 1 
        7  9651 1 1 85 PHE N    N  -5.683  -4.653   3.357 1.00 . A A . 82 PHE N    1 1 
        7  9652 1 1 85 PHE O    O  -6.541  -3.282   0.341 1.00 . A A . 82 PHE O    1 1 
        7  9653 1 1 86 ASN C    C  -9.693  -2.299   1.023 1.00 . A A . 83 ASN C    1 1 
        7  9654 1 1 86 ASN CA   C  -9.142  -3.742   1.144 1.00 . A A . 83 ASN CA   1 1 
        7  9655 1 1 86 ASN CB   C -10.224  -4.709   1.664 1.00 . A A . 83 ASN CB   1 1 
        7  9656 1 1 86 ASN CG   C  -9.715  -6.129   1.842 1.00 . A A . 83 ASN CG   1 1 
        7  9657 1 1 86 ASN H    H  -8.072  -4.027   2.954 1.00 . A A . 83 ASN H    1 1 
        7  9658 1 1 86 ASN HA   H  -8.814  -4.076   0.174 1.00 . A A . 83 ASN HA   1 1 
        7  9659 1 1 86 ASN HB2  H -10.608  -4.361   2.614 1.00 . A A . 83 ASN HB2  1 1 
        7  9660 1 1 86 ASN HB3  H -11.035  -4.735   0.951 1.00 . A A . 83 ASN HB3  1 1 
        7  9661 1 1 86 ASN HD21 H -10.929  -6.381   3.386 1.00 . A A . 83 ASN HD21 1 1 
        7  9662 1 1 86 ASN HD22 H  -9.935  -7.736   2.986 1.00 . A A . 83 ASN HD22 1 1 
        7  9663 1 1 86 ASN N    N  -7.970  -3.759   2.014 1.00 . A A . 83 ASN N    1 1 
        7  9664 1 1 86 ASN ND2  N -10.248  -6.816   2.839 1.00 . A A . 83 ASN ND2  1 1 
        7  9665 1 1 86 ASN O    O -10.905  -2.070   1.098 1.00 . A A . 83 ASN O    1 1 
        7  9666 1 1 86 ASN OD1  O  -8.847  -6.601   1.106 1.00 . A A . 83 ASN OD1  1 1 
        7  9667 1 1 87 ALA C    C  -7.820   0.881   0.256 1.00 . A A . 84 ALA C    1 1 
        7  9668 1 1 87 ALA CA   C  -9.040   0.099   0.793 1.00 . A A . 84 ALA CA   1 1 
        7  9669 1 1 87 ALA CB   C  -9.401   0.583   2.210 1.00 . A A . 84 ALA CB   1 1 
        7  9670 1 1 87 ALA H    H  -7.844  -1.633   0.591 1.00 . A A . 84 ALA H    1 1 
        7  9671 1 1 87 ALA HA   H  -9.884   0.282   0.143 1.00 . A A . 84 ALA HA   1 1 
        7  9672 1 1 87 ALA HB1  H  -9.672   1.631   2.173 1.00 . A A . 84 ALA HB1  1 1 
        7  9673 1 1 87 ALA HB2  H  -8.553   0.459   2.868 1.00 . A A . 84 ALA HB2  1 1 
        7  9674 1 1 87 ALA HB3  H -10.240   0.011   2.590 1.00 . A A . 84 ALA HB3  1 1 
        7  9675 1 1 87 ALA N    N  -8.767  -1.342   0.793 1.00 . A A . 84 ALA N    1 1 
        7  9676 1 1 87 ALA O    O  -7.538   1.998   0.700 1.00 . A A . 84 ALA O    1 1 
        7  9677 1 1 88 ARG C    C  -5.792   0.600  -2.802 1.00 . A A . 85 ARG C    1 1 
        7  9678 1 1 88 ARG CA   C  -5.918   0.956  -1.306 1.00 . A A . 85 ARG CA   1 1 
        7  9679 1 1 88 ARG CB   C  -4.611   0.593  -0.546 1.00 . A A . 85 ARG CB   1 1 
        7  9680 1 1 88 ARG CD   C  -3.148   1.409   1.426 1.00 . A A . 85 ARG CD   1 1 
        7  9681 1 1 88 ARG CG   C  -3.917   1.784   0.142 1.00 . A A . 85 ARG CG   1 1 
        7  9682 1 1 88 ARG CZ   C  -1.015   2.742   1.134 1.00 . A A . 85 ARG CZ   1 1 
        7  9683 1 1 88 ARG H    H  -7.338  -0.624  -1.002 1.00 . A A . 85 ARG H    1 1 
        7  9684 1 1 88 ARG HA   H  -6.081   2.025  -1.234 1.00 . A A . 85 ARG HA   1 1 
        7  9685 1 1 88 ARG HB2  H  -4.830  -0.154   0.198 1.00 . A A . 85 ARG HB2  1 1 
        7  9686 1 1 88 ARG HB3  H  -3.917   0.184  -1.268 1.00 . A A . 85 ARG HB3  1 1 
        7  9687 1 1 88 ARG HD2  H  -3.491   2.035   2.240 1.00 . A A . 85 ARG HD2  1 1 
        7  9688 1 1 88 ARG HD3  H  -3.352   0.376   1.667 1.00 . A A . 85 ARG HD3  1 1 
        7  9689 1 1 88 ARG HE   H  -1.146   0.756   1.394 1.00 . A A . 85 ARG HE   1 1 
        7  9690 1 1 88 ARG HG2  H  -3.196   2.214  -0.551 1.00 . A A . 85 ARG HG2  1 1 
        7  9691 1 1 88 ARG HG3  H  -4.662   2.528   0.384 1.00 . A A . 85 ARG HG3  1 1 
        7  9692 1 1 88 ARG HH11 H  -2.660   3.926   1.094 1.00 . A A . 85 ARG HH11 1 1 
        7  9693 1 1 88 ARG HH12 H  -1.152   4.756   0.900 1.00 . A A . 85 ARG HH12 1 1 
        7  9694 1 1 88 ARG HH21 H   0.829   1.888   1.188 1.00 . A A . 85 ARG HH21 1 1 
        7  9695 1 1 88 ARG HH22 H   0.824   3.604   0.954 1.00 . A A . 85 ARG HH22 1 1 
        7  9696 1 1 88 ARG N    N  -7.088   0.284  -0.696 1.00 . A A . 85 ARG N    1 1 
        7  9697 1 1 88 ARG NE   N  -1.680   1.573   1.310 1.00 . A A . 85 ARG NE   1 1 
        7  9698 1 1 88 ARG NH1  N  -1.662   3.902   1.030 1.00 . A A . 85 ARG NH1  1 1 
        7  9699 1 1 88 ARG NH2  N   0.319   2.741   1.092 1.00 . A A . 85 ARG NH2  1 1 
        7  9700 1 1 88 ARG O    O  -4.689   0.350  -3.289 1.00 . A A . 85 ARG O    1 1 
        7  9701 1 1 89 GLU C    C  -6.949   1.659  -5.754 1.00 . A A . 86 GLU C    1 1 
        7  9702 1 1 89 GLU CA   C  -6.891   0.339  -4.978 1.00 . A A . 86 GLU CA   1 1 
        7  9703 1 1 89 GLU CB   C  -8.035  -0.606  -5.412 1.00 . A A . 86 GLU CB   1 1 
        7  9704 1 1 89 GLU CD   C  -7.772  -2.876  -6.549 1.00 . A A . 86 GLU CD   1 1 
        7  9705 1 1 89 GLU CG   C  -7.742  -2.108  -5.232 1.00 . A A . 86 GLU CG   1 1 
        7  9706 1 1 89 GLU H    H  -7.771   0.827  -3.111 1.00 . A A . 86 GLU H    1 1 
        7  9707 1 1 89 GLU HA   H  -5.947  -0.136  -5.194 1.00 . A A . 86 GLU HA   1 1 
        7  9708 1 1 89 GLU HB2  H  -8.918  -0.356  -4.841 1.00 . A A . 86 GLU HB2  1 1 
        7  9709 1 1 89 GLU HB3  H  -8.241  -0.428  -6.456 1.00 . A A . 86 GLU HB3  1 1 
        7  9710 1 1 89 GLU HG2  H  -6.762  -2.229  -4.792 1.00 . A A . 86 GLU HG2  1 1 
        7  9711 1 1 89 GLU HG3  H  -8.484  -2.543  -4.574 1.00 . A A . 86 GLU HG3  1 1 
        7  9712 1 1 89 GLU N    N  -6.917   0.604  -3.534 1.00 . A A . 86 GLU N    1 1 
        7  9713 1 1 89 GLU O    O  -8.036   2.278  -5.796 1.00 . A A . 86 GLU O    1 1 
        7  9714 1 1 89 GLU OXT  O  -5.892   2.087  -6.280 1.00 . A A . 86 GLU OXT  1 1 
        7  9715 1 1 89 GLU OE1  O  -6.719  -2.965  -7.214 1.00 . A A . 86 GLU OE1  1 1 
        7  9716 1 1 89 GLU OE2  O  -8.848  -3.403  -6.914 1.00 . A A . 86 GLU OE2  1 1 
        8  9717 1 1  1 GLY C    C -21.388   9.716   3.817 1.00 . A A . -2 GLY C    1 1 
        8  9718 1 1  1 GLY CA   C -22.565   8.777   3.617 1.00 . A A . -2 GLY CA   1 1 
        8  9719 1 1  1 GLY H1   H -24.510   8.807   2.848 1.00 . A A . -2 GLY H1   1 1 
        8  9720 1 1  1 GLY H2   H -23.436   9.842   2.051 1.00 . A A . -2 GLY H2   1 1 
        8  9721 1 1  1 GLY H3   H -24.033  10.259   3.577 1.00 . A A . -2 GLY H3   1 1 
        8  9722 1 1  1 GLY HA2  H -22.875   8.389   4.575 1.00 . A A . -2 GLY HA2  1 1 
        8  9723 1 1  1 GLY HA3  H -22.257   7.956   2.986 1.00 . A A . -2 GLY HA3  1 1 
        8  9724 1 1  1 GLY N    N -23.717   9.468   2.979 1.00 . A A . -2 GLY N    1 1 
        8  9725 1 1  1 GLY O    O -21.291  10.737   3.136 1.00 . A A . -2 GLY O    1 1 
        8  9726 1 1  2 SER C    C -18.032   9.508   4.729 1.00 . A A . -1 SER C    1 1 
        8  9727 1 1  2 SER CA   C -19.358  10.219   5.085 1.00 . A A . -1 SER CA   1 1 
        8  9728 1 1  2 SER CB   C -19.425  10.565   6.583 1.00 . A A . -1 SER CB   1 1 
        8  9729 1 1  2 SER H    H -20.601   8.509   5.206 1.00 . A A . -1 SER H    1 1 
        8  9730 1 1  2 SER HA   H -19.436  11.127   4.504 1.00 . A A . -1 SER HA   1 1 
        8  9731 1 1  2 SER HB2  H -20.448  10.784   6.849 1.00 . A A . -1 SER HB2  1 1 
        8  9732 1 1  2 SER HB3  H -19.083   9.718   7.159 1.00 . A A . -1 SER HB3  1 1 
        8  9733 1 1  2 SER HG   H -19.017  12.149   7.668 1.00 . A A . -1 SER HG   1 1 
        8  9734 1 1  2 SER N    N -20.497   9.367   4.743 1.00 . A A . -1 SER N    1 1 
        8  9735 1 1  2 SER O    O -18.044   8.397   4.197 1.00 . A A . -1 SER O    1 1 
        8  9736 1 1  2 SER OG   O -18.624  11.691   6.913 1.00 . A A . -1 SER OG   1 1 
        8  9737 1 1  3 HIS C    C -14.623   9.670   5.886 1.00 . A A .  0 HIS C    1 1 
        8  9738 1 1  3 HIS CA   C -15.568   9.615   4.683 1.00 . A A .  0 HIS CA   1 1 
        8  9739 1 1  3 HIS CB   C -14.947  10.377   3.501 1.00 . A A .  0 HIS CB   1 1 
        8  9740 1 1  3 HIS CD2  C -15.151   9.020   1.296 1.00 . A A .  0 HIS CD2  1 1 
        8  9741 1 1  3 HIS CE1  C -16.818  10.110   0.394 1.00 . A A .  0 HIS CE1  1 1 
        8  9742 1 1  3 HIS CG   C -15.508  10.001   2.160 1.00 . A A .  0 HIS CG   1 1 
        8  9743 1 1  3 HIS H    H -16.948  11.015   5.498 1.00 . A A .  0 HIS H    1 1 
        8  9744 1 1  3 HIS HA   H -15.704   8.581   4.397 1.00 . A A .  0 HIS HA   1 1 
        8  9745 1 1  3 HIS HB2  H -15.112  11.436   3.639 1.00 . A A .  0 HIS HB2  1 1 
        8  9746 1 1  3 HIS HB3  H -13.883  10.186   3.481 1.00 . A A .  0 HIS HB3  1 1 
        8  9747 1 1  3 HIS HD1  H -17.042  11.428   1.939 1.00 . A A .  0 HIS HD1  1 1 
        8  9748 1 1  3 HIS HD2  H -14.362   8.298   1.442 1.00 . A A .  0 HIS HD2  1 1 
        8  9749 1 1  3 HIS HE1  H -17.588  10.421  -0.290 1.00 . A A .  0 HIS HE1  1 1 
        8  9750 1 1  3 HIS HE2  H -15.794   8.699  -0.668 1.00 . A A .  0 HIS HE2  1 1 
        8  9751 1 1  3 HIS N    N -16.895  10.156   5.019 1.00 . A A .  0 HIS N    1 1 
        8  9752 1 1  3 HIS ND1  N -16.559  10.663   1.565 1.00 . A A .  0 HIS ND1  1 1 
        8  9753 1 1  3 HIS NE2  N -15.978   9.108   0.206 1.00 . A A .  0 HIS NE2  1 1 
        8  9754 1 1  3 HIS O    O -14.785  10.509   6.773 1.00 . A A .  0 HIS O    1 1 
        8  9755 1 1  4 MET C    C -11.266   9.066   6.580 1.00 . A A .  1 MET C    1 1 
        8  9756 1 1  4 MET CA   C -12.679   8.664   7.018 1.00 . A A .  1 MET CA   1 1 
        8  9757 1 1  4 MET CB   C -12.659   7.233   7.605 1.00 . A A .  1 MET CB   1 1 
        8  9758 1 1  4 MET CE   C -14.668   4.205   7.315 1.00 . A A .  1 MET CE   1 1 
        8  9759 1 1  4 MET CG   C -13.996   6.765   8.183 1.00 . A A .  1 MET CG   1 1 
        8  9760 1 1  4 MET H    H -13.527   8.161   5.139 1.00 . A A .  1 MET H    1 1 
        8  9761 1 1  4 MET HA   H -13.008   9.351   7.785 1.00 . A A .  1 MET HA   1 1 
        8  9762 1 1  4 MET HB2  H -12.372   6.544   6.823 1.00 . A A .  1 MET HB2  1 1 
        8  9763 1 1  4 MET HB3  H -11.916   7.195   8.391 1.00 . A A .  1 MET HB3  1 1 
        8  9764 1 1  4 MET HE1  H -15.149   3.578   6.581 1.00 . A A .  1 MET HE1  1 1 
        8  9765 1 1  4 MET HE2  H -15.036   3.949   8.299 1.00 . A A .  1 MET HE2  1 1 
        8  9766 1 1  4 MET HE3  H -13.599   4.051   7.281 1.00 . A A .  1 MET HE3  1 1 
        8  9767 1 1  4 MET HG2  H -13.800   6.083   8.997 1.00 . A A .  1 MET HG2  1 1 
        8  9768 1 1  4 MET HG3  H -14.528   7.626   8.561 1.00 . A A .  1 MET HG3  1 1 
        8  9769 1 1  4 MET N    N -13.631   8.768   5.899 1.00 . A A .  1 MET N    1 1 
        8  9770 1 1  4 MET O    O -10.859   8.799   5.449 1.00 . A A .  1 MET O    1 1 
        8  9771 1 1  4 MET SD   S -15.046   5.927   6.974 1.00 . A A .  1 MET SD   1 1 
        8  9772 1 1  5 VAL C    C  -8.163   9.551   8.174 1.00 . A A .  2 VAL C    1 1 
        8  9773 1 1  5 VAL CA   C  -9.160  10.193   7.199 1.00 . A A .  2 VAL CA   1 1 
        8  9774 1 1  5 VAL CB   C  -9.052  11.751   7.306 1.00 . A A .  2 VAL CB   1 1 
        8  9775 1 1  5 VAL CG1  C  -7.660  12.257   6.933 1.00 . A A .  2 VAL CG1  1 1 
        8  9776 1 1  5 VAL CG2  C -10.091  12.443   6.436 1.00 . A A .  2 VAL CG2  1 1 
        8  9777 1 1  5 VAL H    H -10.910   9.899   8.371 1.00 . A A .  2 VAL H    1 1 
        8  9778 1 1  5 VAL HA   H  -8.907   9.899   6.190 1.00 . A A .  2 VAL HA   1 1 
        8  9779 1 1  5 VAL HB   H  -9.240  12.029   8.332 1.00 . A A .  2 VAL HB   1 1 
        8  9780 1 1  5 VAL HG11 H  -7.631  13.332   7.028 1.00 . A A .  2 VAL HG11 1 1 
        8  9781 1 1  5 VAL HG12 H  -7.437  11.979   5.915 1.00 . A A .  2 VAL HG12 1 1 
        8  9782 1 1  5 VAL HG13 H  -6.927  11.816   7.593 1.00 . A A .  2 VAL HG13 1 1 
        8  9783 1 1  5 VAL HG21 H -11.079  12.125   6.735 1.00 . A A .  2 VAL HG21 1 1 
        8  9784 1 1  5 VAL HG22 H  -9.925  12.181   5.402 1.00 . A A .  2 VAL HG22 1 1 
        8  9785 1 1  5 VAL HG23 H -10.004  13.513   6.555 1.00 . A A .  2 VAL HG23 1 1 
        8  9786 1 1  5 VAL N    N -10.528   9.724   7.483 1.00 . A A .  2 VAL N    1 1 
        8  9787 1 1  5 VAL O    O  -8.354   9.608   9.393 1.00 . A A .  2 VAL O    1 1 
        8  9788 1 1  6 ILE C    C  -4.709   9.106   8.204 1.00 . A A .  3 ILE C    1 1 
        8  9789 1 1  6 ILE CA   C  -6.041   8.350   8.460 1.00 . A A .  3 ILE CA   1 1 
        8  9790 1 1  6 ILE CB   C  -5.845   6.806   8.190 1.00 . A A .  3 ILE CB   1 1 
        8  9791 1 1  6 ILE CD1  C  -4.099   5.674   6.700 1.00 . A A .  3 ILE CD1  1 1 
        8  9792 1 1  6 ILE CG1  C  -5.337   6.549   6.751 1.00 . A A .  3 ILE CG1  1 1 
        8  9793 1 1  6 ILE CG2  C  -7.142   6.004   8.468 1.00 . A A .  3 ILE CG2  1 1 
        8  9794 1 1  6 ILE H    H  -7.039   8.868   6.657 1.00 . A A .  3 ILE H    1 1 
        8  9795 1 1  6 ILE HA   H  -6.319   8.483   9.496 1.00 . A A .  3 ILE HA   1 1 
        8  9796 1 1  6 ILE HB   H  -5.100   6.440   8.883 1.00 . A A .  3 ILE HB   1 1 
        8  9797 1 1  6 ILE HD11 H  -3.826   5.496   5.671 1.00 . A A .  3 ILE HD11 1 1 
        8  9798 1 1  6 ILE HD12 H  -4.301   4.735   7.189 1.00 . A A .  3 ILE HD12 1 1 
        8  9799 1 1  6 ILE HD13 H  -3.284   6.176   7.205 1.00 . A A .  3 ILE HD13 1 1 
        8  9800 1 1  6 ILE HG12 H  -6.113   6.067   6.176 1.00 . A A .  3 ILE HG12 1 1 
        8  9801 1 1  6 ILE HG13 H  -5.080   7.497   6.285 1.00 . A A .  3 ILE HG13 1 1 
        8  9802 1 1  6 ILE HG21 H  -7.003   4.969   8.174 1.00 . A A .  3 ILE HG21 1 1 
        8  9803 1 1  6 ILE HG22 H  -7.969   6.423   7.906 1.00 . A A .  3 ILE HG22 1 1 
        8  9804 1 1  6 ILE HG23 H  -7.380   6.039   9.522 1.00 . A A .  3 ILE HG23 1 1 
        8  9805 1 1  6 ILE N    N  -7.107   8.930   7.635 1.00 . A A .  3 ILE N    1 1 
        8  9806 1 1  6 ILE O    O  -4.479   9.598   7.095 1.00 . A A .  3 ILE O    1 1 
        8  9807 1 1  7 ARG C    C  -1.491   8.945   9.873 1.00 . A A .  4 ARG C    1 1 
        8  9808 1 1  7 ARG CA   C  -2.504   9.768   9.041 1.00 . A A .  4 ARG CA   1 1 
        8  9809 1 1  7 ARG CB   C  -2.434  11.258   9.426 1.00 . A A .  4 ARG CB   1 1 
        8  9810 1 1  7 ARG CD   C  -3.212  13.088  10.985 1.00 . A A .  4 ARG CD   1 1 
        8  9811 1 1  7 ARG CG   C  -3.120  11.592  10.757 1.00 . A A .  4 ARG CG   1 1 
        8  9812 1 1  7 ARG CZ   C  -4.528  14.655  12.394 1.00 . A A .  4 ARG CZ   1 1 
        8  9813 1 1  7 ARG H    H  -4.177   9.122  10.155 1.00 . A A .  4 ARG H    1 1 
        8  9814 1 1  7 ARG HA   H  -2.289   9.666   7.989 1.00 . A A .  4 ARG HA   1 1 
        8  9815 1 1  7 ARG HB2  H  -1.394  11.542   9.502 1.00 . A A .  4 ARG HB2  1 1 
        8  9816 1 1  7 ARG HB3  H  -2.902  11.845   8.645 1.00 . A A .  4 ARG HB3  1 1 
        8  9817 1 1  7 ARG HD2  H  -2.222  13.472  11.181 1.00 . A A .  4 ARG HD2  1 1 
        8  9818 1 1  7 ARG HD3  H  -3.605  13.549  10.094 1.00 . A A .  4 ARG HD3  1 1 
        8  9819 1 1  7 ARG HE   H  -4.369  12.674  12.696 1.00 . A A .  4 ARG HE   1 1 
        8  9820 1 1  7 ARG HG2  H  -4.118  11.179  10.753 1.00 . A A .  4 ARG HG2  1 1 
        8  9821 1 1  7 ARG HG3  H  -2.549  11.147  11.562 1.00 . A A .  4 ARG HG3  1 1 
        8  9822 1 1  7 ARG HH11 H  -3.580  15.561  10.838 1.00 . A A .  4 ARG HH11 1 1 
        8  9823 1 1  7 ARG HH12 H  -4.513  16.617  11.842 1.00 . A A .  4 ARG HH12 1 1 
        8  9824 1 1  7 ARG HH21 H  -5.613  14.075  14.005 1.00 . A A .  4 ARG HH21 1 1 
        8  9825 1 1  7 ARG HH22 H  -5.669  15.766  13.646 1.00 . A A .  4 ARG HH22 1 1 
        8  9826 1 1  7 ARG N    N  -3.868   9.270   9.237 1.00 . A A .  4 ARG N    1 1 
        8  9827 1 1  7 ARG NE   N  -4.087  13.419  12.115 1.00 . A A .  4 ARG NE   1 1 
        8  9828 1 1  7 ARG NH1  N  -4.180  15.695  11.629 1.00 . A A .  4 ARG NH1  1 1 
        8  9829 1 1  7 ARG NH2  N  -5.331  14.848  13.435 1.00 . A A .  4 ARG NH2  1 1 
        8  9830 1 1  7 ARG O    O  -1.843   8.522  10.980 1.00 . A A .  4 ARG O    1 1 
        8  9831 1 1  8 GLU C    C   0.603   6.590  10.407 1.00 . A A .  5 GLU C    1 1 
        8  9832 1 1  8 GLU CA   C   0.889   8.076  10.046 1.00 . A A .  5 GLU CA   1 1 
        8  9833 1 1  8 GLU CB   C   1.261   8.919  11.322 1.00 . A A .  5 GLU CB   1 1 
        8  9834 1 1  8 GLU CD   C   2.860   9.437  13.232 1.00 . A A .  5 GLU CD   1 1 
        8  9835 1 1  8 GLU CG   C   2.535   8.498  12.085 1.00 . A A .  5 GLU CG   1 1 
        8  9836 1 1  8 GLU H    H  -0.135   8.878   8.351 1.00 . A A .  5 GLU H    1 1 
        8  9837 1 1  8 GLU HA   H   1.731   8.104   9.367 1.00 . A A .  5 GLU HA   1 1 
        8  9838 1 1  8 GLU HB2  H   1.376   9.957  11.039 1.00 . A A .  5 GLU HB2  1 1 
        8  9839 1 1  8 GLU HB3  H   0.431   8.855  12.010 1.00 . A A .  5 GLU HB3  1 1 
        8  9840 1 1  8 GLU HG2  H   2.381   7.514  12.506 1.00 . A A .  5 GLU HG2  1 1 
        8  9841 1 1  8 GLU HG3  H   3.384   8.473  11.416 1.00 . A A .  5 GLU HG3  1 1 
        8  9842 1 1  8 GLU N    N  -0.265   8.687   9.313 1.00 . A A .  5 GLU N    1 1 
        8  9843 1 1  8 GLU O    O   0.116   6.297  11.504 1.00 . A A .  5 GLU O    1 1 
        8  9844 1 1  8 GLU OE1  O   3.259  10.600  12.968 1.00 . A A .  5 GLU OE1  1 1 
        8  9845 1 1  8 GLU OE2  O   2.745   9.004  14.400 1.00 . A A .  5 GLU OE2  1 1 
        8  9846 1 1  9 SER C    C   1.653   3.338   9.052 1.00 . A A .  6 SER C    1 1 
        8  9847 1 1  9 SER CA   C   0.607   4.231   9.759 1.00 . A A .  6 SER CA   1 1 
        8  9848 1 1  9 SER CB   C  -0.822   3.823   9.335 1.00 . A A .  6 SER CB   1 1 
        8  9849 1 1  9 SER H    H   1.211   5.897   8.587 1.00 . A A .  6 SER H    1 1 
        8  9850 1 1  9 SER HA   H   0.698   4.116  10.828 1.00 . A A .  6 SER HA   1 1 
        8  9851 1 1  9 SER HB2  H  -1.527   4.576   9.655 1.00 . A A .  6 SER HB2  1 1 
        8  9852 1 1  9 SER HB3  H  -0.865   3.725   8.261 1.00 . A A .  6 SER HB3  1 1 
        8  9853 1 1  9 SER HG   H  -2.104   2.614  10.200 1.00 . A A .  6 SER HG   1 1 
        8  9854 1 1  9 SER N    N   0.849   5.648   9.472 1.00 . A A .  6 SER N    1 1 
        8  9855 1 1  9 SER O    O   2.345   3.803   8.138 1.00 . A A .  6 SER O    1 1 
        8  9856 1 1  9 SER OG   O  -1.190   2.576   9.914 1.00 . A A .  6 SER OG   1 1 
        8  9857 1 1 10 VAL C    C   1.830  -0.018   8.143 1.00 . A A .  7 VAL C    1 1 
        8  9858 1 1 10 VAL CA   C   2.667   1.083   8.819 1.00 . A A .  7 VAL CA   1 1 
        8  9859 1 1 10 VAL CB   C   3.775   0.460   9.788 1.00 . A A .  7 VAL CB   1 1 
        8  9860 1 1 10 VAL CG1  C   4.640   1.558  10.381 1.00 . A A .  7 VAL CG1  1 1 
        8  9861 1 1 10 VAL CG2  C   3.233  -0.456  10.919 1.00 . A A .  7 VAL CG2  1 1 
        8  9862 1 1 10 VAL H    H   1.148   1.737  10.158 1.00 . A A .  7 VAL H    1 1 
        8  9863 1 1 10 VAL HA   H   3.183   1.631   8.032 1.00 . A A .  7 VAL HA   1 1 
        8  9864 1 1 10 VAL HB   H   4.436  -0.151   9.180 1.00 . A A .  7 VAL HB   1 1 
        8  9865 1 1 10 VAL HG11 H   5.397   1.122  11.016 1.00 . A A .  7 VAL HG11 1 1 
        8  9866 1 1 10 VAL HG12 H   4.021   2.224  10.961 1.00 . A A .  7 VAL HG12 1 1 
        8  9867 1 1 10 VAL HG13 H   5.114   2.112   9.581 1.00 . A A .  7 VAL HG13 1 1 
        8  9868 1 1 10 VAL HG21 H   4.062  -0.795  11.533 1.00 . A A .  7 VAL HG21 1 1 
        8  9869 1 1 10 VAL HG22 H   2.746  -1.321  10.491 1.00 . A A .  7 VAL HG22 1 1 
        8  9870 1 1 10 VAL HG23 H   2.531   0.078  11.537 1.00 . A A .  7 VAL HG23 1 1 
        8  9871 1 1 10 VAL N    N   1.753   2.053   9.459 1.00 . A A .  7 VAL N    1 1 
        8  9872 1 1 10 VAL O    O   0.933  -0.594   8.759 1.00 . A A .  7 VAL O    1 1 
        8  9873 1 1 11 SER C    C   1.848  -2.655   6.316 1.00 . A A .  8 SER C    1 1 
        8  9874 1 1 11 SER CA   C   1.289  -1.237   6.088 1.00 . A A .  8 SER CA   1 1 
        8  9875 1 1 11 SER CB   C   1.286  -0.811   4.599 1.00 . A A .  8 SER CB   1 1 
        8  9876 1 1 11 SER H    H   2.798   0.240   6.395 1.00 . A A .  8 SER H    1 1 
        8  9877 1 1 11 SER HA   H   0.280  -1.207   6.465 1.00 . A A .  8 SER HA   1 1 
        8  9878 1 1 11 SER HB2  H   0.301  -0.431   4.337 1.00 . A A .  8 SER HB2  1 1 
        8  9879 1 1 11 SER HB3  H   2.008  -0.021   4.460 1.00 . A A .  8 SER HB3  1 1 
        8  9880 1 1 11 SER HG   H   2.564  -1.856   3.548 1.00 . A A .  8 SER HG   1 1 
        8  9881 1 1 11 SER N    N   2.071  -0.255   6.851 1.00 . A A .  8 SER N    1 1 
        8  9882 1 1 11 SER O    O   3.055  -2.825   6.341 1.00 . A A .  8 SER O    1 1 
        8  9883 1 1 11 SER OG   O   1.615  -1.871   3.721 1.00 . A A .  8 SER OG   1 1 
        8  9884 1 1 12 ARG C    C   0.725  -6.154   6.130 1.00 . A A .  9 ARG C    1 1 
        8  9885 1 1 12 ARG CA   C   1.478  -5.048   6.878 1.00 . A A .  9 ARG CA   1 1 
        8  9886 1 1 12 ARG CB   C   1.442  -5.400   8.406 1.00 . A A .  9 ARG CB   1 1 
        8  9887 1 1 12 ARG CD   C   0.693  -3.516   9.971 1.00 . A A .  9 ARG CD   1 1 
        8  9888 1 1 12 ARG CG   C   1.862  -4.275   9.350 1.00 . A A .  9 ARG CG   1 1 
        8  9889 1 1 12 ARG CZ   C   0.203  -4.476  12.212 1.00 . A A .  9 ARG CZ   1 1 
        8  9890 1 1 12 ARG H    H   0.015  -3.524   6.302 1.00 . A A .  9 ARG H    1 1 
        8  9891 1 1 12 ARG HA   H   2.505  -5.065   6.551 1.00 . A A .  9 ARG HA   1 1 
        8  9892 1 1 12 ARG HB2  H   0.458  -5.752   8.688 1.00 . A A .  9 ARG HB2  1 1 
        8  9893 1 1 12 ARG HB3  H   2.136  -6.220   8.565 1.00 . A A .  9 ARG HB3  1 1 
        8  9894 1 1 12 ARG HD2  H   1.087  -2.672  10.511 1.00 . A A .  9 ARG HD2  1 1 
        8  9895 1 1 12 ARG HD3  H   0.044  -3.159   9.183 1.00 . A A .  9 ARG HD3  1 1 
        8  9896 1 1 12 ARG HE   H  -0.878  -4.790  10.544 1.00 . A A .  9 ARG HE   1 1 
        8  9897 1 1 12 ARG HG2  H   2.449  -4.699  10.152 1.00 . A A .  9 ARG HG2  1 1 
        8  9898 1 1 12 ARG HG3  H   2.473  -3.575   8.796 1.00 . A A .  9 ARG HG3  1 1 
        8  9899 1 1 12 ARG HH11 H   1.878  -3.317  12.184 1.00 . A A .  9 ARG HH11 1 1 
        8  9900 1 1 12 ARG HH12 H   1.478  -3.995  13.727 1.00 . A A .  9 ARG HH12 1 1 
        8  9901 1 1 12 ARG HH21 H  -1.422  -5.624  12.610 1.00 . A A .  9 ARG HH21 1 1 
        8  9902 1 1 12 ARG HH22 H  -0.396  -5.307  13.964 1.00 . A A .  9 ARG HH22 1 1 
        8  9903 1 1 12 ARG N    N   0.975  -3.674   6.507 1.00 . A A .  9 ARG N    1 1 
        8  9904 1 1 12 ARG NE   N  -0.089  -4.331  10.906 1.00 . A A .  9 ARG NE   1 1 
        8  9905 1 1 12 ARG NH1  N   1.272  -3.880  12.754 1.00 . A A .  9 ARG NH1  1 1 
        8  9906 1 1 12 ARG NH2  N  -0.603  -5.194  12.990 1.00 . A A .  9 ARG NH2  1 1 
        8  9907 1 1 12 ARG O    O  -0.392  -5.928   5.684 1.00 . A A .  9 ARG O    1 1 
        8  9908 1 1 13 ILE C    C   0.805  -9.733   6.126 1.00 . A A . 10 ILE C    1 1 
        8  9909 1 1 13 ILE CA   C   0.690  -8.467   5.275 1.00 . A A . 10 ILE CA   1 1 
        8  9910 1 1 13 ILE CB   C   1.305  -8.731   3.835 1.00 . A A . 10 ILE CB   1 1 
        8  9911 1 1 13 ILE CD1  C   2.488  -6.587   3.032 1.00 . A A . 10 ILE CD1  1 1 
        8  9912 1 1 13 ILE CG1  C   1.289  -7.498   2.898 1.00 . A A . 10 ILE CG1  1 1 
        8  9913 1 1 13 ILE CG2  C   0.620  -9.902   3.106 1.00 . A A . 10 ILE CG2  1 1 
        8  9914 1 1 13 ILE H    H   2.206  -7.546   6.479 1.00 . A A . 10 ILE H    1 1 
        8  9915 1 1 13 ILE HA   H  -0.358  -8.224   5.167 1.00 . A A . 10 ILE HA   1 1 
        8  9916 1 1 13 ILE HB   H   2.324  -9.021   3.986 1.00 . A A . 10 ILE HB   1 1 
        8  9917 1 1 13 ILE HD11 H   2.556  -5.937   2.169 1.00 . A A . 10 ILE HD11 1 1 
        8  9918 1 1 13 ILE HD12 H   3.388  -7.169   3.095 1.00 . A A . 10 ILE HD12 1 1 
        8  9919 1 1 13 ILE HD13 H   2.388  -5.982   3.921 1.00 . A A . 10 ILE HD13 1 1 
        8  9920 1 1 13 ILE HG12 H   1.262  -7.830   1.878 1.00 . A A . 10 ILE HG12 1 1 
        8  9921 1 1 13 ILE HG13 H   0.404  -6.910   3.081 1.00 . A A . 10 ILE HG13 1 1 
        8  9922 1 1 13 ILE HG21 H   1.129 -10.085   2.169 1.00 . A A . 10 ILE HG21 1 1 
        8  9923 1 1 13 ILE HG22 H  -0.410  -9.658   2.902 1.00 . A A . 10 ILE HG22 1 1 
        8  9924 1 1 13 ILE HG23 H   0.670 -10.791   3.722 1.00 . A A . 10 ILE HG23 1 1 
        8  9925 1 1 13 ILE N    N   1.317  -7.366   6.019 1.00 . A A . 10 ILE N    1 1 
        8  9926 1 1 13 ILE O    O   1.891  -9.995   6.727 1.00 . A A . 10 ILE O    1 1 
        8  9927 1 1 14 TYR C    C  -0.604 -12.925   6.001 1.00 . A A . 11 TYR C    1 1 
        8  9928 1 1 14 TYR CA   C  -0.481 -11.703   6.979 1.00 . A A . 11 TYR CA   1 1 
        8  9929 1 1 14 TYR CB   C  -1.760 -11.561   7.844 1.00 . A A . 11 TYR CB   1 1 
        8  9930 1 1 14 TYR CD1  C  -1.378 -12.349  10.211 1.00 . A A . 11 TYR CD1  1 1 
        8  9931 1 1 14 TYR CD2  C  -2.700 -13.725   8.776 1.00 . A A . 11 TYR CD2  1 1 
        8  9932 1 1 14 TYR CE1  C  -1.565 -13.245  11.248 1.00 . A A . 11 TYR CE1  1 1 
        8  9933 1 1 14 TYR CE2  C  -2.897 -14.619   9.813 1.00 . A A . 11 TYR CE2  1 1 
        8  9934 1 1 14 TYR CG   C  -1.936 -12.575   8.956 1.00 . A A . 11 TYR CG   1 1 
        8  9935 1 1 14 TYR CZ   C  -2.328 -14.376  11.042 1.00 . A A . 11 TYR CZ   1 1 
        8  9936 1 1 14 TYR H    H  -1.151 -10.104   5.728 1.00 . A A . 11 TYR H    1 1 
        8  9937 1 1 14 TYR HA   H   0.373 -11.811   7.633 1.00 . A A . 11 TYR HA   1 1 
        8  9938 1 1 14 TYR HB2  H  -1.762 -10.584   8.310 1.00 . A A . 11 TYR HB2  1 1 
        8  9939 1 1 14 TYR HB3  H  -2.630 -11.634   7.199 1.00 . A A . 11 TYR HB3  1 1 
        8  9940 1 1 14 TYR HD1  H  -0.784 -11.461  10.369 1.00 . A A . 11 TYR HD1  1 1 
        8  9941 1 1 14 TYR HD2  H  -3.142 -13.917   7.809 1.00 . A A . 11 TYR HD2  1 1 
        8  9942 1 1 14 TYR HE1  H  -1.124 -13.052  12.216 1.00 . A A . 11 TYR HE1  1 1 
        8  9943 1 1 14 TYR HE2  H  -3.498 -15.500   9.655 1.00 . A A . 11 TYR HE2  1 1 
        8  9944 1 1 14 TYR HH   H  -2.503 -16.163  11.734 1.00 . A A . 11 TYR HH   1 1 
        8  9945 1 1 14 TYR N    N  -0.344 -10.451   6.210 1.00 . A A . 11 TYR N    1 1 
        8  9946 1 1 14 TYR O    O  -1.608 -13.014   5.263 1.00 . A A . 11 TYR O    1 1 
        8  9947 1 1 14 TYR OH   O  -2.530 -15.265  12.075 1.00 . A A . 11 TYR OH   1 1 
        8  9948 1 1 15 VAL C    C   0.278 -16.360   5.791 1.00 . A A . 12 VAL C    1 1 
        8  9949 1 1 15 VAL CA   C   0.217 -15.011   4.999 1.00 . A A . 12 VAL CA   1 1 
        8  9950 1 1 15 VAL CB   C   1.279 -14.891   3.777 1.00 . A A . 12 VAL CB   1 1 
        8  9951 1 1 15 VAL CG1  C   2.693 -14.657   4.275 1.00 . A A . 12 VAL CG1  1 1 
        8  9952 1 1 15 VAL CG2  C   1.308 -16.104   2.832 1.00 . A A . 12 VAL CG2  1 1 
        8  9953 1 1 15 VAL H    H   1.153 -13.883   6.595 1.00 . A A . 12 VAL H    1 1 
        8  9954 1 1 15 VAL HA   H  -0.787 -14.920   4.596 1.00 . A A . 12 VAL HA   1 1 
        8  9955 1 1 15 VAL HB   H   1.021 -14.014   3.163 1.00 . A A . 12 VAL HB   1 1 
        8  9956 1 1 15 VAL HG11 H   3.383 -14.682   3.445 1.00 . A A . 12 VAL HG11 1 1 
        8  9957 1 1 15 VAL HG12 H   2.946 -15.430   4.982 1.00 . A A . 12 VAL HG12 1 1 
        8  9958 1 1 15 VAL HG13 H   2.753 -13.691   4.759 1.00 . A A . 12 VAL HG13 1 1 
        8  9959 1 1 15 VAL HG21 H   1.403 -17.014   3.402 1.00 . A A . 12 VAL HG21 1 1 
        8  9960 1 1 15 VAL HG22 H   2.167 -16.018   2.173 1.00 . A A . 12 VAL HG22 1 1 
        8  9961 1 1 15 VAL HG23 H   0.418 -16.139   2.230 1.00 . A A . 12 VAL HG23 1 1 
        8  9962 1 1 15 VAL N    N   0.377 -13.883   5.955 1.00 . A A . 12 VAL N    1 1 
        8  9963 1 1 15 VAL O    O   1.346 -16.788   6.240 1.00 . A A . 12 VAL O    1 1 
        8  9964 1 1 16 GLY C    C  -1.604 -19.439   6.212 1.00 . A A . 13 GLY C    1 1 
        8  9965 1 1 16 GLY CA   C  -0.929 -18.231   6.848 1.00 . A A . 13 GLY CA   1 1 
        8  9966 1 1 16 GLY H    H  -1.756 -16.679   5.599 1.00 . A A . 13 GLY H    1 1 
        8  9967 1 1 16 GLY HA2  H   0.080 -18.506   7.100 1.00 . A A . 13 GLY HA2  1 1 
        8  9968 1 1 16 GLY HA3  H  -1.448 -17.984   7.757 1.00 . A A . 13 GLY HA3  1 1 
        8  9969 1 1 16 GLY N    N  -0.895 -17.024   5.999 1.00 . A A . 13 GLY N    1 1 
        8  9970 1 1 16 GLY O    O  -2.241 -19.307   5.165 1.00 . A A . 13 GLY O    1 1 
        8  9971 1 1 17 ASN C    C  -1.609 -22.224   4.847 1.00 . A A . 14 ASN C    1 1 
        8  9972 1 1 17 ASN CA   C  -1.996 -21.940   6.332 1.00 . A A . 14 ASN CA   1 1 
        8  9973 1 1 17 ASN CB   C  -3.532 -21.982   6.487 1.00 . A A . 14 ASN CB   1 1 
        8  9974 1 1 17 ASN CG   C  -4.007 -21.724   7.910 1.00 . A A . 14 ASN CG   1 1 
        8  9975 1 1 17 ASN H    H  -1.070 -20.639   7.777 1.00 . A A . 14 ASN H    1 1 
        8  9976 1 1 17 ASN HA   H  -1.586 -22.735   6.942 1.00 . A A . 14 ASN HA   1 1 
        8  9977 1 1 17 ASN HB2  H  -3.955 -21.224   5.857 1.00 . A A . 14 ASN HB2  1 1 
        8  9978 1 1 17 ASN HB3  H  -3.891 -22.950   6.177 1.00 . A A . 14 ASN HB3  1 1 
        8  9979 1 1 17 ASN HD21 H  -3.745 -23.633   8.386 1.00 . A A . 14 ASN HD21 1 1 
        8  9980 1 1 17 ASN HD22 H  -4.336 -22.617   9.653 1.00 . A A . 14 ASN HD22 1 1 
        8  9981 1 1 17 ASN N    N  -1.471 -20.639   6.862 1.00 . A A . 14 ASN N    1 1 
        8  9982 1 1 17 ASN ND2  N  -4.032 -22.764   8.728 1.00 . A A . 14 ASN ND2  1 1 
        8  9983 1 1 17 ASN O    O  -2.246 -23.009   4.187 1.00 . A A . 14 ASN O    1 1 
        8  9984 1 1 17 ASN OD1  O  -4.337 -20.594   8.274 1.00 . A A . 14 ASN OD1  1 1 
        8  9985 1 1 18 LEU C    C   0.742 -22.892   2.637 1.00 . A A . 15 LEU C    1 1 
        8  9986 1 1 18 LEU CA   C  -0.081 -21.624   2.989 1.00 . A A . 15 LEU CA   1 1 
        8  9987 1 1 18 LEU CB   C   0.769 -20.345   2.764 1.00 . A A . 15 LEU CB   1 1 
        8  9988 1 1 18 LEU CD1  C   3.058 -19.377   2.664 1.00 . A A . 15 LEU CD1  1 1 
        8  9989 1 1 18 LEU CD2  C   2.140 -19.900   4.879 1.00 . A A . 15 LEU CD2  1 1 
        8  9990 1 1 18 LEU CG   C   2.170 -20.323   3.413 1.00 . A A . 15 LEU CG   1 1 
        8  9991 1 1 18 LEU H    H   0.017 -21.133   4.986 1.00 . A A . 15 LEU H    1 1 
        8  9992 1 1 18 LEU HA   H  -0.964 -21.588   2.365 1.00 . A A . 15 LEU HA   1 1 
        8  9993 1 1 18 LEU HB2  H   0.885 -20.196   1.703 1.00 . A A . 15 LEU HB2  1 1 
        8  9994 1 1 18 LEU HB3  H   0.217 -19.500   3.169 1.00 . A A . 15 LEU HB3  1 1 
        8  9995 1 1 18 LEU HD11 H   2.506 -18.490   2.394 1.00 . A A . 15 LEU HD11 1 1 
        8  9996 1 1 18 LEU HD12 H   3.438 -19.856   1.775 1.00 . A A . 15 LEU HD12 1 1 
        8  9997 1 1 18 LEU HD13 H   3.878 -19.100   3.311 1.00 . A A . 15 LEU HD13 1 1 
        8  9998 1 1 18 LEU HD21 H   3.149 -19.810   5.248 1.00 . A A . 15 LEU HD21 1 1 
        8  9999 1 1 18 LEU HD22 H   1.617 -20.645   5.450 1.00 . A A . 15 LEU HD22 1 1 
        8 10000 1 1 18 LEU HD23 H   1.633 -18.951   4.970 1.00 . A A . 15 LEU HD23 1 1 
        8 10001 1 1 18 LEU HG   H   2.604 -21.308   3.354 1.00 . A A . 15 LEU HG   1 1 
        8 10002 1 1 18 LEU N    N  -0.513 -21.629   4.381 1.00 . A A . 15 LEU N    1 1 
        8 10003 1 1 18 LEU O    O   1.399 -23.460   3.521 1.00 . A A . 15 LEU O    1 1 
        8 10004 1 1 19 PRO C    C   3.042 -24.040   0.776 1.00 . A A . 16 PRO C    1 1 
        8 10005 1 1 19 PRO CA   C   1.564 -24.486   0.913 1.00 . A A . 16 PRO CA   1 1 
        8 10006 1 1 19 PRO CB   C   0.954 -24.900  -0.444 1.00 . A A . 16 PRO CB   1 1 
        8 10007 1 1 19 PRO CD   C  -0.225 -22.931   0.279 1.00 . A A . 16 PRO CD   1 1 
        8 10008 1 1 19 PRO CG   C   0.188 -23.720  -0.932 1.00 . A A . 16 PRO CG   1 1 
        8 10009 1 1 19 PRO HA   H   1.485 -25.312   1.606 1.00 . A A . 16 PRO HA   1 1 
        8 10010 1 1 19 PRO HB2  H   1.734 -25.157  -1.150 1.00 . A A . 16 PRO HB2  1 1 
        8 10011 1 1 19 PRO HB3  H   0.286 -25.736  -0.302 1.00 . A A . 16 PRO HB3  1 1 
        8 10012 1 1 19 PRO HD2  H  -0.115 -21.880   0.081 1.00 . A A . 16 PRO HD2  1 1 
        8 10013 1 1 19 PRO HD3  H  -1.243 -23.160   0.536 1.00 . A A . 16 PRO HD3  1 1 
        8 10014 1 1 19 PRO HG2  H   0.818 -23.115  -1.577 1.00 . A A . 16 PRO HG2  1 1 
        8 10015 1 1 19 PRO HG3  H  -0.688 -24.055  -1.472 1.00 . A A . 16 PRO HG3  1 1 
        8 10016 1 1 19 PRO N    N   0.700 -23.373   1.358 1.00 . A A . 16 PRO N    1 1 
        8 10017 1 1 19 PRO O    O   3.264 -22.885   0.410 1.00 . A A . 16 PRO O    1 1 
        8 10018 1 1 20 SER C    C   6.043 -23.898   2.257 1.00 . A A . 17 SER C    1 1 
        8 10019 1 1 20 SER CA   C   5.508 -24.731   1.082 1.00 . A A . 17 SER CA   1 1 
        8 10020 1 1 20 SER CB   C   6.018 -24.172  -0.284 1.00 . A A . 17 SER CB   1 1 
        8 10021 1 1 20 SER H    H   3.749 -25.766   1.623 1.00 . A A . 17 SER H    1 1 
        8 10022 1 1 20 SER HA   H   5.937 -25.726   1.199 1.00 . A A . 17 SER HA   1 1 
        8 10023 1 1 20 SER HB2  H   7.046 -24.482  -0.422 1.00 . A A . 17 SER HB2  1 1 
        8 10024 1 1 20 SER HB3  H   5.418 -24.581  -1.082 1.00 . A A . 17 SER HB3  1 1 
        8 10025 1 1 20 SER HG   H   6.870 -22.407  -0.445 1.00 . A A . 17 SER HG   1 1 
        8 10026 1 1 20 SER N    N   4.027 -24.928   1.179 1.00 . A A . 17 SER N    1 1 
        8 10027 1 1 20 SER O    O   7.143 -24.179   2.757 1.00 . A A . 17 SER O    1 1 
        8 10028 1 1 20 SER OG   O   5.970 -22.752  -0.367 1.00 . A A . 17 SER OG   1 1 
        8 10029 1 1 21 HIS C    C   6.716 -21.112   3.488 1.00 . A A . 18 HIS C    1 1 
        8 10030 1 1 21 HIS CA   C   5.522 -22.010   3.846 1.00 . A A . 18 HIS CA   1 1 
        8 10031 1 1 21 HIS CB   C   5.791 -22.738   5.189 1.00 . A A . 18 HIS CB   1 1 
        8 10032 1 1 21 HIS CD2  C   5.035 -25.183   5.699 1.00 . A A . 18 HIS CD2  1 1 
        8 10033 1 1 21 HIS CE1  C   2.920 -24.794   6.094 1.00 . A A . 18 HIS CE1  1 1 
        8 10034 1 1 21 HIS CG   C   4.831 -23.847   5.553 1.00 . A A . 18 HIS CG   1 1 
        8 10035 1 1 21 HIS H    H   4.368 -22.806   2.254 1.00 . A A . 18 HIS H    1 1 
        8 10036 1 1 21 HIS HA   H   4.655 -21.371   3.972 1.00 . A A . 18 HIS HA   1 1 
        8 10037 1 1 21 HIS HB2  H   6.770 -23.164   5.140 1.00 . A A . 18 HIS HB2  1 1 
        8 10038 1 1 21 HIS HB3  H   5.769 -22.011   5.984 1.00 . A A . 18 HIS HB3  1 1 
        8 10039 1 1 21 HIS HD1  H   3.029 -22.780   5.756 1.00 . A A . 18 HIS HD1  1 1 
        8 10040 1 1 21 HIS HD2  H   5.977 -25.702   5.588 1.00 . A A . 18 HIS HD2  1 1 
        8 10041 1 1 21 HIS HE1  H   1.882 -24.929   6.350 1.00 . A A . 18 HIS HE1  1 1 
        8 10042 1 1 21 HIS HE2  H   3.637 -26.715   6.036 1.00 . A A . 18 HIS HE2  1 1 
        8 10043 1 1 21 HIS N    N   5.220 -22.926   2.724 1.00 . A A . 18 HIS N    1 1 
        8 10044 1 1 21 HIS ND1  N   3.495 -23.640   5.806 1.00 . A A . 18 HIS ND1  1 1 
        8 10045 1 1 21 HIS NE2  N   3.830 -25.748   6.030 1.00 . A A . 18 HIS NE2  1 1 
        8 10046 1 1 21 HIS O    O   7.860 -21.453   3.795 1.00 . A A . 18 HIS O    1 1 
        8 10047 1 1 22 VAL C    C   8.261 -18.453   3.492 1.00 . A A . 19 VAL C    1 1 
        8 10048 1 1 22 VAL CA   C   7.446 -19.045   2.295 1.00 . A A . 19 VAL CA   1 1 
        8 10049 1 1 22 VAL CB   C   6.787 -17.928   1.360 1.00 . A A . 19 VAL CB   1 1 
        8 10050 1 1 22 VAL CG1  C   5.621 -17.160   1.988 1.00 . A A . 19 VAL CG1  1 1 
        8 10051 1 1 22 VAL CG2  C   7.797 -16.943   0.825 1.00 . A A . 19 VAL CG2  1 1 
        8 10052 1 1 22 VAL H    H   5.480 -19.826   2.573 1.00 . A A . 19 VAL H    1 1 
        8 10053 1 1 22 VAL HA   H   8.119 -19.619   1.675 1.00 . A A . 19 VAL HA   1 1 
        8 10054 1 1 22 VAL HB   H   6.391 -18.442   0.492 1.00 . A A . 19 VAL HB   1 1 
        8 10055 1 1 22 VAL HG11 H   5.904 -16.768   2.955 1.00 . A A . 19 VAL HG11 1 1 
        8 10056 1 1 22 VAL HG12 H   4.781 -17.819   2.097 1.00 . A A . 19 VAL HG12 1 1 
        8 10057 1 1 22 VAL HG13 H   5.335 -16.343   1.340 1.00 . A A . 19 VAL HG13 1 1 
        8 10058 1 1 22 VAL HG21 H   8.498 -17.467   0.204 1.00 . A A . 19 VAL HG21 1 1 
        8 10059 1 1 22 VAL HG22 H   8.305 -16.455   1.643 1.00 . A A . 19 VAL HG22 1 1 
        8 10060 1 1 22 VAL HG23 H   7.286 -16.199   0.226 1.00 . A A . 19 VAL HG23 1 1 
        8 10061 1 1 22 VAL N    N   6.421 -19.996   2.785 1.00 . A A . 19 VAL N    1 1 
        8 10062 1 1 22 VAL O    O   7.682 -17.870   4.418 1.00 . A A . 19 VAL O    1 1 
        8 10063 1 1 23 SER C    C  10.774 -16.667   4.356 1.00 . A A . 20 SER C    1 1 
        8 10064 1 1 23 SER CA   C  10.466 -18.173   4.592 1.00 . A A . 20 SER CA   1 1 
        8 10065 1 1 23 SER CB   C  11.749 -19.049   4.611 1.00 . A A . 20 SER CB   1 1 
        8 10066 1 1 23 SER H    H  10.043 -19.194   2.784 1.00 . A A . 20 SER H    1 1 
        8 10067 1 1 23 SER HA   H   9.936 -18.308   5.524 1.00 . A A . 20 SER HA   1 1 
        8 10068 1 1 23 SER HB2  H  12.392 -18.799   3.782 1.00 . A A . 20 SER HB2  1 1 
        8 10069 1 1 23 SER HB3  H  12.293 -18.919   5.536 1.00 . A A . 20 SER HB3  1 1 
        8 10070 1 1 23 SER HG   H  10.551 -20.493   4.054 1.00 . A A . 20 SER HG   1 1 
        8 10071 1 1 23 SER N    N   9.608 -18.661   3.502 1.00 . A A . 20 SER N    1 1 
        8 10072 1 1 23 SER O    O  10.643 -16.217   3.215 1.00 . A A . 20 SER O    1 1 
        8 10073 1 1 23 SER OG   O  11.391 -20.418   4.514 1.00 . A A . 20 SER OG   1 1 
        8 10074 1 1 24 SER C    C  12.433 -14.048   4.208 1.00 . A A . 21 SER C    1 1 
        8 10075 1 1 24 SER CA   C  11.433 -14.444   5.323 1.00 . A A . 21 SER CA   1 1 
        8 10076 1 1 24 SER CB   C  11.927 -13.932   6.686 1.00 . A A . 21 SER CB   1 1 
        8 10077 1 1 24 SER H    H  11.102 -16.246   6.334 1.00 . A A . 21 SER H    1 1 
        8 10078 1 1 24 SER HA   H  10.498 -13.948   5.110 1.00 . A A . 21 SER HA   1 1 
        8 10079 1 1 24 SER HB2  H  12.376 -12.954   6.560 1.00 . A A . 21 SER HB2  1 1 
        8 10080 1 1 24 SER HB3  H  11.089 -13.861   7.359 1.00 . A A . 21 SER HB3  1 1 
        8 10081 1 1 24 SER HG   H  13.550 -14.301   7.730 1.00 . A A . 21 SER HG   1 1 
        8 10082 1 1 24 SER N    N  11.126 -15.881   5.428 1.00 . A A . 21 SER N    1 1 
        8 10083 1 1 24 SER O    O  12.252 -12.988   3.608 1.00 . A A . 21 SER O    1 1 
        8 10084 1 1 24 SER OG   O  12.889 -14.814   7.249 1.00 . A A . 21 SER OG   1 1 
        8 10085 1 1 25 ARG C    C  13.621 -14.503   1.380 1.00 . A A . 22 ARG C    1 1 
        8 10086 1 1 25 ARG CA   C  14.380 -14.597   2.772 1.00 . A A . 22 ARG CA   1 1 
        8 10087 1 1 25 ARG CB   C  15.664 -15.538   2.730 1.00 . A A . 22 ARG CB   1 1 
        8 10088 1 1 25 ARG CD   C  15.919 -16.913   0.585 1.00 . A A . 22 ARG CD   1 1 
        8 10089 1 1 25 ARG CG   C  16.371 -15.684   1.375 1.00 . A A . 22 ARG CG   1 1 
        8 10090 1 1 25 ARG CZ   C  18.080 -17.957  -0.100 1.00 . A A . 22 ARG CZ   1 1 
        8 10091 1 1 25 ARG H    H  13.694 -15.583   4.576 1.00 . A A . 22 ARG H    1 1 
        8 10092 1 1 25 ARG HA   H  14.744 -13.607   2.987 1.00 . A A . 22 ARG HA   1 1 
        8 10093 1 1 25 ARG HB2  H  16.394 -15.110   3.391 1.00 . A A . 22 ARG HB2  1 1 
        8 10094 1 1 25 ARG HB3  H  15.446 -16.533   3.094 1.00 . A A . 22 ARG HB3  1 1 
        8 10095 1 1 25 ARG HD2  H  15.015 -17.298   1.031 1.00 . A A . 22 ARG HD2  1 1 
        8 10096 1 1 25 ARG HD3  H  15.724 -16.625  -0.436 1.00 . A A . 22 ARG HD3  1 1 
        8 10097 1 1 25 ARG HE   H  16.729 -18.770   1.146 1.00 . A A . 22 ARG HE   1 1 
        8 10098 1 1 25 ARG HG2  H  16.190 -14.811   0.775 1.00 . A A . 22 ARG HG2  1 1 
        8 10099 1 1 25 ARG HG3  H  17.431 -15.772   1.556 1.00 . A A . 22 ARG HG3  1 1 
        8 10100 1 1 25 ARG HH11 H  17.786 -16.137  -0.944 1.00 . A A . 22 ARG HH11 1 1 
        8 10101 1 1 25 ARG HH12 H  19.267 -16.911  -1.381 1.00 . A A . 22 ARG HH12 1 1 
        8 10102 1 1 25 ARG HH21 H  18.666 -19.781   0.541 1.00 . A A . 22 ARG HH21 1 1 
        8 10103 1 1 25 ARG HH22 H  19.771 -18.993  -0.532 1.00 . A A . 22 ARG HH22 1 1 
        8 10104 1 1 25 ARG N    N  13.480 -14.865   3.938 1.00 . A A . 22 ARG N    1 1 
        8 10105 1 1 25 ARG NE   N  16.930 -17.979   0.598 1.00 . A A . 22 ARG NE   1 1 
        8 10106 1 1 25 ARG NH1  N  18.406 -16.917  -0.871 1.00 . A A . 22 ARG NH1  1 1 
        8 10107 1 1 25 ARG NH2  N  18.900 -18.994  -0.025 1.00 . A A . 22 ARG NH2  1 1 
        8 10108 1 1 25 ARG O    O  13.840 -13.536   0.617 1.00 . A A . 22 ARG O    1 1 
        8 10109 1 1 26 ASP C    C  11.024 -14.282  -0.381 1.00 . A A . 23 ASP C    1 1 
        8 10110 1 1 26 ASP CA   C  11.948 -15.510  -0.216 1.00 . A A . 23 ASP CA   1 1 
        8 10111 1 1 26 ASP CB   C  11.106 -16.812  -0.327 1.00 . A A . 23 ASP CB   1 1 
        8 10112 1 1 26 ASP CG   C  11.928 -18.059  -0.048 1.00 . A A . 23 ASP CG   1 1 
        8 10113 1 1 26 ASP H    H  12.574 -16.201   1.700 1.00 . A A . 23 ASP H    1 1 
        8 10114 1 1 26 ASP HA   H  12.674 -15.502  -1.017 1.00 . A A . 23 ASP HA   1 1 
        8 10115 1 1 26 ASP HB2  H  10.290 -16.777   0.376 1.00 . A A . 23 ASP HB2  1 1 
        8 10116 1 1 26 ASP HB3  H  10.677 -16.899  -1.322 1.00 . A A . 23 ASP HB3  1 1 
        8 10117 1 1 26 ASP N    N  12.715 -15.473   1.068 1.00 . A A . 23 ASP N    1 1 
        8 10118 1 1 26 ASP O    O  11.071 -13.593  -1.442 1.00 . A A . 23 ASP O    1 1 
        8 10119 1 1 26 ASP OD1  O  12.696 -18.473  -0.938 1.00 . A A . 23 ASP OD1  1 1 
        8 10120 1 1 26 ASP OD2  O  11.821 -18.609   1.074 1.00 . A A . 23 ASP OD2  1 1 
        8 10121 1 1 27 VAL C    C  10.149 -11.537   0.588 1.00 . A A . 24 VAL C    1 1 
        8 10122 1 1 27 VAL CA   C   9.340 -12.817   0.687 1.00 . A A . 24 VAL CA   1 1 
        8 10123 1 1 27 VAL CB   C   8.324 -12.727   1.864 1.00 . A A . 24 VAL CB   1 1 
        8 10124 1 1 27 VAL CG1  C   7.023 -13.390   1.517 1.00 . A A . 24 VAL CG1  1 1 
        8 10125 1 1 27 VAL CG2  C   8.814 -13.328   3.144 1.00 . A A . 24 VAL CG2  1 1 
        8 10126 1 1 27 VAL H    H  10.149 -14.616   1.440 1.00 . A A . 24 VAL H    1 1 
        8 10127 1 1 27 VAL HA   H   8.755 -12.872  -0.211 1.00 . A A . 24 VAL HA   1 1 
        8 10128 1 1 27 VAL HB   H   8.117 -11.685   2.045 1.00 . A A . 24 VAL HB   1 1 
        8 10129 1 1 27 VAL HG11 H   6.454 -12.737   0.884 1.00 . A A . 24 VAL HG11 1 1 
        8 10130 1 1 27 VAL HG12 H   6.474 -13.592   2.425 1.00 . A A . 24 VAL HG12 1 1 
        8 10131 1 1 27 VAL HG13 H   7.216 -14.316   0.995 1.00 . A A . 24 VAL HG13 1 1 
        8 10132 1 1 27 VAL HG21 H   9.691 -12.803   3.469 1.00 . A A . 24 VAL HG21 1 1 
        8 10133 1 1 27 VAL HG22 H   9.042 -14.375   2.991 1.00 . A A . 24 VAL HG22 1 1 
        8 10134 1 1 27 VAL HG23 H   8.040 -13.235   3.886 1.00 . A A . 24 VAL HG23 1 1 
        8 10135 1 1 27 VAL N    N  10.194 -14.000   0.674 1.00 . A A . 24 VAL N    1 1 
        8 10136 1 1 27 VAL O    O   9.813 -10.706  -0.213 1.00 . A A . 24 VAL O    1 1 
        8 10137 1 1 28 GLU C    C  12.569 -10.135  -0.368 1.00 . A A . 25 GLU C    1 1 
        8 10138 1 1 28 GLU CA   C  12.118 -10.240   1.120 1.00 . A A . 25 GLU CA   1 1 
        8 10139 1 1 28 GLU CB   C  13.266 -10.127   2.198 1.00 . A A . 25 GLU CB   1 1 
        8 10140 1 1 28 GLU CD   C