NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
446938 2knr 16476 cing 4-filtered-FRED STAR entry full 4009


data_FRED_restraints_with_modified_coordinates_PDB_code_2knr

# This FRED archive file contains, for PDB entry <2knr>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2knr
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2knr
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        13249.79

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Uncharacterized_protein_ATC0905 A . 1 1 
    stop_

save_


save_Uncharacterized_protein_ATC0905
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Uncharacterized protein ATC0905"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  QGHMRLKSEMFVSALIRRVFAAGGFAAVEKKGAEAAGAIFVRQRLRDGRENLYGPAPQSFADDEDIMRAERRFETRLAGVEGEEIAALLERERRFDSDLWVVEIETDEIGTLLTLVDQPQA
    _Entity.Number_of_monomers           121

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 GLN . 1 1 
         2 GLY . 1 1 
         3 HIS . 1 1 
         4 MET . 1 1 
         5 ARG . 1 1 
         6 LEU . 1 1 
         7 LYS . 1 1 
         8 SER . 1 1 
         9 GLU . 1 1 
        10 MET . 1 1 
        11 PHE . 1 1 
        12 VAL . 1 1 
        13 SER . 1 1 
        14 ALA . 1 1 
        15 LEU . 1 1 
        16 ILE . 1 1 
        17 ARG . 1 1 
        18 ARG . 1 1 
        19 VAL . 1 1 
        20 PHE . 1 1 
        21 ALA . 1 1 
        22 ALA . 1 1 
        23 GLY . 1 1 
        24 GLY . 1 1 
        25 PHE . 1 1 
        26 ALA . 1 1 
        27 ALA . 1 1 
        28 VAL . 1 1 
        29 GLU . 1 1 
        30 LYS . 1 1 
        31 LYS . 1 1 
        32 GLY . 1 1 
        33 ALA . 1 1 
        34 GLU . 1 1 
        35 ALA . 1 1 
        36 ALA . 1 1 
        37 GLY . 1 1 
        38 ALA . 1 1 
        39 ILE . 1 1 
        40 PHE . 1 1 
        41 VAL . 1 1 
        42 ARG . 1 1 
        43 GLN . 1 1 
        44 ARG . 1 1 
        45 LEU . 1 1 
        46 ARG . 1 1 
        47 ASP . 1 1 
        48 GLY . 1 1 
        49 ARG . 1 1 
        50 GLU . 1 1 
        51 ASN . 1 1 
        52 LEU . 1 1 
        53 TYR . 1 1 
        54 GLY . 1 1 
        55 PRO . 1 1 
        56 ALA . 1 1 
        57 PRO . 1 1 
        58 GLN . 1 1 
        59 SER . 1 1 
        60 PHE . 1 1 
        61 ALA . 1 1 
        62 ASP . 1 1 
        63 ASP . 1 1 
        64 GLU . 1 1 
        65 ASP . 1 1 
        66 ILE . 1 1 
        67 MET . 1 1 
        68 ARG . 1 1 
        69 ALA . 1 1 
        70 GLU . 1 1 
        71 ARG . 1 1 
        72 ARG . 1 1 
        73 PHE . 1 1 
        74 GLU . 1 1 
        75 THR . 1 1 
        76 ARG . 1 1 
        77 LEU . 1 1 
        78 ALA . 1 1 
        79 GLY . 1 1 
        80 VAL . 1 1 
        81 GLU . 1 1 
        82 GLY . 1 1 
        83 GLU . 1 1 
        84 GLU . 1 1 
        85 ILE . 1 1 
        86 ALA . 1 1 
        87 ALA . 1 1 
        88 LEU . 1 1 
        89 LEU . 1 1 
        90 GLU . 1 1 
        91 ARG . 1 1 
        92 GLU . 1 1 
        93 ARG . 1 1 
        94 ARG . 1 1 
        95 PHE . 1 1 
        96 ASP . 1 1 
        97 SER . 1 1 
        98 ASP . 1 1 
        99 LEU . 1 1 
       100 TRP . 1 1 
       101 VAL . 1 1 
       102 VAL . 1 1 
       103 GLU . 1 1 
       104 ILE . 1 1 
       105 GLU . 1 1 
       106 THR . 1 1 
       107 ASP . 1 1 
       108 GLU . 1 1 
       109 ILE . 1 1 
       110 GLY . 1 1 
       111 THR . 1 1 
       112 LEU . 1 1 
       113 LEU . 1 1 
       114 THR . 1 1 
       115 LEU . 1 1 
       116 VAL . 1 1 
       117 ASP . 1 1 
       118 GLN . 1 1 
       119 PRO . 1 1 
       120 GLN . 1 1 
       121 ALA . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLN   1   1 1 1 
       GLY   2   2 1 1 
       HIS   3   3 1 1 
       MET   4   4 1 1 
       ARG   5   5 1 1 
       LEU   6   6 1 1 
       LYS   7   7 1 1 
       SER   8   8 1 1 
       GLU   9   9 1 1 
       MET  10  10 1 1 
       PHE  11  11 1 1 
       VAL  12  12 1 1 
       SER  13  13 1 1 
       ALA  14  14 1 1 
       LEU  15  15 1 1 
       ILE  16  16 1 1 
       ARG  17  17 1 1 
       ARG  18  18 1 1 
       VAL  19  19 1 1 
       PHE  20  20 1 1 
       ALA  21  21 1 1 
       ALA  22  22 1 1 
       GLY  23  23 1 1 
       GLY  24  24 1 1 
       PHE  25  25 1 1 
       ALA  26  26 1 1 
       ALA  27  27 1 1 
       VAL  28  28 1 1 
       GLU  29  29 1 1 
       LYS  30  30 1 1 
       LYS  31  31 1 1 
       GLY  32  32 1 1 
       ALA  33  33 1 1 
       GLU  34  34 1 1 
       ALA  35  35 1 1 
       ALA  36  36 1 1 
       GLY  37  37 1 1 
       ALA  38  38 1 1 
       ILE  39  39 1 1 
       PHE  40  40 1 1 
       VAL  41  41 1 1 
       ARG  42  42 1 1 
       GLN  43  43 1 1 
       ARG  44  44 1 1 
       LEU  45  45 1 1 
       ARG  46  46 1 1 
       ASP  47  47 1 1 
       GLY  48  48 1 1 
       ARG  49  49 1 1 
       GLU  50  50 1 1 
       ASN  51  51 1 1 
       LEU  52  52 1 1 
       TYR  53  53 1 1 
       GLY  54  54 1 1 
       PRO  55  55 1 1 
       ALA  56  56 1 1 
       PRO  57  57 1 1 
       GLN  58  58 1 1 
       SER  59  59 1 1 
       PHE  60  60 1 1 
       ALA  61  61 1 1 
       ASP  62  62 1 1 
       ASP  63  63 1 1 
       GLU  64  64 1 1 
       ASP  65  65 1 1 
       ILE  66  66 1 1 
       MET  67  67 1 1 
       ARG  68  68 1 1 
       ALA  69  69 1 1 
       GLU  70  70 1 1 
       ARG  71  71 1 1 
       ARG  72  72 1 1 
       PHE  73  73 1 1 
       GLU  74  74 1 1 
       THR  75  75 1 1 
       ARG  76  76 1 1 
       LEU  77  77 1 1 
       ALA  78  78 1 1 
       GLY  79  79 1 1 
       VAL  80  80 1 1 
       GLU  81  81 1 1 
       GLY  82  82 1 1 
       GLU  83  83 1 1 
       GLU  84  84 1 1 
       ILE  85  85 1 1 
       ALA  86  86 1 1 
       ALA  87  87 1 1 
       LEU  88  88 1 1 
       LEU  89  89 1 1 
       GLU  90  90 1 1 
       ARG  91  91 1 1 
       GLU  92  92 1 1 
       ARG  93  93 1 1 
       ARG  94  94 1 1 
       PHE  95  95 1 1 
       ASP  96  96 1 1 
       SER  97  97 1 1 
       ASP  98  98 1 1 
       LEU  99  99 1 1 
       TRP 100 100 1 1 
       VAL 101 101 1 1 
       VAL 102 102 1 1 
       GLU 103 103 1 1 
       ILE 104 104 1 1 
       GLU 105 105 1 1 
       THR 106 106 1 1 
       ASP 107 107 1 1 
       GLU 108 108 1 1 
       ILE 109 109 1 1 
       GLY 110 110 1 1 
       THR 111 111 1 1 
       LEU 112 112 1 1 
       LEU 113 113 1 1 
       THR 114 114 1 1 
       LEU 115 115 1 1 
       VAL 116 116 1 1 
       ASP 117 117 1 1 
       GLN 118 118 1 1 
       PRO 119 119 1 1 
       GLN 120 120 1 1 
       ALA 121 121 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
       1795 1 . . . 1 1 
       1796 1 . . . 1 1 
       1797 1 . . . 1 1 
       1798 1 . . . 1 1 
       1799 1 . . . 1 1 
       1800 1 . . . 1 1 
       1801 1 . . . 1 1 
       1802 1 . . . 1 1 
       1803 1 . . . 1 1 
       1804 1 . . . 1 1 
       1805 1 . . . 1 1 
       1806 1 . . . 1 1 
       1807 1 . . . 1 1 
       1808 1 . . . 1 1 
       1809 1 . . . 1 1 
       1810 1 . . . 1 1 
       1811 1 . . . 1 1 
       1812 1 . . . 1 1 
       1813 1 . . . 1 1 
       1814 1 . . . 1 1 
       1815 1 . . . 1 1 
       1816 1 . . . 1 1 
       1817 1 . . . 1 1 
       1818 1 . . . 1 1 
       1819 1 . . . 1 1 
       1820 1 . . . 1 1 
       1821 1 . . . 1 1 
       1822 1 . . . 1 1 
       1823 1 . . . 1 1 
       1824 1 . . . 1 1 
       1825 1 . . . 1 1 
       1826 1 . . . 1 1 
       1827 1 . . . 1 1 
       1828 1 . . . 1 1 
       1829 1 . . . 1 1 
       1830 1 . . . 1 1 
       1831 1 . . . 1 1 
       1832 1 . . . 1 1 
       1833 1 . . . 1 1 
       1834 1 . . . 1 1 
       1835 1 . . . 1 1 
       1836 1 . . . 1 1 
       1837 1 . . . 1 1 
       1838 1 . . . 1 1 
       1839 1 . . . 1 1 
       1840 1 . . . 1 1 
       1841 1 . . . 1 1 
       1842 1 . . . 1 1 
       1843 1 . . . 1 1 
       1844 1 . . . 1 1 
       1845 1 . . . 1 1 
       1846 1 . . . 1 1 
       1847 1 . . . 1 1 
       1848 1 . . . 1 1 
       1849 1 . . . 1 1 
       1850 1 . . . 1 1 
       1851 1 . . . 1 1 
       1852 1 . . . 1 1 
       1853 1 . . . 1 1 
       1854 1 . . . 1 1 
       1855 1 . . . 1 1 
       1856 1 . . . 1 1 
       1857 1 . . . 1 1 
       1858 1 . . . 1 1 
       1859 1 . . . 1 1 
       1860 1 . . . 1 1 
       1861 1 . . . 1 1 
       1862 1 . . . 1 1 
       1863 1 . . . 1 1 
       1864 1 . . . 1 1 
       1865 1 . . . 1 1 
       1866 1 . . . 1 1 
       1867 1 . . . 1 1 
       1868 1 . . . 1 1 
       1869 1 . . . 1 1 
       1870 1 . . . 1 1 
       1871 1 . . . 1 1 
       1872 1 . . . 1 1 
       1873 1 . . . 1 1 
       1874 1 . . . 1 1 
       1875 1 . . . 1 1 
       1876 1 . . . 1 1 
       1877 1 . . . 1 1 
       1878 1 . . . 1 1 
       1879 1 . . . 1 1 
       1880 1 . . . 1 1 
       1881 1 . . . 1 1 
       1882 1 . . . 1 1 
       1883 1 . . . 1 1 
       1884 1 . . . 1 1 
       1885 1 . . . 1 1 
       1886 1 . . . 1 1 
       1887 1 . . . 1 1 
       1888 1 . . . 1 1 
       1889 1 . . . 1 1 
       1890 1 . . . 1 1 
       1891 1 . . . 1 1 
       1892 1 . . . 1 1 
       1893 1 . . . 1 1 
       1894 1 . . . 1 1 
       1895 1 . . . 1 1 
       1896 1 . . . 1 1 
       1897 1 . . . 1 1 
       1898 1 . . . 1 1 
       1899 1 . . . 1 1 
       1900 1 . . . 1 1 
       1901 1 . . . 1 1 
       1902 1 . . . 1 1 
       1903 1 . . . 1 1 
       1904 1 . . . 1 1 
       1905 1 . . . 1 1 
       1906 1 . . . 1 1 
       1907 1 . . . 1 1 
       1908 1 . . . 1 1 
       1909 1 . . . 1 1 
       1910 1 . . . 1 1 
       1911 1 . . . 1 1 
       1912 1 . . . 1 1 
       1913 1 . . . 1 1 
       1914 1 . . . 1 1 
       1915 1 . . . 1 1 
       1916 1 . . . 1 1 
       1917 1 . . . 1 1 
       1918 1 . . . 1 1 
       1919 1 . . . 1 1 
       1920 1 . . . 1 1 
       1921 1 . . . 1 1 
       1922 1 . . . 1 1 
       1923 1 . . . 1 1 
       1924 1 . . . 1 1 
       1925 1 . . . 1 1 
       1926 1 . . . 1 1 
       1927 1 . . . 1 1 
       1928 1 . . . 1 1 
       1929 1 . . . 1 1 
       1930 1 . . . 1 1 
       1931 1 . . . 1 1 
       1932 1 . . . 1 1 
       1933 1 . . . 1 1 
       1934 1 . . . 1 1 
       1935 1 . . . 1 1 
       1936 1 . . . 1 1 
       1937 1 . . . 1 1 
       1938 1 . . . 1 1 
       1939 1 . . . 1 1 
       1940 1 . . . 1 1 
       1941 1 . . . 1 1 
       1942 1 . . . 1 1 
       1943 1 . . . 1 1 
       1944 1 . . . 1 1 
       1945 1 . . . 1 1 
       1946 1 . . . 1 1 
       1947 1 . . . 1 1 
       1948 1 . . . 1 1 
       1949 1 . . . 1 1 
       1950 1 . . . 1 1 
       1951 1 . . . 1 1 
       1952 1 . . . 1 1 
       1953 1 . . . 1 1 
       1954 1 . . . 1 1 
       1955 1 . . . 1 1 
       1956 1 . . . 1 1 
       1957 1 . . . 1 1 
       1958 1 . . . 1 1 
       1959 1 . . . 1 1 
       1960 1 . . . 1 1 
       1961 1 . . . 1 1 
       1962 1 . . . 1 1 
       1963 1 . . . 1 1 
       1964 1 . . . 1 1 
       1965 1 . . . 1 1 
       1966 1 . . . 1 1 
       1967 1 . . . 1 1 
       1968 1 . . . 1 1 
       1969 1 . . . 1 1 
       1970 1 . . . 1 1 
       1971 1 . . . 1 1 
       1972 1 . . . 1 1 
       1973 1 . . . 1 1 
       1974 1 . . . 1 1 
       1975 1 . . . 1 1 
       1976 1 . . . 1 1 
       1977 1 . . . 1 1 
       1978 1 . . . 1 1 
       1979 1 . . . 1 1 
       1980 1 . . . 1 1 
       1981 1 . . . 1 1 
       1982 1 . . . 1 1 
       1983 1 . . . 1 1 
       1984 1 . . . 1 1 
       1985 1 . . . 1 1 
       1986 1 . . . 1 1 
       1987 1 . . . 1 1 
       1988 1 . . . 1 1 
       1989 1 . . . 1 1 
       1990 1 . . . 1 1 
       1991 1 . . . 1 1 
       1992 1 . . . 1 1 
       1993 1 . . . 1 1 
       1994 1 . . . 1 1 
       1995 1 . . . 1 1 
       1996 1 . . . 1 1 
       1997 1 . . . 1 1 
       1998 1 . . . 1 1 
       1999 1 . . . 1 1 
       2000 1 . . . 1 1 
       2001 1 . . . 1 1 
       2002 1 . . . 1 1 
       2003 1 . . . 1 1 
       2004 1 . . . 1 1 
       2005 1 . . . 1 1 
       2006 1 . . . 1 1 
       2007 1 . . . 1 1 
       2008 1 . . . 1 1 
       2009 1 . . . 1 1 
       2010 1 . . . 1 1 
       2011 1 . . . 1 1 
       2012 1 . . . 1 1 
       2013 1 . . . 1 1 
       2014 1 . . . 1 1 
       2015 1 . . . 1 1 
       2016 1 . . . 1 1 
       2017 1 . . . 1 1 
       2018 1 . . . 1 1 
       2019 1 . . . 1 1 
       2020 1 . . . 1 1 
       2021 1 . . . 1 1 
       2022 1 . . . 1 1 
       2023 1 . . . 1 1 
       2024 1 . . . 1 1 
       2025 1 . . . 1 1 
       2026 1 . . . 1 1 
       2027 1 . . . 1 1 
       2028 1 . . . 1 1 
       2029 1 . . . 1 1 
       2030 1 . . . 1 1 
       2031 1 . . . 1 1 
       2032 1 . . . 1 1 
       2033 1 . . . 1 1 
       2034 1 . . . 1 1 
       2035 1 . . . 1 1 
       2036 1 . . . 1 1 
       2037 1 . . . 1 1 
       2038 1 . . . 1 1 
       2039 1 . . . 1 1 
       2040 1 . . . 1 1 
       2041 1 . . . 1 1 
       2042 1 . . . 1 1 
       2043 1 . . . 1 1 
       2044 1 . . . 1 1 
       2045 1 . . . 1 1 
       2046 1 . . . 1 1 
       2047 1 . . . 1 1 
       2048 1 . . . 1 1 
       2049 1 . . . 1 1 
       2050 1 . . . 1 1 
       2051 1 . . . 1 1 
       2052 1 . . . 1 1 
       2053 1 . . . 1 1 
       2054 1 . . . 1 1 
       2055 1 . . . 1 1 
       2056 1 . . . 1 1 
       2057 1 . . . 1 1 
       2058 1 . . . 1 1 
       2059 1 . . . 1 1 
       2060 1 . . . 1 1 
       2061 1 . . . 1 1 
       2062 1 . . . 1 1 
       2063 1 . . . 1 1 
       2064 1 . . . 1 1 
       2065 1 . . . 1 1 
       2066 1 . . . 1 1 
       2067 1 . . . 1 1 
       2068 1 . . . 1 1 
       2069 1 . . . 1 1 
       2070 1 . . . 1 1 
       2071 1 . . . 1 1 
       2072 1 . . . 1 1 
       2073 1 . . . 1 1 
       2074 1 . . . 1 1 
       2075 1 . . . 1 1 
       2076 1 . . . 1 1 
       2077 1 . . . 1 1 
       2078 1 . . . 1 1 
       2079 1 . . . 1 1 
       2080 1 . . . 1 1 
       2081 1 . . . 1 1 
       2082 1 . . . 1 1 
       2083 1 . . . 1 1 
       2084 1 . . . 1 1 
       2085 1 . . . 1 1 
       2086 1 . . . 1 1 
       2087 1 . . . 1 1 
       2088 1 . . . 1 1 
       2089 1 . . . 1 1 
       2090 1 . . . 1 1 
       2091 1 . . . 1 1 
       2092 1 . . . 1 1 
       2093 1 . . . 1 1 
       2094 1 . . . 1 1 
       2095 1 . . . 1 1 
       2096 1 . . . 1 1 
       2097 1 . . . 1 1 
       2098 1 . . . 1 1 
       2099 1 . . . 1 1 
       2100 1 . . . 1 1 
       2101 1 . . . 1 1 
       2102 1 . . . 1 1 
       2103 1 . . . 1 1 
       2104 1 . . . 1 1 
       2105 1 . . . 1 1 
       2106 1 . . . 1 1 
       2107 1 . . . 1 1 
       2108 1 . . . 1 1 
       2109 1 . . . 1 1 
       2110 1 . . . 1 1 
       2111 1 . . . 1 1 
       2112 1 . . . 1 1 
       2113 1 . . . 1 1 
       2114 1 . . . 1 1 
       2115 1 . . . 1 1 
       2116 1 . . . 1 1 
       2117 1 . . . 1 1 
       2118 1 . . . 1 1 
       2119 1 . . . 1 1 
       2120 1 . . . 1 1 
       2121 1 . . . 1 1 
       2122 1 . . . 1 1 
       2123 1 . . . 1 1 
       2124 1 . . . 1 1 
       2125 1 . . . 1 1 
       2126 1 . . . 1 1 
       2127 1 . . . 1 1 
       2128 1 . . . 1 1 
       2129 1 . . . 1 1 
       2130 1 . . . 1 1 
       2131 1 . . . 1 1 
       2132 1 . . . 1 1 
       2133 1 . . . 1 1 
       2134 1 . . . 1 1 
       2135 1 . . . 1 1 
       2136 1 . . . 1 1 
       2137 1 . . . 1 1 
       2138 1 . . . 1 1 
       2139 1 . . . 1 1 
       2140 1 . . . 1 1 
       2141 1 . . . 1 1 
       2142 1 . . . 1 1 
       2143 1 . . . 1 1 
       2144 1 . . . 1 1 
       2145 1 . . . 1 1 
       2146 1 . . . 1 1 
       2147 1 . . . 1 1 
       2148 1 . . . 1 1 
       2149 1 . . . 1 1 
       2150 1 . . . 1 1 
       2151 1 . . . 1 1 
       2152 1 . . . 1 1 
       2153 1 . . . 1 1 
       2154 1 . . . 1 1 
       2155 1 . . . 1 1 
       2156 1 . . . 1 1 
       2157 1 . . . 1 1 
       2158 1 . . . 1 1 
       2159 1 . . . 1 1 
       2160 1 . . . 1 1 
       2161 1 . . . 1 1 
       2162 1 . . . 1 1 
       2163 1 . . . 1 1 
       2164 1 . . . 1 1 
       2165 1 . . . 1 1 
       2166 1 . . . 1 1 
       2167 1 . . . 1 1 
       2168 1 . . . 1 1 
       2169 1 . . . 1 1 
       2170 1 . . . 1 1 
       2171 1 . . . 1 1 
       2172 1 . . . 1 1 
       2173 1 . . . 1 1 
       2174 1 . . . 1 1 
       2175 1 . . . 1 1 
       2176 1 . . . 1 1 
       2177 1 . . . 1 1 
       2178 1 . . . 1 1 
       2179 1 . . . 1 1 
       2180 1 . . . 1 1 
       2181 1 . . . 1 1 
       2182 1 . . . 1 1 
       2183 1 . . . 1 1 
       2184 1 . . . 1 1 
       2185 1 . . . 1 1 
       2186 1 . . . 1 1 
       2187 1 . . . 1 1 
       2188 1 . . . 1 1 
       2189 1 . . . 1 1 
       2190 1 . . . 1 1 
       2191 1 . . . 1 1 
       2192 1 . . . 1 1 
       2193 1 . . . 1 1 
       2194 1 . . . 1 1 
       2195 1 . . . 1 1 
       2196 1 . . . 1 1 
       2197 1 . . . 1 1 
       2198 1 . . . 1 1 
       2199 1 . . . 1 1 
       2200 1 . . . 1 1 
       2201 1 . . . 1 1 
       2202 1 . . . 1 1 
       2203 1 . . . 1 1 
       2204 1 . . . 1 1 
       2205 1 . . . 1 1 
       2206 1 . . . 1 1 
       2207 1 . . . 1 1 
       2208 1 . . . 1 1 
       2209 1 . . . 1 1 
       2210 1 . . . 1 1 
       2211 1 . . . 1 1 
       2212 1 . . . 1 1 
       2213 1 . . . 1 1 
       2214 1 . . . 1 1 
       2215 1 . . . 1 1 
       2216 1 . . . 1 1 
       2217 1 . . . 1 1 
       2218 1 . . . 1 1 
       2219 1 . . . 1 1 
       2220 1 . . . 1 1 
       2221 1 . . . 1 1 
       2222 1 . . . 1 1 
       2223 1 . . . 1 1 
       2224 1 . . . 1 1 
       2225 1 . . . 1 1 
       2226 1 . . . 1 1 
       2227 1 . . . 1 1 
       2228 1 . . . 1 1 
       2229 1 . . . 1 1 
       2230 1 . . . 1 1 
       2231 1 . . . 1 1 
       2232 1 . . . 1 1 
       2233 1 . . . 1 1 
       2234 1 . . . 1 1 
       2235 1 . . . 1 1 
       2236 1 . . . 1 1 
       2237 1 . . . 1 1 
       2238 1 . . . 1 1 
       2239 1 . . . 1 1 
       2240 1 . . . 1 1 
       2241 1 . . . 1 1 
       2242 1 . . . 1 1 
       2243 1 . . . 1 1 
       2244 1 . . . 1 1 
       2245 1 . . . 1 1 
       2246 1 . . . 1 1 
       2247 1 . . . 1 1 
       2248 1 . . . 1 1 
       2249 1 . . . 1 1 
       2250 1 . . . 1 1 
       2251 1 . . . 1 1 
       2252 1 . . . 1 1 
       2253 1 . . . 1 1 
       2254 1 . . . 1 1 
       2255 1 . . . 1 1 
       2256 1 . . . 1 1 
       2257 1 . . . 1 1 
       2258 1 . . . 1 1 
       2259 1 . . . 1 1 
       2260 1 . . . 1 1 
       2261 1 . . . 1 1 
       2262 1 . . . 1 1 
       2263 1 . . . 1 1 
       2264 1 . . . 1 1 
       2265 1 . . . 1 1 
       2266 1 . . . 1 1 
       2267 1 . . . 1 1 
       2268 1 . . . 1 1 
       2269 1 . . . 1 1 
       2270 1 . . . 1 1 
       2271 1 . . . 1 1 
       2272 1 . . . 1 1 
       2273 1 . . . 1 1 
       2274 1 . . . 1 1 
       2275 1 . . . 1 1 
       2276 1 . . . 1 1 
       2277 1 . . . 1 1 
       2278 1 . . . 1 1 
       2279 1 . . . 1 1 
       2280 1 . . . 1 1 
       2281 1 . . . 1 1 
       2282 1 . . . 1 1 
       2283 1 . . . 1 1 
       2284 1 . . . 1 1 
       2285 1 . . . 1 1 
       2286 1 . . . 1 1 
       2287 1 . . . 1 1 
       2288 1 . . . 1 1 
       2289 1 . . . 1 1 
       2290 1 . . . 1 1 
       2291 1 . . . 1 1 
       2292 1 . . . 1 1 
       2293 1 . . . 1 1 
       2294 1 . . . 1 1 
       2295 1 . . . 1 1 
       2296 1 . . . 1 1 
       2297 1 . . . 1 1 
       2298 1 . . . 1 1 
       2299 1 . . . 1 1 
       2300 1 . . . 1 1 
       2301 1 . . . 1 1 
       2302 1 . . . 1 1 
       2303 1 . . . 1 1 
       2304 1 . . . 1 1 
       2305 1 . . . 1 1 
       2306 1 . . . 1 1 
       2307 1 . . . 1 1 
       2308 1 . . . 1 1 
       2309 1 . . . 1 1 
       2310 1 . . . 1 1 
       2311 1 . . . 1 1 
       2312 1 . . . 1 1 
       2313 1 . . . 1 1 
       2314 1 . . . 1 1 
       2315 1 . . . 1 1 
       2316 1 . . . 1 1 
       2317 1 . . . 1 1 
       2318 1 . . . 1 1 
       2319 1 . . . 1 1 
       2320 1 . . . 1 1 
       2321 1 . . . 1 1 
       2322 1 . . . 1 1 
       2323 1 . . . 1 1 
       2324 1 . . . 1 1 
       2325 1 . . . 1 1 
       2326 1 . . . 1 1 
       2327 1 . . . 1 1 
       2328 1 . . . 1 1 
       2329 1 . . . 1 1 
       2330 1 . . . 1 1 
       2331 1 . . . 1 1 
       2332 1 . . . 1 1 
       2333 1 . . . 1 1 
       2334 1 . . . 1 1 
       2335 1 . . . 1 1 
       2336 1 . . . 1 1 
       2337 1 . . . 1 1 
       2338 1 . . . 1 1 
       2339 1 . . . 1 1 
       2340 1 . . . 1 1 
       2341 1 . . . 1 1 
       2342 1 . . . 1 1 
       2343 1 . . . 1 1 
       2344 1 . . . 1 1 
       2345 1 . . . 1 1 
       2346 1 . . . 1 1 
       2347 1 . . . 1 1 
       2348 1 . . . 1 1 
       2349 1 . . . 1 1 
       2350 1 . . . 1 1 
       2351 1 . . . 1 1 
       2352 1 . . . 1 1 
       2353 1 . . . 1 1 
       2354 1 . . . 1 1 
       2355 1 . . . 1 1 
       2356 1 . . . 1 1 
       2357 1 . . . 1 1 
       2358 1 . . . 1 1 
       2359 1 . . . 1 1 
       2360 1 . . . 1 1 
       2361 1 . . . 1 1 
       2362 1 . . . 1 1 
       2363 1 . . . 1 1 
       2364 1 . . . 1 1 
       2365 1 . . . 1 1 
       2366 1 . . . 1 1 
       2367 1 . . . 1 1 
       2368 1 . . . 1 1 
       2369 1 . . . 1 1 
       2370 1 . . . 1 1 
       2371 1 . . . 1 1 
       2372 1 . . . 1 1 
       2373 1 . . . 1 1 
       2374 1 . . . 1 1 
       2375 1 . . . 1 1 
       2376 1 . . . 1 1 
       2377 1 . . . 1 1 
       2378 1 . . . 1 1 
       2379 1 . . . 1 1 
       2380 1 . . . 1 1 
       2381 1 . . . 1 1 
       2382 1 . . . 1 1 
       2383 1 . . . 1 1 
       2384 1 . . . 1 1 
       2385 1 . . . 1 1 
       2386 1 . . . 1 1 
       2387 1 . . . 1 1 
       2388 1 . . . 1 1 
       2389 1 . . . 1 1 
       2390 1 . . . 1 1 
       2391 1 . . . 1 1 
       2392 1 . . . 1 1 
       2393 1 . . . 1 1 
       2394 1 . . . 1 1 
       2395 1 . . . 1 1 
       2396 1 . . . 1 1 
       2397 1 . . . 1 1 
       2398 1 . . . 1 1 
       2399 1 . . . 1 1 
       2400 1 . . . 1 1 
       2401 1 . . . 1 1 
       2402 1 . . . 1 1 
       2403 1 . . . 1 1 
       2404 1 . . . 1 1 
       2405 1 . . . 1 1 
       2406 1 . . . 1 1 
       2407 1 . . . 1 1 
       2408 1 . . . 1 1 
       2409 1 . . . 1 1 
       2410 1 . . . 1 1 
       2411 1 . . . 1 1 
       2412 1 . . . 1 1 
       2413 1 . . . 1 1 
       2414 1 . . . 1 1 
       2415 1 . . . 1 1 
       2416 1 . . . 1 1 
       2417 1 . . . 1 1 
       2418 1 . . . 1 1 
       2419 1 . . . 1 1 
       2420 1 . . . 1 1 
       2421 1 . . . 1 1 
       2422 1 . . . 1 1 
       2423 1 . . . 1 1 
       2424 1 . . . 1 1 
       2425 1 . . . 1 1 
       2426 1 . . . 1 1 
       2427 1 . . . 1 1 
       2428 1 . . . 1 1 
       2429 1 . . . 1 1 
       2430 1 . . . 1 1 
       2431 1 . . . 1 1 
       2432 1 . . . 1 1 
       2433 1 . . . 1 1 
       2434 1 . . . 1 1 
       2435 1 . . . 1 1 
       2436 1 . . . 1 1 
       2437 1 . . . 1 1 
       2438 1 . . . 1 1 
       2439 1 . . . 1 1 
       2440 1 . . . 1 1 
       2441 1 . . . 1 1 
       2442 1 . . . 1 1 
       2443 1 . . . 1 1 
       2444 1 . . . 1 1 
       2445 1 . . . 1 1 
       2446 1 . . . 1 1 
       2447 1 . . . 1 1 
       2448 1 . . . 1 1 
       2449 1 . . . 1 1 
       2450 1 . . . 1 1 
       2451 1 . . . 1 1 
       2452 1 . . . 1 1 
       2453 1 . . . 1 1 
       2454 1 . . . 1 1 
       2455 1 . . . 1 1 
       2456 1 . . . 1 1 
       2457 1 . . . 1 1 
       2458 1 . . . 1 1 
       2459 1 . . . 1 1 
       2460 1 . . . 1 1 
       2461 1 . . . 1 1 
       2462 1 . . . 1 1 
       2463 1 . . . 1 1 
       2464 1 . . . 1 1 
       2465 1 . . . 1 1 
       2466 1 . . . 1 1 
       2467 1 . . . 1 1 
       2468 1 . . . 1 1 
       2469 1 . . . 1 1 
       2470 1 . . . 1 1 
       2471 1 . . . 1 1 
       2472 1 . . . 1 1 
       2473 1 . . . 1 1 
       2474 1 . . . 1 1 
       2475 1 . . . 1 1 
       2476 1 . . . 1 1 
       2477 1 . . . 1 1 
       2478 1 . . . 1 1 
       2479 1 . . . 1 1 
       2480 1 . . . 1 1 
       2481 1 . . . 1 1 
       2482 1 . . . 1 1 
       2483 1 . . . 1 1 
       2484 1 . . . 1 1 
       2485 1 . . . 1 1 
       2486 1 . . . 1 1 
       2487 1 . . . 1 1 
       2488 1 . . . 1 1 
       2489 1 . . . 1 1 
       2490 1 . . . 1 1 
       2491 1 . . . 1 1 
       2492 1 . . . 1 1 
       2493 1 . . . 1 1 
       2494 1 . . . 1 1 
       2495 1 . . . 1 1 
       2496 1 . . . 1 1 
       2497 1 . . . 1 1 
       2498 1 . . . 1 1 
       2499 1 . . . 1 1 
       2500 1 . . . 1 1 
       2501 1 . . . 1 1 
       2502 1 . . . 1 1 
       2503 1 . . . 1 1 
       2504 1 . . . 1 1 
       2505 1 . . . 1 1 
       2506 1 . . . 1 1 
       2507 1 . . . 1 1 
       2508 1 . . . 1 1 
       2509 1 . . . 1 1 
       2510 1 . . . 1 1 
       2511 1 . . . 1 1 
       2512 1 . . . 1 1 
       2513 1 . . . 1 1 
       2514 1 . . . 1 1 
       2515 1 . . . 1 1 
       2516 1 . . . 1 1 
       2517 1 . . . 1 1 
       2518 1 . . . 1 1 
       2519 1 . . . 1 1 
       2520 1 . . . 1 1 
       2521 1 . . . 1 1 
       2522 1 . . . 1 1 
       2523 1 . . . 1 1 
       2524 1 . . . 1 1 
       2525 1 . . . 1 1 
       2526 1 . . . 1 1 
       2527 1 . . . 1 1 
       2528 1 . . . 1 1 
       2529 1 . . . 1 1 
       2530 1 . . . 1 1 
       2531 1 . . . 1 1 
       2532 1 . . . 1 1 
       2533 1 . . . 1 1 
       2534 1 . . . 1 1 
       2535 1 . . . 1 1 
       2536 1 . . . 1 1 
       2537 1 . . . 1 1 
       2538 1 . . . 1 1 
       2539 1 . . . 1 1 
       2540 1 . . . 1 1 
       2541 1 . . . 1 1 
       2542 1 . . . 1 1 
       2543 1 . . . 1 1 
       2544 1 . . . 1 1 
       2545 1 . . . 1 1 
       2546 1 . . . 1 1 
       2547 1 . . . 1 1 
       2548 1 . . . 1 1 
       2549 1 . . . 1 1 
       2550 1 . . . 1 1 
       2551 1 . . . 1 1 
       2552 1 . . . 1 1 
       2553 1 . . . 1 1 
       2554 1 . . . 1 1 
       2555 1 . . . 1 1 
       2556 1 . . . 1 1 
       2557 1 . . . 1 1 
       2558 1 . . . 1 1 
       2559 1 . . . 1 1 
       2560 1 . . . 1 1 
       2561 1 . . . 1 1 
       2562 1 . . . 1 1 
       2563 1 . . . 1 1 
       2564 1 . . . 1 1 
       2565 1 . . . 1 1 
       2566 1 . . . 1 1 
       2567 1 . . . 1 1 
       2568 1 . . . 1 1 
       2569 1 . . . 1 1 
       2570 1 . . . 1 1 
       2571 1 . . . 1 1 
       2572 1 . . . 1 1 
       2573 1 . . . 1 1 
       2574 1 . . . 1 1 
       2575 1 . . . 1 1 
       2576 1 . . . 1 1 
       2577 1 . . . 1 1 
       2578 1 . . . 1 1 
       2579 1 . . . 1 1 
       2580 1 . . . 1 1 
       2581 1 . . . 1 1 
       2582 1 . . . 1 1 
       2583 1 . . . 1 1 
       2584 1 . . . 1 1 
       2585 1 . . . 1 1 
       2586 1 . . . 1 1 
       2587 1 . . . 1 1 
       2588 1 . . . 1 1 
       2589 1 . . . 1 1 
       2590 1 . . . 1 1 
       2591 1 . . . 1 1 
       2592 1 . . . 1 1 
       2593 1 . . . 1 1 
       2594 1 . . . 1 1 
       2595 1 . . . 1 1 
       2596 1 . . . 1 1 
       2597 1 . . . 1 1 
       2598 1 . . . 1 1 
       2599 1 . . . 1 1 
       2600 1 . . . 1 1 
       2601 1 . . . 1 1 
       2602 1 . . . 1 1 
       2603 1 . . . 1 1 
       2604 1 . . . 1 1 
       2605 1 . . . 1 1 
       2606 1 . . . 1 1 
       2607 1 . . . 1 1 
       2608 1 . . . 1 1 
       2609 1 . . . 1 1 
       2610 1 . . . 1 1 
       2611 1 . . . 1 1 
       2612 1 . . . 1 1 
       2613 1 . . . 1 1 
       2614 1 . . . 1 1 
       2615 1 . . . 1 1 
       2616 1 . . . 1 1 
       2617 1 . . . 1 1 
       2618 1 . . . 1 1 
       2619 1 . . . 1 1 
       2620 1 . . . 1 1 
       2621 1 . . . 1 1 
       2622 1 . . . 1 1 
       2623 1 . . . 1 1 
       2624 1 . . . 1 1 
       2625 1 . . . 1 1 
       2626 1 . . . 1 1 
       2627 1 . . . 1 1 
       2628 1 . . . 1 1 
       2629 1 . . . 1 1 
       2630 1 . . . 1 1 
       2631 1 . . . 1 1 
       2632 1 . . . 1 1 
       2633 1 . . . 1 1 
       2634 1 . . . 1 1 
       2635 1 . . . 1 1 
       2636 1 . . . 1 1 
       2637 1 . . . 1 1 
       2638 1 . . . 1 1 
       2639 1 . . . 1 1 
       2640 1 . . . 1 1 
       2641 1 . . . 1 1 
       2642 1 . . . 1 1 
       2643 1 . . . 1 1 
       2644 1 . . . 1 1 
       2645 1 . . . 1 1 
       2646 1 . . . 1 1 
       2647 1 . . . 1 1 
       2648 1 . . . 1 1 
       2649 1 . . . 1 1 
       2650 1 . . . 1 1 
       2651 1 . . . 1 1 
       2652 1 . . . 1 1 
       2653 1 . . . 1 1 
       2654 1 . . . 1 1 
       2655 1 . . . 1 1 
       2656 1 . . . 1 1 
       2657 1 . . . 1 1 
       2658 1 . . . 1 1 
       2659 1 . . . 1 1 
       2660 1 . . . 1 1 
       2661 1 . . . 1 1 
       2662 1 . . . 1 1 
       2663 1 . . . 1 1 
       2664 1 . . . 1 1 
       2665 1 . . . 1 1 
       2666 1 . . . 1 1 
       2667 1 . . . 1 1 
       2668 1 . . . 1 1 
       2669 1 . . . 1 1 
       2670 1 . . . 1 1 
       2671 1 . . . 1 1 
       2672 1 . . . 1 1 
       2673 1 . . . 1 1 
       2674 1 . . . 1 1 
       2675 1 . . . 1 1 
       2676 1 . . . 1 1 
       2677 1 . . . 1 1 
       2678 1 . . . 1 1 
       2679 1 . . . 1 1 
       2680 1 . . . 1 1 
       2681 1 . . . 1 1 
       2682 1 . . . 1 1 
       2683 1 . . . 1 1 
       2684 1 . . . 1 1 
       2685 1 . . . 1 1 
       2686 1 . . . 1 1 
       2687 1 . . . 1 1 
       2688 1 . . . 1 1 
       2689 1 . . . 1 1 
       2690 1 . . . 1 1 
       2691 1 . . . 1 1 
       2692 1 . . . 1 1 
       2693 1 . . . 1 1 
       2694 1 . . . 1 1 
       2695 1 . . . 1 1 
       2696 1 . . . 1 1 
       2697 1 . . . 1 1 
       2698 1 . . . 1 1 
       2699 1 . . . 1 1 
       2700 1 . . . 1 1 
       2701 1 . . . 1 1 
       2702 1 . . . 1 1 
       2703 1 . . . 1 1 
       2704 1 . . . 1 1 
       2705 1 . . . 1 1 
       2706 1 . . . 1 1 
       2707 1 . . . 1 1 
       2708 1 . . . 1 1 
       2709 1 . . . 1 1 
       2710 1 . . . 1 1 
       2711 1 . . . 1 1 
       2712 1 . . . 1 1 
       2713 1 . . . 1 1 
       2714 1 . . . 1 1 
       2715 1 . . . 1 1 
       2716 1 . . . 1 1 
       2717 1 . . . 1 1 
       2718 1 . . . 1 1 
       2719 1 . . . 1 1 
       2720 1 . . . 1 1 
       2721 1 . . . 1 1 
       2722 1 . . . 1 1 
       2723 1 . . . 1 1 
       2724 1 . . . 1 1 
       2725 1 . . . 1 1 
       2726 1 . . . 1 1 
       2727 1 . . . 1 1 
       2728 1 . . . 1 1 
       2729 1 . . . 1 1 
       2730 1 . . . 1 1 
       2731 1 . . . 1 1 
       2732 1 . . . 1 1 
       2733 1 . . . 1 1 
       2734 1 . . . 1 1 
       2735 1 . . . 1 1 
       2736 1 . . . 1 1 
       2737 1 . . . 1 1 
       2738 1 . . . 1 1 
       2739 1 . . . 1 1 
       2740 1 . . . 1 1 
       2741 1 . . . 1 1 
       2742 1 . . . 1 1 
       2743 1 . . . 1 1 
       2744 1 . . . 1 1 
       2745 1 . . . 1 1 
       2746 1 . . . 1 1 
       2747 1 . . . 1 1 
       2748 1 . . . 1 1 
       2749 1 . . . 1 1 
       2750 1 . . . 1 1 
       2751 1 . . . 1 1 
       2752 1 . . . 1 1 
       2753 1 . . . 1 1 
       2754 1 . . . 1 1 
       2755 1 . . . 1 1 
       2756 1 . . . 1 1 
       2757 1 . . . 1 1 
       2758 1 . . . 1 1 
       2759 1 . . . 1 1 
       2760 1 . . . 1 1 
       2761 1 . . . 1 1 
       2762 1 . . . 1 1 
       2763 1 . . . 1 1 
       2764 1 . . . 1 1 
       2765 1 . . . 1 1 
       2766 1 . . . 1 1 
       2767 1 . . . 1 1 
       2768 1 . . . 1 1 
       2769 1 . . . 1 1 
       2770 1 . . . 1 1 
       2771 1 . . . 1 1 
       2772 1 . . . 1 1 
       2773 1 . . . 1 1 
       2774 1 . . . 1 1 
       2775 1 . . . 1 1 
       2776 1 . . . 1 1 
       2777 1 . . . 1 1 
       2778 1 . . . 1 1 
       2779 1 . . . 1 1 
       2780 1 . . . 1 1 
       2781 1 . . . 1 1 
       2782 1 . . . 1 1 
       2783 1 . . . 1 1 
       2784 1 . . . 1 1 
       2785 1 . . . 1 1 
       2786 1 . . . 1 1 
       2787 1 . . . 1 1 
       2788 1 . . . 1 1 
       2789 1 . . . 1 1 
       2790 1 . . . 1 1 
       2791 1 . . . 1 1 
       2792 1 . . . 1 1 
       2793 1 . . . 1 1 
       2794 1 . . . 1 1 
       2795 1 . . . 1 1 
       2796 1 . . . 1 1 
       2797 1 . . . 1 1 
       2798 1 . . . 1 1 
       2799 1 . . . 1 1 
       2800 1 . . . 1 1 
       2801 1 . . . 1 1 
       2802 1 . . . 1 1 
       2803 1 . . . 1 1 
       2804 1 . . . 1 1 
       2805 1 . . . 1 1 
       2806 1 . . . 1 1 
       2807 1 . . . 1 1 
       2808 1 . . . 1 1 
       2809 1 . . . 1 1 
       2810 1 . . . 1 1 
       2811 1 . . . 1 1 
       2812 1 . . . 1 1 
       2813 1 . . . 1 1 
       2814 1 . . . 1 1 
       2815 1 . . . 1 1 
       2816 1 . . . 1 1 
       2817 1 . . . 1 1 
       2818 1 . . . 1 1 
       2819 1 . . . 1 1 
       2820 1 . . . 1 1 
       2821 1 . . . 1 1 
       2822 1 . . . 1 1 
       2823 1 . . . 1 1 
       2824 1 . . . 1 1 
       2825 1 . . . 1 1 
       2826 1 . . . 1 1 
       2827 1 . . . 1 1 
       2828 1 . . . 1 1 
       2829 1 . . . 1 1 
       2830 1 . . . 1 1 
       2831 1 . . . 1 1 
       2832 1 . . . 1 1 
       2833 1 . . . 1 1 
       2834 1 . . . 1 1 
       2835 1 . . . 1 1 
       2836 1 . . . 1 1 
       2837 1 . . . 1 1 
       2838 1 . . . 1 1 
       2839 1 . . . 1 1 
       2840 1 . . . 1 1 
       2841 1 . . . 1 1 
       2842 1 . . . 1 1 
       2843 1 . . . 1 1 
       2844 1 . . . 1 1 
       2845 1 . . . 1 1 
       2846 1 . . . 1 1 
       2847 1 . . . 1 1 
       2848 1 . . . 1 1 
       2849 1 . . . 1 1 
       2850 1 . . . 1 1 
       2851 1 . . . 1 1 
       2852 1 . . . 1 1 
       2853 1 . . . 1 1 
       2854 1 . . . 1 1 
       2855 1 . . . 1 1 
       2856 1 . . . 1 1 
       2857 1 . . . 1 1 
       2858 1 . . . 1 1 
       2859 1 . . . 1 1 
       2860 1 . . . 1 1 
       2861 1 . . . 1 1 
       2862 1 . . . 1 1 
       2863 1 . . . 1 1 
       2864 1 . . . 1 1 
       2865 1 . . . 1 1 
       2866 1 . . . 1 1 
       2867 1 . . . 1 1 
       2868 1 . . . 1 1 
       2869 1 . . . 1 1 
       2870 1 . . . 1 1 
       2871 1 . . . 1 1 
       2872 1 . . . 1 1 
       2873 1 . . . 1 1 
       2874 1 . . . 1 1 
       2875 1 . . . 1 1 
       2876 1 . . . 1 1 
       2877 1 . . . 1 1 
       2878 1 . . . 1 1 
       2879 1 . . . 1 1 
       2880 1 . . . 1 1 
       2881 1 . . . 1 1 
       2882 1 . . . 1 1 
       2883 1 . . . 1 1 
       2884 1 . . . 1 1 
       2885 1 . . . 1 1 
       2886 1 . . . 1 1 
       2887 1 . . . 1 1 
       2888 1 . . . 1 1 
       2889 1 . . . 1 1 
       2890 1 . . . 1 1 
       2891 1 . . . 1 1 
       2892 1 . . . 1 1 
       2893 1 . . . 1 1 
       2894 1 . . . 1 1 
       2895 1 . . . 1 1 
       2896 1 . . . 1 1 
       2897 1 . . . 1 1 
       2898 1 . . . 1 1 
       2899 1 . . . 1 1 
       2900 1 . . . 1 1 
       2901 1 . . . 1 1 
       2902 1 . . . 1 1 
       2903 1 . . . 1 1 
       2904 1 . . . 1 1 
       2905 1 . . . 1 1 
       2906 1 . . . 1 1 
       2907 1 . . . 1 1 
       2908 1 . . . 1 1 
       2909 1 . . . 1 1 
       2910 1 . . . 1 1 
       2911 1 . . . 1 1 
       2912 1 . . . 1 1 
       2913 1 . . . 1 1 
       2914 1 . . . 1 1 
       2915 1 . . . 1 1 
       2916 1 . . . 1 1 
       2917 1 . . . 1 1 
       2918 1 . . . 1 1 
       2919 1 . . . 1 1 
       2920 1 . . . 1 1 
       2921 1 . . . 1 1 
       2922 1 . . . 1 1 
       2923 1 . . . 1 1 
       2924 1 . . . 1 1 
       2925 1 . . . 1 1 
       2926 1 . . . 1 1 
       2927 1 . . . 1 1 
       2928 1 . . . 1 1 
       2929 1 . . . 1 1 
       2930 1 . . . 1 1 
       2931 1 . . . 1 1 
       2932 1 . . . 1 1 
       2933 1 . . . 1 1 
       2934 1 . . . 1 1 
       2935 1 . . . 1 1 
       2936 1 . . . 1 1 
       2937 1 . . . 1 1 
       2938 1 . . . 1 1 
       2939 1 . . . 1 1 
       2940 1 . . . 1 1 
       2941 1 . . . 1 1 
       2942 1 . . . 1 1 
       2943 1 . . . 1 1 
       2944 1 . . . 1 1 
       2945 1 . . . 1 1 
       2946 1 . . . 1 1 
       2947 1 . . . 1 1 
       2948 1 . . . 1 1 
       2949 1 . . . 1 1 
       2950 1 . . . 1 1 
       2951 1 . . . 1 1 
       2952 1 . . . 1 1 
       2953 1 . . . 1 1 
       2954 1 . . . 1 1 
       2955 1 . . . 1 1 
       2956 1 . . . 1 1 
       2957 1 . . . 1 1 
       2958 1 . . . 1 1 
       2959 1 . . . 1 1 
       2960 1 . . . 1 1 
       2961 1 . . . 1 1 
       2962 1 . . . 1 1 
       2963 1 . . . 1 1 
       2964 1 . . . 1 1 
       2965 1 . . . 1 1 
       2966 1 . . . 1 1 
       2967 1 . . . 1 1 
       2968 1 . . . 1 1 
       2969 1 . . . 1 1 
       2970 1 . . . 1 1 
       2971 1 . . . 1 1 
       2972 1 . . . 1 1 
       2973 1 . . . 1 1 
       2974 1 . . . 1 1 
       2975 1 . . . 1 1 
       2976 1 . . . 1 1 
       2977 1 . . . 1 1 
       2978 1 . . . 1 1 
       2979 1 . . . 1 1 
       2980 1 . . . 1 1 
       2981 1 . . . 1 1 
       2982 1 . . . 1 1 
       2983 1 . . . 1 1 
       2984 1 . . . 1 1 
       2985 1 . . . 1 1 
       2986 1 . . . 1 1 
       2987 1 . . . 1 1 
       2988 1 . . . 1 1 
       2989 1 . . . 1 1 
       2990 1 . . . 1 1 
       2991 1 . . . 1 1 
       2992 1 . . . 1 1 
       2993 1 . . . 1 1 
       2994 1 . . . 1 1 
       2995 1 . . . 1 1 
       2996 1 . . . 1 1 
       2997 1 . . . 1 1 
       2998 1 . . . 1 1 
       2999 1 . . . 1 1 
       3000 1 . . . 1 1 
       3001 1 . . . 1 1 
       3002 1 . . . 1 1 
       3003 1 . . . 1 1 
       3004 1 . . . 1 1 
       3005 1 . . . 1 1 
       3006 1 . . . 1 1 
       3007 1 . . . 1 1 
       3008 1 . . . 1 1 
       3009 1 . . . 1 1 
       3010 1 . . . 1 1 
       3011 1 . . . 1 1 
       3012 1 . . . 1 1 
       3013 1 . . . 1 1 
       3014 1 . . . 1 1 
       3015 1 . . . 1 1 
       3016 1 . . . 1 1 
       3017 1 . . . 1 1 
       3018 1 . . . 1 1 
       3019 1 . . . 1 1 
       3020 1 . . . 1 1 
       3021 1 . . . 1 1 
       3022 1 . . . 1 1 
       3023 1 . . . 1 1 
       3024 1 . . . 1 1 
       3025 1 . . . 1 1 
       3026 1 . . . 1 1 
       3027 1 . . . 1 1 
       3028 1 . . . 1 1 
       3029 1 . . . 1 1 
       3030 1 . . . 1 1 
       3031 1 . . . 1 1 
       3032 1 . . . 1 1 
       3033 1 . . . 1 1 
       3034 1 . . . 1 1 
       3035 1 . . . 1 1 
       3036 1 . . . 1 1 
       3037 1 . . . 1 1 
       3038 1 . . . 1 1 
       3039 1 . . . 1 1 
       3040 1 . . . 1 1 
       3041 1 . . . 1 1 
       3042 1 . . . 1 1 
       3043 1 . . . 1 1 
       3044 1 . . . 1 1 
       3045 1 . . . 1 1 
       3046 1 . . . 1 1 
       3047 1 . . . 1 1 
       3048 1 . . . 1 1 
       3049 1 . . . 1 1 
       3050 1 . . . 1 1 
       3051 1 . . . 1 1 
       3052 1 . . . 1 1 
       3053 1 . . . 1 1 
       3054 1 . . . 1 1 
       3055 1 . . . 1 1 
       3056 1 . . . 1 1 
       3057 1 . . . 1 1 
       3058 1 . . . 1 1 
       3059 1 . . . 1 1 
       3060 1 . . . 1 1 
       3061 1 . . . 1 1 
       3062 1 . . . 1 1 
       3063 1 . . . 1 1 
       3064 1 . . . 1 1 
       3065 1 . . . 1 1 
       3066 1 . . . 1 1 
       3067 1 . . . 1 1 
       3068 1 . . . 1 1 
       3069 1 . . . 1 1 
       3070 1 . . . 1 1 
       3071 1 . . . 1 1 
       3072 1 . . . 1 1 
       3073 1 . . . 1 1 
       3074 1 . . . 1 1 
       3075 1 . . . 1 1 
       3076 1 . . . 1 1 
       3077 1 . . . 1 1 
       3078 1 . . . 1 1 
       3079 1 . . . 1 1 
       3080 1 . . . 1 1 
       3081 1 . . . 1 1 
       3082 1 . . . 1 1 
       3083 1 . . . 1 1 
       3084 1 . . . 1 1 
       3085 1 . . . 1 1 
       3086 1 . . . 1 1 
       3087 1 . . . 1 1 
       3088 1 . . . 1 1 
       3089 1 . . . 1 1 
       3090 1 . . . 1 1 
       3091 1 . . . 1 1 
       3092 1 . . . 1 1 
       3093 1 . . . 1 1 
       3094 1 . . . 1 1 
       3095 1 . . . 1 1 
       3096 1 . . . 1 1 
       3097 1 . . . 1 1 
       3098 1 . . . 1 1 
       3099 1 . . . 1 1 
       3100 1 . . . 1 1 
       3101 1 . . . 1 1 
       3102 1 . . . 1 1 
       3103 1 . . . 1 1 
       3104 1 . . . 1 1 
       3105 1 . . . 1 1 
       3106 1 . . . 1 1 
       3107 1 . . . 1 1 
       3108 1 . . . 1 1 
       3109 1 . . . 1 1 
       3110 1 . . . 1 1 
       3111 1 . . . 1 1 
       3112 1 . . . 1 1 
       3113 1 . . . 1 1 
       3114 1 . . . 1 1 
       3115 1 . . . 1 1 
       3116 1 . . . 1 1 
       3117 1 . . . 1 1 
       3118 1 . . . 1 1 
       3119 1 . . . 1 1 
       3120 1 . . . 1 1 
       3121 1 . . . 1 1 
       3122 1 . . . 1 1 
       3123 1 . . . 1 1 
       3124 1 . . . 1 1 
       3125 1 . . . 1 1 
       3126 1 . . . 1 1 
       3127 1 . . . 1 1 
       3128 1 . . . 1 1 
       3129 1 . . . 1 1 
       3130 1 . . . 1 1 
       3131 1 . . . 1 1 
       3132 1 . . . 1 1 
       3133 1 . . . 1 1 
       3134 1 . . . 1 1 
       3135 1 . . . 1 1 
       3136 1 . . . 1 1 
       3137 1 . . . 1 1 
       3138 1 . . . 1 1 
       3139 1 . . . 1 1 
       3140 1 . . . 1 1 
       3141 1 . . . 1 1 
       3142 1 . . . 1 1 
       3143 1 . . . 1 1 
       3144 1 . . . 1 1 
       3145 1 . . . 1 1 
       3146 1 . . . 1 1 
       3147 1 . . . 1 1 
       3148 1 . . . 1 1 
       3149 1 . . . 1 1 
       3150 1 . . . 1 1 
       3151 1 . . . 1 1 
       3152 1 . . . 1 1 
       3153 1 . . . 1 1 
       3154 1 . . . 1 1 
       3155 1 . . . 1 1 
       3156 1 . . . 1 1 
       3157 1 . . . 1 1 
       3158 1 . . . 1 1 
       3159 1 . . . 1 1 
       3160 1 . . . 1 1 
       3161 1 . . . 1 1 
       3162 1 . . . 1 1 
       3163 1 . . . 1 1 
       3164 1 . . . 1 1 
       3165 1 . . . 1 1 
       3166 1 . . . 1 1 
       3167 1 . . . 1 1 
       3168 1 . . . 1 1 
       3169 1 . . . 1 1 
       3170 1 . . . 1 1 
       3171 1 . . . 1 1 
       3172 1 . . . 1 1 
       3173 1 . . . 1 1 
       3174 1 . . . 1 1 
       3175 1 . . . 1 1 
       3176 1 . . . 1 1 
       3177 1 . . . 1 1 
       3178 1 . . . 1 1 
       3179 1 . . . 1 1 
       3180 1 . . . 1 1 
       3181 1 . . . 1 1 
       3182 1 . . . 1 1 
       3183 1 . . . 1 1 
       3184 1 . . . 1 1 
       3185 1 . . . 1 1 
       3186 1 . . . 1 1 
       3187 1 . . . 1 1 
       3188 1 . . . 1 1 
       3189 1 . . . 1 1 
       3190 1 . . . 1 1 
       3191 1 . . . 1 1 
       3192 1 . . . 1 1 
       3193 1 . . . 1 1 
       3194 1 . . . 1 1 
       3195 1 . . . 1 1 
       3196 1 . . . 1 1 
       3197 1 . . . 1 1 
       3198 1 . . . 1 1 
       3199 1 . . . 1 1 
       3200 1 . . . 1 1 
       3201 1 . . . 1 1 
       3202 1 . . . 1 1 
       3203 1 . . . 1 1 
       3204 1 . . . 1 1 
       3205 1 . . . 1 1 
       3206 1 . . . 1 1 
       3207 1 . . . 1 1 
       3208 1 . . . 1 1 
       3209 1 . . . 1 1 
       3210 1 . . . 1 1 
       3211 1 . . . 1 1 
       3212 1 . . . 1 1 
       3213 1 . . . 1 1 
       3214 1 . . . 1 1 
       3215 1 . . . 1 1 
       3216 1 . . . 1 1 
       3217 1 . . . 1 1 
       3218 1 . . . 1 1 
       3219 1 . . . 1 1 
       3220 1 . . . 1 1 
       3221 1 . . . 1 1 
       3222 1 . . . 1 1 
       3223 1 . . . 1 1 
       3224 1 . . . 1 1 
       3225 1 . . . 1 1 
       3226 1 . . . 1 1 
       3227 1 . . . 1 1 
       3228 1 . . . 1 1 
       3229 1 . . . 1 1 
       3230 1 . . . 1 1 
       3231 1 . . . 1 1 
       3232 1 . . . 1 1 
       3233 1 . . . 1 1 
       3234 1 . . . 1 1 
       3235 1 . . . 1 1 
       3236 1 . . . 1 1 
       3237 1 . . . 1 1 
       3238 1 . . . 1 1 
       3239 1 . . . 1 1 
       3240 1 . . . 1 1 
       3241 1 . . . 1 1 
       3242 1 . . . 1 1 
       3243 1 . . . 1 1 
       3244 1 . . . 1 1 
       3245 1 . . . 1 1 
       3246 1 . . . 1 1 
       3247 1 . . . 1 1 
       3248 1 . . . 1 1 
       3249 1 . . . 1 1 
       3250 1 . . . 1 1 
       3251 1 . . . 1 1 
       3252 1 . . . 1 1 
       3253 1 . . . 1 1 
       3254 1 . . . 1 1 
       3255 1 . . . 1 1 
       3256 1 . . . 1 1 
       3257 1 . . . 1 1 
       3258 1 . . . 1 1 
       3259 1 . . . 1 1 
       3260 1 . . . 1 1 
       3261 1 . . . 1 1 
       3262 1 . . . 1 1 
       3263 1 . . . 1 1 
       3264 1 . . . 1 1 
       3265 1 . . . 1 1 
       3266 1 . . . 1 1 
       3267 1 . . . 1 1 
       3268 1 . . . 1 1 
       3269 1 . . . 1 1 
       3270 1 . . . 1 1 
       3271 1 . . . 1 1 
       3272 1 . . . 1 1 
       3273 1 . . . 1 1 
       3274 1 . . . 1 1 
       3275 1 . . . 1 1 
       3276 1 . . . 1 1 
       3277 1 . . . 1 1 
       3278 1 . . . 1 1 
       3279 1 . . . 1 1 
       3280 1 . . . 1 1 
       3281 1 . . . 1 1 
       3282 1 . . . 1 1 
       3283 1 . . . 1 1 
       3284 1 . . . 1 1 
       3285 1 . . . 1 1 
       3286 1 . . . 1 1 
       3287 1 . . . 1 1 
       3288 1 . . . 1 1 
       3289 1 . . . 1 1 
       3290 1 . . . 1 1 
       3291 1 . . . 1 1 
       3292 1 . . . 1 1 
       3293 1 . . . 1 1 
       3294 1 . . . 1 1 
       3295 1 . . . 1 1 
       3296 1 . . . 1 1 
       3297 1 . . . 1 1 
       3298 1 . . . 1 1 
       3299 1 . . . 1 1 
       3300 1 . . . 1 1 
       3301 1 . . . 1 1 
       3302 1 . . . 1 1 
       3303 1 . . . 1 1 
       3304 1 . . . 1 1 
       3305 1 . . . 1 1 
       3306 1 . . . 1 1 
       3307 1 . . . 1 1 
       3308 1 . . . 1 1 
       3309 1 . . . 1 1 
       3310 1 . . . 1 1 
       3311 1 . . . 1 1 
       3312 1 . . . 1 1 
       3313 1 . . . 1 1 
       3314 1 . . . 1 1 
       3315 1 . . . 1 1 
       3316 1 . . . 1 1 
       3317 1 . . . 1 1 
       3318 1 . . . 1 1 
       3319 1 . . . 1 1 
       3320 1 . . . 1 1 
       3321 1 . . . 1 1 
       3322 1 . . . 1 1 
       3323 1 . . . 1 1 
       3324 1 . . . 1 1 
       3325 1 . . . 1 1 
       3326 1 . . . 1 1 
       3327 1 . . . 1 1 
       3328 1 . . . 1 1 
       3329 1 . . . 1 1 
       3330 1 . . . 1 1 
       3331 1 . . . 1 1 
       3332 1 . . . 1 1 
       3333 1 . . . 1 1 
       3334 1 . . . 1 1 
       3335 1 . . . 1 1 
       3336 1 . . . 1 1 
       3337 1 . . . 1 1 
       3338 1 . . . 1 1 
       3339 1 . . . 1 1 
       3340 1 . . . 1 1 
       3341 1 . . . 1 1 
       3342 1 . . . 1 1 
       3343 1 . . . 1 1 
       3344 1 . . . 1 1 
       3345 1 . . . 1 1 
       3346 1 . . . 1 1 
       3347 1 . . . 1 1 
       3348 1 . . . 1 1 
       3349 1 . . . 1 1 
       3350 1 . . . 1 1 
       3351 1 . . . 1 1 
       3352 1 . . . 1 1 
       3353 1 . . . 1 1 
       3354 1 . . . 1 1 
       3355 1 . . . 1 1 
       3356 1 . . . 1 1 
       3357 1 . . . 1 1 
       3358 1 . . . 1 1 
       3359 1 . . . 1 1 
       3360 1 . . . 1 1 
       3361 1 . . . 1 1 
       3362 1 . . . 1 1 
       3363 1 . . . 1 1 
       3364 1 . . . 1 1 
       3365 1 . . . 1 1 
       3366 1 . . . 1 1 
       3367 1 . . . 1 1 
       3368 1 . . . 1 1 
       3369 1 . . . 1 1 
       3370 1 . . . 1 1 
       3371 1 . . . 1 1 
       3372 1 . . . 1 1 
       3373 1 . . . 1 1 
       3374 1 . . . 1 1 
       3375 1 . . . 1 1 
       3376 1 . . . 1 1 
       3377 1 . . . 1 1 
       3378 1 . . . 1 1 
       3379 1 . . . 1 1 
       3380 1 . . . 1 1 
       3381 1 . . . 1 1 
       3382 1 . . . 1 1 
       3383 1 . . . 1 1 
       3384 1 . . . 1 1 
       3385 1 . . . 1 1 
       3386 1 . . . 1 1 
       3387 1 . . . 1 1 
       3388 1 . . . 1 1 
       3389 1 . . . 1 1 
       3390 1 . . . 1 1 
       3391 1 . . . 1 1 
       3392 1 . . . 1 1 
       3393 1 . . . 1 1 
       3394 1 . . . 1 1 
       3395 1 . . . 1 1 
       3396 1 . . . 1 1 
       3397 1 . . . 1 1 
       3398 1 . . . 1 1 
       3399 1 . . . 1 1 
       3400 1 . . . 1 1 
       3401 1 . . . 1 1 
       3402 1 . . . 1 1 
       3403 1 . . . 1 1 
       3404 1 . . . 1 1 
       3405 1 . . . 1 1 
       3406 1 . . . 1 1 
       3407 1 . . . 1 1 
       3408 1 . . . 1 1 
       3409 1 . . . 1 1 
       3410 1 . . . 1 1 
       3411 1 . . . 1 1 
       3412 1 . . . 1 1 
       3413 1 . . . 1 1 
       3414 1 . . . 1 1 
       3415 1 . . . 1 1 
       3416 1 . . . 1 1 
       3417 1 . . . 1 1 
       3418 1 . . . 1 1 
       3419 1 . . . 1 1 
       3420 1 . . . 1 1 
       3421 1 . . . 1 1 
       3422 1 . . . 1 1 
       3423 1 . . . 1 1 
       3424 1 . . . 1 1 
       3425 1 . . . 1 1 
       3426 1 . . . 1 1 
       3427 1 . . . 1 1 
       3428 1 . . . 1 1 
       3429 1 . . . 1 1 
       3430 1 . . . 1 1 
       3431 1 . . . 1 1 
       3432 1 . . . 1 1 
       3433 1 . . . 1 1 
       3434 1 . . . 1 1 
       3435 1 . . . 1 1 
       3436 1 . . . 1 1 
       3437 1 . . . 1 1 
       3438 1 . . . 1 1 
       3439 1 . . . 1 1 
       3440 1 . . . 1 1 
       3441 1 . . . 1 1 
       3442 1 . . . 1 1 
       3443 1 . . . 1 1 
       3444 1 . . . 1 1 
       3445 1 . . . 1 1 
       3446 1 . . . 1 1 
       3447 1 . . . 1 1 
       3448 1 . . . 1 1 
       3449 1 . . . 1 1 
       3450 1 . . . 1 1 
       3451 1 . . . 1 1 
       3452 1 . . . 1 1 
       3453 1 . . . 1 1 
       3454 1 . . . 1 1 
       3455 1 . . . 1 1 
       3456 1 . . . 1 1 
       3457 1 . . . 1 1 
       3458 1 . . . 1 1 
       3459 1 . . . 1 1 
       3460 1 . . . 1 1 
       3461 1 . . . 1 1 
       3462 1 . . . 1 1 
       3463 1 . . . 1 1 
       3464 1 . . . 1 1 
       3465 1 . . . 1 1 
       3466 1 . . . 1 1 
       3467 1 . . . 1 1 
       3468 1 . . . 1 1 
       3469 1 . . . 1 1 
       3470 1 . . . 1 1 
       3471 1 . . . 1 1 
       3472 1 . . . 1 1 
       3473 1 . . . 1 1 
       3474 1 . . . 1 1 
       3475 1 . . . 1 1 
       3476 1 . . . 1 1 
       3477 1 . . . 1 1 
       3478 1 . . . 1 1 
       3479 1 . . . 1 1 
       3480 1 . . . 1 1 
       3481 1 . . . 1 1 
       3482 1 . . . 1 1 
       3483 1 . . . 1 1 
       3484 1 . . . 1 1 
       3485 1 . . . 1 1 
       3486 1 . . . 1 1 
       3487 1 . . . 1 1 
       3488 1 . . . 1 1 
       3489 1 . . . 1 1 
       3490 1 . . . 1 1 
       3491 1 . . . 1 1 
       3492 1 . . . 1 1 
       3493 1 . . . 1 1 
       3494 1 . . . 1 1 
       3495 1 . . . 1 1 
       3496 1 . . . 1 1 
       3497 1 . . . 1 1 
       3498 1 . . . 1 1 
       3499 1 . . . 1 1 
       3500 1 . . . 1 1 
       3501 1 . . . 1 1 
       3502 1 . . . 1 1 
       3503 1 . . . 1 1 
       3504 1 . . . 1 1 
       3505 1 . . . 1 1 
       3506 1 . . . 1 1 
       3507 1 . . . 1 1 
       3508 1 . . . 1 1 
       3509 1 . . . 1 1 
       3510 1 . . . 1 1 
       3511 1 . . . 1 1 
       3512 1 . . . 1 1 
       3513 1 . . . 1 1 
       3514 1 . . . 1 1 
       3515 1 . . . 1 1 
       3516 1 . . . 1 1 
       3517 1 . . . 1 1 
       3518 1 . . . 1 1 
       3519 1 . . . 1 1 
       3520 1 . . . 1 1 
       3521 1 . . . 1 1 
       3522 1 . . . 1 1 
       3523 1 . . . 1 1 
       3524 1 . . . 1 1 
       3525 1 . . . 1 1 
       3526 1 . . . 1 1 
       3527 1 . . . 1 1 
       3528 1 . . . 1 1 
       3529 1 . . . 1 1 
       3530 1 . . . 1 1 
       3531 1 . . . 1 1 
       3532 1 . . . 1 1 
       3533 1 . . . 1 1 
       3534 1 . . . 1 1 
       3535 1 . . . 1 1 
       3536 1 . . . 1 1 
       3537 1 . . . 1 1 
       3538 1 . . . 1 1 
       3539 1 . . . 1 1 
       3540 1 . . . 1 1 
       3541 1 . . . 1 1 
       3542 1 . . . 1 1 
       3543 1 . . . 1 1 
       3544 1 . . . 1 1 
       3545 1 . . . 1 1 
       3546 1 . . . 1 1 
       3547 1 . . . 1 1 
       3548 1 . . . 1 1 
       3549 1 . . . 1 1 
       3550 1 . . . 1 1 
       3551 1 . . . 1 1 
       3552 1 . . . 1 1 
       3553 1 . . . 1 1 
       3554 1 . . . 1 1 
       3555 1 . . . 1 1 
       3556 1 . . . 1 1 
       3557 1 . . . 1 1 
       3558 1 . . . 1 1 
       3559 1 . . . 1 1 
       3560 1 . . . 1 1 
       3561 1 . . . 1 1 
       3562 1 . . . 1 1 
       3563 1 . . . 1 1 
       3564 1 . . . 1 1 
       3565 1 . . . 1 1 
       3566 1 . . . 1 1 
       3567 1 . . . 1 1 
       3568 1 . . . 1 1 
       3569 1 . . . 1 1 
       3570 1 . . . 1 1 
       3571 1 . . . 1 1 
       3572 1 . . . 1 1 
       3573 1 . . . 1 1 
       3574 1 . . . 1 1 
       3575 1 . . . 1 1 
       3576 1 . . . 1 1 
       3577 1 . . . 1 1 
       3578 1 . . . 1 1 
       3579 1 . . . 1 1 
       3580 1 . . . 1 1 
       3581 1 . . . 1 1 
       3582 1 . . . 1 1 
       3583 1 . . . 1 1 
       3584 1 . . . 1 1 
       3585 1 . . . 1 1 
       3586 1 . . . 1 1 
       3587 1 . . . 1 1 
       3588 1 . . . 1 1 
       3589 1 . . . 1 1 
       3590 1 . . . 1 1 
       3591 1 . . . 1 1 
       3592 1 . . . 1 1 
       3593 1 . . . 1 1 
       3594 1 . . . 1 1 
       3595 1 . . . 1 1 
       3596 1 . . . 1 1 
       3597 1 . . . 1 1 
       3598 1 . . . 1 1 
       3599 1 . . . 1 1 
       3600 1 . . . 1 1 
       3601 1 . . . 1 1 
       3602 1 . . . 1 1 
       3603 1 . . . 1 1 
       3604 1 . . . 1 1 
       3605 1 . . . 1 1 
       3606 1 . . . 1 1 
       3607 1 . . . 1 1 
       3608 1 . . . 1 1 
       3609 1 . . . 1 1 
       3610 1 . . . 1 1 
       3611 1 . . . 1 1 
       3612 1 . . . 1 1 
       3613 1 . . . 1 1 
       3614 1 . . . 1 1 
       3615 1 . . . 1 1 
       3616 1 . . . 1 1 
       3617 1 . . . 1 1 
       3618 1 . . . 1 1 
       3619 1 . . . 1 1 
       3620 1 . . . 1 1 
       3621 1 . . . 1 1 
       3622 1 . . . 1 1 
       3623 1 . . . 1 1 
       3624 1 . . . 1 1 
       3625 1 . . . 1 1 
       3626 1 . . . 1 1 
       3627 1 . . . 1 1 
       3628 1 . . . 1 1 
       3629 1 . . . 1 1 
       3630 1 . . . 1 1 
       3631 1 . . . 1 1 
       3632 1 . . . 1 1 
       3633 1 . . . 1 1 
       3634 1 . . . 1 1 
       3635 1 . . . 1 1 
       3636 1 . . . 1 1 
       3637 1 . . . 1 1 
       3638 1 . . . 1 1 
       3639 1 . . . 1 1 
       3640 1 . . . 1 1 
       3641 1 . . . 1 1 
       3642 1 . . . 1 1 
       3643 1 . . . 1 1 
       3644 1 . . . 1 1 
       3645 1 . . . 1 1 
       3646 1 . . . 1 1 
       3647 1 . . . 1 1 
       3648 1 . . . 1 1 
       3649 1 . . . 1 1 
       3650 1 . . . 1 1 
       3651 1 . . . 1 1 
       3652 1 . . . 1 1 
       3653 1 . . . 1 1 
       3654 1 . . . 1 1 
       3655 1 . . . 1 1 
       3656 1 . . . 1 1 
       3657 1 . . . 1 1 
       3658 1 . . . 1 1 
       3659 1 . . . 1 1 
       3660 1 . . . 1 1 
       3661 1 . . . 1 1 
       3662 1 . . . 1 1 
       3663 1 . . . 1 1 
       3664 1 . . . 1 1 
       3665 1 . . . 1 1 
       3666 1 . . . 1 1 
       3667 1 . . . 1 1 
       3668 1 . . . 1 1 
       3669 1 . . . 1 1 
       3670 1 . . . 1 1 
       3671 1 . . . 1 1 
       3672 1 . . . 1 1 
       3673 1 . . . 1 1 
       3674 1 . . . 1 1 
       3675 1 . . . 1 1 
       3676 1 . . . 1 1 
       3677 1 . . . 1 1 
       3678 1 . . . 1 1 
       3679 1 . . . 1 1 
       3680 1 . . . 1 1 
       3681 1 . . . 1 1 
       3682 1 . . . 1 1 
       3683 1 . . . 1 1 
       3684 1 . . . 1 1 
       3685 1 . . . 1 1 
       3686 1 . . . 1 1 
       3687 1 . . . 1 1 
       3688 1 . . . 1 1 
       3689 1 . . . 1 1 
       3690 1 . . . 1 1 
       3691 1 . . . 1 1 
       3692 1 . . . 1 1 
       3693 1 . . . 1 1 
       3694 1 . . . 1 1 
       3695 1 . . . 1 1 
       3696 1 . . . 1 1 
       3697 1 . . . 1 1 
       3698 1 . . . 1 1 
       3699 1 . . . 1 1 
       3700 1 . . . 1 1 
       3701 1 . . . 1 1 
       3702 1 . . . 1 1 
       3703 1 . . . 1 1 
       3704 1 . . . 1 1 
       3705 1 . . . 1 1 
       3706 1 . . . 1 1 
       3707 1 . . . 1 1 
       3708 1 . . . 1 1 
       3709 1 . . . 1 1 
       3710 1 . . . 1 1 
       3711 1 . . . 1 1 
       3712 1 . . . 1 1 
       3713 1 . . . 1 1 
       3714 1 . . . 1 1 
       3715 1 . . . 1 1 
       3716 1 . . . 1 1 
       3717 1 . . . 1 1 
       3718 1 . . . 1 1 
       3719 1 . . . 1 1 
       3720 1 . . . 1 1 
       3721 1 . . . 1 1 
       3722 1 . . . 1 1 
       3723 1 . . . 1 1 
       3724 1 . . . 1 1 
       3725 1 . . . 1 1 
       3726 1 . . . 1 1 
       3727 1 . . . 1 1 
       3728 1 . . . 1 1 
       3729 1 . . . 1 1 
       3730 1 . . . 1 1 
       3731 1 . . . 1 1 
       3732 1 . . . 1 1 
       3733 1 . . . 1 1 
       3734 1 . . . 1 1 
       3735 1 . . . 1 1 
       3736 1 . . . 1 1 
       3737 1 . . . 1 1 
       3738 1 . . . 1 1 
       3739 1 . . . 1 1 
       3740 1 . . . 1 1 
       3741 1 . . . 1 1 
       3742 1 . . . 1 1 
       3743 1 . . . 1 1 
       3744 1 . . . 1 1 
       3745 1 . . . 1 1 
       3746 1 . . . 1 1 
       3747 1 . . . 1 1 
       3748 1 . . . 1 1 
       3749 1 . . . 1 1 
       3750 1 . . . 1 1 
       3751 1 . . . 1 1 
       3752 1 . . . 1 1 
       3753 1 . . . 1 1 
       3754 1 . . . 1 1 
       3755 1 . . . 1 1 
       3756 1 . . . 1 1 
       3757 1 . . . 1 1 
       3758 1 . . . 1 1 
       3759 1 . . . 1 1 
       3760 1 . . . 1 1 
       3761 1 . . . 1 1 
       3762 1 . . . 1 1 
       3763 1 . . . 1 1 
       3764 1 . . . 1 1 
       3765 1 . . . 1 1 
       3766 1 . . . 1 1 
       3767 1 . . . 1 1 
       3768 1 . . . 1 1 
       3769 1 . . . 1 1 
       3770 1 . . . 1 1 
       3771 1 . . . 1 1 
       3772 1 . . . 1 1 
       3773 1 . . . 1 1 
       3774 1 . . . 1 1 
       3775 1 . . . 1 1 
       3776 1 . . . 1 1 
       3777 1 . . . 1 1 
       3778 1 . . . 1 1 
       3779 1 . . . 1 1 
       3780 1 . . . 1 1 
       3781 1 . . . 1 1 
       3782 1 . . . 1 1 
       3783 1 . . . 1 1 
       3784 1 . . . 1 1 
       3785 1 . . . 1 1 
       3786 1 . . . 1 1 
       3787 1 . . . 1 1 
       3788 1 . . . 1 1 
       3789 1 . . . 1 1 
       3790 1 . . . 1 1 
       3791 1 . . . 1 1 
       3792 1 . . . 1 1 
       3793 1 . . . 1 1 
       3794 1 . . . 1 1 
       3795 1 . . . 1 1 
       3796 1 . . . 1 1 
       3797 1 . . . 1 1 
       3798 1 . . . 1 1 
       3799 1 . . . 1 1 
       3800 1 . . . 1 1 
       3801 1 . . . 1 1 
       3802 1 . . . 1 1 
       3803 1 . . . 1 1 
       3804 1 . . . 1 1 
       3805 1 . . . 1 1 
       3806 1 . . . 1 1 
       3807 1 . . . 1 1 
       3808 1 . . . 1 1 
       3809 1 . . . 1 1 
       3810 1 . . . 1 1 
       3811 1 . . . 1 1 
       3812 1 . . . 1 1 
       3813 1 . . . 1 1 
       3814 1 . . . 1 1 
       3815 1 . . . 1 1 
       3816 1 . . . 1 1 
       3817 1 . . . 1 1 
       3818 1 . . . 1 1 
       3819 1 . . . 1 1 
       3820 1 . . . 1 1 
       3821 1 . . . 1 1 
       3822 1 . . . 1 1 
       3823 1 . . . 1 1 
       3824 1 . . . 1 1 
       3825 1 . . . 1 1 
       3826 1 . . . 1 1 
       3827 1 . . . 1 1 
       3828 1 . . . 1 1 
       3829 1 . . . 1 1 
       3830 1 . . . 1 1 
       3831 1 . . . 1 1 
       3832 1 . . . 1 1 
       3833 1 . . . 1 1 
       3834 1 . . . 1 1 
       3835 1 . . . 1 1 
       3836 1 . . . 1 1 
       3837 1 . . . 1 1 
       3838 1 . . . 1 1 
       3839 1 . . . 1 1 
       3840 1 . . . 1 1 
       3841 1 . . . 1 1 
       3842 1 . . . 1 1 
       3843 1 . . . 1 1 
       3844 1 . . . 1 1 
       3845 1 . . . 1 1 
       3846 1 . . . 1 1 
       3847 1 . . . 1 1 
       3848 1 . . . 1 1 
       3849 1 . . . 1 1 
       3850 1 . . . 1 1 
       3851 1 . . . 1 1 
       3852 1 . . . 1 1 
       3853 1 . . . 1 1 
       3854 1 . . . 1 1 
       3855 1 . . . 1 1 
       3856 1 . . . 1 1 
       3857 1 . . . 1 1 
       3858 1 . . . 1 1 
       3859 1 . . . 1 1 
       3860 1 . . . 1 1 
       3861 1 . . . 1 1 
       3862 1 . . . 1 1 
       3863 1 . . . 1 1 
       3864 1 . . . 1 1 
       3865 1 . . . 1 1 
       3866 1 . . . 1 1 
       3867 1 . . . 1 1 
       3868 1 . . . 1 1 
       3869 1 . . . 1 1 
       3870 1 . . . 1 1 
       3871 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   4 MET HA   .   1 . HA   1 1 
          1 1 2 1 1   4 MET QG   .   1 . HG*  1 1 
          2 1 1 1 1   4 MET HA   .   1 . HA   1 1 
          2 1 2 1 1   5 ARG H    .   2 . HN   1 1 
          3 1 1 1 1   4 MET HA   .   1 . HA   1 1 
          3 1 2 1 1   5 ARG HA   .   2 . HA   1 1 
          4 1 1 1 1   4 MET HA   .   1 . HA   1 1 
          4 1 2 1 1   6 LEU H    .   3 . HN   1 1 
          5 1 1 1 1   4 MET QB   .   1 . HB*  1 1 
          5 1 2 1 1   5 ARG H    .   2 . HN   1 1 
          6 1 1 1 1   4 MET QB   .   1 . HB*  1 1 
          6 1 2 1 1   5 ARG QB   .   2 . HB*  1 1 
          7 1 1 1 1   4 MET QB   .   1 . HB*  1 1 
          7 1 2 1 1   6 LEU QB   .   3 . HB2  1 1 
          8 1 1 1 1   4 MET QB   .   1 . HB*  1 1 
          8 1 2 1 1   6 LEU QD   .   3 . HD*  1 1 
          9 1 1 1 1   4 MET HB2  .   1 . HB2  1 1 
          9 1 2 1 1   5 ARG H    .   2 . HN   1 1 
         10 1 1 1 1   4 MET HB3  .   1 . HB1  1 1 
         10 1 2 1 1   5 ARG H    .   2 . HN   1 1 
         11 1 1 1 1   4 MET ME   .   1 . HE*  1 1 
         11 1 2 1 1   4 MET QG   .   1 . HG*  1 1 
         12 1 1 1 1   4 MET ME   .   1 . HE*  1 1 
         12 1 2 1 1   6 LEU QD   .   3 . HD*  1 1 
         13 1 1 1 1   4 MET QG   .   1 . HG*  1 1 
         13 1 2 1 1   5 ARG H    .   2 . HN   1 1 
         14 1 1 1 1   4 MET QG   .   1 . HG*  1 1 
         14 1 2 1 1   6 LEU QD   .   3 . HD1* 1 1 
         15 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         15 1 2 1 1   5 ARG QB   .   2 . HB*  1 1 
         16 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         16 1 2 1 1   5 ARG QD   .   2 . HD*  1 1 
         17 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         17 1 2 1 1   5 ARG QG   .   2 . HG*  1 1 
         18 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         18 1 2 1 1   6 LEU H    .   3 . HN   1 1 
         19 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         19 1 2 1 1   6 LEU HG   .   3 . HG   1 1 
         20 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         20 1 2 1 1  69 ALA HA   .  66 . HA   1 1 
         21 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         21 1 2 1 1  70 GLU H    .  67 . HN   1 1 
         22 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         22 1 2 1 1  70 GLU HA   .  67 . HA   1 1 
         23 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         23 1 2 1 1  70 GLU HB2  .  67 . HB2  1 1 
         24 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         24 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
         25 1 1 1 1   5 ARG H    .   2 . HN   1 1 
         25 1 2 1 1  70 GLU HB3  .  67 . HB1  1 1 
         26 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         26 1 2 1 1   5 ARG HD2  .   2 . HD2  1 1 
         27 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         27 1 2 1 1   5 ARG QD   .   2 . HD*  1 1 
         28 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         28 1 2 1 1   5 ARG HD3  .   2 . HD1  1 1 
         29 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         29 1 2 1 1   5 ARG QG   .   2 . HG*  1 1 
         30 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         30 1 2 1 1   6 LEU H    .   3 . HN   1 1 
         31 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         31 1 2 1 1   6 LEU HA   .   3 . HA   1 1 
         32 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         32 1 2 1 1   6 LEU QD   .   3 . HD*  1 1 
         33 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         33 1 2 1 1   6 LEU HG   .   3 . HG   1 1 
         34 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         34 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
         35 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         35 1 2 1 1  70 GLU H    .  67 . HN   1 1 
         36 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         36 1 2 1 1  70 GLU HB2  .  67 . HB2  1 1 
         37 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         37 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
         38 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         38 1 2 1 1  70 GLU HB3  .  67 . HB1  1 1 
         39 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         39 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
         40 1 1 1 1   5 ARG HA   .   2 . HA   1 1 
         40 1 2 1 1  71 ARG H    .  68 . HN   1 1 
         41 1 1 1 1   5 ARG QB   .   2 . HB*  1 1 
         41 1 2 1 1   5 ARG HD2  .   2 . HD2  1 1 
         42 1 1 1 1   5 ARG QB   .   2 . HB*  1 1 
         42 1 2 1 1   5 ARG HD3  .   2 . HD1  1 1 
         43 1 1 1 1   5 ARG QB   .   2 . HB*  1 1 
         43 1 2 1 1   6 LEU H    .   3 . HN   1 1 
         44 1 1 1 1   5 ARG QB   .   2 . HB*  1 1 
         44 1 2 1 1  69 ALA HA   .  66 . HA   1 1 
         45 1 1 1 1   5 ARG QB   .   2 . HB*  1 1 
         45 1 2 1 1  70 GLU H    .  67 . HN   1 1 
         46 1 1 1 1   5 ARG QB   .   2 . HB*  1 1 
         46 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
         47 1 1 1 1   5 ARG QD   .   2 . HD*  1 1 
         47 1 2 1 1  68 ARG H    .  65 . HN   1 1 
         48 1 1 1 1   5 ARG QD   .   2 . HD*  1 1 
         48 1 2 1 1  68 ARG HA   .  65 . HA   1 1 
         49 1 1 1 1   5 ARG QD   .   2 . HD*  1 1 
         49 1 2 1 1  69 ALA H    .  66 . HN   1 1 
         50 1 1 1 1   5 ARG QD   .   2 . HD*  1 1 
         50 1 2 1 1  69 ALA HA   .  66 . HA   1 1 
         51 1 1 1 1   5 ARG QD   .   2 . HD*  1 1 
         51 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
         52 1 1 1 1   5 ARG QD   .   2 . HD*  1 1 
         52 1 2 1 1  70 GLU HA   .  67 . HA   1 1 
         53 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         53 1 2 1 1   6 LEU QD   .   3 . HD*  1 1 
         54 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         54 1 2 1 1  69 ALA H    .  66 . HN   1 1 
         55 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         55 1 2 1 1  69 ALA HA   .  66 . HA   1 1 
         56 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         56 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
         57 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         57 1 2 1 1  70 GLU H    .  67 . HN   1 1 
         58 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         58 1 2 1 1  70 GLU HA   .  67 . HA   1 1 
         59 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         59 1 2 1 1  70 GLU HB2  .  67 . HB2  1 1 
         60 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         60 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
         61 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         61 1 2 1 1  70 GLU HB3  .  67 . HB1  1 1 
         62 1 1 1 1   5 ARG QG   .   2 . HG*  1 1 
         62 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
         63 1 1 1 1   6 LEU H    .   3 . HN   1 1 
         63 1 2 1 1   6 LEU QD   .   3 . HD1* 1 1 
         64 1 1 1 1   6 LEU H    .   3 . HN   1 1 
         64 1 2 1 1   6 LEU HG   .   3 . HG   1 1 
         65 1 1 1 1   6 LEU H    .   3 . HN   1 1 
         65 1 2 1 1   7 LYS H    .   4 . HN   1 1 
         66 1 1 1 1   6 LEU H    .   3 . HN   1 1 
         66 1 2 1 1  11 PHE HB2  .   8 . HB2  1 1 
         67 1 1 1 1   6 LEU H    .   3 . HN   1 1 
         67 1 2 1 1  70 GLU HA   .  67 . HA   1 1 
         68 1 1 1 1   6 LEU H    .   3 . HN   1 1 
         68 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
         69 1 1 1 1   6 LEU HA   .   3 . HA   1 1 
         69 1 2 1 1   6 LEU QD   .   3 . HD2* 1 1 
         70 1 1 1 1   6 LEU HA   .   3 . HA   1 1 
         70 1 2 1 1   6 LEU HG   .   3 . HG   1 1 
         71 1 1 1 1   6 LEU HA   .   3 . HA   1 1 
         71 1 2 1 1   7 LYS H    .   4 . HN   1 1 
         72 1 1 1 1   6 LEU HA   .   3 . HA   1 1 
         72 1 2 1 1   7 LYS QB   .   4 . HB*  1 1 
         73 1 1 1 1   6 LEU HA   .   3 . HA   1 1 
         73 1 2 1 1   7 LYS QG   .   4 . HG*  1 1 
         74 1 1 1 1   6 LEU HA   .   3 . HA   1 1 
         74 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
         75 1 1 1 1   6 LEU QB   .   3 . HB1  1 1 
         75 1 2 1 1   7 LYS H    .   4 . HN   1 1 
         76 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         76 1 2 1 1   7 LYS QB   .   4 . HB*  1 1 
         77 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         77 1 2 1 1  10 MET H    .   7 . HN   1 1 
         78 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         78 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
         79 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         79 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
         80 1 1 1 1   6 LEU QB   .   3 . HB1  1 1 
         80 1 2 1 1  11 PHE H    .   8 . HN   1 1 
         81 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         81 1 2 1 1  11 PHE HA   .   8 . HA   1 1 
         82 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         82 1 2 1 1  11 PHE HB2  .   8 . HB2  1 1 
         83 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         83 1 2 1 1  11 PHE HB3  .   8 . HB1  1 1 
         84 1 1 1 1   6 LEU QB   .   3 . HB2  1 1 
         84 1 2 1 1  11 PHE QD   .   8 . HD1  1 1 
         85 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
         85 1 2 1 1   7 LYS H    .   4 . HN   1 1 
         86 1 1 1 1   6 LEU QD   .   3 . HD1* 1 1 
         86 1 2 1 1  10 MET H    .   7 . HN   1 1 
         87 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
         87 1 2 1 1  10 MET HA   .   7 . HA   1 1 
         88 1 1 1 1   6 LEU QD   .   3 . HD1* 1 1 
         88 1 2 1 1  10 MET HB2  .   7 . HB2  1 1 
         89 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
         89 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
         90 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
         90 1 2 1 1  10 MET ME   .   7 . HE*  1 1 
         91 1 1 1 1   6 LEU QD   .   3 . HD1* 1 1 
         91 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
         92 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
         92 1 2 1 1  11 PHE H    .   8 . HN   1 1 
         93 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
         93 1 2 1 1  11 PHE HA   .   8 . HA   1 1 
         94 1 1 1 1   6 LEU QD   .   3 . HD1* 1 1 
         94 1 2 1 1  11 PHE HB2  .   8 . HB2  1 1 
         95 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
         95 1 2 1 1  11 PHE HB3  .   8 . HB1  1 1 
         96 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
         96 1 2 1 1  11 PHE QD   .   8 . HD1  1 1 
         97 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
         97 1 2 1 1  11 PHE QE   .   8 . HE1  1 1 
         98 1 1 1 1   6 LEU QD   .   3 . HD1* 1 1 
         98 1 2 1 1  12 VAL H    .   9 . HN   1 1 
         99 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
         99 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        100 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
        100 1 2 1 1  14 ALA HA   .  11 . HA   1 1 
        101 1 1 1 1   6 LEU QD   .   3 . HD2* 1 1 
        101 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        102 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
        102 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
        103 1 1 1 1   6 LEU QD   .   3 . HD*  1 1 
        103 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
        104 1 1 1 1   6 LEU HG   .   3 . HG   1 1 
        104 1 2 1 1   7 LYS H    .   4 . HN   1 1 
        105 1 1 1 1   6 LEU HG   .   3 . HG   1 1 
        105 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        106 1 1 1 1   6 LEU HG   .   3 . HG   1 1 
        106 1 2 1 1  10 MET ME   .   7 . HE*  1 1 
        107 1 1 1 1   6 LEU HG   .   3 . HG   1 1 
        107 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
        108 1 1 1 1   6 LEU HG   .   3 . HG   1 1 
        108 1 2 1 1  11 PHE QD   .   8 . HD1  1 1 
        109 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        109 1 2 1 1   7 LYS HB2  .   4 . HB2  1 1 
        110 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        110 1 2 1 1   7 LYS QB   .   4 . HB*  1 1 
        111 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        111 1 2 1 1   7 LYS HB3  .   4 . HB1  1 1 
        112 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        112 1 2 1 1   7 LYS QE   .   4 . HE*  1 1 
        113 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        113 1 2 1 1   7 LYS QG   .   4 . HG*  1 1 
        114 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        114 1 2 1 1   8 SER H    .   5 . HN   1 1 
        115 1 1 1 1   7 LYS H    .   4 . HN   1 1 
        115 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        116 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        116 1 2 1 1   7 LYS QD   .   4 . HD*  1 1 
        117 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        117 1 2 1 1   7 LYS QE   .   4 . HE*  1 1 
        118 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        118 1 2 1 1   7 LYS HG2  .   4 . HG2  1 1 
        119 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        119 1 2 1 1   7 LYS QG   .   4 . HG*  1 1 
        120 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        120 1 2 1 1   7 LYS HG3  .   4 . HG1  1 1 
        121 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        121 1 2 1 1   8 SER H    .   5 . HN   1 1 
        122 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        122 1 2 1 1   8 SER HA   .   5 . HA   1 1 
        123 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        123 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        124 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        124 1 2 1 1  10 MET H    .   7 . HN   1 1 
        125 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        125 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        126 1 1 1 1   7 LYS HA   .   4 . HA   1 1 
        126 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
        127 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        127 1 2 1 1   7 LYS QD   .   4 . HD*  1 1 
        128 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        128 1 2 1 1   8 SER H    .   5 . HN   1 1 
        129 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        129 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        130 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        130 1 2 1 1   9 GLU HB3  .   6 . HB1  1 1 
        131 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        131 1 2 1 1  10 MET HB2  .   7 . HB2  1 1 
        132 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        132 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        133 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        133 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
        134 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        134 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        135 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        135 1 2 1 1  34 GLU HB3  .  31 . HB1  1 1 
        136 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        136 1 2 1 1  35 ALA H    .  32 . HN   1 1 
        137 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        137 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        138 1 1 1 1   7 LYS QB   .   4 . HB*  1 1 
        138 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
        139 1 1 1 1   7 LYS HB2  .   4 . HB2  1 1 
        139 1 2 1 1   7 LYS QD   .   4 . HD*  1 1 
        140 1 1 1 1   7 LYS HB2  .   4 . HB2  1 1 
        140 1 2 1 1   7 LYS QE   .   4 . HE*  1 1 
        141 1 1 1 1   7 LYS HB2  .   4 . HB2  1 1 
        141 1 2 1 1   8 SER H    .   5 . HN   1 1 
        142 1 1 1 1   7 LYS HB2  .   4 . HB2  1 1 
        142 1 2 1 1  10 MET H    .   7 . HN   1 1 
        143 1 1 1 1   7 LYS HB2  .   4 . HB2  1 1 
        143 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        144 1 1 1 1   7 LYS HB3  .   4 . HB1  1 1 
        144 1 2 1 1   7 LYS QD   .   4 . HD*  1 1 
        145 1 1 1 1   7 LYS HB3  .   4 . HB1  1 1 
        145 1 2 1 1   7 LYS QE   .   4 . HE*  1 1 
        146 1 1 1 1   7 LYS HB3  .   4 . HB1  1 1 
        146 1 2 1 1   8 SER H    .   5 . HN   1 1 
        147 1 1 1 1   7 LYS HB3  .   4 . HB1  1 1 
        147 1 2 1 1  10 MET H    .   7 . HN   1 1 
        148 1 1 1 1   7 LYS HB3  .   4 . HB1  1 1 
        148 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        149 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        149 1 2 1 1   8 SER H    .   5 . HN   1 1 
        150 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        150 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        151 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        151 1 2 1 1   9 GLU HB3  .   6 . HB1  1 1 
        152 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        152 1 2 1 1  10 MET HB2  .   7 . HB2  1 1 
        153 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        153 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
        154 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        154 1 2 1 1  34 GLU HB2  .  31 . HB2  1 1 
        155 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        155 1 2 1 1  34 GLU HB3  .  31 . HB1  1 1 
        156 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        156 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
        157 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        157 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
        158 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        158 1 2 1 1  35 ALA H    .  32 . HN   1 1 
        159 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        159 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        160 1 1 1 1   7 LYS QD   .   4 . HD*  1 1 
        160 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
        161 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        161 1 2 1 1   7 LYS QG   .   4 . HG*  1 1 
        162 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        162 1 2 1 1   8 SER H    .   5 . HN   1 1 
        163 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        163 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        164 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        164 1 2 1 1  34 GLU HB2  .  31 . HB2  1 1 
        165 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        165 1 2 1 1  34 GLU HB3  .  31 . HB1  1 1 
        166 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        166 1 2 1 1  35 ALA H    .  32 . HN   1 1 
        167 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        167 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        168 1 1 1 1   7 LYS QE   .   4 . HE*  1 1 
        168 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
        169 1 1 1 1   7 LYS QG   .   4 . HG*  1 1 
        169 1 2 1 1   8 SER H    .   5 . HN   1 1 
        170 1 1 1 1   7 LYS QG   .   4 . HG*  1 1 
        170 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        171 1 1 1 1   7 LYS QG   .   4 . HG*  1 1 
        171 1 2 1 1  10 MET HB2  .   7 . HB2  1 1 
        172 1 1 1 1   7 LYS QG   .   4 . HG*  1 1 
        172 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        173 1 1 1 1   7 LYS QG   .   4 . HG*  1 1 
        173 1 2 1 1  35 ALA H    .  32 . HN   1 1 
        174 1 1 1 1   7 LYS QG   .   4 . HG*  1 1 
        174 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        175 1 1 1 1   7 LYS HG2  .   4 . HG2  1 1 
        175 1 2 1 1   8 SER H    .   5 . HN   1 1 
        176 1 1 1 1   7 LYS HG2  .   4 . HG2  1 1 
        176 1 2 1 1  10 MET H    .   7 . HN   1 1 
        177 1 1 1 1   7 LYS HG3  .   4 . HG1  1 1 
        177 1 2 1 1   8 SER H    .   5 . HN   1 1 
        178 1 1 1 1   7 LYS HG3  .   4 . HG1  1 1 
        178 1 2 1 1  10 MET H    .   7 . HN   1 1 
        179 1 1 1 1   8 SER H    .   5 . HN   1 1 
        179 1 2 1 1   8 SER HB2  .   5 . HB2  1 1 
        180 1 1 1 1   8 SER H    .   5 . HN   1 1 
        180 1 2 1 1   8 SER QB   .   5 . HB*  1 1 
        181 1 1 1 1   8 SER H    .   5 . HN   1 1 
        181 1 2 1 1   8 SER HB3  .   5 . HB1  1 1 
        182 1 1 1 1   8 SER H    .   5 . HN   1 1 
        182 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        183 1 1 1 1   8 SER H    .   5 . HN   1 1 
        183 1 2 1 1   9 GLU HB2  .   6 . HB2  1 1 
        184 1 1 1 1   8 SER H    .   5 . HN   1 1 
        184 1 2 1 1   9 GLU HB3  .   6 . HB1  1 1 
        185 1 1 1 1   8 SER H    .   5 . HN   1 1 
        185 1 2 1 1  10 MET H    .   7 . HN   1 1 
        186 1 1 1 1   8 SER H    .   5 . HN   1 1 
        186 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        187 1 1 1 1   8 SER H    .   5 . HN   1 1 
        187 1 2 1 1  11 PHE HB3  .   8 . HB1  1 1 
        188 1 1 1 1   8 SER H    .   5 . HN   1 1 
        188 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        189 1 1 1 1   8 SER H    .   5 . HN   1 1 
        189 1 2 1 1  34 GLU HB3  .  31 . HB1  1 1 
        190 1 1 1 1   8 SER H    .   5 . HN   1 1 
        190 1 2 1 1  35 ALA H    .  32 . HN   1 1 
        191 1 1 1 1   8 SER H    .   5 . HN   1 1 
        191 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        192 1 1 1 1   8 SER H    .   5 . HN   1 1 
        192 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
        193 1 1 1 1   8 SER H    .   5 . HN   1 1 
        193 1 2 1 1  37 GLY H    .  34 . HN   1 1 
        194 1 1 1 1   8 SER H    .   5 . HN   1 1 
        194 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        195 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        195 1 2 1 1  10 MET H    .   7 . HN   1 1 
        196 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        196 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        197 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        197 1 2 1 1  11 PHE HB2  .   8 . HB2  1 1 
        198 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        198 1 2 1 1  11 PHE HB3  .   8 . HB1  1 1 
        199 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        199 1 2 1 1  11 PHE QD   .   8 . HD2  1 1 
        200 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        200 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        201 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        201 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        202 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        202 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        203 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        203 1 2 1 1  37 GLY H    .  34 . HN   1 1 
        204 1 1 1 1   8 SER HA   .   5 . HA   1 1 
        204 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        205 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        205 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        206 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        206 1 2 1 1   9 GLU HA   .   6 . HA   1 1 
        207 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        207 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        208 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        208 1 2 1 1  33 ALA H    .  30 . HN   1 1 
        209 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        209 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        210 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        210 1 2 1 1  37 GLY H    .  34 . HN   1 1 
        211 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        211 1 2 1 1  37 GLY HA2  .  34 . HA2  1 1 
        212 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        212 1 2 1 1  39 ILE H    .  36 . HN   1 1 
        213 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        213 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        214 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        214 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
        215 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        215 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
        216 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        216 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
        217 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        217 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
        218 1 1 1 1   8 SER QB   .   5 . HB*  1 1 
        218 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
        219 1 1 1 1   8 SER HB2  .   5 . HB2  1 1 
        219 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        220 1 1 1 1   8 SER HB2  .   5 . HB2  1 1 
        220 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        221 1 1 1 1   8 SER HB2  .   5 . HB2  1 1 
        221 1 2 1 1  37 GLY H    .  34 . HN   1 1 
        222 1 1 1 1   8 SER HB2  .   5 . HB2  1 1 
        222 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        223 1 1 1 1   8 SER HB2  .   5 . HB2  1 1 
        223 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
        224 1 1 1 1   8 SER HB2  .   5 . HB2  1 1 
        224 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
        225 1 1 1 1   8 SER HB3  .   5 . HB1  1 1 
        225 1 2 1 1   9 GLU H    .   6 . HN   1 1 
        226 1 1 1 1   8 SER HB3  .   5 . HB1  1 1 
        226 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        227 1 1 1 1   8 SER HB3  .   5 . HB1  1 1 
        227 1 2 1 1  37 GLY H    .  34 . HN   1 1 
        228 1 1 1 1   8 SER HB3  .   5 . HB1  1 1 
        228 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        229 1 1 1 1   8 SER HB3  .   5 . HB1  1 1 
        229 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
        230 1 1 1 1   8 SER HB3  .   5 . HB1  1 1 
        230 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
        231 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        231 1 2 1 1   9 GLU HB2  .   6 . HB2  1 1 
        232 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        232 1 2 1 1   9 GLU HB3  .   6 . HB1  1 1 
        233 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        233 1 2 1 1   9 GLU HG2  .   6 . HG2  1 1 
        234 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        234 1 2 1 1   9 GLU QG   .   6 . HG*  1 1 
        235 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        235 1 2 1 1   9 GLU HG3  .   6 . HG1  1 1 
        236 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        236 1 2 1 1  10 MET H    .   7 . HN   1 1 
        237 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        237 1 2 1 1  10 MET HA   .   7 . HA   1 1 
        238 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        238 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        239 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        239 1 2 1 1  11 PHE HB3  .   8 . HB1  1 1 
        240 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        240 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        241 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        241 1 2 1 1  34 GLU HB2  .  31 . HB2  1 1 
        242 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        242 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
        243 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        243 1 2 1 1  35 ALA H    .  32 . HN   1 1 
        244 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        244 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        245 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        245 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
        246 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        246 1 2 1 1  37 GLY H    .  34 . HN   1 1 
        247 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        247 1 2 1 1  37 GLY HA3  .  34 . HA1  1 1 
        248 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        248 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        249 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        249 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
        250 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        250 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        251 1 1 1 1   9 GLU H    .   6 . HN   1 1 
        251 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
        252 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        252 1 2 1 1   9 GLU HG2  .   6 . HG2  1 1 
        253 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        253 1 2 1 1   9 GLU HG3  .   6 . HG1  1 1 
        254 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        254 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        255 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        255 1 2 1 1  12 VAL HB   .   9 . HB   1 1 
        256 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        256 1 2 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        257 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        257 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        258 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        258 1 2 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        259 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        259 1 2 1 1  13 SER H    .  10 . HN   1 1 
        260 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        260 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        261 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        261 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        262 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        262 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        263 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        263 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
        264 1 1 1 1   9 GLU HA   .   6 . HA   1 1 
        264 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        265 1 1 1 1   9 GLU HB2  .   6 . HB2  1 1 
        265 1 2 1 1  10 MET H    .   7 . HN   1 1 
        266 1 1 1 1   9 GLU HB2  .   6 . HB2  1 1 
        266 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        267 1 1 1 1   9 GLU HB2  .   6 . HB2  1 1 
        267 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
        268 1 1 1 1   9 GLU HB2  .   6 . HB2  1 1 
        268 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
        269 1 1 1 1   9 GLU HB2  .   6 . HB2  1 1 
        269 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        270 1 1 1 1   9 GLU HB2  .   6 . HB2  1 1 
        270 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
        271 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        271 1 2 1 1  10 MET H    .   7 . HN   1 1 
        272 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        272 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        273 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        273 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        274 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        274 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
        275 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        275 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
        276 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        276 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        277 1 1 1 1   9 GLU HB3  .   6 . HB1  1 1 
        277 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
        278 1 1 1 1   9 GLU QG   .   6 . HG*  1 1 
        278 1 2 1 1  10 MET H    .   7 . HN   1 1 
        279 1 1 1 1   9 GLU QG   .   6 . HG*  1 1 
        279 1 2 1 1  10 MET HA   .   7 . HA   1 1 
        280 1 1 1 1   9 GLU QG   .   6 . HG*  1 1 
        280 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        281 1 1 1 1   9 GLU QG   .   6 . HG*  1 1 
        281 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
        282 1 1 1 1   9 GLU QG   .   6 . HG*  1 1 
        282 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        283 1 1 1 1   9 GLU HG2  .   6 . HG2  1 1 
        283 1 2 1 1  10 MET H    .   7 . HN   1 1 
        284 1 1 1 1   9 GLU HG2  .   6 . HG2  1 1 
        284 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        285 1 1 1 1   9 GLU HG2  .   6 . HG2  1 1 
        285 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        286 1 1 1 1   9 GLU HG3  .   6 . HG1  1 1 
        286 1 2 1 1  10 MET H    .   7 . HN   1 1 
        287 1 1 1 1   9 GLU HG3  .   6 . HG1  1 1 
        287 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
        288 1 1 1 1   9 GLU HG3  .   6 . HG1  1 1 
        288 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        289 1 1 1 1  10 MET H    .   7 . HN   1 1 
        289 1 2 1 1  10 MET HB2  .   7 . HB2  1 1 
        290 1 1 1 1  10 MET H    .   7 . HN   1 1 
        290 1 2 1 1  10 MET HB3  .   7 . HB1  1 1 
        291 1 1 1 1  10 MET H    .   7 . HN   1 1 
        291 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
        292 1 1 1 1  10 MET H    .   7 . HN   1 1 
        292 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        293 1 1 1 1  10 MET H    .   7 . HN   1 1 
        293 1 2 1 1  11 PHE HB2  .   8 . HB2  1 1 
        294 1 1 1 1  10 MET H    .   7 . HN   1 1 
        294 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        295 1 1 1 1  10 MET H    .   7 . HN   1 1 
        295 1 2 1 1  13 SER H    .  10 . HN   1 1 
        296 1 1 1 1  10 MET H    .   7 . HN   1 1 
        296 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
        297 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        297 1 2 1 1  10 MET ME   .   7 . HE*  1 1 
        298 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        298 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        299 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        299 1 2 1 1  13 SER H    .  10 . HN   1 1 
        300 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        300 1 2 1 1  13 SER HA   .  10 . HA   1 1 
        301 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        301 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        302 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        302 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        303 1 1 1 1  10 MET HA   .   7 . HA   1 1 
        303 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        304 1 1 1 1  10 MET HB2  .   7 . HB2  1 1 
        304 1 2 1 1  10 MET ME   .   7 . HE*  1 1 
        305 1 1 1 1  10 MET HB2  .   7 . HB2  1 1 
        305 1 2 1 1  10 MET QG   .   7 . HG*  1 1 
        306 1 1 1 1  10 MET HB2  .   7 . HB2  1 1 
        306 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        307 1 1 1 1  10 MET HB3  .   7 . HB1  1 1 
        307 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        308 1 1 1 1  10 MET HB3  .   7 . HB1  1 1 
        308 1 2 1 1  11 PHE HA   .   8 . HA   1 1 
        309 1 1 1 1  10 MET ME   .   7 . HE*  1 1 
        309 1 2 1 1  11 PHE HA   .   8 . HA   1 1 
        310 1 1 1 1  10 MET ME   .   7 . HE*  1 1 
        310 1 2 1 1  13 SER H    .  10 . HN   1 1 
        311 1 1 1 1  10 MET ME   .   7 . HE*  1 1 
        311 1 2 1 1  13 SER HB2  .  10 . HB2  1 1 
        312 1 1 1 1  10 MET ME   .   7 . HE*  1 1 
        312 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        313 1 1 1 1  10 MET ME   .   7 . HE*  1 1 
        313 1 2 1 1  13 SER HB3  .  10 . HB1  1 1 
        314 1 1 1 1  10 MET ME   .   7 . HE*  1 1 
        314 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        315 1 1 1 1  10 MET QG   .   7 . HG*  1 1 
        315 1 2 1 1  11 PHE H    .   8 . HN   1 1 
        316 1 1 1 1  10 MET QG   .   7 . HG*  1 1 
        316 1 2 1 1  13 SER H    .  10 . HN   1 1 
        317 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        317 1 2 1 1  11 PHE HB2  .   8 . HB2  1 1 
        318 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        318 1 2 1 1  11 PHE HB3  .   8 . HB1  1 1 
        319 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        319 1 2 1 1  11 PHE QD   .   8 . HD1  1 1 
        320 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        320 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        321 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        321 1 2 1 1  12 VAL HA   .   9 . HA   1 1 
        322 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        322 1 2 1 1  12 VAL HB   .   9 . HB   1 1 
        323 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        323 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        324 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        324 1 2 1 1  13 SER H    .  10 . HN   1 1 
        325 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        325 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        326 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        326 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        327 1 1 1 1  11 PHE H    .   8 . HN   1 1 
        327 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
        328 1 1 1 1  11 PHE HA   .   8 . HA   1 1 
        328 1 2 1 1  11 PHE QD   .   8 . HD1  1 1 
        329 1 1 1 1  11 PHE HA   .   8 . HA   1 1 
        329 1 2 1 1  13 SER H    .  10 . HN   1 1 
        330 1 1 1 1  11 PHE HA   .   8 . HA   1 1 
        330 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        331 1 1 1 1  11 PHE HA   .   8 . HA   1 1 
        331 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        332 1 1 1 1  11 PHE HA   .   8 . HA   1 1 
        332 1 2 1 1  15 LEU H    .  12 . HN   1 1 
        333 1 1 1 1  11 PHE HB2  .   8 . HB2  1 1 
        333 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        334 1 1 1 1  11 PHE HB2  .   8 . HB2  1 1 
        334 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        335 1 1 1 1  11 PHE HB2  .   8 . HB2  1 1 
        335 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        336 1 1 1 1  11 PHE HB3  .   8 . HB1  1 1 
        336 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        337 1 1 1 1  11 PHE HB3  .   8 . HB1  1 1 
        337 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        338 1 1 1 1  11 PHE HB3  .   8 . HB1  1 1 
        338 1 2 1 1  13 SER H    .  10 . HN   1 1 
        339 1 1 1 1  11 PHE HB3  .   8 . HB1  1 1 
        339 1 2 1 1  39 ILE HB   .  36 . HB   1 1 
        340 1 1 1 1  11 PHE HB3  .   8 . HB1  1 1 
        340 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        341 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        341 1 2 1 1  12 VAL H    .   9 . HN   1 1 
        342 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        342 1 2 1 1  12 VAL HA   .   9 . HA   1 1 
        343 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        343 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        344 1 1 1 1  11 PHE QD   .   8 . HD1  1 1 
        344 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        345 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        345 1 2 1 1  15 LEU QB   .  12 . HB*  1 1 
        346 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        346 1 2 1 1  15 LEU QD   .  12 . HD2* 1 1 
        347 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        347 1 2 1 1  39 ILE HB   .  36 . HB   1 1 
        348 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        348 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        349 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        349 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
        350 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        350 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        351 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        351 1 2 1 1  73 PHE HZ   .  70 . HZ   1 1 
        352 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        352 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        353 1 1 1 1  11 PHE QD   .   8 . HD2  1 1 
        353 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
        354 1 1 1 1  11 PHE QE   .   8 . HE2  1 1 
        354 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        355 1 1 1 1  11 PHE QE   .   8 . HE2  1 1 
        355 1 2 1 1  15 LEU QD   .  12 . HD2* 1 1 
        356 1 1 1 1  11 PHE QE   .   8 . HE2  1 1 
        356 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        357 1 1 1 1  11 PHE QE   .   8 . HE1  1 1 
        357 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
        358 1 1 1 1  11 PHE QE   .   8 . HE2  1 1 
        358 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        359 1 1 1 1  11 PHE QE   .   8 . HE2  1 1 
        359 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
        360 1 1 1 1  11 PHE QE   .   8 . HE2  1 1 
        360 1 2 1 1 114 THR H    . 111 . HN   1 1 
        361 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        361 1 2 1 1  12 VAL HB   .   9 . HB   1 1 
        362 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        362 1 2 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        363 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        363 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        364 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        364 1 2 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        365 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        365 1 2 1 1  13 SER H    .  10 . HN   1 1 
        366 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        366 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        367 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        367 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        368 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        368 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        369 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        369 1 2 1 1  15 LEU QB   .  12 . HB*  1 1 
        370 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        370 1 2 1 1  15 LEU QD   .  12 . HD*  1 1 
        371 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        371 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        372 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        372 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        373 1 1 1 1  12 VAL H    .   9 . HN   1 1 
        373 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
        374 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        374 1 2 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        375 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        375 1 2 1 1  12 VAL QG   .   9 . HG*  1 1 
        376 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        376 1 2 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        377 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        377 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        378 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        378 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        379 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        379 1 2 1 1  15 LEU H    .  12 . HN   1 1 
        380 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        380 1 2 1 1  15 LEU HB2  .  12 . HB2  1 1 
        381 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        381 1 2 1 1  15 LEU HB3  .  12 . HB1  1 1 
        382 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        382 1 2 1 1  15 LEU QD   .  12 . HD*  1 1 
        383 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        383 1 2 1 1  15 LEU HG   .  12 . HG   1 1 
        384 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        384 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        385 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        385 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        386 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        386 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        387 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        387 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        388 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        388 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
        389 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        389 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        390 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        390 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
        391 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        391 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        392 1 1 1 1  12 VAL HA   .   9 . HA   1 1 
        392 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
        393 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        393 1 2 1 1  13 SER H    .  10 . HN   1 1 
        394 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        394 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        395 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        395 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        396 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        396 1 2 1 1  28 VAL HB   .  25 . HB   1 1 
        397 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        397 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        398 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        398 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        399 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        399 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
        400 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        400 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        401 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        401 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
        402 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        402 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        403 1 1 1 1  12 VAL HB   .   9 . HB   1 1 
        403 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
        404 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        404 1 2 1 1  13 SER H    .  10 . HN   1 1 
        405 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        405 1 2 1 1  13 SER HA   .  10 . HA   1 1 
        406 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        406 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        407 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        407 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        408 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        408 1 2 1 1  15 LEU H    .  12 . HN   1 1 
        409 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        409 1 2 1 1  15 LEU QB   .  12 . HB*  1 1 
        410 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        410 1 2 1 1  15 LEU QD   .  12 . HD*  1 1 
        411 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        411 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        412 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        412 1 2 1 1  16 ILE HB   .  13 . HB   1 1 
        413 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        413 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        414 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        414 1 2 1 1  28 VAL HA   .  25 . HA   1 1 
        415 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        415 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        416 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        416 1 2 1 1  39 ILE H    .  36 . HN   1 1 
        417 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        417 1 2 1 1  39 ILE HA   .  36 . HA   1 1 
        418 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        418 1 2 1 1  39 ILE HB   .  36 . HB   1 1 
        419 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        419 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        420 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        420 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
        421 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        421 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
        422 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        422 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        423 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        423 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
        424 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        424 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
        425 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        425 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
        426 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        426 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
        427 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        427 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        428 1 1 1 1  12 VAL QG   .   9 . HG*  1 1 
        428 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        429 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        429 1 2 1 1  13 SER H    .  10 . HN   1 1 
        430 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        430 1 2 1 1  15 LEU H    .  12 . HN   1 1 
        431 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        431 1 2 1 1  15 LEU HB2  .  12 . HB2  1 1 
        432 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        432 1 2 1 1  15 LEU HB3  .  12 . HB1  1 1 
        433 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        433 1 2 1 1  28 VAL MG1  .  25 . HG1* 1 1 
        434 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        434 1 2 1 1  28 VAL MG2  .  25 . HG2* 1 1 
        435 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        435 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        436 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        436 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
        437 1 1 1 1  12 VAL MG1  .   9 . HG1* 1 1 
        437 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        438 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        438 1 2 1 1  13 SER H    .  10 . HN   1 1 
        439 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        439 1 2 1 1  15 LEU H    .  12 . HN   1 1 
        440 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        440 1 2 1 1  15 LEU HB2  .  12 . HB2  1 1 
        441 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        441 1 2 1 1  15 LEU HB3  .  12 . HB1  1 1 
        442 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        442 1 2 1 1  28 VAL MG1  .  25 . HG1* 1 1 
        443 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        443 1 2 1 1  28 VAL MG2  .  25 . HG2* 1 1 
        444 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        444 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
        445 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        445 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
        446 1 1 1 1  12 VAL MG2  .   9 . HG2* 1 1 
        446 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        447 1 1 1 1  13 SER H    .  10 . HN   1 1 
        447 1 2 1 1  13 SER QB   .  10 . HB*  1 1 
        448 1 1 1 1  13 SER H    .  10 . HN   1 1 
        448 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        449 1 1 1 1  13 SER H    .  10 . HN   1 1 
        449 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        450 1 1 1 1  13 SER H    .  10 . HN   1 1 
        450 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        451 1 1 1 1  13 SER H    .  10 . HN   1 1 
        451 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        452 1 1 1 1  13 SER H    .  10 . HN   1 1 
        452 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
        453 1 1 1 1  13 SER H    .  10 . HN   1 1 
        453 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        454 1 1 1 1  13 SER H    .  10 . HN   1 1 
        454 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        455 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        455 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        456 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        456 1 2 1 1  16 ILE HB   .  13 . HB   1 1 
        457 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        457 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        458 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        458 1 2 1 1  16 ILE QG   .  13 . HG1* 1 1 
        459 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        459 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        460 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        460 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        461 1 1 1 1  13 SER HA   .  10 . HA   1 1 
        461 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        462 1 1 1 1  13 SER QB   .  10 . HB*  1 1 
        462 1 2 1 1  14 ALA H    .  11 . HN   1 1 
        463 1 1 1 1  13 SER QB   .  10 . HB*  1 1 
        463 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        464 1 1 1 1  13 SER QB   .  10 . HB*  1 1 
        464 1 2 1 1  16 ILE HB   .  13 . HB   1 1 
        465 1 1 1 1  13 SER HB2  .  10 . HB2  1 1 
        465 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        466 1 1 1 1  13 SER HB2  .  10 . HB2  1 1 
        466 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        467 1 1 1 1  13 SER HB3  .  10 . HB1  1 1 
        467 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        468 1 1 1 1  13 SER HB3  .  10 . HB1  1 1 
        468 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        469 1 1 1 1  14 ALA H    .  11 . HN   1 1 
        469 1 2 1 1  14 ALA MB   .  11 . HB*  1 1 
        470 1 1 1 1  14 ALA H    .  11 . HN   1 1 
        470 1 2 1 1  15 LEU HA   .  12 . HA   1 1 
        471 1 1 1 1  14 ALA H    .  11 . HN   1 1 
        471 1 2 1 1  15 LEU QB   .  12 . HB*  1 1 
        472 1 1 1 1  14 ALA H    .  11 . HN   1 1 
        472 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        473 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        473 1 2 1 1  15 LEU HA   .  12 . HA   1 1 
        474 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        474 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        475 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        475 1 2 1 1  16 ILE HB   .  13 . HB   1 1 
        476 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        476 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        477 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        477 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        478 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        478 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        479 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        479 1 2 1 1  17 ARG QB   .  14 . HB*  1 1 
        480 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        480 1 2 1 1  17 ARG QD   .  14 . HD*  1 1 
        481 1 1 1 1  14 ALA HA   .  11 . HA   1 1 
        481 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        482 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        482 1 2 1 1  15 LEU H    .  12 . HN   1 1 
        483 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        483 1 2 1 1  15 LEU HA   .  12 . HA   1 1 
        484 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        484 1 2 1 1  15 LEU QB   .  12 . HB*  1 1 
        485 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        485 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        486 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        486 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        487 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        487 1 2 1 1  17 ARG QB   .  14 . HB*  1 1 
        488 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        488 1 2 1 1  17 ARG QG   .  14 . HG*  1 1 
        489 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        489 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        490 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        490 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        491 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        491 1 2 1 1  18 ARG HG2  .  15 . HG2  1 1 
        492 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        492 1 2 1 1  18 ARG QG   .  15 . HG*  1 1 
        493 1 1 1 1  14 ALA MB   .  11 . HB*  1 1 
        493 1 2 1 1  18 ARG HG3  .  15 . HG1  1 1 
        494 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        494 1 2 1 1  15 LEU HB2  .  12 . HB2  1 1 
        495 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        495 1 2 1 1  15 LEU HB3  .  12 . HB1  1 1 
        496 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        496 1 2 1 1  15 LEU QD   .  12 . HD2* 1 1 
        497 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        497 1 2 1 1  15 LEU HG   .  12 . HG   1 1 
        498 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        498 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        499 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        499 1 2 1 1  16 ILE HA   .  13 . HA   1 1 
        500 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        500 1 2 1 1  16 ILE HB   .  13 . HB   1 1 
        501 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        501 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        502 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        502 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        503 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        503 1 2 1 1  17 ARG QB   .  14 . HB*  1 1 
        504 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        504 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        505 1 1 1 1  15 LEU H    .  12 . HN   1 1 
        505 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        506 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        506 1 2 1 1  15 LEU QD   .  12 . HD2* 1 1 
        507 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        507 1 2 1 1  15 LEU HG   .  12 . HG   1 1 
        508 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        508 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        509 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        509 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        510 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        510 1 2 1 1  17 ARG QB   .  14 . HB*  1 1 
        511 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        511 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        512 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        512 1 2 1 1  18 ARG HA   .  15 . HA   1 1 
        513 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        513 1 2 1 1  18 ARG QB   .  15 . HB*  1 1 
        514 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        514 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        515 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        515 1 2 1 1  18 ARG QG   .  15 . HG*  1 1 
        516 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        516 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        517 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        517 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        518 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        518 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
        519 1 1 1 1  15 LEU HA   .  12 . HA   1 1 
        519 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
        520 1 1 1 1  15 LEU QB   .  12 . HB*  1 1 
        520 1 2 1 1  15 LEU QD   .  12 . HD*  1 1 
        521 1 1 1 1  15 LEU QB   .  12 . HB*  1 1 
        521 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        522 1 1 1 1  15 LEU QB   .  12 . HB*  1 1 
        522 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        523 1 1 1 1  15 LEU QB   .  12 . HB*  1 1 
        523 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        524 1 1 1 1  15 LEU QB   .  12 . HB*  1 1 
        524 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        525 1 1 1 1  15 LEU HB2  .  12 . HB2  1 1 
        525 1 2 1 1  15 LEU QD   .  12 . HD2* 1 1 
        526 1 1 1 1  15 LEU HB3  .  12 . HB1  1 1 
        526 1 2 1 1  15 LEU QD   .  12 . HD2* 1 1 
        527 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        527 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        528 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        528 1 2 1 1  16 ILE HA   .  13 . HA   1 1 
        529 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        529 1 2 1 1  16 ILE QG   .  13 . HG1* 1 1 
        530 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        530 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        531 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        531 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        532 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        532 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        533 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        533 1 2 1 1  18 ARG QB   .  15 . HB*  1 1 
        534 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        534 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        535 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        535 1 2 1 1  18 ARG QG   .  15 . HG*  1 1 
        536 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        536 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        537 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        537 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        538 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        538 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        539 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        539 1 2 1 1  39 ILE HB   .  36 . HB   1 1 
        540 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        540 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
        541 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        541 1 2 1 1  41 VAL H    .  38 . HN   1 1 
        542 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        542 1 2 1 1  41 VAL HB   .  38 . HB   1 1 
        543 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        543 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        544 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        544 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
        545 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        545 1 2 1 1 102 VAL H    .  99 . HN   1 1 
        546 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        546 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
        547 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        547 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        548 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        548 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
        549 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        549 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        550 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        550 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
        551 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        551 1 2 1 1 113 LEU HA   . 110 . HA   1 1 
        552 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        552 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
        553 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        553 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
        554 1 1 1 1  15 LEU QD   .  12 . HD*  1 1 
        554 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
        555 1 1 1 1  15 LEU QD   .  12 . HD1* 1 1 
        555 1 2 1 1 114 THR H    . 111 . HN   1 1 
        556 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        556 1 2 1 1  16 ILE H    .  13 . HN   1 1 
        557 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        557 1 2 1 1  16 ILE HA   .  13 . HA   1 1 
        558 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        558 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        559 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        559 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        560 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        560 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        561 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        561 1 2 1 1  41 VAL MG1  .  38 . HG1* 1 1 
        562 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        562 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        563 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        563 1 2 1 1  41 VAL MG2  .  38 . HG2* 1 1 
        564 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        564 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        565 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        565 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
        566 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        566 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        567 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        567 1 2 1 1 113 LEU HA   . 110 . HA   1 1 
        568 1 1 1 1  15 LEU HG   .  12 . HG   1 1 
        568 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
        569 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        569 1 2 1 1  16 ILE HB   .  13 . HB   1 1 
        570 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        570 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        571 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        571 1 2 1 1  16 ILE QG   .  13 . HG1* 1 1 
        572 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        572 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        573 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        573 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        574 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        574 1 2 1 1  17 ARG HA   .  14 . HA   1 1 
        575 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        575 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        576 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        576 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        577 1 1 1 1  16 ILE H    .  13 . HN   1 1 
        577 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        578 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        578 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        579 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        579 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        580 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        580 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        581 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        581 1 2 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        582 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        582 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        583 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        583 1 2 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        584 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        584 1 2 1 1  20 PHE QD   .  17 . HD1  1 1 
        585 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        585 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        586 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        586 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        587 1 1 1 1  16 ILE HA   .  13 . HA   1 1 
        587 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        588 1 1 1 1  16 ILE HB   .  13 . HB   1 1 
        588 1 2 1 1  16 ILE MD   .  13 . HD1* 1 1 
        589 1 1 1 1  16 ILE HB   .  13 . HB   1 1 
        589 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        590 1 1 1 1  16 ILE HB   .  13 . HB   1 1 
        590 1 2 1 1  17 ARG QD   .  14 . HD*  1 1 
        591 1 1 1 1  16 ILE HB   .  13 . HB   1 1 
        591 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        592 1 1 1 1  16 ILE HB   .  13 . HB   1 1 
        592 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        593 1 1 1 1  16 ILE HB   .  13 . HB   1 1 
        593 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        594 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        594 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        595 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        595 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        596 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        596 1 2 1 1  20 PHE QD   .  17 . HD1  1 1 
        597 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        597 1 2 1 1  20 PHE QE   .  17 . HE1  1 1 
        598 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        598 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        599 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        599 1 2 1 1  27 ALA HA   .  24 . HA   1 1 
        600 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        600 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        601 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        601 1 2 1 1  28 VAL H    .  25 . HN   1 1 
        602 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        602 1 2 1 1  28 VAL HA   .  25 . HA   1 1 
        603 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        603 1 2 1 1  28 VAL HB   .  25 . HB   1 1 
        604 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        604 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        605 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        605 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        606 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        606 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
        607 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        607 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
        608 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        608 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
        609 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        609 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        610 1 1 1 1  16 ILE MD   .  13 . HD1* 1 1 
        610 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
        611 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        611 1 2 1 1  16 ILE MG   .  13 . HG2* 1 1 
        612 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        612 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        613 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        613 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        614 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        614 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        615 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        615 1 2 1 1  27 ALA HA   .  24 . HA   1 1 
        616 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        616 1 2 1 1  28 VAL HA   .  25 . HA   1 1 
        617 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        617 1 2 1 1  28 VAL HB   .  25 . HB   1 1 
        618 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        618 1 2 1 1  28 VAL MG1  .  25 . HG1* 1 1 
        619 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        619 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        620 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        620 1 2 1 1  28 VAL MG2  .  25 . HG2* 1 1 
        621 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        621 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        622 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        622 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
        623 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        623 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        624 1 1 1 1  16 ILE QG   .  13 . HG1* 1 1 
        624 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
        625 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        625 1 2 1 1  17 ARG H    .  14 . HN   1 1 
        626 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        626 1 2 1 1  17 ARG HA   .  14 . HA   1 1 
        627 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        627 1 2 1 1  17 ARG QB   .  14 . HB*  1 1 
        628 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        628 1 2 1 1  17 ARG QD   .  14 . HD*  1 1 
        629 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        629 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        630 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        630 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        631 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        631 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        632 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        632 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        633 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        633 1 2 1 1  20 PHE QB   .  17 . HB*  1 1 
        634 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        634 1 2 1 1  20 PHE QD   .  17 . HD1  1 1 
        635 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        635 1 2 1 1  20 PHE QE   .  17 . HE1  1 1 
        636 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        636 1 2 1 1  20 PHE HZ   .  17 . HZ   1 1 
        637 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        637 1 2 1 1  25 PHE HD1  .  22 . HD1  1 1 
        638 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        638 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        639 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        639 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        640 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        640 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        641 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        641 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        642 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        642 1 2 1 1  27 ALA HA   .  24 . HA   1 1 
        643 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        643 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        644 1 1 1 1  16 ILE MG   .  13 . HG2* 1 1 
        644 1 2 1 1  28 VAL H    .  25 . HN   1 1 
        645 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        645 1 2 1 1  17 ARG QB   .  14 . HB*  1 1 
        646 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        646 1 2 1 1  17 ARG QD   .  14 . HD*  1 1 
        647 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        647 1 2 1 1  17 ARG QG   .  14 . HG*  1 1 
        648 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        648 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        649 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        649 1 2 1 1  18 ARG HA   .  15 . HA   1 1 
        650 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        650 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        651 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        651 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        652 1 1 1 1  17 ARG H    .  14 . HN   1 1 
        652 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        653 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        653 1 2 1 1  17 ARG QD   .  14 . HD*  1 1 
        654 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        654 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        655 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        655 1 2 1 1  20 PHE HB2  .  17 . HB2  1 1 
        656 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        656 1 2 1 1  20 PHE QB   .  17 . HB*  1 1 
        657 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        657 1 2 1 1  20 PHE HB3  .  17 . HB1  1 1 
        658 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        658 1 2 1 1  20 PHE QD   .  17 . HD1  1 1 
        659 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        659 1 2 1 1  20 PHE QE   .  17 . HE1  1 1 
        660 1 1 1 1  17 ARG HA   .  14 . HA   1 1 
        660 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        661 1 1 1 1  17 ARG QB   .  14 . HB*  1 1 
        661 1 2 1 1  17 ARG QD   .  14 . HD*  1 1 
        662 1 1 1 1  17 ARG QB   .  14 . HB*  1 1 
        662 1 2 1 1  18 ARG H    .  15 . HN   1 1 
        663 1 1 1 1  17 ARG QB   .  14 . HB*  1 1 
        663 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        664 1 1 1 1  17 ARG QB   .  14 . HB*  1 1 
        664 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        665 1 1 1 1  17 ARG QG   .  14 . HG*  1 1 
        665 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        666 1 1 1 1  17 ARG QG   .  14 . HG*  1 1 
        666 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        667 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        667 1 2 1 1  18 ARG QB   .  15 . HB*  1 1 
        668 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        668 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        669 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        669 1 2 1 1  18 ARG HG2  .  15 . HG2  1 1 
        670 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        670 1 2 1 1  18 ARG QG   .  15 . HG*  1 1 
        671 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        671 1 2 1 1  18 ARG HG3  .  15 . HG1  1 1 
        672 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        672 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        673 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        673 1 2 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        674 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        674 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        675 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        675 1 2 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        676 1 1 1 1  18 ARG H    .  15 . HN   1 1 
        676 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        677 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        677 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        678 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        678 1 2 1 1  18 ARG QG   .  15 . HG*  1 1 
        679 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        679 1 2 1 1  19 VAL HA   .  16 . HA   1 1 
        680 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        680 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        681 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        681 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        682 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        682 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        683 1 1 1 1  18 ARG HA   .  15 . HA   1 1 
        683 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        684 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        684 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        685 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        685 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        686 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        686 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        687 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        687 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        688 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        688 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        689 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        689 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
        690 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        690 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
        691 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        691 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        692 1 1 1 1  18 ARG QB   .  15 . HB*  1 1 
        692 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        693 1 1 1 1  18 ARG HB2  .  15 . HB2  1 1 
        693 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        694 1 1 1 1  18 ARG HB2  .  15 . HB2  1 1 
        694 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        695 1 1 1 1  18 ARG HB2  .  15 . HB2  1 1 
        695 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
        696 1 1 1 1  18 ARG HB3  .  15 . HB1  1 1 
        696 1 2 1 1  18 ARG QD   .  15 . HD*  1 1 
        697 1 1 1 1  18 ARG HB3  .  15 . HB1  1 1 
        697 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        698 1 1 1 1  18 ARG HB3  .  15 . HB1  1 1 
        698 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
        699 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        699 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        700 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        700 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        701 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        701 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
        702 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        702 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        703 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        703 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        704 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        704 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
        705 1 1 1 1  18 ARG QD   .  15 . HD*  1 1 
        705 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
        706 1 1 1 1  18 ARG QG   .  15 . HG*  1 1 
        706 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        707 1 1 1 1  18 ARG HG2  .  15 . HG2  1 1 
        707 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        708 1 1 1 1  18 ARG HG3  .  15 . HG1  1 1 
        708 1 2 1 1  19 VAL H    .  16 . HN   1 1 
        709 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        709 1 2 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        710 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        710 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        711 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        711 1 2 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        712 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        712 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        713 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        713 1 2 1 1  20 PHE HA   .  17 . HA   1 1 
        714 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        714 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        715 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        715 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        716 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        716 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        717 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        717 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        718 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        718 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
        719 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        719 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        720 1 1 1 1  19 VAL H    .  16 . HN   1 1 
        720 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        721 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        721 1 2 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        722 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        722 1 2 1 1  19 VAL QG   .  16 . HG*  1 1 
        723 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        723 1 2 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        724 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        724 1 2 1 1  20 PHE HA   .  17 . HA   1 1 
        725 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        725 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        726 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        726 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        727 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        727 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        728 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        728 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        729 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        729 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        730 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        730 1 2 1 1  25 PHE H    .  22 . HN   1 1 
        731 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        731 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        732 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        732 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        733 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        733 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
        734 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        734 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
        735 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        735 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
        736 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        736 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        737 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        737 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        738 1 1 1 1  19 VAL HA   .  16 . HA   1 1 
        738 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        739 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        739 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        740 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        740 1 2 1 1  20 PHE HA   .  17 . HA   1 1 
        741 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        741 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        742 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        742 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        743 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        743 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        744 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        744 1 2 1 1  25 PHE H    .  22 . HN   1 1 
        745 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        745 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        746 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        746 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
        747 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        747 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        748 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        748 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        749 1 1 1 1  19 VAL HB   .  16 . HB   1 1 
        749 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        750 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        750 1 2 1 1  20 PHE HA   .  17 . HA   1 1 
        751 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        751 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        752 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        752 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        753 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        753 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        754 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        754 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        755 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        755 1 2 1 1  24 GLY HA2  .  21 . HA2  1 1 
        756 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        756 1 2 1 1  24 GLY HA3  .  21 . HA1  1 1 
        757 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        757 1 2 1 1  25 PHE H    .  22 . HN   1 1 
        758 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        758 1 2 1 1  25 PHE HA   .  22 . HA   1 1 
        759 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        759 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        760 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        760 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        761 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        761 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        762 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        762 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        763 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        763 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        764 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        764 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
        765 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        765 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
        766 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        766 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
        767 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        767 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        768 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        768 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        769 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        769 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        770 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        770 1 2 1 1 112 LEU H    . 109 . HN   1 1 
        771 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        771 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
        772 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        772 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
        773 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        773 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        774 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        774 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        775 1 1 1 1  19 VAL QG   .  16 . HG*  1 1 
        775 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        776 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        776 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        777 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        777 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        778 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        778 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        779 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        779 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        780 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        780 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        781 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        781 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        782 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        782 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        783 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        783 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
        784 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        784 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        785 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        785 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        786 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        786 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        787 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        787 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        788 1 1 1 1  19 VAL MG1  .  16 . HG1* 1 1 
        788 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        789 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        789 1 2 1 1  20 PHE H    .  17 . HN   1 1 
        790 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        790 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        791 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        791 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        792 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        792 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        793 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        793 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        794 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        794 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        795 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        795 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        796 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        796 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
        797 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        797 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        798 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        798 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        799 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        799 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        800 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        800 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        801 1 1 1 1  19 VAL MG2  .  16 . HG2* 1 1 
        801 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        802 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        802 1 2 1 1  20 PHE HB2  .  17 . HB2  1 1 
        803 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        803 1 2 1 1  20 PHE QB   .  17 . HB*  1 1 
        804 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        804 1 2 1 1  20 PHE HB3  .  17 . HB1  1 1 
        805 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        805 1 2 1 1  20 PHE QD   .  17 . HD1  1 1 
        806 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        806 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        807 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        807 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        808 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        808 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        809 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        809 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        810 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        810 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        811 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        811 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        812 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        812 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        813 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        813 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
        814 1 1 1 1  20 PHE H    .  17 . HN   1 1 
        814 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        815 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        815 1 2 1 1  20 PHE QD   .  17 . HD2  1 1 
        816 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        816 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        817 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        817 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        818 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        818 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        819 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        819 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        820 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        820 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        821 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        821 1 2 1 1  24 GLY HA3  .  21 . HA1  1 1 
        822 1 1 1 1  20 PHE HA   .  17 . HA   1 1 
        822 1 2 1 1  25 PHE HA   .  22 . HA   1 1 
        823 1 1 1 1  20 PHE QB   .  17 . HB*  1 1 
        823 1 2 1 1  21 ALA HA   .  18 . HA   1 1 
        824 1 1 1 1  20 PHE QB   .  17 . HB*  1 1 
        824 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        825 1 1 1 1  20 PHE QB   .  17 . HB*  1 1 
        825 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        826 1 1 1 1  20 PHE HB2  .  17 . HB2  1 1 
        826 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        827 1 1 1 1  20 PHE HB2  .  17 . HB2  1 1 
        827 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        828 1 1 1 1  20 PHE HB3  .  17 . HB1  1 1 
        828 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        829 1 1 1 1  20 PHE HB3  .  17 . HB1  1 1 
        829 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        830 1 1 1 1  20 PHE QD   .  17 . HD1  1 1 
        830 1 2 1 1  21 ALA H    .  18 . HN   1 1 
        831 1 1 1 1  20 PHE QD   .  17 . HD2  1 1 
        831 1 2 1 1  25 PHE HA   .  22 . HA   1 1 
        832 1 1 1 1  20 PHE QD   .  17 . HD1  1 1 
        832 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        833 1 1 1 1  20 PHE QD   .  17 . HD1  1 1 
        833 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        834 1 1 1 1  20 PHE QE   .  17 . HE2  1 1 
        834 1 2 1 1  25 PHE HA   .  22 . HA   1 1 
        835 1 1 1 1  20 PHE QE   .  17 . HE2  1 1 
        835 1 2 1 1  25 PHE HB2  .  22 . HB2  1 1 
        836 1 1 1 1  20 PHE QE   .  17 . HE2  1 1 
        836 1 2 1 1  25 PHE HD1  .  22 . HD1  1 1 
        837 1 1 1 1  20 PHE QE   .  17 . HE2  1 1 
        837 1 2 1 1  25 PHE HE1  .  22 . HE1  1 1 
        838 1 1 1 1  20 PHE QE   .  17 . HE1  1 1 
        838 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        839 1 1 1 1  20 PHE QE   .  17 . HE1  1 1 
        839 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        840 1 1 1 1  20 PHE QE   .  17 . HE1  1 1 
        840 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        841 1 1 1 1  20 PHE QE   .  17 . HE1  1 1 
        841 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        842 1 1 1 1  20 PHE HZ   .  17 . HZ   1 1 
        842 1 2 1 1  25 PHE HA   .  22 . HA   1 1 
        843 1 1 1 1  20 PHE HZ   .  17 . HZ   1 1 
        843 1 2 1 1  25 PHE HD1  .  22 . HD1  1 1 
        844 1 1 1 1  20 PHE HZ   .  17 . HZ   1 1 
        844 1 2 1 1  25 PHE HE1  .  22 . HE1  1 1 
        845 1 1 1 1  20 PHE HZ   .  17 . HZ   1 1 
        845 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        846 1 1 1 1  20 PHE HZ   .  17 . HZ   1 1 
        846 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        847 1 1 1 1  20 PHE HZ   .  17 . HZ   1 1 
        847 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        848 1 1 1 1  21 ALA H    .  18 . HN   1 1 
        848 1 2 1 1  21 ALA MB   .  18 . HB*  1 1 
        849 1 1 1 1  21 ALA H    .  18 . HN   1 1 
        849 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        850 1 1 1 1  21 ALA H    .  18 . HN   1 1 
        850 1 2 1 1  22 ALA HA   .  19 . HA   1 1 
        851 1 1 1 1  21 ALA H    .  18 . HN   1 1 
        851 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        852 1 1 1 1  21 ALA H    .  18 . HN   1 1 
        852 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        853 1 1 1 1  21 ALA H    .  18 . HN   1 1 
        853 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        854 1 1 1 1  21 ALA HA   .  18 . HA   1 1 
        854 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        855 1 1 1 1  21 ALA HA   .  18 . HA   1 1 
        855 1 2 1 1  22 ALA HA   .  19 . HA   1 1 
        856 1 1 1 1  21 ALA HA   .  18 . HA   1 1 
        856 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        857 1 1 1 1  21 ALA MB   .  18 . HB*  1 1 
        857 1 2 1 1  22 ALA H    .  19 . HN   1 1 
        858 1 1 1 1  21 ALA MB   .  18 . HB*  1 1 
        858 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        859 1 1 1 1  22 ALA H    .  19 . HN   1 1 
        859 1 2 1 1  22 ALA MB   .  19 . HB*  1 1 
        860 1 1 1 1  22 ALA H    .  19 . HN   1 1 
        860 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        861 1 1 1 1  22 ALA H    .  19 . HN   1 1 
        861 1 2 1 1  23 GLY QA   .  20 . HA*  1 1 
        862 1 1 1 1  22 ALA H    .  19 . HN   1 1 
        862 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        863 1 1 1 1  22 ALA H    .  19 . HN   1 1 
        863 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        864 1 1 1 1  22 ALA HA   .  19 . HA   1 1 
        864 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        865 1 1 1 1  22 ALA HA   .  19 . HA   1 1 
        865 1 2 1 1  23 GLY QA   .  20 . HA*  1 1 
        866 1 1 1 1  22 ALA HA   .  19 . HA   1 1 
        866 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        867 1 1 1 1  22 ALA HA   .  19 . HA   1 1 
        867 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        868 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        868 1 2 1 1  23 GLY H    .  20 . HN   1 1 
        869 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        869 1 2 1 1  23 GLY HA2  .  20 . HA2  1 1 
        870 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        870 1 2 1 1  23 GLY HA3  .  20 . HA1  1 1 
        871 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        871 1 2 1 1  24 GLY H    .  21 . HN   1 1 
        872 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        872 1 2 1 1  24 GLY HA2  .  21 . HA2  1 1 
        873 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        873 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
        874 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        874 1 2 1 1 107 ASP H    . 104 . HN   1 1 
        875 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        875 1 2 1 1 108 GLU H    . 105 . HN   1 1 
        876 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        876 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
        877 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        877 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
        878 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        878 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
        879 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        879 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        880 1 1 1 1  22 ALA MB   .  19 . HB*  1 1 
        880 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        881 1 1 1 1  23 GLY H    .  20 . HN   1 1 
        881 1 2 1 1  24 GLY HA2  .  21 . HA2  1 1 
        882 1 1 1 1  23 GLY H    .  20 . HN   1 1 
        882 1 2 1 1  24 GLY HA3  .  21 . HA1  1 1 
        883 1 1 1 1  23 GLY QA   .  20 . HA*  1 1 
        883 1 2 1 1  24 GLY HA2  .  21 . HA2  1 1 
        884 1 1 1 1  24 GLY H    .  21 . HN   1 1 
        884 1 2 1 1  25 PHE H    .  22 . HN   1 1 
        885 1 1 1 1  24 GLY H    .  21 . HN   1 1 
        885 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
        886 1 1 1 1  24 GLY H    .  21 . HN   1 1 
        886 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        887 1 1 1 1  24 GLY HA2  .  21 . HA2  1 1 
        887 1 2 1 1  25 PHE H    .  22 . HN   1 1 
        888 1 1 1 1  24 GLY HA2  .  21 . HA2  1 1 
        888 1 2 1 1 106 THR HA   . 103 . HA   1 1 
        889 1 1 1 1  24 GLY HA2  .  21 . HA2  1 1 
        889 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        890 1 1 1 1  24 GLY HA3  .  21 . HA1  1 1 
        890 1 2 1 1  25 PHE H    .  22 . HN   1 1 
        891 1 1 1 1  24 GLY HA3  .  21 . HA1  1 1 
        891 1 2 1 1  25 PHE HB2  .  22 . HB2  1 1 
        892 1 1 1 1  24 GLY HA3  .  21 . HA1  1 1 
        892 1 2 1 1 106 THR HA   . 103 . HA   1 1 
        893 1 1 1 1  24 GLY HA3  .  21 . HA1  1 1 
        893 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        894 1 1 1 1  24 GLY HA3  .  21 . HA1  1 1 
        894 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
        895 1 1 1 1  24 GLY HA3  .  21 . HA1  1 1 
        895 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        896 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        896 1 2 1 1  25 PHE HB2  .  22 . HB2  1 1 
        897 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        897 1 2 1 1  25 PHE HB3  .  22 . HB1  1 1 
        898 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        898 1 2 1 1  25 PHE HD2  .  22 . HD2  1 1 
        899 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        899 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        900 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        900 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        901 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        901 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        902 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        902 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        903 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        903 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        904 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        904 1 2 1 1 105 GLU HB2  . 102 . HB2  1 1 
        905 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        905 1 2 1 1 105 GLU HB3  . 102 . HB1  1 1 
        906 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        906 1 2 1 1 106 THR HA   . 103 . HA   1 1 
        907 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        907 1 2 1 1 106 THR HB   . 103 . HB   1 1 
        908 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        908 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
        909 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        909 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
        910 1 1 1 1  25 PHE H    .  22 . HN   1 1 
        910 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
        911 1 1 1 1  25 PHE HA   .  22 . HA   1 1 
        911 1 2 1 1  25 PHE HD1  .  22 . HD1  1 1 
        912 1 1 1 1  25 PHE HA   .  22 . HA   1 1 
        912 1 2 1 1  25 PHE HE1  .  22 . HE1  1 1 
        913 1 1 1 1  25 PHE HA   .  22 . HA   1 1 
        913 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        914 1 1 1 1  25 PHE HA   .  22 . HA   1 1 
        914 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        915 1 1 1 1  25 PHE HA   .  22 . HA   1 1 
        915 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        916 1 1 1 1  25 PHE HB2  .  22 . HB2  1 1 
        916 1 2 1 1  25 PHE HD1  .  22 . HD1  1 1 
        917 1 1 1 1  25 PHE HB2  .  22 . HB2  1 1 
        917 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        918 1 1 1 1  25 PHE HB2  .  22 . HB2  1 1 
        918 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        919 1 1 1 1  25 PHE HB2  .  22 . HB2  1 1 
        919 1 2 1 1 105 GLU HB2  . 102 . HB2  1 1 
        920 1 1 1 1  25 PHE HB2  .  22 . HB2  1 1 
        920 1 2 1 1 105 GLU HB3  . 102 . HB1  1 1 
        921 1 1 1 1  25 PHE HB3  .  22 . HB1  1 1 
        921 1 2 1 1  25 PHE HE2  .  22 . HE2  1 1 
        922 1 1 1 1  25 PHE HB3  .  22 . HB1  1 1 
        922 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        923 1 1 1 1  25 PHE HB3  .  22 . HB1  1 1 
        923 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        924 1 1 1 1  25 PHE HB3  .  22 . HB1  1 1 
        924 1 2 1 1 105 GLU HB2  . 102 . HB2  1 1 
        925 1 1 1 1  25 PHE HB3  .  22 . HB1  1 1 
        925 1 2 1 1 105 GLU HB3  . 102 . HB1  1 1 
        926 1 1 1 1  25 PHE HB3  .  22 . HB1  1 1 
        926 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
        927 1 1 1 1  25 PHE HD1  .  22 . HD1  1 1 
        927 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        928 1 1 1 1  25 PHE HD1  .  22 . HD1  1 1 
        928 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        929 1 1 1 1  25 PHE HD1  .  22 . HD1  1 1 
        929 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        930 1 1 1 1  25 PHE HD2  .  22 . HD2  1 1 
        930 1 2 1 1  26 ALA HA   .  23 . HA   1 1 
        931 1 1 1 1  25 PHE HD2  .  22 . HD2  1 1 
        931 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        932 1 1 1 1  25 PHE HD2  .  22 . HD2  1 1 
        932 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        933 1 1 1 1  25 PHE HD2  .  22 . HD2  1 1 
        933 1 2 1 1 105 GLU HB2  . 102 . HB2  1 1 
        934 1 1 1 1  25 PHE HD2  .  22 . HD2  1 1 
        934 1 2 1 1 105 GLU HB3  . 102 . HB1  1 1 
        935 1 1 1 1  25 PHE HD2  .  22 . HD2  1 1 
        935 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
        936 1 1 1 1  25 PHE HE1  .  22 . HE1  1 1 
        936 1 2 1 1  26 ALA H    .  23 . HN   1 1 
        937 1 1 1 1  25 PHE HE1  .  22 . HE1  1 1 
        937 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        938 1 1 1 1  25 PHE HE2  .  22 . HE2  1 1 
        938 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        939 1 1 1 1  25 PHE HE2  .  22 . HE2  1 1 
        939 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        940 1 1 1 1  26 ALA H    .  23 . HN   1 1 
        940 1 2 1 1  26 ALA MB   .  23 . HB*  1 1 
        941 1 1 1 1  26 ALA H    .  23 . HN   1 1 
        941 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        942 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        942 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        943 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        943 1 2 1 1  27 ALA HA   .  24 . HA   1 1 
        944 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        944 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        945 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        945 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        946 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        946 1 2 1 1 103 GLU H    . 100 . HN   1 1 
        947 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        947 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
        948 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        948 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
        949 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        949 1 2 1 1 104 ILE H    . 101 . HN   1 1 
        950 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        950 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        951 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        951 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
        952 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        952 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        953 1 1 1 1  26 ALA HA   .  23 . HA   1 1 
        953 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        954 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        954 1 2 1 1  27 ALA H    .  24 . HN   1 1 
        955 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        955 1 2 1 1  27 ALA HA   .  24 . HA   1 1 
        956 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        956 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        957 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        957 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
        958 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        958 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
        959 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        959 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        960 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        960 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
        961 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        961 1 2 1 1 104 ILE H    . 101 . HN   1 1 
        962 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        962 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        963 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        963 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
        964 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        964 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
        965 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        965 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        966 1 1 1 1  26 ALA MB   .  23 . HB*  1 1 
        966 1 2 1 1 105 GLU H    . 102 . HN   1 1 
        967 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        967 1 2 1 1  27 ALA MB   .  24 . HB*  1 1 
        968 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        968 1 2 1 1  28 VAL H    .  25 . HN   1 1 
        969 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        969 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        970 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        970 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
        971 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        971 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
        972 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        972 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        973 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        973 1 2 1 1 103 GLU H    . 100 . HN   1 1 
        974 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        974 1 2 1 1 103 GLU HB2  . 100 . HB2  1 1 
        975 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        975 1 2 1 1 103 GLU HG2  . 100 . HG2  1 1 
        976 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        976 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
        977 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        977 1 2 1 1 103 GLU HG3  . 100 . HG1  1 1 
        978 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        978 1 2 1 1 104 ILE H    . 101 . HN   1 1 
        979 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        979 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
        980 1 1 1 1  27 ALA H    .  24 . HN   1 1 
        980 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
        981 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        981 1 2 1 1  28 VAL H    .  25 . HN   1 1 
        982 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        982 1 2 1 1  28 VAL HA   .  25 . HA   1 1 
        983 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        983 1 2 1 1  28 VAL HB   .  25 . HB   1 1 
        984 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        984 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        985 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        985 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
        986 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        986 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        987 1 1 1 1  27 ALA HA   .  24 . HA   1 1 
        987 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
        988 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        988 1 2 1 1  28 VAL H    .  25 . HN   1 1 
        989 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        989 1 2 1 1  28 VAL HA   .  25 . HA   1 1 
        990 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        990 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
        991 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        991 1 2 1 1  29 GLU H    .  26 . HN   1 1 
        992 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        992 1 2 1 1  29 GLU HA   .  26 . HA   1 1 
        993 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        993 1 2 1 1  29 GLU QG   .  26 . HG*  1 1 
        994 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        994 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
        995 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        995 1 2 1 1 103 GLU H    . 100 . HN   1 1 
        996 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        996 1 2 1 1 103 GLU HB3  . 100 . HB1  1 1 
        997 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        997 1 2 1 1 103 GLU HG2  . 100 . HG2  1 1 
        998 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        998 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
        999 1 1 1 1  27 ALA MB   .  24 . HB*  1 1 
        999 1 2 1 1 103 GLU HG3  . 100 . HG1  1 1 
       1000 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1000 1 2 1 1  28 VAL HB   .  25 . HB   1 1 
       1001 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1001 1 2 1 1  28 VAL MG1  .  25 . HG1* 1 1 
       1002 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1002 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
       1003 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1003 1 2 1 1  28 VAL MG2  .  25 . HG2* 1 1 
       1004 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1004 1 2 1 1  29 GLU H    .  26 . HN   1 1 
       1005 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1005 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1006 1 1 1 1  28 VAL H    .  25 . HN   1 1 
       1006 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1007 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1007 1 2 1 1  28 VAL MG1  .  25 . HG1* 1 1 
       1008 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1008 1 2 1 1  28 VAL QG   .  25 . HG*  1 1 
       1009 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1009 1 2 1 1  28 VAL MG2  .  25 . HG2* 1 1 
       1010 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1010 1 2 1 1  29 GLU H    .  26 . HN   1 1 
       1011 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1011 1 2 1 1  29 GLU HA   .  26 . HA   1 1 
       1012 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1012 1 2 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1013 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1013 1 2 1 1  29 GLU QG   .  26 . HG*  1 1 
       1014 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1014 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1015 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1015 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1016 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1016 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1017 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1017 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1018 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1018 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
       1019 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1019 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
       1020 1 1 1 1  28 VAL HA   .  25 . HA   1 1 
       1020 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       1021 1 1 1 1  28 VAL HB   .  25 . HB   1 1 
       1021 1 2 1 1  29 GLU H    .  26 . HN   1 1 
       1022 1 1 1 1  28 VAL HB   .  25 . HB   1 1 
       1022 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1023 1 1 1 1  28 VAL HB   .  25 . HB   1 1 
       1023 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1024 1 1 1 1  28 VAL HB   .  25 . HB   1 1 
       1024 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1025 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1025 1 2 1 1  29 GLU H    .  26 . HN   1 1 
       1026 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1026 1 2 1 1  29 GLU HA   .  26 . HA   1 1 
       1027 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1027 1 2 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1028 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1028 1 2 1 1  29 GLU HB3  .  26 . HB1  1 1 
       1029 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1029 1 2 1 1  29 GLU QG   .  26 . HG*  1 1 
       1030 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1030 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1031 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1031 1 2 1 1  30 LYS HA   .  27 . HA   1 1 
       1032 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1032 1 2 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1033 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1033 1 2 1 1  31 LYS HA   .  28 . HA   1 1 
       1034 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1034 1 2 1 1  31 LYS QB   .  28 . HB*  1 1 
       1035 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1035 1 2 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1036 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1036 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1037 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1037 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
       1038 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1038 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1039 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1039 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1040 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1040 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1041 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1041 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1042 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1042 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1043 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1043 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1044 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1044 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1045 1 1 1 1  28 VAL QG   .  25 . HG*  1 1 
       1045 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1046 1 1 1 1  28 VAL MG1  .  25 . HG1* 1 1 
       1046 1 2 1 1  29 GLU H    .  26 . HN   1 1 
       1047 1 1 1 1  28 VAL MG1  .  25 . HG1* 1 1 
       1047 1 2 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1048 1 1 1 1  28 VAL MG1  .  25 . HG1* 1 1 
       1048 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1049 1 1 1 1  28 VAL MG1  .  25 . HG1* 1 1 
       1049 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1050 1 1 1 1  28 VAL MG2  .  25 . HG2* 1 1 
       1050 1 2 1 1  29 GLU H    .  26 . HN   1 1 
       1051 1 1 1 1  28 VAL MG2  .  25 . HG2* 1 1 
       1051 1 2 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1052 1 1 1 1  28 VAL MG2  .  25 . HG2* 1 1 
       1052 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1053 1 1 1 1  28 VAL MG2  .  25 . HG2* 1 1 
       1053 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1054 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1054 1 2 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1055 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1055 1 2 1 1  29 GLU HB3  .  26 . HB1  1 1 
       1056 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1056 1 2 1 1  29 GLU HG2  .  26 . HG2  1 1 
       1057 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1057 1 2 1 1  29 GLU QG   .  26 . HG*  1 1 
       1058 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1058 1 2 1 1  29 GLU HG3  .  26 . HG1  1 1 
       1059 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1059 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1060 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1060 1 2 1 1  30 LYS HA   .  27 . HA   1 1 
       1061 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1061 1 2 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1062 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1062 1 2 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1063 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1063 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1064 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1064 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1065 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1065 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1066 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1066 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       1067 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1067 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1068 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1068 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
       1069 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1069 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
       1070 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1070 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       1071 1 1 1 1  29 GLU H    .  26 . HN   1 1 
       1071 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
       1072 1 1 1 1  29 GLU HA   .  26 . HA   1 1 
       1072 1 2 1 1  29 GLU HG2  .  26 . HG2  1 1 
       1073 1 1 1 1  29 GLU HA   .  26 . HA   1 1 
       1073 1 2 1 1  29 GLU QG   .  26 . HG*  1 1 
       1074 1 1 1 1  29 GLU HA   .  26 . HA   1 1 
       1074 1 2 1 1  29 GLU HG3  .  26 . HG1  1 1 
       1075 1 1 1 1  29 GLU HA   .  26 . HA   1 1 
       1075 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1076 1 1 1 1  29 GLU HA   .  26 . HA   1 1 
       1076 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
       1077 1 1 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1077 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1078 1 1 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1078 1 2 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1079 1 1 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1079 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1080 1 1 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1080 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1081 1 1 1 1  29 GLU HB2  .  26 . HB2  1 1 
       1081 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1082 1 1 1 1  29 GLU HB3  .  26 . HB1  1 1 
       1082 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1083 1 1 1 1  29 GLU HB3  .  26 . HB1  1 1 
       1083 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1084 1 1 1 1  29 GLU QG   .  26 . HG*  1 1 
       1084 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1085 1 1 1 1  29 GLU QG   .  26 . HG*  1 1 
       1085 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1086 1 1 1 1  29 GLU QG   .  26 . HG*  1 1 
       1086 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1087 1 1 1 1  29 GLU QG   .  26 . HG*  1 1 
       1087 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       1088 1 1 1 1  29 GLU QG   .  26 . HG*  1 1 
       1088 1 2 1 1 103 GLU HB2  . 100 . HB2  1 1 
       1089 1 1 1 1  29 GLU QG   .  26 . HG*  1 1 
       1089 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
       1090 1 1 1 1  29 GLU HG2  .  26 . HG2  1 1 
       1090 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1091 1 1 1 1  29 GLU HG2  .  26 . HG2  1 1 
       1091 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1092 1 1 1 1  29 GLU HG3  .  26 . HG1  1 1 
       1092 1 2 1 1  30 LYS H    .  27 . HN   1 1 
       1093 1 1 1 1  29 GLU HG3  .  26 . HG1  1 1 
       1093 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1094 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1094 1 2 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1095 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1095 1 2 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1096 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1096 1 2 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1097 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1097 1 2 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1098 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1098 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1099 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1099 1 2 1 1  31 LYS HA   .  28 . HA   1 1 
       1100 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1100 1 2 1 1  31 LYS QB   .  28 . HB*  1 1 
       1101 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1101 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1102 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1102 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1103 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1103 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1104 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1104 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1105 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1105 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1106 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1106 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1107 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1107 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1108 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1108 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1109 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1109 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       1110 1 1 1 1  30 LYS H    .  27 . HN   1 1 
       1110 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1111 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1111 1 2 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1112 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1112 1 2 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1113 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1113 1 2 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1114 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1114 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1115 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1115 1 2 1 1  31 LYS QB   .  28 . HB*  1 1 
       1116 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1116 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1117 1 1 1 1  30 LYS HA   .  27 . HA   1 1 
       1117 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1118 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1118 1 2 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1119 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1119 1 2 1 1  30 LYS QE   .  27 . HE*  1 1 
       1120 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1120 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1121 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1121 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1122 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1122 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1123 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1123 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1124 1 1 1 1  30 LYS HB2  .  27 . HB2  1 1 
       1124 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1125 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1125 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1126 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1126 1 2 1 1  31 LYS HA   .  28 . HA   1 1 
       1127 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1127 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1128 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1128 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1129 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1129 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
       1130 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1130 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1131 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1131 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1132 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1132 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1133 1 1 1 1  30 LYS HB3  .  27 . HB1  1 1 
       1133 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1134 1 1 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1134 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1135 1 1 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1135 1 2 1 1  89 LEU HB3  .  86 . HB1  1 1 
       1136 1 1 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1136 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1137 1 1 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1137 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1138 1 1 1 1  30 LYS HD2  .  27 . HD2  1 1 
       1138 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1139 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1139 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1140 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1140 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       1141 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1141 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       1142 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1142 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       1143 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1143 1 2 1 1  99 LEU HG   .  96 . HG   1 1 
       1144 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1144 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1145 1 1 1 1  30 LYS HD3  .  27 . HD1  1 1 
       1145 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1146 1 1 1 1  30 LYS QE   .  27 . HE*  1 1 
       1146 1 2 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1147 1 1 1 1  30 LYS QE   .  27 . HE*  1 1 
       1147 1 2 1 1  93 ARG HB2  .  90 . HB2  1 1 
       1148 1 1 1 1  30 LYS QE   .  27 . HE*  1 1 
       1148 1 2 1 1  93 ARG HB3  .  90 . HB1  1 1 
       1149 1 1 1 1  30 LYS QE   .  27 . HE*  1 1 
       1149 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       1150 1 1 1 1  30 LYS QE   .  27 . HE*  1 1 
       1150 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1151 1 1 1 1  30 LYS QE   .  27 . HE*  1 1 
       1151 1 2 1 1  99 LEU HG   .  96 . HG   1 1 
       1152 1 1 1 1  30 LYS HE2  .  27 . HE2  1 1 
       1152 1 2 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1153 1 1 1 1  30 LYS HE2  .  27 . HE2  1 1 
       1153 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       1154 1 1 1 1  30 LYS HE2  .  27 . HE2  1 1 
       1154 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       1155 1 1 1 1  30 LYS HE2  .  27 . HE2  1 1 
       1155 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       1156 1 1 1 1  30 LYS HE3  .  27 . HE1  1 1 
       1156 1 2 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1157 1 1 1 1  30 LYS HE3  .  27 . HE1  1 1 
       1157 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       1158 1 1 1 1  30 LYS HE3  .  27 . HE1  1 1 
       1158 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       1159 1 1 1 1  30 LYS HE3  .  27 . HE1  1 1 
       1159 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       1160 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1160 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1161 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1161 1 2 1 1  31 LYS HA   .  28 . HA   1 1 
       1162 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1162 1 2 1 1  31 LYS QB   .  28 . HB*  1 1 
       1163 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1163 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       1164 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1164 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1165 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1165 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       1166 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1166 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1167 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1167 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1168 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1168 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1169 1 1 1 1  30 LYS HG2  .  27 . HG2  1 1 
       1169 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1170 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1170 1 2 1 1  31 LYS H    .  28 . HN   1 1 
       1171 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1171 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1172 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1172 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1173 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1173 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1174 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1174 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1175 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1175 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1176 1 1 1 1  30 LYS HG3  .  27 . HG1  1 1 
       1176 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1177 1 1 1 1  31 LYS H    .  28 . HN   1 1 
       1177 1 2 1 1  31 LYS QB   .  28 . HB*  1 1 
       1178 1 1 1 1  31 LYS H    .  28 . HN   1 1 
       1178 1 2 1 1  31 LYS HG2  .  28 . HG2  1 1 
       1179 1 1 1 1  31 LYS H    .  28 . HN   1 1 
       1179 1 2 1 1  31 LYS HG3  .  28 . HG1  1 1 
       1180 1 1 1 1  31 LYS H    .  28 . HN   1 1 
       1180 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1181 1 1 1 1  31 LYS H    .  28 . HN   1 1 
       1181 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       1182 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1182 1 2 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1183 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1183 1 2 1 1  31 LYS HD3  .  28 . HD1  1 1 
       1184 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1184 1 2 1 1  31 LYS QE   .  28 . HE*  1 1 
       1185 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1185 1 2 1 1  31 LYS HG2  .  28 . HG2  1 1 
       1186 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1186 1 2 1 1  31 LYS HG3  .  28 . HG1  1 1 
       1187 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1187 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1188 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1188 1 2 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1189 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1189 1 2 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1190 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1190 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1191 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1191 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1192 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1192 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1193 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1193 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1194 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1194 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1195 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1195 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1196 1 1 1 1  31 LYS HA   .  28 . HA   1 1 
       1196 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1197 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1197 1 2 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1198 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1198 1 2 1 1  31 LYS HD3  .  28 . HD1  1 1 
       1199 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1199 1 2 1 1  31 LYS QE   .  28 . HE*  1 1 
       1200 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1200 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1201 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1201 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1202 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1202 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1203 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1203 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1204 1 1 1 1  31 LYS QB   .  28 . HB*  1 1 
       1204 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1205 1 1 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1205 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1206 1 1 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1206 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1207 1 1 1 1  31 LYS HD2  .  28 . HD2  1 1 
       1207 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1208 1 1 1 1  31 LYS HD3  .  28 . HD1  1 1 
       1208 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1209 1 1 1 1  31 LYS HD3  .  28 . HD1  1 1 
       1209 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1210 1 1 1 1  31 LYS QE   .  28 . HE*  1 1 
       1210 1 2 1 1  31 LYS HG2  .  28 . HG2  1 1 
       1211 1 1 1 1  31 LYS QE   .  28 . HE*  1 1 
       1211 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1212 1 1 1 1  31 LYS QE   .  28 . HE*  1 1 
       1212 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1213 1 1 1 1  31 LYS QE   .  28 . HE*  1 1 
       1213 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1214 1 1 1 1  31 LYS QE   .  28 . HE*  1 1 
       1214 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1215 1 1 1 1  31 LYS QE   .  28 . HE*  1 1 
       1215 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1216 1 1 1 1  31 LYS HG2  .  28 . HG2  1 1 
       1216 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1217 1 1 1 1  31 LYS HG2  .  28 . HG2  1 1 
       1217 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1218 1 1 1 1  31 LYS HG3  .  28 . HG1  1 1 
       1218 1 2 1 1  32 GLY H    .  29 . HN   1 1 
       1219 1 1 1 1  31 LYS HG3  .  28 . HG1  1 1 
       1219 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1220 1 1 1 1  31 LYS HG3  .  28 . HG1  1 1 
       1220 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1221 1 1 1 1  31 LYS HG3  .  28 . HG1  1 1 
       1221 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1222 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1222 1 2 1 1  33 ALA H    .  30 . HN   1 1 
       1223 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1223 1 2 1 1  33 ALA HA   .  30 . HA   1 1 
       1224 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1224 1 2 1 1  33 ALA MB   .  30 . HB*  1 1 
       1225 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1225 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1226 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1226 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1227 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1227 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
       1228 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1228 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1229 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1229 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1230 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1230 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1231 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1231 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1232 1 1 1 1  32 GLY H    .  29 . HN   1 1 
       1232 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1233 1 1 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1233 1 2 1 1  33 ALA H    .  30 . HN   1 1 
       1234 1 1 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1234 1 2 1 1  33 ALA MB   .  30 . HB*  1 1 
       1235 1 1 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1235 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       1236 1 1 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1236 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       1237 1 1 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1237 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1238 1 1 1 1  32 GLY HA2  .  29 . HA2  1 1 
       1238 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1239 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1239 1 2 1 1  33 ALA H    .  30 . HN   1 1 
       1240 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1240 1 2 1 1  33 ALA HA   .  30 . HA   1 1 
       1241 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1241 1 2 1 1  33 ALA MB   .  30 . HB*  1 1 
       1242 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1242 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       1243 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1243 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1244 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1244 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1245 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1245 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1246 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1246 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1247 1 1 1 1  32 GLY HA3  .  29 . HA1  1 1 
       1247 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1248 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1248 1 2 1 1  33 ALA MB   .  30 . HB*  1 1 
       1249 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1249 1 2 1 1  34 GLU H    .  31 . HN   1 1 
       1250 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1250 1 2 1 1  36 ALA MB   .  33 . HB*  1 1 
       1251 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1251 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1252 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1252 1 2 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1253 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1253 1 2 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1254 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1254 1 2 1 1  38 ALA H    .  35 . HN   1 1 
       1255 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1255 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       1256 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1256 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1257 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1257 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1258 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1258 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1259 1 1 1 1  33 ALA H    .  30 . HN   1 1 
       1259 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1260 1 1 1 1  33 ALA HA   .  30 . HA   1 1 
       1260 1 2 1 1  34 GLU H    .  31 . HN   1 1 
       1261 1 1 1 1  33 ALA HA   .  30 . HA   1 1 
       1261 1 2 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1262 1 1 1 1  33 ALA HA   .  30 . HA   1 1 
       1262 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1263 1 1 1 1  33 ALA HA   .  30 . HA   1 1 
       1263 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1264 1 1 1 1  33 ALA HA   .  30 . HA   1 1 
       1264 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1265 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1265 1 2 1 1  34 GLU H    .  31 . HN   1 1 
       1266 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1266 1 2 1 1  34 GLU HA   .  31 . HA   1 1 
       1267 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1267 1 2 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1268 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1268 1 2 1 1  34 GLU HB3  .  31 . HB1  1 1 
       1269 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1269 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1270 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1270 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1271 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1271 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1272 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1272 1 2 1 1  36 ALA H    .  33 . HN   1 1 
       1273 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1273 1 2 1 1  36 ALA HA   .  33 . HA   1 1 
       1274 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1274 1 2 1 1  36 ALA MB   .  33 . HB*  1 1 
       1275 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1275 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1276 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1276 1 2 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1277 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1277 1 2 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1278 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1278 1 2 1 1  38 ALA H    .  35 . HN   1 1 
       1279 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1279 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       1280 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1280 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1281 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1281 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       1282 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1282 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1283 1 1 1 1  33 ALA MB   .  30 . HB*  1 1 
       1283 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1284 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1284 1 2 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1285 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1285 1 2 1 1  34 GLU HB3  .  31 . HB1  1 1 
       1286 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1286 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1287 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1287 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1288 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1288 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1289 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1289 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
       1290 1 1 1 1  34 GLU H    .  31 . HN   1 1 
       1290 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1291 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1291 1 2 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1292 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1292 1 2 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1293 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1293 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
       1294 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1294 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
       1295 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1295 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1296 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1296 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1297 1 1 1 1  34 GLU HA   .  31 . HA   1 1 
       1297 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1298 1 1 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1298 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1299 1 1 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1299 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
       1300 1 1 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1300 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
       1301 1 1 1 1  34 GLU HB2  .  31 . HB2  1 1 
       1301 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1302 1 1 1 1  34 GLU HB3  .  31 . HB1  1 1 
       1302 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1303 1 1 1 1  34 GLU HB3  .  31 . HB1  1 1 
       1303 1 2 1 1  35 ALA HA   .  32 . HA   1 1 
       1304 1 1 1 1  34 GLU HB3  .  31 . HB1  1 1 
       1304 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
       1305 1 1 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1305 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1306 1 1 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1306 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1307 1 1 1 1  34 GLU HG2  .  31 . HG2  1 1 
       1307 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1308 1 1 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1308 1 2 1 1  35 ALA H    .  32 . HN   1 1 
       1309 1 1 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1309 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
       1310 1 1 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1310 1 2 1 1 100 TRP HH2  .  97 . HH2  1 1 
       1311 1 1 1 1  34 GLU HG3  .  31 . HG1  1 1 
       1311 1 2 1 1 100 TRP HZ2  .  97 . HZ2  1 1 
       1312 1 1 1 1  35 ALA H    .  32 . HN   1 1 
       1312 1 2 1 1  35 ALA MB   .  32 . HB*  1 1 
       1313 1 1 1 1  35 ALA H    .  32 . HN   1 1 
       1313 1 2 1 1  36 ALA H    .  33 . HN   1 1 
       1314 1 1 1 1  35 ALA H    .  32 . HN   1 1 
       1314 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1315 1 1 1 1  35 ALA H    .  32 . HN   1 1 
       1315 1 2 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1316 1 1 1 1  35 ALA HA   .  32 . HA   1 1 
       1316 1 2 1 1  36 ALA MB   .  33 . HB*  1 1 
       1317 1 1 1 1  35 ALA HA   .  32 . HA   1 1 
       1317 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1318 1 1 1 1  35 ALA MB   .  32 . HB*  1 1 
       1318 1 2 1 1  36 ALA H    .  33 . HN   1 1 
       1319 1 1 1 1  35 ALA MB   .  32 . HB*  1 1 
       1319 1 2 1 1  36 ALA HA   .  33 . HA   1 1 
       1320 1 1 1 1  35 ALA MB   .  32 . HB*  1 1 
       1320 1 2 1 1  36 ALA MB   .  33 . HB*  1 1 
       1321 1 1 1 1  35 ALA MB   .  32 . HB*  1 1 
       1321 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1322 1 1 1 1  36 ALA H    .  33 . HN   1 1 
       1322 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1323 1 1 1 1  36 ALA HA   .  33 . HA   1 1 
       1323 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1324 1 1 1 1  36 ALA MB   .  33 . HB*  1 1 
       1324 1 2 1 1  37 GLY H    .  34 . HN   1 1 
       1325 1 1 1 1  37 GLY H    .  34 . HN   1 1 
       1325 1 2 1 1  38 ALA H    .  35 . HN   1 1 
       1326 1 1 1 1  37 GLY H    .  34 . HN   1 1 
       1326 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1327 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1327 1 2 1 1  38 ALA H    .  35 . HN   1 1 
       1328 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1328 1 2 1 1  38 ALA MB   .  35 . HB*  1 1 
       1329 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1329 1 2 1 1  98 ASP HB2  .  95 . HB2  1 1 
       1330 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1330 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1331 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1331 1 2 1 1  98 ASP HB3  .  95 . HB1  1 1 
       1332 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1332 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1333 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1333 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1334 1 1 1 1  37 GLY HA2  .  34 . HA2  1 1 
       1334 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1335 1 1 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1335 1 2 1 1  38 ALA MB   .  35 . HB*  1 1 
       1336 1 1 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1336 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1337 1 1 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1337 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1338 1 1 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1338 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1339 1 1 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1339 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1340 1 1 1 1  37 GLY HA3  .  34 . HA1  1 1 
       1340 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1341 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1341 1 2 1 1  38 ALA MB   .  35 . HB*  1 1 
       1342 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1342 1 2 1 1  98 ASP HB2  .  95 . HB2  1 1 
       1343 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1343 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1344 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1344 1 2 1 1  98 ASP HB3  .  95 . HB1  1 1 
       1345 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1345 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       1346 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1346 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1347 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1347 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       1348 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1348 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1349 1 1 1 1  38 ALA H    .  35 . HN   1 1 
       1349 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1350 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1350 1 2 1 1  39 ILE H    .  36 . HN   1 1 
       1351 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1351 1 2 1 1  39 ILE HA   .  36 . HA   1 1 
       1352 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1352 1 2 1 1  39 ILE HB   .  36 . HB   1 1 
       1353 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1353 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1354 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1354 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1355 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1355 1 2 1 1  55 PRO QB   .  52 . HB*  1 1 
       1356 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1356 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       1357 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1357 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1358 1 1 1 1  38 ALA HA   .  35 . HA   1 1 
       1358 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1359 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1359 1 2 1 1  39 ILE H    .  36 . HN   1 1 
       1360 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1360 1 2 1 1  39 ILE HA   .  36 . HA   1 1 
       1361 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1361 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1362 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1362 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1363 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1363 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1364 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1364 1 2 1 1  40 PHE QD   .  37 . HD1  1 1 
       1365 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1365 1 2 1 1  54 GLY QA   .  51 . HA*  1 1 
       1366 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1366 1 2 1 1  55 PRO QB   .  52 . HB*  1 1 
       1367 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1367 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       1368 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1368 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       1369 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1369 1 2 1 1  96 ASP QB   .  93 . HB*  1 1 
       1370 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1370 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       1371 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1371 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       1372 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1372 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       1373 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1373 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1374 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1374 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       1375 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1375 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       1376 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1376 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1377 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1377 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       1378 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1378 1 2 1 1  99 LEU HG   .  96 . HG   1 1 
       1379 1 1 1 1  38 ALA MB   .  35 . HB*  1 1 
       1379 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1380 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1380 1 2 1 1  39 ILE HB   .  36 . HB   1 1 
       1381 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1381 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1382 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1382 1 2 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1383 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1383 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1384 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1384 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1385 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1385 1 2 1 1  40 PHE QD   .  37 . HD1  1 1 
       1386 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1386 1 2 1 1  55 PRO HA   .  52 . HA   1 1 
       1387 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1387 1 2 1 1  55 PRO QB   .  52 . HB*  1 1 
       1388 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1388 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       1389 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1389 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       1390 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1390 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       1391 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1391 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1392 1 1 1 1  39 ILE H    .  36 . HN   1 1 
       1392 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1393 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1393 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1394 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1394 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1395 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1395 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1396 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1396 1 2 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1397 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1397 1 2 1 1  40 PHE QD   .  37 . HD1  1 1 
       1398 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1398 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1399 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1399 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1400 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1400 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1401 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1401 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1402 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1402 1 2 1 1 100 TRP HB2  .  97 . HB2  1 1 
       1403 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1403 1 2 1 1 100 TRP HB3  .  97 . HB1  1 1 
       1404 1 1 1 1  39 ILE HA   .  36 . HA   1 1 
       1404 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1405 1 1 1 1  39 ILE HB   .  36 . HB   1 1 
       1405 1 2 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1406 1 1 1 1  39 ILE HB   .  36 . HB   1 1 
       1406 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1407 1 1 1 1  39 ILE HB   .  36 . HB   1 1 
       1407 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
       1408 1 1 1 1  39 ILE HB   .  36 . HB   1 1 
       1408 1 2 1 1  73 PHE HE1  .  70 . HE1  1 1 
       1409 1 1 1 1  39 ILE HB   .  36 . HB   1 1 
       1409 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       1410 1 1 1 1  39 ILE HB   .  36 . HB   1 1 
       1410 1 2 1 1  73 PHE HZ   .  70 . HZ   1 1 
       1411 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1411 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1412 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1412 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1413 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1413 1 2 1 1  73 PHE HZ   .  70 . HZ   1 1 
       1414 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1414 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1415 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1415 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1416 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1416 1 2 1 1 100 TRP HB2  .  97 . HB2  1 1 
       1417 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1417 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
       1418 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1418 1 2 1 1 100 TRP HB3  .  97 . HB1  1 1 
       1419 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1419 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1420 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1420 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       1421 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1421 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1422 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1422 1 2 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       1423 1 1 1 1  39 ILE MD   .  36 . HD1* 1 1 
       1423 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1424 1 1 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1424 1 2 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1425 1 1 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1425 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1426 1 1 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1426 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
       1427 1 1 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1427 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1428 1 1 1 1  39 ILE QG   .  36 . HG1* 1 1 
       1428 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       1429 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1429 1 2 1 1  40 PHE H    .  37 . HN   1 1 
       1430 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1430 1 2 1 1  40 PHE HA   .  37 . HA   1 1 
       1431 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1431 1 2 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1432 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1432 1 2 1 1  41 VAL H    .  38 . HN   1 1 
       1433 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1433 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       1434 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1434 1 2 1 1  73 PHE HZ   .  70 . HZ   1 1 
       1435 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1435 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1436 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1436 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       1437 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1437 1 2 1 1 100 TRP HB2  .  97 . HB2  1 1 
       1438 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1438 1 2 1 1 100 TRP HB3  .  97 . HB1  1 1 
       1439 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1439 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       1440 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1440 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       1441 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1441 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1442 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1442 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1443 1 1 1 1  39 ILE MG   .  36 . HG2* 1 1 
       1443 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       1444 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1444 1 2 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1445 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1445 1 2 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1446 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1446 1 2 1 1  40 PHE QD   .  37 . HD1  1 1 
       1447 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1447 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
       1448 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1448 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1449 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1449 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1450 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1450 1 2 1 1 100 TRP HB2  .  97 . HB2  1 1 
       1451 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1451 1 2 1 1 100 TRP QB   .  97 . HB*  1 1 
       1452 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1452 1 2 1 1 100 TRP HB3  .  97 . HB1  1 1 
       1453 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1453 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1454 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1454 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1455 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1455 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1456 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1456 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       1457 1 1 1 1  40 PHE H    .  37 . HN   1 1 
       1457 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1458 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1458 1 2 1 1  40 PHE QD   .  37 . HD1  1 1 
       1459 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1459 1 2 1 1  41 VAL H    .  38 . HN   1 1 
       1460 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1460 1 2 1 1  41 VAL HA   .  38 . HA   1 1 
       1461 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1461 1 2 1 1  41 VAL HB   .  38 . HB   1 1 
       1462 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1462 1 2 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1463 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1463 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
       1464 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1464 1 2 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1465 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1465 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1466 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1466 1 2 1 1  53 TYR HB2  .  50 . HB2  1 1 
       1467 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1467 1 2 1 1  54 GLY HA2  .  51 . HA2  1 1 
       1468 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1468 1 2 1 1  54 GLY QA   .  51 . HA*  1 1 
       1469 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1469 1 2 1 1  54 GLY HA3  .  51 . HA1  1 1 
       1470 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1470 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       1471 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1471 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1472 1 1 1 1  40 PHE HA   .  37 . HA   1 1 
       1472 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1473 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1473 1 2 1 1  41 VAL H    .  38 . HN   1 1 
       1474 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1474 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1475 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1475 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1476 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1476 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       1477 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1477 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1478 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1478 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       1479 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1479 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1480 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1480 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1481 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1481 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1482 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1482 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1483 1 1 1 1  40 PHE HB2  .  37 . HB2  1 1 
       1483 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       1484 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1484 1 2 1 1  41 VAL H    .  38 . HN   1 1 
       1485 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1485 1 2 1 1  41 VAL HA   .  38 . HA   1 1 
       1486 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1486 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1487 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1487 1 2 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       1488 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1488 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1489 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1489 1 2 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       1490 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1490 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1491 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1491 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1492 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1492 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1493 1 1 1 1  40 PHE HB3  .  37 . HB1  1 1 
       1493 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1494 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1494 1 2 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       1495 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1495 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1496 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1496 1 2 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       1497 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1497 1 2 1 1  54 GLY HA2  .  51 . HA2  1 1 
       1498 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1498 1 2 1 1  54 GLY QA   .  51 . HA*  1 1 
       1499 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1499 1 2 1 1  54 GLY HA3  .  51 . HA1  1 1 
       1500 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1500 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       1501 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1501 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       1502 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1502 1 2 1 1  77 LEU QD   .  74 . HD1* 1 1 
       1503 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1503 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1504 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1504 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       1505 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1505 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       1506 1 1 1 1  40 PHE QD   .  37 . HD2  1 1 
       1506 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1507 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1507 1 2 1 1  99 LEU HA   .  96 . HA   1 1 
       1508 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1508 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       1509 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1509 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       1510 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1510 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       1511 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1511 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1512 1 1 1 1  40 PHE QD   .  37 . HD1  1 1 
       1512 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1513 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1513 1 2 1 1  41 VAL HB   .  38 . HB   1 1 
       1514 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1514 1 2 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1515 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1515 1 2 1 1  41 VAL QG   .  38 . HG*  1 1 
       1516 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1516 1 2 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1517 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1517 1 2 1 1  42 ARG H    .  39 . HN   1 1 
       1518 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1518 1 2 1 1  42 ARG HA   .  39 . HA   1 1 
       1519 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1519 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1520 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1520 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1521 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1521 1 2 1 1  53 TYR HA   .  50 . HA   1 1 
       1522 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1522 1 2 1 1  53 TYR HB2  .  50 . HB2  1 1 
       1523 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1523 1 2 1 1  53 TYR HB3  .  50 . HB1  1 1 
       1524 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1524 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1525 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1525 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       1526 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1526 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1527 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1527 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1528 1 1 1 1  41 VAL H    .  38 . HN   1 1 
       1528 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1529 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1529 1 2 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1530 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1530 1 2 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1531 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1531 1 2 1 1  42 ARG H    .  39 . HN   1 1 
       1532 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1532 1 2 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1533 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1533 1 2 1 1  42 ARG QG   .  39 . HG*  1 1 
       1534 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1534 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1535 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1535 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       1536 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1536 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1537 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1537 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
       1538 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1538 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1539 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1539 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
       1540 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1540 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1541 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1541 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1542 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1542 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       1543 1 1 1 1  41 VAL HA   .  38 . HA   1 1 
       1543 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       1544 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1544 1 2 1 1  42 ARG H    .  39 . HN   1 1 
       1545 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1545 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1546 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1546 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1547 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1547 1 2 1 1  53 TYR HB2  .  50 . HB2  1 1 
       1548 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1548 1 2 1 1  53 TYR HB3  .  50 . HB1  1 1 
       1549 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1549 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1550 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1550 1 2 1 1  53 TYR HE2  .  50 . HE2  1 1 
       1551 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1551 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       1552 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1552 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       1553 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1553 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1554 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1554 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1555 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1555 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       1556 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1556 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       1557 1 1 1 1  41 VAL HB   .  38 . HB   1 1 
       1557 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       1558 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1558 1 2 1 1  42 ARG H    .  39 . HN   1 1 
       1559 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1559 1 2 1 1  42 ARG HA   .  39 . HA   1 1 
       1560 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1560 1 2 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1561 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1561 1 2 1 1  42 ARG QG   .  39 . HG*  1 1 
       1562 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1562 1 2 1 1  43 GLN H    .  40 . HN   1 1 
       1563 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1563 1 2 1 1  43 GLN HA   .  40 . HA   1 1 
       1564 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1564 1 2 1 1  43 GLN QB   .  40 . HB*  1 1 
       1565 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1565 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1566 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1566 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1567 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1567 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1568 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1568 1 2 1 1  53 TYR HB3  .  50 . HB1  1 1 
       1569 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1569 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1570 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1570 1 2 1 1  53 TYR HE2  .  50 . HE2  1 1 
       1571 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1571 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       1572 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1572 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       1573 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1573 1 2 1 1  73 PHE HZ   .  70 . HZ   1 1 
       1574 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1574 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       1575 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1575 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       1576 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1576 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       1577 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1577 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1578 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1578 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1579 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1579 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1580 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1580 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1581 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1581 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
       1582 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1582 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1583 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1583 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       1584 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1584 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1585 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1585 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1586 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1586 1 2 1 1 109 ILE HG12 . 106 . HG12 1 1 
       1587 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1587 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       1588 1 1 1 1  41 VAL QG   .  38 . HG*  1 1 
       1588 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
       1589 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1589 1 2 1 1  42 ARG H    .  39 . HN   1 1 
       1590 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1590 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1591 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1591 1 2 1 1  53 TYR HB2  .  50 . HB2  1 1 
       1592 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1592 1 2 1 1  53 TYR HB3  .  50 . HB1  1 1 
       1593 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1593 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1594 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1594 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       1595 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1595 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1596 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1596 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1597 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1597 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1598 1 1 1 1  41 VAL MG1  .  38 . HG1* 1 1 
       1598 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       1599 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1599 1 2 1 1  42 ARG H    .  39 . HN   1 1 
       1600 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1600 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1601 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1601 1 2 1 1  53 TYR HB2  .  50 . HB2  1 1 
       1602 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1602 1 2 1 1  53 TYR HB3  .  50 . HB1  1 1 
       1603 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1603 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1604 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1604 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       1605 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1605 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1606 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1606 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1607 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1607 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1608 1 1 1 1  41 VAL MG2  .  38 . HG2* 1 1 
       1608 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       1609 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1609 1 2 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1610 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1610 1 2 1 1  42 ARG QD   .  39 . HD*  1 1 
       1611 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1611 1 2 1 1  42 ARG HE   .  39 . HE   1 1 
       1612 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1612 1 2 1 1  42 ARG HG2  .  39 . HG2  1 1 
       1613 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1613 1 2 1 1  42 ARG QG   .  39 . HG*  1 1 
       1614 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1614 1 2 1 1  42 ARG HG3  .  39 . HG1  1 1 
       1615 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1615 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1616 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1616 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1617 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1617 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1618 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1618 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1619 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1619 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1620 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1620 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       1621 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1621 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       1622 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1622 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       1623 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1623 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       1624 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1624 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1625 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1625 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1626 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1626 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1627 1 1 1 1  42 ARG H    .  39 . HN   1 1 
       1627 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       1628 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1628 1 2 1 1  43 GLN H    .  40 . HN   1 1 
       1629 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1629 1 2 1 1  43 GLN HA   .  40 . HA   1 1 
       1630 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1630 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1631 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1631 1 2 1 1  52 LEU HB2  .  49 . HB2  1 1 
       1632 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1632 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1633 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1633 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1634 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1634 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       1635 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1635 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1636 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1636 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1637 1 1 1 1  42 ARG HA   .  39 . HA   1 1 
       1637 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       1638 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1638 1 2 1 1  42 ARG HE   .  39 . HE   1 1 
       1639 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1639 1 2 1 1  43 GLN H    .  40 . HN   1 1 
       1640 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1640 1 2 1 1  43 GLN HA   .  40 . HA   1 1 
       1641 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1641 1 2 1 1  50 GLU HB3  .  47 . HB1  1 1 
       1642 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1642 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1643 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1643 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1644 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1644 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1645 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1645 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       1646 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1646 1 2 1 1  85 ILE HG13 .  82 . HG11 1 1 
       1647 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1647 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1648 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1648 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1649 1 1 1 1  42 ARG HB2  .  39 . HB2  1 1 
       1649 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1650 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1650 1 2 1 1  42 ARG HE   .  39 . HE   1 1 
       1651 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1651 1 2 1 1  43 GLN H    .  40 . HN   1 1 
       1652 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1652 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1653 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1653 1 2 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       1654 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1654 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1655 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1655 1 2 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       1656 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1656 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       1657 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1657 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1658 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1658 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1659 1 1 1 1  42 ARG HB3  .  39 . HB1  1 1 
       1659 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1660 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1660 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       1661 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1661 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1662 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1662 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1663 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1663 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1664 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1664 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1665 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1665 1 2 1 1 103 GLU HB2  . 100 . HB2  1 1 
       1666 1 1 1 1  42 ARG QD   .  39 . HD*  1 1 
       1666 1 2 1 1 103 GLU HB3  . 100 . HB1  1 1 
       1667 1 1 1 1  42 ARG HD2  .  39 . HD2  1 1 
       1667 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1668 1 1 1 1  42 ARG HD3  .  39 . HD1  1 1 
       1668 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1669 1 1 1 1  42 ARG HE   .  39 . HE   1 1 
       1669 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       1670 1 1 1 1  42 ARG HE   .  39 . HE   1 1 
       1670 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       1671 1 1 1 1  42 ARG HE   .  39 . HE   1 1 
       1671 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1672 1 1 1 1  42 ARG HE   .  39 . HE   1 1 
       1672 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       1673 1 1 1 1  42 ARG HE   .  39 . HE   1 1 
       1673 1 2 1 1  89 LEU HG   .  86 . HG   1 1 
       1674 1 1 1 1  42 ARG HE   .  39 . HE   1 1 
       1674 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       1675 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1675 1 2 1 1  43 GLN HA   .  40 . HA   1 1 
       1676 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1676 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1677 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1677 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1678 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1678 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       1679 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1679 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1680 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1680 1 2 1 1 103 GLU HB2  . 100 . HB2  1 1 
       1681 1 1 1 1  42 ARG QG   .  39 . HG*  1 1 
       1681 1 2 1 1 103 GLU HB3  . 100 . HB1  1 1 
       1682 1 1 1 1  42 ARG HG2  .  39 . HG2  1 1 
       1682 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1683 1 1 1 1  42 ARG HG2  .  39 . HG2  1 1 
       1683 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1684 1 1 1 1  42 ARG HG3  .  39 . HG1  1 1 
       1684 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       1685 1 1 1 1  42 ARG HG3  .  39 . HG1  1 1 
       1685 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1686 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1686 1 2 1 1  43 GLN QG   .  40 . HG*  1 1 
       1687 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1687 1 2 1 1  44 ARG H    .  41 . HN   1 1 
       1688 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1688 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1689 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1689 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1690 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1690 1 2 1 1  51 ASN HB2  .  48 . HB2  1 1 
       1691 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1691 1 2 1 1  51 ASN QB   .  48 . HB*  1 1 
       1692 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1692 1 2 1 1  51 ASN HB3  .  48 . HB1  1 1 
       1693 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1693 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1694 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1694 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       1695 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1695 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       1696 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1696 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1697 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1697 1 2 1 1  53 TYR HE2  .  50 . HE2  1 1 
       1698 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1698 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       1699 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1699 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       1700 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1700 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1701 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1701 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       1702 1 1 1 1  43 GLN H    .  40 . HN   1 1 
       1702 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1703 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1703 1 2 1 1  43 GLN HG2  .  40 . HG2  1 1 
       1704 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1704 1 2 1 1  43 GLN HG3  .  40 . HG1  1 1 
       1705 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1705 1 2 1 1  44 ARG H    .  41 . HN   1 1 
       1706 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1706 1 2 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1707 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1707 1 2 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1708 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1708 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       1709 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1709 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
       1710 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1710 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1711 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1711 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       1712 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1712 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1713 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1713 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       1714 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1714 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1715 1 1 1 1  43 GLN HA   .  40 . HA   1 1 
       1715 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1716 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1716 1 2 1 1  43 GLN HE21 .  40 . HE21 1 1 
       1717 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1717 1 2 1 1  43 GLN HE22 .  40 . HE22 1 1 
       1718 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1718 1 2 1 1  44 ARG H    .  41 . HN   1 1 
       1719 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1719 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1720 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1720 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1721 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1721 1 2 1 1  51 ASN QB   .  48 . HB*  1 1 
       1722 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1722 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       1723 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1723 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       1724 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1724 1 2 1 1  53 TYR HE2  .  50 . HE2  1 1 
       1725 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1725 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1726 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1726 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1727 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1727 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1728 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1728 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1729 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1729 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       1730 1 1 1 1  43 GLN QB   .  40 . HB*  1 1 
       1730 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       1731 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1731 1 2 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1732 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1732 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1733 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1733 1 2 1 1  45 LEU HG   .  42 . HG   1 1 
       1734 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1734 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1735 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1735 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       1736 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1736 1 2 1 1 108 GLU HA   . 105 . HA   1 1 
       1737 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1737 1 2 1 1 109 ILE HA   . 106 . HA   1 1 
       1738 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1738 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       1739 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1739 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1740 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1740 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       1741 1 1 1 1  43 GLN QE   .  40 . HE2* 1 1 
       1741 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       1742 1 1 1 1  43 GLN HE21 .  40 . HE21 1 1 
       1742 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1743 1 1 1 1  43 GLN HE21 .  40 . HE21 1 1 
       1743 1 2 1 1 107 ASP HA   . 104 . HA   1 1 
       1744 1 1 1 1  43 GLN HE21 .  40 . HE21 1 1 
       1744 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       1745 1 1 1 1  43 GLN HE21 .  40 . HE21 1 1 
       1745 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1746 1 1 1 1  43 GLN HE21 .  40 . HE21 1 1 
       1746 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       1747 1 1 1 1  43 GLN HE22 .  40 . HE22 1 1 
       1747 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1748 1 1 1 1  43 GLN HE22 .  40 . HE22 1 1 
       1748 1 2 1 1 107 ASP HA   . 104 . HA   1 1 
       1749 1 1 1 1  43 GLN HE22 .  40 . HE22 1 1 
       1749 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       1750 1 1 1 1  43 GLN HE22 .  40 . HE22 1 1 
       1750 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1751 1 1 1 1  43 GLN HE22 .  40 . HE22 1 1 
       1751 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       1752 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1752 1 2 1 1  44 ARG H    .  41 . HN   1 1 
       1753 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1753 1 2 1 1  44 ARG HA   .  41 . HA   1 1 
       1754 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1754 1 2 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1755 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1755 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1756 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1756 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1757 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1757 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       1758 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1758 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1759 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1759 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1760 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1760 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1761 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1761 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1762 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1762 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       1763 1 1 1 1  43 GLN QG   .  40 . HG*  1 1 
       1763 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       1764 1 1 1 1  43 GLN HG2  .  40 . HG2  1 1 
       1764 1 2 1 1  44 ARG H    .  41 . HN   1 1 
       1765 1 1 1 1  43 GLN HG2  .  40 . HG2  1 1 
       1765 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1766 1 1 1 1  43 GLN HG2  .  40 . HG2  1 1 
       1766 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1767 1 1 1 1  43 GLN HG2  .  40 . HG2  1 1 
       1767 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1768 1 1 1 1  43 GLN HG2  .  40 . HG2  1 1 
       1768 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1769 1 1 1 1  43 GLN HG3  .  40 . HG1  1 1 
       1769 1 2 1 1  44 ARG H    .  41 . HN   1 1 
       1770 1 1 1 1  43 GLN HG3  .  40 . HG1  1 1 
       1770 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1771 1 1 1 1  43 GLN HG3  .  40 . HG1  1 1 
       1771 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1772 1 1 1 1  43 GLN HG3  .  40 . HG1  1 1 
       1772 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1773 1 1 1 1  43 GLN HG3  .  40 . HG1  1 1 
       1773 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       1774 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1774 1 2 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1775 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1775 1 2 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1776 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1776 1 2 1 1  44 ARG QD   .  41 . HD*  1 1 
       1777 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1777 1 2 1 1  45 LEU H    .  42 . HN   1 1 
       1778 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1778 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1779 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1779 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1780 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1780 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1781 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1781 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1782 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1782 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1783 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1783 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       1784 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1784 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       1785 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1785 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       1786 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1786 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
       1787 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1787 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1788 1 1 1 1  44 ARG H    .  41 . HN   1 1 
       1788 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       1789 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1789 1 2 1 1  44 ARG QD   .  41 . HD*  1 1 
       1790 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1790 1 2 1 1  45 LEU H    .  42 . HN   1 1 
       1791 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1791 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1792 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1792 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1793 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1793 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1794 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1794 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1795 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1795 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1796 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1796 1 2 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1797 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1797 1 2 1 1  50 GLU HB3  .  47 . HB1  1 1 
       1798 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1798 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1799 1 1 1 1  44 ARG HA   .  41 . HA   1 1 
       1799 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1800 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1800 1 2 1 1  44 ARG QD   .  41 . HD*  1 1 
       1801 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1801 1 2 1 1  45 LEU H    .  42 . HN   1 1 
       1802 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1802 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1803 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1803 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1804 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1804 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       1805 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1805 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
       1806 1 1 1 1  44 ARG HB2  .  41 . HB2  1 1 
       1806 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1807 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1807 1 2 1 1  44 ARG QD   .  41 . HD*  1 1 
       1808 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1808 1 2 1 1  44 ARG QG   .  41 . HG*  1 1 
       1809 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1809 1 2 1 1  45 LEU H    .  42 . HN   1 1 
       1810 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1810 1 2 1 1  45 LEU HA   .  42 . HA   1 1 
       1811 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1811 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1812 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1812 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1813 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1813 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       1814 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1814 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
       1815 1 1 1 1  44 ARG HB3  .  41 . HB1  1 1 
       1815 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1816 1 1 1 1  44 ARG QD   .  41 . HD*  1 1 
       1816 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
       1817 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1817 1 2 1 1  45 LEU H    .  42 . HN   1 1 
       1818 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1818 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1819 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1819 1 2 1 1  46 ARG HA   .  43 . HA   1 1 
       1820 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1820 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1821 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1821 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1822 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1822 1 2 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1823 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1823 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1824 1 1 1 1  44 ARG QG   .  41 . HG*  1 1 
       1824 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
       1825 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1825 1 2 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1826 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1826 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1827 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1827 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1828 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1828 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1829 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1829 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1830 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1830 1 2 1 1  46 ARG HA   .  43 . HA   1 1 
       1831 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1831 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1832 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1832 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1833 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1833 1 2 1 1  48 GLY HA2  .  45 . HA2  1 1 
       1834 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1834 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1835 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1835 1 2 1 1  49 ARG HA   .  46 . HA   1 1 
       1836 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1836 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1837 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1837 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1838 1 1 1 1  45 LEU H    .  42 . HN   1 1 
       1838 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1839 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1839 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1840 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1840 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1841 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1841 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1842 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1842 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1843 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1843 1 2 1 1  46 ARG HA   .  43 . HA   1 1 
       1844 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1844 1 2 1 1  46 ARG QB   .  43 . HB*  1 1 
       1845 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1845 1 2 1 1  46 ARG QD   .  43 . HD*  1 1 
       1846 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1846 1 2 1 1  46 ARG QG   .  43 . HG*  1 1 
       1847 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1847 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1848 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1848 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1849 1 1 1 1  45 LEU HA   .  42 . HA   1 1 
       1849 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1850 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1850 1 2 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1851 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1851 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1852 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1852 1 2 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1853 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1853 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1854 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1854 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1855 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1855 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1856 1 1 1 1  45 LEU HB2  .  42 . HB2  1 1 
       1856 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1857 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1857 1 2 1 1  45 LEU QD   .  42 . HD*  1 1 
       1858 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1858 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1859 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1859 1 2 1 1  46 ARG HA   .  43 . HA   1 1 
       1860 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1860 1 2 1 1  46 ARG QG   .  43 . HG*  1 1 
       1861 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1861 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1862 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1862 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1863 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1863 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1864 1 1 1 1  45 LEU HB3  .  42 . HB1  1 1 
       1864 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1865 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1865 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1866 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1866 1 2 1 1  46 ARG QD   .  43 . HD*  1 1 
       1867 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1867 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1868 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1868 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1869 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1869 1 2 1 1  49 ARG HA   .  46 . HA   1 1 
       1870 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1870 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1871 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1871 1 2 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1872 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1872 1 2 1 1  49 ARG QD   .  46 . HD*  1 1 
       1873 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1873 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1874 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1874 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1875 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1875 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1876 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1876 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1877 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1877 1 2 1 1  51 ASN QB   .  48 . HB*  1 1 
       1878 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1878 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       1879 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1879 1 2 1 1  51 ASN HD22 .  48 . HD22 1 1 
       1880 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1880 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       1881 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1881 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       1882 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1882 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       1883 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1883 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1884 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1884 1 2 1 1 106 THR H    . 103 . HN   1 1 
       1885 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1885 1 2 1 1 107 ASP H    . 104 . HN   1 1 
       1886 1 1 1 1  45 LEU QD   .  42 . HD*  1 1 
       1886 1 2 1 1 107 ASP HA   . 104 . HA   1 1 
       1887 1 1 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1887 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1888 1 1 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1888 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1889 1 1 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1889 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1890 1 1 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1890 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1891 1 1 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1891 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       1892 1 1 1 1  45 LEU MD1  .  42 . HD1* 1 1 
       1892 1 2 1 1  51 ASN HD22 .  48 . HD22 1 1 
       1893 1 1 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1893 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1894 1 1 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1894 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1895 1 1 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1895 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1896 1 1 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1896 1 2 1 1  50 GLU HA   .  47 . HA   1 1 
       1897 1 1 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1897 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       1898 1 1 1 1  45 LEU MD2  .  42 . HD2* 1 1 
       1898 1 2 1 1  51 ASN HD22 .  48 . HD22 1 1 
       1899 1 1 1 1  45 LEU HG   .  42 . HG   1 1 
       1899 1 2 1 1  46 ARG H    .  43 . HN   1 1 
       1900 1 1 1 1  45 LEU HG   .  42 . HG   1 1 
       1900 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1901 1 1 1 1  45 LEU HG   .  42 . HG   1 1 
       1901 1 2 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1902 1 1 1 1  45 LEU HG   .  42 . HG   1 1 
       1902 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1903 1 1 1 1  45 LEU HG   .  42 . HG   1 1 
       1903 1 2 1 1  51 ASN HD22 .  48 . HD22 1 1 
       1904 1 1 1 1  46 ARG H    .  43 . HN   1 1 
       1904 1 2 1 1  46 ARG QB   .  43 . HB*  1 1 
       1905 1 1 1 1  46 ARG H    .  43 . HN   1 1 
       1905 1 2 1 1  46 ARG QD   .  43 . HD*  1 1 
       1906 1 1 1 1  46 ARG H    .  43 . HN   1 1 
       1906 1 2 1 1  46 ARG QG   .  43 . HG*  1 1 
       1907 1 1 1 1  46 ARG H    .  43 . HN   1 1 
       1907 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1908 1 1 1 1  46 ARG HA   .  43 . HA   1 1 
       1908 1 2 1 1  46 ARG QD   .  43 . HD*  1 1 
       1909 1 1 1 1  46 ARG HA   .  43 . HA   1 1 
       1909 1 2 1 1  46 ARG QG   .  43 . HG*  1 1 
       1910 1 1 1 1  46 ARG HA   .  43 . HA   1 1 
       1910 1 2 1 1  47 ASP HA   .  44 . HA   1 1 
       1911 1 1 1 1  46 ARG HA   .  43 . HA   1 1 
       1911 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1912 1 1 1 1  46 ARG QB   .  43 . HB*  1 1 
       1912 1 2 1 1  46 ARG QD   .  43 . HD*  1 1 
       1913 1 1 1 1  46 ARG QB   .  43 . HB*  1 1 
       1913 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1914 1 1 1 1  46 ARG QB   .  43 . HB*  1 1 
       1914 1 2 1 1  47 ASP HA   .  44 . HA   1 1 
       1915 1 1 1 1  46 ARG QD   .  43 . HD*  1 1 
       1915 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1916 1 1 1 1  46 ARG QG   .  43 . HG*  1 1 
       1916 1 2 1 1  47 ASP H    .  44 . HN   1 1 
       1917 1 1 1 1  46 ARG QG   .  43 . HG*  1 1 
       1917 1 2 1 1  47 ASP HA   .  44 . HA   1 1 
       1918 1 1 1 1  46 ARG QG   .  43 . HG*  1 1 
       1918 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1919 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1919 1 2 1 1  47 ASP HB2  .  44 . HB2  1 1 
       1920 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1920 1 2 1 1  47 ASP QB   .  44 . HB*  1 1 
       1921 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1921 1 2 1 1  47 ASP HB3  .  44 . HB1  1 1 
       1922 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1922 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1923 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1923 1 2 1 1  48 GLY HA2  .  45 . HA2  1 1 
       1924 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1924 1 2 1 1  48 GLY HA3  .  45 . HA1  1 1 
       1925 1 1 1 1  47 ASP H    .  44 . HN   1 1 
       1925 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1926 1 1 1 1  47 ASP HA   .  44 . HA   1 1 
       1926 1 2 1 1  48 GLY HA3  .  45 . HA1  1 1 
       1927 1 1 1 1  47 ASP QB   .  44 . HB*  1 1 
       1927 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1928 1 1 1 1  47 ASP QB   .  44 . HB*  1 1 
       1928 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1929 1 1 1 1  47 ASP QB   .  44 . HB*  1 1 
       1929 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1930 1 1 1 1  47 ASP HB2  .  44 . HB2  1 1 
       1930 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1931 1 1 1 1  47 ASP HB2  .  44 . HB2  1 1 
       1931 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1932 1 1 1 1  47 ASP HB3  .  44 . HB1  1 1 
       1932 1 2 1 1  48 GLY H    .  45 . HN   1 1 
       1933 1 1 1 1  47 ASP HB3  .  44 . HB1  1 1 
       1933 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1934 1 1 1 1  48 GLY H    .  45 . HN   1 1 
       1934 1 2 1 1  49 ARG H    .  46 . HN   1 1 
       1935 1 1 1 1  48 GLY H    .  45 . HN   1 1 
       1935 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1936 1 1 1 1  48 GLY H    .  45 . HN   1 1 
       1936 1 2 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1937 1 1 1 1  48 GLY H    .  45 . HN   1 1 
       1937 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1938 1 1 1 1  48 GLY HA2  .  45 . HA2  1 1 
       1938 1 2 1 1  49 ARG QD   .  46 . HD*  1 1 
       1939 1 1 1 1  48 GLY HA2  .  45 . HA2  1 1 
       1939 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1940 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1940 1 2 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1941 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1941 1 2 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1942 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1942 1 2 1 1  49 ARG HD2  .  46 . HD2  1 1 
       1943 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1943 1 2 1 1  49 ARG QD   .  46 . HD*  1 1 
       1944 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1944 1 2 1 1  49 ARG HD3  .  46 . HD1  1 1 
       1945 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1945 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1946 1 1 1 1  49 ARG H    .  46 . HN   1 1 
       1946 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1947 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1947 1 2 1 1  49 ARG HD2  .  46 . HD2  1 1 
       1948 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1948 1 2 1 1  49 ARG QD   .  46 . HD*  1 1 
       1949 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1949 1 2 1 1  49 ARG HD3  .  46 . HD1  1 1 
       1950 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1950 1 2 1 1  49 ARG HG2  .  46 . HG2  1 1 
       1951 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1951 1 2 1 1  49 ARG QG   .  46 . HG*  1 1 
       1952 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1952 1 2 1 1  49 ARG HG3  .  46 . HG1  1 1 
       1953 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1953 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1954 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1954 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1955 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1955 1 2 1 1  81 GLU H    .  78 . HN   1 1 
       1956 1 1 1 1  49 ARG HA   .  46 . HA   1 1 
       1956 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       1957 1 1 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1957 1 2 1 1  49 ARG HD2  .  46 . HD2  1 1 
       1958 1 1 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1958 1 2 1 1  49 ARG HD3  .  46 . HD1  1 1 
       1959 1 1 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1959 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1960 1 1 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1960 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       1961 1 1 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1961 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       1962 1 1 1 1  49 ARG HB2  .  46 . HB2  1 1 
       1962 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1963 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1963 1 2 1 1  49 ARG HD2  .  46 . HD2  1 1 
       1964 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1964 1 2 1 1  49 ARG QD   .  46 . HD*  1 1 
       1965 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1965 1 2 1 1  49 ARG HD3  .  46 . HD1  1 1 
       1966 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1966 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1967 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1967 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       1968 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1968 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       1969 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1969 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1970 1 1 1 1  49 ARG HB3  .  46 . HB1  1 1 
       1970 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       1971 1 1 1 1  49 ARG QD   .  46 . HD*  1 1 
       1971 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1972 1 1 1 1  49 ARG QD   .  46 . HD*  1 1 
       1972 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       1973 1 1 1 1  49 ARG QD   .  46 . HD*  1 1 
       1973 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       1974 1 1 1 1  49 ARG QD   .  46 . HD*  1 1 
       1974 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1975 1 1 1 1  49 ARG QG   .  46 . HG*  1 1 
       1975 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       1976 1 1 1 1  49 ARG HG2  .  46 . HG2  1 1 
       1976 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1977 1 1 1 1  49 ARG HG3  .  46 . HG1  1 1 
       1977 1 2 1 1  50 GLU H    .  47 . HN   1 1 
       1978 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1978 1 2 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1979 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1979 1 2 1 1  50 GLU HB3  .  47 . HB1  1 1 
       1980 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1980 1 2 1 1  50 GLU QG   .  47 . HG*  1 1 
       1981 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1981 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1982 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1982 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       1983 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1983 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       1984 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1984 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       1985 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1985 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1986 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1986 1 2 1 1  80 VAL HB   .  77 . HB   1 1 
       1987 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1987 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       1988 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1988 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       1989 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1989 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       1990 1 1 1 1  50 GLU H    .  47 . HN   1 1 
       1990 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       1991 1 1 1 1  50 GLU HA   .  47 . HA   1 1 
       1991 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1992 1 1 1 1  50 GLU HA   .  47 . HA   1 1 
       1992 1 2 1 1  51 ASN HA   .  48 . HA   1 1 
       1993 1 1 1 1  50 GLU HA   .  47 . HA   1 1 
       1993 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1994 1 1 1 1  50 GLU HA   .  47 . HA   1 1 
       1994 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       1995 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1995 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       1996 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1996 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       1997 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1997 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       1998 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1998 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       1999 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       1999 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2000 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       2000 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2001 1 1 1 1  50 GLU HB2  .  47 . HB2  1 1 
       2001 1 2 1 1  85 ILE HG13 .  82 . HG11 1 1 
       2002 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2002 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       2003 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2003 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       2004 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2004 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2005 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2005 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2006 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2006 1 2 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2007 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2007 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2008 1 1 1 1  50 GLU HB3  .  47 . HB1  1 1 
       2008 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2009 1 1 1 1  50 GLU QG   .  47 . HG*  1 1 
       2009 1 2 1 1  51 ASN H    .  48 . HN   1 1 
       2010 1 1 1 1  50 GLU QG   .  47 . HG*  1 1 
       2010 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       2011 1 1 1 1  50 GLU QG   .  47 . HG*  1 1 
       2011 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2012 1 1 1 1  50 GLU QG   .  47 . HG*  1 1 
       2012 1 2 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2013 1 1 1 1  51 ASN H    .  48 . HN   1 1 
       2013 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       2014 1 1 1 1  51 ASN H    .  48 . HN   1 1 
       2014 1 2 1 1  51 ASN HD22 .  48 . HD22 1 1 
       2015 1 1 1 1  51 ASN H    .  48 . HN   1 1 
       2015 1 2 1 1  52 LEU H    .  49 . HN   1 1 
       2016 1 1 1 1  51 ASN H    .  48 . HN   1 1 
       2016 1 2 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2017 1 1 1 1  51 ASN H    .  48 . HN   1 1 
       2017 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2018 1 1 1 1  51 ASN H    .  48 . HN   1 1 
       2018 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2019 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2019 1 2 1 1  51 ASN HD21 .  48 . HD21 1 1 
       2020 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2020 1 2 1 1  51 ASN HD22 .  48 . HD22 1 1 
       2021 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2021 1 2 1 1  52 LEU H    .  49 . HN   1 1 
       2022 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2022 1 2 1 1  52 LEU HA   .  49 . HA   1 1 
       2023 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2023 1 2 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2024 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2024 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2025 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2025 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2026 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2026 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2027 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2027 1 2 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2028 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2028 1 2 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2029 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2029 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2030 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2030 1 2 1 1  78 ALA HA   .  75 . HA   1 1 
       2031 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2031 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2032 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2032 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       2033 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2033 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2034 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2034 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2035 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2035 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2036 1 1 1 1  51 ASN HA   .  48 . HA   1 1 
       2036 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2037 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2037 1 2 1 1  52 LEU H    .  49 . HN   1 1 
       2038 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2038 1 2 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2039 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2039 1 2 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2040 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2040 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2041 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2041 1 2 1 1  78 ALA HA   .  75 . HA   1 1 
       2042 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2042 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2043 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2043 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       2044 1 1 1 1  51 ASN QB   .  48 . HB*  1 1 
       2044 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2045 1 1 1 1  51 ASN HB2  .  48 . HB2  1 1 
       2045 1 2 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2046 1 1 1 1  51 ASN HB3  .  48 . HB1  1 1 
       2046 1 2 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2047 1 1 1 1  51 ASN HD21 .  48 . HD21 1 1 
       2047 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2048 1 1 1 1  51 ASN HD22 .  48 . HD22 1 1 
       2048 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2049 1 1 1 1  51 ASN HD22 .  48 . HD22 1 1 
       2049 1 2 1 1  78 ALA HA   .  75 . HA   1 1 
       2050 1 1 1 1  51 ASN HD22 .  48 . HD22 1 1 
       2050 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2051 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2051 1 2 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2052 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2052 1 2 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2053 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2053 1 2 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2054 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2054 1 2 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2055 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2055 1 2 1 1  52 LEU HG   .  49 . HG   1 1 
       2056 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2056 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2057 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2057 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2058 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2058 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2059 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2059 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2060 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2060 1 2 1 1  77 LEU HA   .  74 . HA   1 1 
       2061 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2061 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2062 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2062 1 2 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2063 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2063 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2064 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2064 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2065 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2065 1 2 1 1  78 ALA HA   .  75 . HA   1 1 
       2066 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2066 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2067 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2067 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2068 1 1 1 1  52 LEU H    .  49 . HN   1 1 
       2068 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2069 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2069 1 2 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2070 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2070 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       2071 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2071 1 2 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2072 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2072 1 2 1 1  52 LEU HG   .  49 . HG   1 1 
       2073 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2073 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2074 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2074 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       2075 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2075 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2076 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2076 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2077 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2077 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2078 1 1 1 1  52 LEU HA   .  49 . HA   1 1 
       2078 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       2079 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2079 1 2 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2080 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2080 1 2 1 1  52 LEU QD   .  49 . HD*  1 1 
       2081 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2081 1 2 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2082 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2082 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2083 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2083 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2084 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2084 1 2 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2085 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2085 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2086 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2086 1 2 1 1  77 LEU HA   .  74 . HA   1 1 
       2087 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2087 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2088 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2088 1 2 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2089 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2089 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2090 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2090 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2091 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2091 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2092 1 1 1 1  52 LEU HB2  .  49 . HB2  1 1 
       2092 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2093 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2093 1 2 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2094 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2094 1 2 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2095 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2095 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2096 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2096 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2097 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2097 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2098 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2098 1 2 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2099 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2099 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2100 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2100 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2101 1 1 1 1  52 LEU HB3  .  49 . HB1  1 1 
       2101 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2102 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2102 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2103 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2103 1 2 1 1  53 TYR HA   .  50 . HA   1 1 
       2104 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2104 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       2105 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2105 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2106 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2106 1 2 1 1  76 ARG HA   .  73 . HA   1 1 
       2107 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2107 1 2 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2108 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2108 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2109 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2109 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2110 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2110 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2111 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2111 1 2 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2112 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2112 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2113 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2113 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       2114 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2114 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2115 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2115 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2116 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2116 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       2117 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2117 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       2118 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2118 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       2119 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2119 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       2120 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2120 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       2121 1 1 1 1  52 LEU QD   .  49 . HD*  1 1 
       2121 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       2122 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2122 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2123 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2123 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2124 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2124 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2125 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2125 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2126 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2126 1 2 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2127 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2127 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2128 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2128 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2129 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2129 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2130 1 1 1 1  52 LEU MD1  .  49 . HD1* 1 1 
       2130 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       2131 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2131 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2132 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2132 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2133 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2133 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2134 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2134 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2135 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2135 1 2 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2136 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2136 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2137 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2137 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2138 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2138 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2139 1 1 1 1  52 LEU MD2  .  49 . HD2* 1 1 
       2139 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       2140 1 1 1 1  52 LEU HG   .  49 . HG   1 1 
       2140 1 2 1 1  53 TYR H    .  50 . HN   1 1 
       2141 1 1 1 1  52 LEU HG   .  49 . HG   1 1 
       2141 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2142 1 1 1 1  52 LEU HG   .  49 . HG   1 1 
       2142 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2143 1 1 1 1  52 LEU HG   .  49 . HG   1 1 
       2143 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2144 1 1 1 1  52 LEU HG   .  49 . HG   1 1 
       2144 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       2145 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2145 1 2 1 1  53 TYR HB2  .  50 . HB2  1 1 
       2146 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2146 1 2 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2147 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2147 1 2 1 1  53 TYR HD2  .  50 . HD2  1 1 
       2148 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2148 1 2 1 1  54 GLY H    .  51 . HN   1 1 
       2149 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2149 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2150 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2150 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2151 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2151 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2152 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2152 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2153 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2153 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2154 1 1 1 1  53 TYR H    .  50 . HN   1 1 
       2154 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2155 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2155 1 2 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2156 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2156 1 2 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2157 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2157 1 2 1 1  54 GLY H    .  51 . HN   1 1 
       2158 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2158 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2159 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2159 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2160 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2160 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2161 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2161 1 2 1 1  75 THR HA   .  72 . HA   1 1 
       2162 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2162 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2163 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2163 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2164 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2164 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2165 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2165 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2166 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2166 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2167 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2167 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       2168 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2168 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2169 1 1 1 1  53 TYR HA   .  50 . HA   1 1 
       2169 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       2170 1 1 1 1  53 TYR HB2  .  50 . HB2  1 1 
       2170 1 2 1 1  54 GLY H    .  51 . HN   1 1 
       2171 1 1 1 1  53 TYR HB2  .  50 . HB2  1 1 
       2171 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2172 1 1 1 1  53 TYR HB2  .  50 . HB2  1 1 
       2172 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       2173 1 1 1 1  53 TYR HB2  .  50 . HB2  1 1 
       2173 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2174 1 1 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2174 1 2 1 1  54 GLY H    .  51 . HN   1 1 
       2175 1 1 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2175 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2176 1 1 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2176 1 2 1 1  73 PHE HE2  .  70 . HE2  1 1 
       2177 1 1 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2177 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2178 1 1 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2178 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       2179 1 1 1 1  53 TYR HB3  .  50 . HB1  1 1 
       2179 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2180 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2180 1 2 1 1  54 GLY H    .  51 . HN   1 1 
       2181 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2181 1 2 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2182 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2182 1 2 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2183 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2183 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2184 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2184 1 2 1 1  74 GLU HA   .  71 . HA   1 1 
       2185 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2185 1 2 1 1  75 THR H    .  72 . HN   1 1 
       2186 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2186 1 2 1 1  75 THR HA   .  72 . HA   1 1 
       2187 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2187 1 2 1 1  75 THR HB   .  72 . HB   1 1 
       2188 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2188 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2189 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2189 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2190 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2190 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       2191 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2191 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2192 1 1 1 1  53 TYR HD1  .  50 . HD1  1 1 
       2192 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       2193 1 1 1 1  53 TYR HD2  .  50 . HD2  1 1 
       2193 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       2194 1 1 1 1  53 TYR HD2  .  50 . HD2  1 1 
       2194 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       2195 1 1 1 1  53 TYR HD2  .  50 . HD2  1 1 
       2195 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       2196 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2196 1 2 1 1  75 THR HA   .  72 . HA   1 1 
       2197 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2197 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2198 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2198 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2199 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2199 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       2200 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2200 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       2201 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2201 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2202 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2202 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       2203 1 1 1 1  53 TYR HE1  .  50 . HE1  1 1 
       2203 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       2204 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2204 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       2205 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2205 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       2206 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2206 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       2207 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2207 1 2 1 1 109 ILE HG12 . 106 . HG12 1 1 
       2208 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2208 1 2 1 1 109 ILE HG13 . 106 . HG11 1 1 
       2209 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2209 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       2210 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2210 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       2211 1 1 1 1  53 TYR HE2  .  50 . HE2  1 1 
       2211 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       2212 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2212 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       2213 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2213 1 2 1 1  56 ALA MB   .  53 . HB*  1 1 
       2214 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2214 1 2 1 1  73 PHE HA   .  70 . HA   1 1 
       2215 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2215 1 2 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2216 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2216 1 2 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2217 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2217 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2218 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2218 1 2 1 1  74 GLU HA   .  71 . HA   1 1 
       2219 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2219 1 2 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2220 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2220 1 2 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2221 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2221 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2222 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2222 1 2 1 1  75 THR HA   .  72 . HA   1 1 
       2223 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2223 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2224 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2224 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2225 1 1 1 1  54 GLY H    .  51 . HN   1 1 
       2225 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2226 1 1 1 1  54 GLY QA   .  51 . HA*  1 1 
       2226 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       2227 1 1 1 1  54 GLY QA   .  51 . HA*  1 1 
       2227 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2228 1 1 1 1  54 GLY QA   .  51 . HA*  1 1 
       2228 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2229 1 1 1 1  54 GLY QA   .  51 . HA*  1 1 
       2229 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2230 1 1 1 1  54 GLY QA   .  51 . HA*  1 1 
       2230 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       2231 1 1 1 1  54 GLY HA2  .  51 . HA2  1 1 
       2231 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       2232 1 1 1 1  54 GLY HA2  .  51 . HA2  1 1 
       2232 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       2233 1 1 1 1  54 GLY HA3  .  51 . HA1  1 1 
       2233 1 2 1 1  55 PRO QD   .  52 . HD*  1 1 
       2234 1 1 1 1  54 GLY HA3  .  51 . HA1  1 1 
       2234 1 2 1 1  55 PRO QG   .  52 . HG*  1 1 
       2235 1 1 1 1  55 PRO HA   .  52 . HA   1 1 
       2235 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2236 1 1 1 1  55 PRO HA   .  52 . HA   1 1 
       2236 1 2 1 1  56 ALA HA   .  53 . HA   1 1 
       2237 1 1 1 1  55 PRO HA   .  52 . HA   1 1 
       2237 1 2 1 1  56 ALA MB   .  53 . HB*  1 1 
       2238 1 1 1 1  55 PRO HA   .  52 . HA   1 1 
       2238 1 2 1 1  73 PHE HA   .  70 . HA   1 1 
       2239 1 1 1 1  55 PRO HA   .  52 . HA   1 1 
       2239 1 2 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2240 1 1 1 1  55 PRO HA   .  52 . HA   1 1 
       2240 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2241 1 1 1 1  55 PRO QB   .  52 . HB*  1 1 
       2241 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2242 1 1 1 1  55 PRO HB2  .  52 . HB2  1 1 
       2242 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2243 1 1 1 1  55 PRO HB3  .  52 . HB1  1 1 
       2243 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2244 1 1 1 1  55 PRO QD   .  52 . HD*  1 1 
       2244 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2245 1 1 1 1  55 PRO QG   .  52 . HG*  1 1 
       2245 1 2 1 1  56 ALA H    .  53 . HN   1 1 
       2246 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2246 1 2 1 1  56 ALA MB   .  53 . HB*  1 1 
       2247 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2247 1 2 1 1  57 PRO HD2  .  54 . HD2  1 1 
       2248 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2248 1 2 1 1  57 PRO QD   .  54 . HD*  1 1 
       2249 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2249 1 2 1 1  57 PRO HD3  .  54 . HD1  1 1 
       2250 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2250 1 2 1 1  71 ARG HB2  .  68 . HB2  1 1 
       2251 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2251 1 2 1 1  71 ARG QD   .  68 . HD*  1 1 
       2252 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2252 1 2 1 1  71 ARG HG3  .  68 . HG1  1 1 
       2253 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2253 1 2 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2254 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2254 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2255 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2255 1 2 1 1  73 PHE HA   .  70 . HA   1 1 
       2256 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2256 1 2 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2257 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2257 1 2 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2258 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2258 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2259 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2259 1 2 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2260 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2260 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2261 1 1 1 1  56 ALA H    .  53 . HN   1 1 
       2261 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2262 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2262 1 2 1 1  57 PRO HD2  .  54 . HD2  1 1 
       2263 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2263 1 2 1 1  57 PRO QD   .  54 . HD*  1 1 
       2264 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2264 1 2 1 1  57 PRO HD3  .  54 . HD1  1 1 
       2265 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2265 1 2 1 1  57 PRO QG   .  54 . HG*  1 1 
       2266 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2266 1 2 1 1  73 PHE HA   .  70 . HA   1 1 
       2267 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2267 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2268 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2268 1 2 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2269 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2269 1 2 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2270 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2270 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2271 1 1 1 1  56 ALA HA   .  53 . HA   1 1 
       2271 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2272 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2272 1 2 1 1  57 PRO HA   .  54 . HA   1 1 
       2273 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2273 1 2 1 1  57 PRO QB   .  54 . HB*  1 1 
       2274 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2274 1 2 1 1  57 PRO HD2  .  54 . HD2  1 1 
       2275 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2275 1 2 1 1  57 PRO HD3  .  54 . HD1  1 1 
       2276 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2276 1 2 1 1  57 PRO QG   .  54 . HG*  1 1 
       2277 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2277 1 2 1 1  71 ARG HB2  .  68 . HB2  1 1 
       2278 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2278 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2279 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2279 1 2 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2280 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2280 1 2 1 1  72 ARG QD   .  69 . HD*  1 1 
       2281 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2281 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2282 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2282 1 2 1 1  73 PHE HA   .  70 . HA   1 1 
       2283 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2283 1 2 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2284 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2284 1 2 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2285 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2285 1 2 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2286 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2286 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2287 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2287 1 2 1 1  74 GLU HA   .  71 . HA   1 1 
       2288 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2288 1 2 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2289 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2289 1 2 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2290 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2290 1 2 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2291 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2291 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       2292 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2292 1 2 1 1 116 VAL HA   . 113 . HA   1 1 
       2293 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2293 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2294 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2294 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2295 1 1 1 1  56 ALA MB   .  53 . HB*  1 1 
       2295 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2296 1 1 1 1  57 PRO HA   .  54 . HA   1 1 
       2296 1 2 1 1  58 GLN H    .  55 . HN   1 1 
       2297 1 1 1 1  57 PRO QB   .  54 . HB*  1 1 
       2297 1 2 1 1  58 GLN H    .  55 . HN   1 1 
       2298 1 1 1 1  57 PRO QD   .  54 . HD*  1 1 
       2298 1 2 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2299 1 1 1 1  57 PRO QD   .  54 . HD*  1 1 
       2299 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2300 1 1 1 1  57 PRO QG   .  54 . HG*  1 1 
       2300 1 2 1 1  58 GLN H    .  55 . HN   1 1 
       2301 1 1 1 1  57 PRO QG   .  54 . HG*  1 1 
       2301 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2302 1 1 1 1  57 PRO QG   .  54 . HG*  1 1 
       2302 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2303 1 1 1 1  57 PRO QG   .  54 . HG*  1 1 
       2303 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2304 1 1 1 1  58 GLN H    .  55 . HN   1 1 
       2304 1 2 1 1  58 GLN QB   .  55 . HB*  1 1 
       2305 1 1 1 1  58 GLN H    .  55 . HN   1 1 
       2305 1 2 1 1  58 GLN QG   .  55 . HG*  1 1 
       2306 1 1 1 1  58 GLN H    .  55 . HN   1 1 
       2306 1 2 1 1  59 SER H    .  56 . HN   1 1 
       2307 1 1 1 1  58 GLN H    .  55 . HN   1 1 
       2307 1 2 1 1  59 SER HA   .  56 . HA   1 1 
       2308 1 1 1 1  58 GLN HA   .  55 . HA   1 1 
       2308 1 2 1 1  58 GLN QE   .  55 . HE2* 1 1 
       2309 1 1 1 1  58 GLN HA   .  55 . HA   1 1 
       2309 1 2 1 1  58 GLN QG   .  55 . HG*  1 1 
       2310 1 1 1 1  58 GLN HA   .  55 . HA   1 1 
       2310 1 2 1 1  59 SER HA   .  56 . HA   1 1 
       2311 1 1 1 1  58 GLN HA   .  55 . HA   1 1 
       2311 1 2 1 1  59 SER HB2  .  56 . HB2  1 1 
       2312 1 1 1 1  58 GLN HA   .  55 . HA   1 1 
       2312 1 2 1 1  59 SER HB3  .  56 . HB1  1 1 
       2313 1 1 1 1  58 GLN HA   .  55 . HA   1 1 
       2313 1 2 1 1  60 PHE QD   .  57 . HD2  1 1 
       2314 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2314 1 2 1 1  58 GLN HE21 .  55 . HE21 1 1 
       2315 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2315 1 2 1 1  58 GLN HE22 .  55 . HE22 1 1 
       2316 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2316 1 2 1 1  58 GLN QG   .  55 . HG*  1 1 
       2317 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2317 1 2 1 1  59 SER H    .  56 . HN   1 1 
       2318 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2318 1 2 1 1  60 PHE QD   .  57 . HD2  1 1 
       2319 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2319 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2320 1 1 1 1  58 GLN QB   .  55 . HB*  1 1 
       2320 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2321 1 1 1 1  58 GLN QE   .  55 . HE2* 1 1 
       2321 1 2 1 1  60 PHE QB   .  57 . HB*  1 1 
       2322 1 1 1 1  58 GLN QE   .  55 . HE2* 1 1 
       2322 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2323 1 1 1 1  58 GLN QE   .  55 . HE2* 1 1 
       2323 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2324 1 1 1 1  58 GLN HE21 .  55 . HE21 1 1 
       2324 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2325 1 1 1 1  58 GLN HE22 .  55 . HE22 1 1 
       2325 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2326 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2326 1 2 1 1  59 SER H    .  56 . HN   1 1 
       2327 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2327 1 2 1 1  59 SER HB2  .  56 . HB2  1 1 
       2328 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2328 1 2 1 1  59 SER HB3  .  56 . HB1  1 1 
       2329 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2329 1 2 1 1  60 PHE QD   .  57 . HD2  1 1 
       2330 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2330 1 2 1 1  60 PHE HE2  .  57 . HE2  1 1 
       2331 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2331 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2332 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2332 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2333 1 1 1 1  58 GLN QG   .  55 . HG*  1 1 
       2333 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2334 1 1 1 1  59 SER H    .  56 . HN   1 1 
       2334 1 2 1 1  60 PHE H    .  57 . HN   1 1 
       2335 1 1 1 1  59 SER HA   .  56 . HA   1 1 
       2335 1 2 1 1  60 PHE H    .  57 . HN   1 1 
       2336 1 1 1 1  59 SER HA   .  56 . HA   1 1 
       2336 1 2 1 1  60 PHE HA   .  57 . HA   1 1 
       2337 1 1 1 1  59 SER HA   .  56 . HA   1 1 
       2337 1 2 1 1  60 PHE QB   .  57 . HB*  1 1 
       2338 1 1 1 1  59 SER HA   .  56 . HA   1 1 
       2338 1 2 1 1  60 PHE QD   .  57 . HD2  1 1 
       2339 1 1 1 1  59 SER HB2  .  56 . HB2  1 1 
       2339 1 2 1 1  60 PHE H    .  57 . HN   1 1 
       2340 1 1 1 1  59 SER HB3  .  56 . HB1  1 1 
       2340 1 2 1 1  60 PHE H    .  57 . HN   1 1 
       2341 1 1 1 1  60 PHE H    .  57 . HN   1 1 
       2341 1 2 1 1  60 PHE QD   .  57 . HD2  1 1 
       2342 1 1 1 1  60 PHE H    .  57 . HN   1 1 
       2342 1 2 1 1  61 ALA MB   .  58 . HB*  1 1 
       2343 1 1 1 1  60 PHE HA   .  57 . HA   1 1 
       2343 1 2 1 1  60 PHE QD   .  57 . HD1  1 1 
       2344 1 1 1 1  60 PHE HA   .  57 . HA   1 1 
       2344 1 2 1 1  61 ALA H    .  58 . HN   1 1 
       2345 1 1 1 1  60 PHE HA   .  57 . HA   1 1 
       2345 1 2 1 1  61 ALA HA   .  58 . HA   1 1 
       2346 1 1 1 1  60 PHE HA   .  57 . HA   1 1 
       2346 1 2 1 1  61 ALA MB   .  58 . HB*  1 1 
       2347 1 1 1 1  60 PHE HA   .  57 . HA   1 1 
       2347 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2348 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2348 1 2 1 1  60 PHE HE1  .  57 . HE1  1 1 
       2349 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2349 1 2 1 1  60 PHE HE2  .  57 . HE2  1 1 
       2350 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2350 1 2 1 1  61 ALA H    .  58 . HN   1 1 
       2351 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2351 1 2 1 1  61 ALA MB   .  58 . HB*  1 1 
       2352 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2352 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2353 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2353 1 2 1 1  63 ASP HA   .  60 . HA   1 1 
       2354 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2354 1 2 1 1  65 ASP H    .  62 . HN   1 1 
       2355 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2355 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2356 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2356 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2357 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2357 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2358 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2358 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2359 1 1 1 1  60 PHE QB   .  57 . HB*  1 1 
       2359 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2360 1 1 1 1  60 PHE HB2  .  57 . HB2  1 1 
       2360 1 2 1 1  61 ALA H    .  58 . HN   1 1 
       2361 1 1 1 1  60 PHE HB2  .  57 . HB2  1 1 
       2361 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2362 1 1 1 1  60 PHE HB2  .  57 . HB2  1 1 
       2362 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2363 1 1 1 1  60 PHE HB3  .  57 . HB1  1 1 
       2363 1 2 1 1  61 ALA H    .  58 . HN   1 1 
       2364 1 1 1 1  60 PHE HB3  .  57 . HB1  1 1 
       2364 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2365 1 1 1 1  60 PHE HB3  .  57 . HB1  1 1 
       2365 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2366 1 1 1 1  60 PHE QD   .  57 . HD1  1 1 
       2366 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2367 1 1 1 1  60 PHE QD   .  57 . HD1  1 1 
       2367 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2368 1 1 1 1  60 PHE QD   .  57 . HD2  1 1 
       2368 1 2 1 1  66 ILE HA   .  63 . HA   1 1 
       2369 1 1 1 1  60 PHE QD   .  57 . HD1  1 1 
       2369 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2370 1 1 1 1  60 PHE QD   .  57 . HD1  1 1 
       2370 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2371 1 1 1 1  60 PHE QD   .  57 . HD2  1 1 
       2371 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2372 1 1 1 1  60 PHE HE1  .  57 . HE1  1 1 
       2372 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2373 1 1 1 1  60 PHE HE2  .  57 . HE2  1 1 
       2373 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2374 1 1 1 1  60 PHE HE2  .  57 . HE2  1 1 
       2374 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2375 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2375 1 2 1 1  61 ALA MB   .  58 . HB*  1 1 
       2376 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2376 1 2 1 1  63 ASP HA   .  60 . HA   1 1 
       2377 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2377 1 2 1 1  64 GLU H    .  61 . HN   1 1 
       2378 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2378 1 2 1 1  64 GLU HB2  .  61 . HB2  1 1 
       2379 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2379 1 2 1 1  64 GLU QB   .  61 . HB*  1 1 
       2380 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2380 1 2 1 1  64 GLU HB3  .  61 . HB1  1 1 
       2381 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2381 1 2 1 1  65 ASP H    .  62 . HN   1 1 
       2382 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2382 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2383 1 1 1 1  61 ALA H    .  58 . HN   1 1 
       2383 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2384 1 1 1 1  61 ALA HA   .  58 . HA   1 1 
       2384 1 2 1 1  62 ASP H    .  59 . HN   1 1 
       2385 1 1 1 1  61 ALA HA   .  58 . HA   1 1 
       2385 1 2 1 1  62 ASP HA   .  59 . HA   1 1 
       2386 1 1 1 1  61 ALA HA   .  58 . HA   1 1 
       2386 1 2 1 1  62 ASP HB2  .  59 . HB2  1 1 
       2387 1 1 1 1  61 ALA HA   .  58 . HA   1 1 
       2387 1 2 1 1  62 ASP HB3  .  59 . HB1  1 1 
       2388 1 1 1 1  61 ALA HA   .  58 . HA   1 1 
       2388 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2389 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2389 1 2 1 1  62 ASP H    .  59 . HN   1 1 
       2390 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2390 1 2 1 1  62 ASP HA   .  59 . HA   1 1 
       2391 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2391 1 2 1 1  62 ASP HB2  .  59 . HB2  1 1 
       2392 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2392 1 2 1 1  62 ASP HB3  .  59 . HB1  1 1 
       2393 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2393 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2394 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2394 1 2 1 1  64 GLU H    .  61 . HN   1 1 
       2395 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2395 1 2 1 1  64 GLU QB   .  61 . HB*  1 1 
       2396 1 1 1 1  61 ALA MB   .  58 . HB*  1 1 
       2396 1 2 1 1  64 GLU QG   .  61 . HG*  1 1 
       2397 1 1 1 1  62 ASP H    .  59 . HN   1 1 
       2397 1 2 1 1  62 ASP HB2  .  59 . HB2  1 1 
       2398 1 1 1 1  62 ASP H    .  59 . HN   1 1 
       2398 1 2 1 1  62 ASP HB3  .  59 . HB1  1 1 
       2399 1 1 1 1  62 ASP H    .  59 . HN   1 1 
       2399 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2400 1 1 1 1  62 ASP HA   .  59 . HA   1 1 
       2400 1 2 1 1  62 ASP HB2  .  59 . HB2  1 1 
       2401 1 1 1 1  62 ASP HA   .  59 . HA   1 1 
       2401 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2402 1 1 1 1  62 ASP HB3  .  59 . HB1  1 1 
       2402 1 2 1 1  63 ASP H    .  60 . HN   1 1 
       2403 1 1 1 1  62 ASP HB3  .  59 . HB1  1 1 
       2403 1 2 1 1  64 GLU QB   .  61 . HB*  1 1 
       2404 1 1 1 1  62 ASP HB3  .  59 . HB1  1 1 
       2404 1 2 1 1  64 GLU QG   .  61 . HG*  1 1 
       2405 1 1 1 1  63 ASP H    .  60 . HN   1 1 
       2405 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2406 1 1 1 1  63 ASP H    .  60 . HN   1 1 
       2406 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2407 1 1 1 1  63 ASP H    .  60 . HN   1 1 
       2407 1 2 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2408 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2408 1 2 1 1  64 GLU H    .  61 . HN   1 1 
       2409 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2409 1 2 1 1  64 GLU HA   .  61 . HA   1 1 
       2410 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2410 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2411 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2411 1 2 1 1  66 ILE HA   .  63 . HA   1 1 
       2412 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2412 1 2 1 1  66 ILE HB   .  63 . HB   1 1 
       2413 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2413 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2414 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2414 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2415 1 1 1 1  63 ASP HA   .  60 . HA   1 1 
       2415 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2416 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2416 1 2 1 1  64 GLU H    .  61 . HN   1 1 
       2417 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2417 1 2 1 1  64 GLU HA   .  61 . HA   1 1 
       2418 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2418 1 2 1 1  64 GLU QG   .  61 . HG*  1 1 
       2419 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2419 1 2 1 1  66 ILE HB   .  63 . HB   1 1 
       2420 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2420 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2421 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2421 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2422 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2422 1 2 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2423 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2423 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2424 1 1 1 1  63 ASP QB   .  60 . HB*  1 1 
       2424 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2425 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2425 1 2 1 1  64 GLU QB   .  61 . HB*  1 1 
       2426 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2426 1 2 1 1  64 GLU HG2  .  61 . HG2  1 1 
       2427 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2427 1 2 1 1  64 GLU QG   .  61 . HG*  1 1 
       2428 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2428 1 2 1 1  64 GLU HG3  .  61 . HG1  1 1 
       2429 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2429 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2430 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2430 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2431 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2431 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2432 1 1 1 1  64 GLU H    .  61 . HN   1 1 
       2432 1 2 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2433 1 1 1 1  64 GLU HA   .  61 . HA   1 1 
       2433 1 2 1 1  64 GLU HG2  .  61 . HG2  1 1 
       2434 1 1 1 1  64 GLU HA   .  61 . HA   1 1 
       2434 1 2 1 1  64 GLU HG3  .  61 . HG1  1 1 
       2435 1 1 1 1  64 GLU HA   .  61 . HA   1 1 
       2435 1 2 1 1  65 ASP HA   .  62 . HA   1 1 
       2436 1 1 1 1  64 GLU HA   .  61 . HA   1 1 
       2436 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2437 1 1 1 1  64 GLU HA   .  61 . HA   1 1 
       2437 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2438 1 1 1 1  64 GLU HA   .  61 . HA   1 1 
       2438 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2439 1 1 1 1  64 GLU QB   .  61 . HB*  1 1 
       2439 1 2 1 1  65 ASP H    .  62 . HN   1 1 
       2440 1 1 1 1  64 GLU QB   .  61 . HB*  1 1 
       2440 1 2 1 1  65 ASP HA   .  62 . HA   1 1 
       2441 1 1 1 1  64 GLU QB   .  61 . HB*  1 1 
       2441 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2442 1 1 1 1  64 GLU QB   .  61 . HB*  1 1 
       2442 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2443 1 1 1 1  64 GLU HB2  .  61 . HB2  1 1 
       2443 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2444 1 1 1 1  64 GLU HB3  .  61 . HB1  1 1 
       2444 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2445 1 1 1 1  64 GLU QG   .  61 . HG*  1 1 
       2445 1 2 1 1  65 ASP H    .  62 . HN   1 1 
       2446 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2446 1 2 1 1  65 ASP QB   .  62 . HB*  1 1 
       2447 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2447 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2448 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2448 1 2 1 1  66 ILE HA   .  63 . HA   1 1 
       2449 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2449 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2450 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2450 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2451 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2451 1 2 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2452 1 1 1 1  65 ASP H    .  62 . HN   1 1 
       2452 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2453 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2453 1 2 1 1  66 ILE HA   .  63 . HA   1 1 
       2454 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2454 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2455 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2455 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2456 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2456 1 2 1 1  68 ARG HA   .  65 . HA   1 1 
       2457 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2457 1 2 1 1  68 ARG HB2  .  65 . HB2  1 1 
       2458 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2458 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2459 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2459 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2460 1 1 1 1  65 ASP HA   .  62 . HA   1 1 
       2460 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2461 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2461 1 2 1 1  66 ILE H    .  63 . HN   1 1 
       2462 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2462 1 2 1 1  66 ILE HA   .  63 . HA   1 1 
       2463 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2463 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2464 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2464 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2465 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2465 1 2 1 1  68 ARG HB2  .  65 . HB2  1 1 
       2466 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2466 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2467 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2467 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2468 1 1 1 1  65 ASP QB   .  62 . HB*  1 1 
       2468 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2469 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2469 1 2 1 1  66 ILE HB   .  63 . HB   1 1 
       2470 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2470 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2471 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2471 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2472 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2472 1 2 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2473 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2473 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2474 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2474 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2475 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2475 1 2 1 1  67 MET HA   .  64 . HA   1 1 
       2476 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2476 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2477 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2477 1 2 1 1  67 MET QG   .  64 . HG*  1 1 
       2478 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2478 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2479 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2479 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2480 1 1 1 1  66 ILE H    .  63 . HN   1 1 
       2480 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2481 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2481 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2482 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2482 1 2 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2483 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2483 1 2 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2484 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2484 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2485 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2485 1 2 1 1  67 MET HA   .  64 . HA   1 1 
       2486 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2486 1 2 1 1  67 MET QB   .  64 . HB*  1 1 
       2487 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2487 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2488 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2488 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2489 1 1 1 1  66 ILE HA   .  63 . HA   1 1 
       2489 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2490 1 1 1 1  66 ILE HB   .  63 . HB   1 1 
       2490 1 2 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2491 1 1 1 1  66 ILE HB   .  63 . HB   1 1 
       2491 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2492 1 1 1 1  66 ILE HB   .  63 . HB   1 1 
       2492 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2493 1 1 1 1  66 ILE HB   .  63 . HB   1 1 
       2493 1 2 1 1  67 MET HG2  .  64 . HG2  1 1 
       2494 1 1 1 1  66 ILE HB   .  63 . HB   1 1 
       2494 1 2 1 1  67 MET HG3  .  64 . HG1  1 1 
       2495 1 1 1 1  66 ILE HB   .  63 . HB   1 1 
       2495 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2496 1 1 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2496 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2497 1 1 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2497 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2498 1 1 1 1  66 ILE MD   .  63 . HD1* 1 1 
       2498 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2499 1 1 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2499 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2500 1 1 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2500 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2501 1 1 1 1  66 ILE HG12 .  63 . HG12 1 1 
       2501 1 2 1 1  67 MET QG   .  64 . HG*  1 1 
       2502 1 1 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2502 1 2 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2503 1 1 1 1  66 ILE HG13 .  63 . HG11 1 1 
       2503 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2504 1 1 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2504 1 2 1 1  67 MET H    .  64 . HN   1 1 
       2505 1 1 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2505 1 2 1 1  67 MET HA   .  64 . HA   1 1 
       2506 1 1 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2506 1 2 1 1  67 MET QB   .  64 . HB*  1 1 
       2507 1 1 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2507 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2508 1 1 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2508 1 2 1 1  67 MET QG   .  64 . HG*  1 1 
       2509 1 1 1 1  66 ILE MG   .  63 . HG2* 1 1 
       2509 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2510 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2510 1 2 1 1  67 MET ME   .  64 . HE*  1 1 
       2511 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2511 1 2 1 1  67 MET HG2  .  64 . HG2  1 1 
       2512 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2512 1 2 1 1  67 MET QG   .  64 . HG*  1 1 
       2513 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2513 1 2 1 1  67 MET HG3  .  64 . HG1  1 1 
       2514 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2514 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2515 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2515 1 2 1 1  68 ARG HB2  .  65 . HB2  1 1 
       2516 1 1 1 1  67 MET H    .  64 . HN   1 1 
       2516 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2517 1 1 1 1  67 MET HA   .  64 . HA   1 1 
       2517 1 2 1 1  67 MET QG   .  64 . HG*  1 1 
       2518 1 1 1 1  67 MET HA   .  64 . HA   1 1 
       2518 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2519 1 1 1 1  67 MET QB   .  64 . HB*  1 1 
       2519 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2520 1 1 1 1  67 MET QB   .  64 . HB*  1 1 
       2520 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2521 1 1 1 1  67 MET QB   .  64 . HB*  1 1 
       2521 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2522 1 1 1 1  67 MET ME   .  64 . HE*  1 1 
       2522 1 2 1 1  67 MET QG   .  64 . HG*  1 1 
       2523 1 1 1 1  67 MET ME   .  64 . HE*  1 1 
       2523 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2524 1 1 1 1  67 MET ME   .  64 . HE*  1 1 
       2524 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2525 1 1 1 1  67 MET ME   .  64 . HE*  1 1 
       2525 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2526 1 1 1 1  67 MET QG   .  64 . HG*  1 1 
       2526 1 2 1 1  68 ARG H    .  65 . HN   1 1 
       2527 1 1 1 1  67 MET QG   .  64 . HG*  1 1 
       2527 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2528 1 1 1 1  67 MET QG   .  64 . HG*  1 1 
       2528 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2529 1 1 1 1  68 ARG H    .  65 . HN   1 1 
       2529 1 2 1 1  68 ARG HB2  .  65 . HB2  1 1 
       2530 1 1 1 1  68 ARG H    .  65 . HN   1 1 
       2530 1 2 1 1  68 ARG HB3  .  65 . HB1  1 1 
       2531 1 1 1 1  68 ARG H    .  65 . HN   1 1 
       2531 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2532 1 1 1 1  68 ARG H    .  65 . HN   1 1 
       2532 1 2 1 1  68 ARG QG   .  65 . HG*  1 1 
       2533 1 1 1 1  68 ARG H    .  65 . HN   1 1 
       2533 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2534 1 1 1 1  68 ARG HA   .  65 . HA   1 1 
       2534 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2535 1 1 1 1  68 ARG HA   .  65 . HA   1 1 
       2535 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2536 1 1 1 1  68 ARG HB2  .  65 . HB2  1 1 
       2536 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2537 1 1 1 1  68 ARG HB2  .  65 . HB2  1 1 
       2537 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2538 1 1 1 1  68 ARG HB3  .  65 . HB1  1 1 
       2538 1 2 1 1  68 ARG QD   .  65 . HD*  1 1 
       2539 1 1 1 1  68 ARG HB3  .  65 . HB1  1 1 
       2539 1 2 1 1  69 ALA H    .  66 . HN   1 1 
       2540 1 1 1 1  68 ARG HB3  .  65 . HB1  1 1 
       2540 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2541 1 1 1 1  69 ALA H    .  66 . HN   1 1 
       2541 1 2 1 1  69 ALA MB   .  66 . HB*  1 1 
       2542 1 1 1 1  69 ALA H    .  66 . HN   1 1 
       2542 1 2 1 1  70 GLU H    .  67 . HN   1 1 
       2543 1 1 1 1  69 ALA HA   .  66 . HA   1 1 
       2543 1 2 1 1  70 GLU H    .  67 . HN   1 1 
       2544 1 1 1 1  69 ALA HA   .  66 . HA   1 1 
       2544 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
       2545 1 1 1 1  69 ALA HA   .  66 . HA   1 1 
       2545 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
       2546 1 1 1 1  69 ALA MB   .  66 . HB*  1 1 
       2546 1 2 1 1  70 GLU H    .  67 . HN   1 1 
       2547 1 1 1 1  69 ALA MB   .  66 . HB*  1 1 
       2547 1 2 1 1  70 GLU HA   .  67 . HA   1 1 
       2548 1 1 1 1  69 ALA MB   .  66 . HB*  1 1 
       2548 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
       2549 1 1 1 1  70 GLU H    .  67 . HN   1 1 
       2549 1 2 1 1  70 GLU HB2  .  67 . HB2  1 1 
       2550 1 1 1 1  70 GLU H    .  67 . HN   1 1 
       2550 1 2 1 1  70 GLU QB   .  67 . HB*  1 1 
       2551 1 1 1 1  70 GLU H    .  67 . HN   1 1 
       2551 1 2 1 1  70 GLU HB3  .  67 . HB1  1 1 
       2552 1 1 1 1  70 GLU H    .  67 . HN   1 1 
       2552 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
       2553 1 1 1 1  70 GLU H    .  67 . HN   1 1 
       2553 1 2 1 1  71 ARG H    .  68 . HN   1 1 
       2554 1 1 1 1  70 GLU HA   .  67 . HA   1 1 
       2554 1 2 1 1  70 GLU QG   .  67 . HG*  1 1 
       2555 1 1 1 1  70 GLU HA   .  67 . HA   1 1 
       2555 1 2 1 1  71 ARG H    .  68 . HN   1 1 
       2556 1 1 1 1  70 GLU HA   .  67 . HA   1 1 
       2556 1 2 1 1  71 ARG HA   .  68 . HA   1 1 
       2557 1 1 1 1  70 GLU HA   .  67 . HA   1 1 
       2557 1 2 1 1  71 ARG HB3  .  68 . HB1  1 1 
       2558 1 1 1 1  70 GLU HA   .  67 . HA   1 1 
       2558 1 2 1 1  71 ARG HG2  .  68 . HG2  1 1 
       2559 1 1 1 1  70 GLU QB   .  67 . HB*  1 1 
       2559 1 2 1 1  71 ARG H    .  68 . HN   1 1 
       2560 1 1 1 1  70 GLU HB2  .  67 . HB2  1 1 
       2560 1 2 1 1  71 ARG H    .  68 . HN   1 1 
       2561 1 1 1 1  70 GLU HB3  .  67 . HB1  1 1 
       2561 1 2 1 1  71 ARG H    .  68 . HN   1 1 
       2562 1 1 1 1  70 GLU QG   .  67 . HG*  1 1 
       2562 1 2 1 1  71 ARG H    .  68 . HN   1 1 
       2563 1 1 1 1  70 GLU QG   .  67 . HG*  1 1 
       2563 1 2 1 1  71 ARG HG2  .  68 . HG2  1 1 
       2564 1 1 1 1  70 GLU QG   .  67 . HG*  1 1 
       2564 1 2 1 1  71 ARG HG3  .  68 . HG1  1 1 
       2565 1 1 1 1  70 GLU QG   .  67 . HG*  1 1 
       2565 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2566 1 1 1 1  71 ARG H    .  68 . HN   1 1 
       2566 1 2 1 1  71 ARG HB2  .  68 . HB2  1 1 
       2567 1 1 1 1  71 ARG H    .  68 . HN   1 1 
       2567 1 2 1 1  71 ARG HB3  .  68 . HB1  1 1 
       2568 1 1 1 1  71 ARG H    .  68 . HN   1 1 
       2568 1 2 1 1  71 ARG HG2  .  68 . HG2  1 1 
       2569 1 1 1 1  71 ARG H    .  68 . HN   1 1 
       2569 1 2 1 1  71 ARG HG3  .  68 . HG1  1 1 
       2570 1 1 1 1  71 ARG H    .  68 . HN   1 1 
       2570 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2571 1 1 1 1  71 ARG HA   .  68 . HA   1 1 
       2571 1 2 1 1  71 ARG HG2  .  68 . HG2  1 1 
       2572 1 1 1 1  71 ARG HA   .  68 . HA   1 1 
       2572 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2573 1 1 1 1  71 ARG HA   .  68 . HA   1 1 
       2573 1 2 1 1  72 ARG HB2  .  69 . HB2  1 1 
       2574 1 1 1 1  71 ARG HB2  .  68 . HB2  1 1 
       2574 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2575 1 1 1 1  71 ARG HB2  .  68 . HB2  1 1 
       2575 1 2 1 1  73 PHE HE1  .  70 . HE1  1 1 
       2576 1 1 1 1  71 ARG HB3  .  68 . HB1  1 1 
       2576 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2577 1 1 1 1  71 ARG QD   .  68 . HD*  1 1 
       2577 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2578 1 1 1 1  71 ARG QD   .  68 . HD*  1 1 
       2578 1 2 1 1  73 PHE HE1  .  70 . HE1  1 1 
       2579 1 1 1 1  71 ARG HG2  .  68 . HG2  1 1 
       2579 1 2 1 1  72 ARG HA   .  69 . HA   1 1 
       2580 1 1 1 1  71 ARG HG2  .  68 . HG2  1 1 
       2580 1 2 1 1  73 PHE HE1  .  70 . HE1  1 1 
       2581 1 1 1 1  71 ARG HG3  .  68 . HG1  1 1 
       2581 1 2 1 1  72 ARG H    .  69 . HN   1 1 
       2582 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2582 1 2 1 1  72 ARG HB2  .  69 . HB2  1 1 
       2583 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2583 1 2 1 1  72 ARG QD   .  69 . HD*  1 1 
       2584 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2584 1 2 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2585 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2585 1 2 1 1  72 ARG HG3  .  69 . HG1  1 1 
       2586 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2586 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2587 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2587 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2588 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2588 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2589 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2589 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2590 1 1 1 1  72 ARG H    .  69 . HN   1 1 
       2590 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2591 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2591 1 2 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2592 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2592 1 2 1 1  72 ARG HG3  .  69 . HG1  1 1 
       2593 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2593 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2594 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2594 1 2 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2595 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2595 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       2596 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2596 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2597 1 1 1 1  72 ARG HA   .  69 . HA   1 1 
       2597 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2598 1 1 1 1  72 ARG HB2  .  69 . HB2  1 1 
       2598 1 2 1 1  72 ARG QD   .  69 . HD*  1 1 
       2599 1 1 1 1  72 ARG HB2  .  69 . HB2  1 1 
       2599 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2600 1 1 1 1  72 ARG HB2  .  69 . HB2  1 1 
       2600 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2601 1 1 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2601 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2602 1 1 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2602 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2603 1 1 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2603 1 2 1 1 116 VAL HA   . 113 . HA   1 1 
       2604 1 1 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2604 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2605 1 1 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2605 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2606 1 1 1 1  72 ARG HB3  .  69 . HB1  1 1 
       2606 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2607 1 1 1 1  72 ARG QD   .  69 . HD*  1 1 
       2607 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2608 1 1 1 1  72 ARG QD   .  69 . HD*  1 1 
       2608 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2609 1 1 1 1  72 ARG QD   .  69 . HD*  1 1 
       2609 1 2 1 1 116 VAL HA   . 113 . HA   1 1 
       2610 1 1 1 1  72 ARG QD   .  69 . HD*  1 1 
       2610 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2611 1 1 1 1  72 ARG HD2  .  69 . HD2  1 1 
       2611 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2612 1 1 1 1  72 ARG HD3  .  69 . HD1  1 1 
       2612 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2613 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2613 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2614 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2614 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       2615 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2615 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2616 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2616 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       2617 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2617 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       2618 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2618 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2619 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2619 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2620 1 1 1 1  72 ARG HG2  .  69 . HG2  1 1 
       2620 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2621 1 1 1 1  72 ARG HG3  .  69 . HG1  1 1 
       2621 1 2 1 1  73 PHE H    .  70 . HN   1 1 
       2622 1 1 1 1  72 ARG HG3  .  69 . HG1  1 1 
       2622 1 2 1 1 114 THR HA   . 111 . HA   1 1 
       2623 1 1 1 1  72 ARG HG3  .  69 . HG1  1 1 
       2623 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       2624 1 1 1 1  72 ARG HG3  .  69 . HG1  1 1 
       2624 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2625 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2625 1 2 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2626 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2626 1 2 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2627 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2627 1 2 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2628 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2628 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2629 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2629 1 2 1 1 114 THR H    . 111 . HN   1 1 
       2630 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2630 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       2631 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2631 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2632 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2632 1 2 1 1 115 LEU H    . 112 . HN   1 1 
       2633 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2633 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       2634 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2634 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2635 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2635 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       2636 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2636 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2637 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2637 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2638 1 1 1 1  73 PHE H    .  70 . HN   1 1 
       2638 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2639 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2639 1 2 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2640 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2640 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2641 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2641 1 2 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2642 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2642 1 2 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2643 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2643 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2644 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2644 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2645 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2645 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       2646 1 1 1 1  73 PHE HA   .  70 . HA   1 1 
       2646 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       2647 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2647 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2648 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2648 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       2649 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2649 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       2650 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2650 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
       2651 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2651 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       2652 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2652 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2653 1 1 1 1  73 PHE HB2  .  70 . HB2  1 1 
       2653 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       2654 1 1 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2654 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2655 1 1 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2655 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       2656 1 1 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2656 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       2657 1 1 1 1  73 PHE HB3  .  70 . HB1  1 1 
       2657 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2658 1 1 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2658 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2659 1 1 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2659 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       2660 1 1 1 1  73 PHE HD1  .  70 . HD1  1 1 
       2660 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       2661 1 1 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2661 1 2 1 1  74 GLU H    .  71 . HN   1 1 
       2662 1 1 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2662 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       2663 1 1 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2663 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       2664 1 1 1 1  73 PHE HD2  .  70 . HD2  1 1 
       2664 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2665 1 1 1 1  73 PHE HE2  .  70 . HE2  1 1 
       2665 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       2666 1 1 1 1  73 PHE HE2  .  70 . HE2  1 1 
       2666 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       2667 1 1 1 1  73 PHE HE2  .  70 . HE2  1 1 
       2667 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2668 1 1 1 1  73 PHE HZ   .  70 . HZ   1 1 
       2668 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       2669 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2669 1 2 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2670 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2670 1 2 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2671 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2671 1 2 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2672 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2672 1 2 1 1  75 THR H    .  72 . HN   1 1 
       2673 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2673 1 2 1 1  75 THR HA   .  72 . HA   1 1 
       2674 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2674 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2675 1 1 1 1  74 GLU H    .  71 . HN   1 1 
       2675 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2676 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2676 1 2 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2677 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2677 1 2 1 1  75 THR H    .  72 . HN   1 1 
       2678 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2678 1 2 1 1  75 THR HA   .  72 . HA   1 1 
       2679 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2679 1 2 1 1  75 THR HB   .  72 . HB   1 1 
       2680 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2680 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       2681 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2681 1 2 1 1 116 VAL HB   . 113 . HB   1 1 
       2682 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2682 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2683 1 1 1 1  74 GLU HA   .  71 . HA   1 1 
       2683 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       2684 1 1 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2684 1 2 1 1  75 THR H    .  72 . HN   1 1 
       2685 1 1 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2685 1 2 1 1  75 THR HB   .  72 . HB   1 1 
       2686 1 1 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2686 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2687 1 1 1 1  74 GLU HB2  .  71 . HB2  1 1 
       2687 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       2688 1 1 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2688 1 2 1 1  75 THR H    .  72 . HN   1 1 
       2689 1 1 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2689 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2690 1 1 1 1  74 GLU HB3  .  71 . HB1  1 1 
       2690 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       2691 1 1 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2691 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2692 1 1 1 1  74 GLU HG2  .  71 . HG2  1 1 
       2692 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2693 1 1 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2693 1 2 1 1  75 THR H    .  72 . HN   1 1 
       2694 1 1 1 1  74 GLU HG3  .  71 . HG1  1 1 
       2694 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2695 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2695 1 2 1 1  75 THR HB   .  72 . HB   1 1 
       2696 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2696 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2697 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2697 1 2 1 1 115 LEU HB2  . 112 . HB2  1 1 
       2698 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2698 1 2 1 1 115 LEU HB3  . 112 . HB1  1 1 
       2699 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2699 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       2700 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2700 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2701 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2701 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       2702 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2702 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       2703 1 1 1 1  75 THR H    .  72 . HN   1 1 
       2703 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       2704 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2704 1 2 1 1  75 THR MG   .  72 . HG2* 1 1 
       2705 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2705 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2706 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2706 1 2 1 1  76 ARG HA   .  73 . HA   1 1 
       2707 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2707 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2708 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2708 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2709 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2709 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2710 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2710 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       2711 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2711 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2712 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2712 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       2713 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2713 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       2714 1 1 1 1  75 THR HA   .  72 . HA   1 1 
       2714 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       2715 1 1 1 1  75 THR HB   .  72 . HB   1 1 
       2715 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2716 1 1 1 1  75 THR HB   .  72 . HB   1 1 
       2716 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2717 1 1 1 1  75 THR HB   .  72 . HB   1 1 
       2717 1 2 1 1 115 LEU HB2  . 112 . HB2  1 1 
       2718 1 1 1 1  75 THR HB   .  72 . HB   1 1 
       2718 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       2719 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2719 1 2 1 1  76 ARG H    .  73 . HN   1 1 
       2720 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2720 1 2 1 1  76 ARG HA   .  73 . HA   1 1 
       2721 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2721 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2722 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2722 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2723 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2723 1 2 1 1  77 LEU HA   .  74 . HA   1 1 
       2724 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2724 1 2 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2725 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2725 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2726 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2726 1 2 1 1  78 ALA HA   .  75 . HA   1 1 
       2727 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2727 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2728 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2728 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       2729 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2729 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       2730 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2730 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       2731 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2731 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       2732 1 1 1 1  75 THR MG   .  72 . HG2* 1 1 
       2732 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       2733 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2733 1 2 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2734 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2734 1 2 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2735 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2735 1 2 1 1  76 ARG QD   .  73 . HD*  1 1 
       2736 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2736 1 2 1 1  76 ARG QG   .  73 . HG*  1 1 
       2737 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2737 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2738 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2738 1 2 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2739 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2739 1 2 1 1  77 LEU HG   .  74 . HG   1 1 
       2740 1 1 1 1  76 ARG H    .  73 . HN   1 1 
       2740 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       2741 1 1 1 1  76 ARG HA   .  73 . HA   1 1 
       2741 1 2 1 1  76 ARG HD2  .  73 . HD2  1 1 
       2742 1 1 1 1  76 ARG HA   .  73 . HA   1 1 
       2742 1 2 1 1  76 ARG QD   .  73 . HD*  1 1 
       2743 1 1 1 1  76 ARG HA   .  73 . HA   1 1 
       2743 1 2 1 1  76 ARG HD3  .  73 . HD1  1 1 
       2744 1 1 1 1  76 ARG HA   .  73 . HA   1 1 
       2744 1 2 1 1  77 LEU HA   .  74 . HA   1 1 
       2745 1 1 1 1  76 ARG HA   .  73 . HA   1 1 
       2745 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2746 1 1 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2746 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2747 1 1 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2747 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2748 1 1 1 1  76 ARG HB2  .  73 . HB2  1 1 
       2748 1 2 1 1  77 LEU HG   .  74 . HG   1 1 
       2749 1 1 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2749 1 2 1 1  76 ARG HD2  .  73 . HD2  1 1 
       2750 1 1 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2750 1 2 1 1  76 ARG HD3  .  73 . HD1  1 1 
       2751 1 1 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2751 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2752 1 1 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2752 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2753 1 1 1 1  76 ARG HB3  .  73 . HB1  1 1 
       2753 1 2 1 1  77 LEU HG   .  74 . HG   1 1 
       2754 1 1 1 1  76 ARG QD   .  73 . HD*  1 1 
       2754 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2755 1 1 1 1  76 ARG QD   .  73 . HD*  1 1 
       2755 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       2756 1 1 1 1  76 ARG HD2  .  73 . HD2  1 1 
       2756 1 2 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       2757 1 1 1 1  76 ARG HD2  .  73 . HD2  1 1 
       2757 1 2 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       2758 1 1 1 1  76 ARG HD3  .  73 . HD1  1 1 
       2758 1 2 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       2759 1 1 1 1  76 ARG HD3  .  73 . HD1  1 1 
       2759 1 2 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       2760 1 1 1 1  76 ARG HE   .  73 . HE   1 1 
       2760 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       2761 1 1 1 1  76 ARG HE   .  73 . HE   1 1 
       2761 1 2 1 1  88 LEU HG   .  85 . HG   1 1 
       2762 1 1 1 1  76 ARG QG   .  73 . HG*  1 1 
       2762 1 2 1 1  77 LEU H    .  74 . HN   1 1 
       2763 1 1 1 1  77 LEU H    .  74 . HN   1 1 
       2763 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2764 1 1 1 1  77 LEU H    .  74 . HN   1 1 
       2764 1 2 1 1  77 LEU HG   .  74 . HG   1 1 
       2765 1 1 1 1  77 LEU H    .  74 . HN   1 1 
       2765 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2766 1 1 1 1  77 LEU H    .  74 . HN   1 1 
       2766 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2767 1 1 1 1  77 LEU H    .  74 . HN   1 1 
       2767 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2768 1 1 1 1  77 LEU H    .  74 . HN   1 1 
       2768 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2769 1 1 1 1  77 LEU HA   .  74 . HA   1 1 
       2769 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2770 1 1 1 1  77 LEU HA   .  74 . HA   1 1 
       2770 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2771 1 1 1 1  77 LEU HA   .  74 . HA   1 1 
       2771 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2772 1 1 1 1  77 LEU HA   .  74 . HA   1 1 
       2772 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2773 1 1 1 1  77 LEU HA   .  74 . HA   1 1 
       2773 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2774 1 1 1 1  77 LEU HA   .  74 . HA   1 1 
       2774 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2775 1 1 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2775 1 2 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2776 1 1 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2776 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2777 1 1 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2777 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2778 1 1 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2778 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2779 1 1 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2779 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2780 1 1 1 1  77 LEU HB2  .  74 . HB2  1 1 
       2780 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2781 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2781 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2782 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2782 1 2 1 1  78 ALA HA   .  75 . HA   1 1 
       2783 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2783 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2784 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2784 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2785 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2785 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2786 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2786 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2787 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2787 1 2 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2788 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2788 1 2 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2789 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2789 1 2 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2790 1 1 1 1  77 LEU HB3  .  74 . HB1  1 1 
       2790 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2791 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2791 1 2 1 1  78 ALA H    .  75 . HN   1 1 
       2792 1 1 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2792 1 2 1 1  80 VAL HB   .  77 . HB   1 1 
       2793 1 1 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2793 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2794 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2794 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2795 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2795 1 2 1 1  84 GLU HA   .  81 . HA   1 1 
       2796 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2796 1 2 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2797 1 1 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2797 1 2 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2798 1 1 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2798 1 2 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2799 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2799 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2800 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2800 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2801 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2801 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2802 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2802 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2803 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2803 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       2804 1 1 1 1  77 LEU QD   .  74 . HD1* 1 1 
       2804 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2805 1 1 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2805 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       2806 1 1 1 1  77 LEU QD   .  74 . HD2* 1 1 
       2806 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       2807 1 1 1 1  77 LEU HG   .  74 . HG   1 1 
       2807 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2808 1 1 1 1  77 LEU HG   .  74 . HG   1 1 
       2808 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2809 1 1 1 1  77 LEU HG   .  74 . HG   1 1 
       2809 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       2810 1 1 1 1  78 ALA H    .  75 . HN   1 1 
       2810 1 2 1 1  78 ALA MB   .  75 . HB*  1 1 
       2811 1 1 1 1  78 ALA H    .  75 . HN   1 1 
       2811 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       2812 1 1 1 1  78 ALA H    .  75 . HN   1 1 
       2812 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2813 1 1 1 1  78 ALA H    .  75 . HN   1 1 
       2813 1 2 1 1  80 VAL HB   .  77 . HB   1 1 
       2814 1 1 1 1  78 ALA H    .  75 . HN   1 1 
       2814 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2815 1 1 1 1  78 ALA H    .  75 . HN   1 1 
       2815 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2816 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2816 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       2817 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2817 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       2818 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2818 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       2819 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2819 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2820 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2820 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2821 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2821 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2822 1 1 1 1  78 ALA HA   .  75 . HA   1 1 
       2822 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2823 1 1 1 1  78 ALA MB   .  75 . HB*  1 1 
       2823 1 2 1 1  79 GLY H    .  76 . HN   1 1 
       2824 1 1 1 1  78 ALA MB   .  75 . HB*  1 1 
       2824 1 2 1 1  79 GLY HA2  .  76 . HA2  1 1 
       2825 1 1 1 1  78 ALA MB   .  75 . HB*  1 1 
       2825 1 2 1 1  79 GLY HA3  .  76 . HA1  1 1 
       2826 1 1 1 1  78 ALA MB   .  75 . HB*  1 1 
       2826 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2827 1 1 1 1  78 ALA MB   .  75 . HB*  1 1 
       2827 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2828 1 1 1 1  79 GLY H    .  76 . HN   1 1 
       2828 1 2 1 1  80 VAL H    .  77 . HN   1 1 
       2829 1 1 1 1  79 GLY H    .  76 . HN   1 1 
       2829 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2830 1 1 1 1  79 GLY H    .  76 . HN   1 1 
       2830 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2831 1 1 1 1  79 GLY HA2  .  76 . HA2  1 1 
       2831 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2832 1 1 1 1  79 GLY HA3  .  76 . HA1  1 1 
       2832 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2833 1 1 1 1  79 GLY HA3  .  76 . HA1  1 1 
       2833 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2834 1 1 1 1  80 VAL H    .  77 . HN   1 1 
       2834 1 2 1 1  80 VAL HB   .  77 . HB   1 1 
       2835 1 1 1 1  80 VAL H    .  77 . HN   1 1 
       2835 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2836 1 1 1 1  80 VAL H    .  77 . HN   1 1 
       2836 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2837 1 1 1 1  80 VAL H    .  77 . HN   1 1 
       2837 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       2838 1 1 1 1  80 VAL H    .  77 . HN   1 1 
       2838 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2839 1 1 1 1  80 VAL HA   .  77 . HA   1 1 
       2839 1 2 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2840 1 1 1 1  80 VAL HA   .  77 . HA   1 1 
       2840 1 2 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2841 1 1 1 1  80 VAL HA   .  77 . HA   1 1 
       2841 1 2 1 1  81 GLU H    .  78 . HN   1 1 
       2842 1 1 1 1  80 VAL HB   .  77 . HB   1 1 
       2842 1 2 1 1  81 GLU H    .  78 . HN   1 1 
       2843 1 1 1 1  80 VAL HB   .  77 . HB   1 1 
       2843 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2844 1 1 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2844 1 2 1 1  81 GLU H    .  78 . HN   1 1 
       2845 1 1 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2845 1 2 1 1  81 GLU QG   .  78 . HG*  1 1 
       2846 1 1 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2846 1 2 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2847 1 1 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2847 1 2 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2848 1 1 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2848 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2849 1 1 1 1  80 VAL MG1  .  77 . HG1* 1 1 
       2849 1 2 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2850 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2850 1 2 1 1  81 GLU H    .  78 . HN   1 1 
       2851 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2851 1 2 1 1  81 GLU HA   .  78 . HA   1 1 
       2852 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2852 1 2 1 1  81 GLU QG   .  78 . HG*  1 1 
       2853 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2853 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2854 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2854 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2855 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2855 1 2 1 1  84 GLU HA   .  81 . HA   1 1 
       2856 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2856 1 2 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2857 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2857 1 2 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2858 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2858 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2859 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2859 1 2 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2860 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2860 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2861 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2861 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2862 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2862 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2863 1 1 1 1  80 VAL MG2  .  77 . HG2* 1 1 
       2863 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2864 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2864 1 2 1 1  81 GLU HB2  .  78 . HB2  1 1 
       2865 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2865 1 2 1 1  81 GLU HB3  .  78 . HB1  1 1 
       2866 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2866 1 2 1 1  81 GLU QG   .  78 . HG*  1 1 
       2867 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2867 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2868 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2868 1 2 1 1  83 GLU H    .  80 . HN   1 1 
       2869 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2869 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2870 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2870 1 2 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2871 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2871 1 2 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2872 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2872 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2873 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2873 1 2 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2874 1 1 1 1  81 GLU H    .  78 . HN   1 1 
       2874 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2875 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2875 1 2 1 1  81 GLU HG2  .  78 . HG2  1 1 
       2876 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2876 1 2 1 1  81 GLU QG   .  78 . HG*  1 1 
       2877 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2877 1 2 1 1  81 GLU HG3  .  78 . HG1  1 1 
       2878 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2878 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2879 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2879 1 2 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2880 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2880 1 2 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2881 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2881 1 2 1 1  83 GLU H    .  80 . HN   1 1 
       2882 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2882 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2883 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2883 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2884 1 1 1 1  81 GLU HA   .  78 . HA   1 1 
       2884 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2885 1 1 1 1  81 GLU HB2  .  78 . HB2  1 1 
       2885 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2886 1 1 1 1  81 GLU HB2  .  78 . HB2  1 1 
       2886 1 2 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2887 1 1 1 1  81 GLU HB2  .  78 . HB2  1 1 
       2887 1 2 1 1  83 GLU H    .  80 . HN   1 1 
       2888 1 1 1 1  81 GLU HB2  .  78 . HB2  1 1 
       2888 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2889 1 1 1 1  81 GLU HB3  .  78 . HB1  1 1 
       2889 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2890 1 1 1 1  81 GLU HB3  .  78 . HB1  1 1 
       2890 1 2 1 1  83 GLU H    .  80 . HN   1 1 
       2891 1 1 1 1  81 GLU HB3  .  78 . HB1  1 1 
       2891 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2892 1 1 1 1  81 GLU QG   .  78 . HG*  1 1 
       2892 1 2 1 1  83 GLU H    .  80 . HN   1 1 
       2893 1 1 1 1  81 GLU QG   .  78 . HG*  1 1 
       2893 1 2 1 1  83 GLU HB3  .  80 . HB1  1 1 
       2894 1 1 1 1  81 GLU QG   .  78 . HG*  1 1 
       2894 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2895 1 1 1 1  81 GLU QG   .  78 . HG*  1 1 
       2895 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2896 1 1 1 1  81 GLU QG   .  78 . HG*  1 1 
       2896 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2897 1 1 1 1  81 GLU HG2  .  78 . HG2  1 1 
       2897 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2898 1 1 1 1  81 GLU HG2  .  78 . HG2  1 1 
       2898 1 2 1 1  83 GLU HB3  .  80 . HB1  1 1 
       2899 1 1 1 1  81 GLU HG3  .  78 . HG1  1 1 
       2899 1 2 1 1  82 GLY H    .  79 . HN   1 1 
       2900 1 1 1 1  81 GLU HG3  .  78 . HG1  1 1 
       2900 1 2 1 1  83 GLU HB3  .  80 . HB1  1 1 
       2901 1 1 1 1  82 GLY H    .  79 . HN   1 1 
       2901 1 2 1 1  83 GLU H    .  80 . HN   1 1 
       2902 1 1 1 1  82 GLY H    .  79 . HN   1 1 
       2902 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2903 1 1 1 1  82 GLY H    .  79 . HN   1 1 
       2903 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2904 1 1 1 1  82 GLY H    .  79 . HN   1 1 
       2904 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2905 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2905 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2906 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2906 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2907 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2907 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       2908 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2908 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2909 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2909 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2910 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2910 1 2 1 1  85 ILE HG13 .  82 . HG11 1 1 
       2911 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2911 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2912 1 1 1 1  82 GLY HA2  .  79 . HA2  1 1 
       2912 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2913 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2913 1 2 1 1  83 GLU HA   .  80 . HA   1 1 
       2914 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2914 1 2 1 1  83 GLU HB2  .  80 . HB2  1 1 
       2915 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2915 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2916 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2916 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2917 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2917 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       2918 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2918 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2919 1 1 1 1  82 GLY HA3  .  79 . HA1  1 1 
       2919 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2920 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2920 1 2 1 1  83 GLU HB2  .  80 . HB2  1 1 
       2921 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2921 1 2 1 1  83 GLU HB3  .  80 . HB1  1 1 
       2922 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2922 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2923 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2923 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2924 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2924 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2925 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2925 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2926 1 1 1 1  83 GLU H    .  80 . HN   1 1 
       2926 1 2 1 1  86 ALA MB   .  83 . HB*  1 1 
       2927 1 1 1 1  83 GLU HA   .  80 . HA   1 1 
       2927 1 2 1 1  83 GLU HG2  .  80 . HG2  1 1 
       2928 1 1 1 1  83 GLU HA   .  80 . HA   1 1 
       2928 1 2 1 1  83 GLU QG   .  80 . HG*  1 1 
       2929 1 1 1 1  83 GLU HA   .  80 . HA   1 1 
       2929 1 2 1 1  83 GLU HG3  .  80 . HG1  1 1 
       2930 1 1 1 1  83 GLU HA   .  80 . HA   1 1 
       2930 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2931 1 1 1 1  83 GLU HB2  .  80 . HB2  1 1 
       2931 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2932 1 1 1 1  83 GLU HB3  .  80 . HB1  1 1 
       2932 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2933 1 1 1 1  83 GLU HB3  .  80 . HB1  1 1 
       2933 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2934 1 1 1 1  83 GLU QG   .  80 . HG*  1 1 
       2934 1 2 1 1  84 GLU H    .  81 . HN   1 1 
       2935 1 1 1 1  83 GLU QG   .  80 . HG*  1 1 
       2935 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2936 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2936 1 2 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2937 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2937 1 2 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2938 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2938 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2939 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2939 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2940 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2940 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2941 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2941 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       2942 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2942 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2943 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2943 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2944 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2944 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2945 1 1 1 1  84 GLU H    .  81 . HN   1 1 
       2945 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2946 1 1 1 1  84 GLU HA   .  81 . HA   1 1 
       2946 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2947 1 1 1 1  84 GLU HA   .  81 . HA   1 1 
       2947 1 2 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2948 1 1 1 1  84 GLU HA   .  81 . HA   1 1 
       2948 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2949 1 1 1 1  84 GLU HA   .  81 . HA   1 1 
       2949 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       2950 1 1 1 1  84 GLU HA   .  81 . HA   1 1 
       2950 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2951 1 1 1 1  84 GLU HA   .  81 . HA   1 1 
       2951 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       2952 1 1 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2952 1 2 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2953 1 1 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2953 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2954 1 1 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2954 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2955 1 1 1 1  84 GLU HB2  .  81 . HB2  1 1 
       2955 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2956 1 1 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2956 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2957 1 1 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2957 1 2 1 1  85 ILE HA   .  82 . HA   1 1 
       2958 1 1 1 1  84 GLU HB3  .  81 . HB1  1 1 
       2958 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2959 1 1 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2959 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2960 1 1 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2960 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2961 1 1 1 1  84 GLU HG2  .  81 . HG2  1 1 
       2961 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2962 1 1 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2962 1 2 1 1  85 ILE H    .  82 . HN   1 1 
       2963 1 1 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2963 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2964 1 1 1 1  84 GLU HG3  .  81 . HG1  1 1 
       2964 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2965 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2965 1 2 1 1  85 ILE HB   .  82 . HB   1 1 
       2966 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2966 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2967 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2967 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2968 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2968 1 2 1 1  85 ILE HG13 .  82 . HG11 1 1 
       2969 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2969 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2970 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2970 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2971 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2971 1 2 1 1  86 ALA HA   .  83 . HA   1 1 
       2972 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2972 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       2973 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2973 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2974 1 1 1 1  85 ILE H    .  82 . HN   1 1 
       2974 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       2975 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2975 1 2 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2976 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2976 1 2 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2977 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2977 1 2 1 1  85 ILE HG13 .  82 . HG11 1 1 
       2978 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2978 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2979 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2979 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       2980 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2980 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       2981 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2981 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       2982 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2982 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       2983 1 1 1 1  85 ILE HA   .  82 . HA   1 1 
       2983 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       2984 1 1 1 1  85 ILE HB   .  82 . HB   1 1 
       2984 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2985 1 1 1 1  85 ILE HB   .  82 . HB   1 1 
       2985 1 2 1 1  86 ALA HA   .  83 . HA   1 1 
       2986 1 1 1 1  85 ILE HB   .  82 . HB   1 1 
       2986 1 2 1 1  86 ALA MB   .  83 . HB*  1 1 
       2987 1 1 1 1  85 ILE HB   .  82 . HB   1 1 
       2987 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       2988 1 1 1 1  85 ILE HB   .  82 . HB   1 1 
       2988 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       2989 1 1 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2989 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2990 1 1 1 1  85 ILE MD   .  82 . HD1* 1 1 
       2990 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2991 1 1 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2991 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2992 1 1 1 1  85 ILE HG12 .  82 . HG12 1 1 
       2992 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2993 1 1 1 1  85 ILE HG13 .  82 . HG11 1 1 
       2993 1 2 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2994 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2994 1 2 1 1  86 ALA H    .  83 . HN   1 1 
       2995 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2995 1 2 1 1  86 ALA HA   .  83 . HA   1 1 
       2996 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2996 1 2 1 1  86 ALA MB   .  83 . HB*  1 1 
       2997 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2997 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       2998 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2998 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       2999 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       2999 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3000 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       3000 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3001 1 1 1 1  85 ILE MG   .  82 . HG2* 1 1 
       3001 1 2 1 1  89 LEU HG   .  86 . HG   1 1 
       3002 1 1 1 1  86 ALA H    .  83 . HN   1 1 
       3002 1 2 1 1  86 ALA MB   .  83 . HB*  1 1 
       3003 1 1 1 1  86 ALA H    .  83 . HN   1 1 
       3003 1 2 1 1  87 ALA H    .  84 . HN   1 1 
       3004 1 1 1 1  86 ALA H    .  83 . HN   1 1 
       3004 1 2 1 1  87 ALA HA   .  84 . HA   1 1 
       3005 1 1 1 1  86 ALA H    .  83 . HN   1 1 
       3005 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       3006 1 1 1 1  86 ALA H    .  83 . HN   1 1 
       3006 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3007 1 1 1 1  86 ALA H    .  83 . HN   1 1 
       3007 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3008 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3008 1 2 1 1  87 ALA HA   .  84 . HA   1 1 
       3009 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3009 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       3010 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3010 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       3011 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3011 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3012 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3012 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       3013 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3013 1 2 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3014 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3014 1 2 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3015 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3015 1 2 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3016 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3016 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3017 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3017 1 2 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3018 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3018 1 2 1 1  89 LEU HG   .  86 . HG   1 1 
       3019 1 1 1 1  86 ALA HA   .  83 . HA   1 1 
       3019 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3020 1 1 1 1  86 ALA MB   .  83 . HB*  1 1 
       3020 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3021 1 1 1 1  86 ALA MB   .  83 . HB*  1 1 
       3021 1 2 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3022 1 1 1 1  86 ALA MB   .  83 . HB*  1 1 
       3022 1 2 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3023 1 1 1 1  86 ALA MB   .  83 . HB*  1 1 
       3023 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3024 1 1 1 1  86 ALA MB   .  83 . HB*  1 1 
       3024 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3025 1 1 1 1  86 ALA MB   .  83 . HB*  1 1 
       3025 1 2 1 1  90 GLU QB   .  87 . HB*  1 1 
       3026 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3026 1 2 1 1  87 ALA HA   .  84 . HA   1 1 
       3027 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3027 1 2 1 1  87 ALA MB   .  84 . HB*  1 1 
       3028 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3028 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       3029 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3029 1 2 1 1  88 LEU HA   .  85 . HA   1 1 
       3030 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3030 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       3031 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3031 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3032 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3032 1 2 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3033 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3033 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3034 1 1 1 1  87 ALA H    .  84 . HN   1 1 
       3034 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3035 1 1 1 1  87 ALA HA   .  84 . HA   1 1 
       3035 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       3036 1 1 1 1  87 ALA HA   .  84 . HA   1 1 
       3036 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3037 1 1 1 1  87 ALA HA   .  84 . HA   1 1 
       3037 1 2 1 1  90 GLU QB   .  87 . HB*  1 1 
       3038 1 1 1 1  87 ALA HA   .  84 . HA   1 1 
       3038 1 2 1 1  90 GLU HG2  .  87 . HG2  1 1 
       3039 1 1 1 1  87 ALA HA   .  84 . HA   1 1 
       3039 1 2 1 1  90 GLU HG3  .  87 . HG1  1 1 
       3040 1 1 1 1  87 ALA HA   .  84 . HA   1 1 
       3040 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3041 1 1 1 1  87 ALA MB   .  84 . HB*  1 1 
       3041 1 2 1 1  88 LEU H    .  85 . HN   1 1 
       3042 1 1 1 1  87 ALA MB   .  84 . HB*  1 1 
       3042 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       3043 1 1 1 1  87 ALA MB   .  84 . HB*  1 1 
       3043 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3044 1 1 1 1  87 ALA MB   .  84 . HB*  1 1 
       3044 1 2 1 1  90 GLU QG   .  87 . HG*  1 1 
       3045 1 1 1 1  87 ALA MB   .  84 . HB*  1 1 
       3045 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3046 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3046 1 2 1 1  88 LEU QB   .  85 . HB*  1 1 
       3047 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3047 1 2 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3048 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3048 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       3049 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3049 1 2 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3050 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3050 1 2 1 1  88 LEU HG   .  85 . HG   1 1 
       3051 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3051 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3052 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3052 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       3053 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3053 1 2 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3054 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3054 1 2 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3055 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3055 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3056 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3056 1 2 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3057 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3057 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3058 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3058 1 2 1 1  90 GLU QB   .  87 . HB*  1 1 
       3059 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3059 1 2 1 1  90 GLU QG   .  87 . HG*  1 1 
       3060 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3060 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3061 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3061 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3062 1 1 1 1  88 LEU H    .  85 . HN   1 1 
       3062 1 2 1 1  91 ARG QG   .  88 . HG*  1 1 
       3063 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3063 1 2 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3064 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3064 1 2 1 1  88 LEU QD   .  85 . HD*  1 1 
       3065 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3065 1 2 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3066 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3066 1 2 1 1  88 LEU HG   .  85 . HG   1 1 
       3067 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3067 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       3068 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3068 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3069 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3069 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3070 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3070 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3071 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3071 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3072 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3072 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3073 1 1 1 1  88 LEU HA   .  85 . HA   1 1 
       3073 1 2 1 1  91 ARG QG   .  88 . HG*  1 1 
       3074 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3074 1 2 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3075 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3075 1 2 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3076 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3076 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3077 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3077 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       3078 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3078 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3079 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3079 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3080 1 1 1 1  88 LEU QB   .  85 . HB*  1 1 
       3080 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3081 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3081 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3082 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3082 1 2 1 1  89 LEU HA   .  86 . HA   1 1 
       3083 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3083 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3084 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3084 1 2 1 1  90 GLU QG   .  87 . HG*  1 1 
       3085 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3085 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3086 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3086 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3087 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3087 1 2 1 1  91 ARG QG   .  88 . HG*  1 1 
       3088 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3088 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3089 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3089 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3090 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3090 1 2 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3091 1 1 1 1  88 LEU QD   .  85 . HD*  1 1 
       3091 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3092 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3092 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3093 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3093 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3094 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3094 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3095 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3095 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3096 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3096 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3097 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3097 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3098 1 1 1 1  88 LEU MD1  .  85 . HD1* 1 1 
       3098 1 2 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3099 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3099 1 2 1 1  89 LEU H    .  86 . HN   1 1 
       3100 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3100 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3101 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3101 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3102 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3102 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3103 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3103 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3104 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3104 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3105 1 1 1 1  88 LEU MD2  .  85 . HD2* 1 1 
       3105 1 2 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3106 1 1 1 1  88 LEU HG   .  85 . HG   1 1 
       3106 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3107 1 1 1 1  88 LEU HG   .  85 . HG   1 1 
       3107 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3108 1 1 1 1  88 LEU HG   .  85 . HG   1 1 
       3108 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3109 1 1 1 1  88 LEU HG   .  85 . HG   1 1 
       3109 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3110 1 1 1 1  88 LEU HG   .  85 . HG   1 1 
       3110 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3111 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3111 1 2 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3112 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3112 1 2 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3113 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3113 1 2 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3114 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3114 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3115 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3115 1 2 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3116 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3116 1 2 1 1  89 LEU HG   .  86 . HG   1 1 
       3117 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3117 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3118 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3118 1 2 1 1  90 GLU QB   .  87 . HB*  1 1 
       3119 1 1 1 1  89 LEU H    .  86 . HN   1 1 
       3119 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3120 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3120 1 2 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3121 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3121 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3122 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3122 1 2 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3123 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3123 1 2 1 1  89 LEU HG   .  86 . HG   1 1 
       3124 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3124 1 2 1 1  90 GLU HA   .  87 . HA   1 1 
       3125 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3125 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3126 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3126 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3127 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3127 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3128 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3128 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3129 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3129 1 2 1 1  92 GLU HB3  .  89 . HB1  1 1 
       3130 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3130 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3131 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3131 1 2 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3132 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3132 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3133 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3133 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3134 1 1 1 1  89 LEU HA   .  86 . HA   1 1 
       3134 1 2 1 1  99 LEU HG   .  96 . HG   1 1 
       3135 1 1 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3135 1 2 1 1  89 LEU QD   .  86 . HD*  1 1 
       3136 1 1 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3136 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3137 1 1 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3137 1 2 1 1  90 GLU HA   .  87 . HA   1 1 
       3138 1 1 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3138 1 2 1 1  90 GLU QB   .  87 . HB*  1 1 
       3139 1 1 1 1  89 LEU HB2  .  86 . HB2  1 1 
       3139 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3140 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3140 1 2 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3141 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3141 1 2 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3142 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3142 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3143 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3143 1 2 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3144 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3144 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3145 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3145 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3146 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3146 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3147 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3147 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3148 1 1 1 1  89 LEU HB3  .  86 . HB1  1 1 
       3148 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3149 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3149 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3150 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3150 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3151 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3151 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3152 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3152 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3153 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3153 1 2 1 1  92 GLU HB3  .  89 . HB1  1 1 
       3154 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3154 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3155 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3155 1 2 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3156 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3156 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3157 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3157 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3158 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3158 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       3159 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3159 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3160 1 1 1 1  89 LEU QD   .  86 . HD*  1 1 
       3160 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3161 1 1 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3161 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3162 1 1 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3162 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       3163 1 1 1 1  89 LEU MD1  .  86 . HD1* 1 1 
       3163 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3164 1 1 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3164 1 2 1 1  90 GLU H    .  87 . HN   1 1 
       3165 1 1 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3165 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       3166 1 1 1 1  89 LEU MD2  .  86 . HD2* 1 1 
       3166 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3167 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3167 1 2 1 1  90 GLU QB   .  87 . HB*  1 1 
       3168 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3168 1 2 1 1  90 GLU HG2  .  87 . HG2  1 1 
       3169 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3169 1 2 1 1  90 GLU QG   .  87 . HG*  1 1 
       3170 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3170 1 2 1 1  90 GLU HG3  .  87 . HG1  1 1 
       3171 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3171 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3172 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3172 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3173 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3173 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3174 1 1 1 1  90 GLU H    .  87 . HN   1 1 
       3174 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3175 1 1 1 1  90 GLU HA   .  87 . HA   1 1 
       3175 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3176 1 1 1 1  90 GLU HA   .  87 . HA   1 1 
       3176 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3177 1 1 1 1  90 GLU HA   .  87 . HA   1 1 
       3177 1 2 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3178 1 1 1 1  90 GLU HA   .  87 . HA   1 1 
       3178 1 2 1 1  93 ARG HD2  .  90 . HD2  1 1 
       3179 1 1 1 1  90 GLU HA   .  87 . HA   1 1 
       3179 1 2 1 1  93 ARG HD3  .  90 . HD1  1 1 
       3180 1 1 1 1  90 GLU HA   .  87 . HA   1 1 
       3180 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3181 1 1 1 1  90 GLU QB   .  87 . HB*  1 1 
       3181 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3182 1 1 1 1  90 GLU QB   .  87 . HB*  1 1 
       3182 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3183 1 1 1 1  90 GLU QG   .  87 . HG*  1 1 
       3183 1 2 1 1  91 ARG HA   .  88 . HA   1 1 
       3184 1 1 1 1  90 GLU QG   .  87 . HG*  1 1 
       3184 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3185 1 1 1 1  90 GLU QG   .  87 . HG*  1 1 
       3185 1 2 1 1  91 ARG QG   .  88 . HG*  1 1 
       3186 1 1 1 1  90 GLU HG2  .  87 . HG2  1 1 
       3186 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3187 1 1 1 1  90 GLU HG2  .  87 . HG2  1 1 
       3187 1 2 1 1  91 ARG HA   .  88 . HA   1 1 
       3188 1 1 1 1  90 GLU HG3  .  87 . HG1  1 1 
       3188 1 2 1 1  91 ARG H    .  88 . HN   1 1 
       3189 1 1 1 1  90 GLU HG3  .  87 . HG1  1 1 
       3189 1 2 1 1  91 ARG HA   .  88 . HA   1 1 
       3190 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3190 1 2 1 1  91 ARG QB   .  88 . HB*  1 1 
       3191 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3191 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3192 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3192 1 2 1 1  91 ARG HG2  .  88 . HG2  1 1 
       3193 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3193 1 2 1 1  91 ARG QG   .  88 . HG*  1 1 
       3194 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3194 1 2 1 1  91 ARG HG3  .  88 . HG1  1 1 
       3195 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3195 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3196 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3196 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3197 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3197 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3198 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3198 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3199 1 1 1 1  91 ARG H    .  88 . HN   1 1 
       3199 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3200 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3200 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3201 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3201 1 2 1 1  91 ARG HG2  .  88 . HG2  1 1 
       3202 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3202 1 2 1 1  91 ARG QG   .  88 . HG*  1 1 
       3203 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3203 1 2 1 1  91 ARG HG3  .  88 . HG1  1 1 
       3204 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3204 1 2 1 1  92 GLU HA   .  89 . HA   1 1 
       3205 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3205 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3206 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3206 1 2 1 1  94 ARG QB   .  91 . HB2  1 1 
       3207 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3207 1 2 1 1  94 ARG QD   .  91 . HD*  1 1 
       3208 1 1 1 1  91 ARG HA   .  88 . HA   1 1 
       3208 1 2 1 1  94 ARG QG   .  91 . HG*  1 1 
       3209 1 1 1 1  91 ARG QB   .  88 . HB*  1 1 
       3209 1 2 1 1  91 ARG QD   .  88 . HD*  1 1 
       3210 1 1 1 1  91 ARG QB   .  88 . HB*  1 1 
       3210 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3211 1 1 1 1  91 ARG QB   .  88 . HB*  1 1 
       3211 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3212 1 1 1 1  91 ARG QB   .  88 . HB*  1 1 
       3212 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3213 1 1 1 1  91 ARG QB   .  88 . HB*  1 1 
       3213 1 2 1 1  94 ARG QB   .  91 . HB1  1 1 
       3214 1 1 1 1  91 ARG QB   .  88 . HB*  1 1 
       3214 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3215 1 1 1 1  91 ARG QD   .  88 . HD*  1 1 
       3215 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3216 1 1 1 1  91 ARG QG   .  88 . HG*  1 1 
       3216 1 2 1 1  92 GLU H    .  89 . HN   1 1 
       3217 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3217 1 2 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3218 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3218 1 2 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3219 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3219 1 2 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3220 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3220 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3221 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3221 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3222 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3222 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3223 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3223 1 2 1 1  94 ARG QB   .  91 . HB1  1 1 
       3224 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3224 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3225 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3225 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3226 1 1 1 1  92 GLU H    .  89 . HN   1 1 
       3226 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3227 1 1 1 1  92 GLU HA   .  89 . HA   1 1 
       3227 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3228 1 1 1 1  92 GLU HA   .  89 . HA   1 1 
       3228 1 2 1 1  95 PHE HB2  .  92 . HB2  1 1 
       3229 1 1 1 1  92 GLU HA   .  89 . HA   1 1 
       3229 1 2 1 1  95 PHE HB3  .  92 . HB1  1 1 
       3230 1 1 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3230 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3231 1 1 1 1  92 GLU HB2  .  89 . HB2  1 1 
       3231 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3232 1 1 1 1  92 GLU HB3  .  89 . HB1  1 1 
       3232 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3233 1 1 1 1  92 GLU HB3  .  89 . HB1  1 1 
       3233 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3234 1 1 1 1  92 GLU HB3  .  89 . HB1  1 1 
       3234 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3235 1 1 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3235 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3236 1 1 1 1  92 GLU HG2  .  89 . HG2  1 1 
       3236 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3237 1 1 1 1  92 GLU HG3  .  89 . HG1  1 1 
       3237 1 2 1 1  93 ARG H    .  90 . HN   1 1 
       3238 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3238 1 2 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3239 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3239 1 2 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3240 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3240 1 2 1 1  93 ARG QD   .  90 . HD*  1 1 
       3241 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3241 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3242 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3242 1 2 1 1  93 ARG HG3  .  90 . HG1  1 1 
       3243 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3243 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3244 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3244 1 2 1 1  94 ARG HA   .  91 . HA   1 1 
       3245 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3245 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3246 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3246 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3247 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3247 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       3248 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3248 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3249 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3249 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3250 1 1 1 1  93 ARG H    .  90 . HN   1 1 
       3250 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3251 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3251 1 2 1 1  93 ARG HD2  .  90 . HD2  1 1 
       3252 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3252 1 2 1 1  93 ARG QD   .  90 . HD*  1 1 
       3253 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3253 1 2 1 1  93 ARG HD3  .  90 . HD1  1 1 
       3254 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3254 1 2 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3255 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3255 1 2 1 1  93 ARG HG3  .  90 . HG1  1 1 
       3256 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3256 1 2 1 1  94 ARG HA   .  91 . HA   1 1 
       3257 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3257 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3258 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3258 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3259 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3259 1 2 1 1  96 ASP QB   .  93 . HB*  1 1 
       3260 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3260 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3261 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3261 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3262 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3262 1 2 1 1  97 SER QB   .  94 . HB*  1 1 
       3263 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3263 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3264 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3264 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3265 1 1 1 1  93 ARG HA   .  90 . HA   1 1 
       3265 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3266 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3266 1 2 1 1  93 ARG HD2  .  90 . HD2  1 1 
       3267 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3267 1 2 1 1  93 ARG QD   .  90 . HD*  1 1 
       3268 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3268 1 2 1 1  93 ARG HD3  .  90 . HD1  1 1 
       3269 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3269 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3270 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3270 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3271 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3271 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3272 1 1 1 1  93 ARG HB2  .  90 . HB2  1 1 
       3272 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3273 1 1 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3273 1 2 1 1  93 ARG QD   .  90 . HD*  1 1 
       3274 1 1 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3274 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3275 1 1 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3275 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3276 1 1 1 1  93 ARG HB3  .  90 . HB1  1 1 
       3276 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3277 1 1 1 1  93 ARG QD   .  90 . HD*  1 1 
       3277 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3278 1 1 1 1  93 ARG QD   .  90 . HD*  1 1 
       3278 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3279 1 1 1 1  93 ARG QD   .  90 . HD*  1 1 
       3279 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3280 1 1 1 1  93 ARG HD2  .  90 . HD2  1 1 
       3280 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3281 1 1 1 1  93 ARG HD3  .  90 . HD1  1 1 
       3281 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3282 1 1 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3282 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3283 1 1 1 1  93 ARG HG2  .  90 . HG2  1 1 
       3283 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3284 1 1 1 1  93 ARG HG3  .  90 . HG1  1 1 
       3284 1 2 1 1  94 ARG H    .  91 . HN   1 1 
       3285 1 1 1 1  93 ARG HG3  .  90 . HG1  1 1 
       3285 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3286 1 1 1 1  94 ARG H    .  91 . HN   1 1 
       3286 1 2 1 1  94 ARG QB   .  91 . HB2  1 1 
       3287 1 1 1 1  94 ARG H    .  91 . HN   1 1 
       3287 1 2 1 1  94 ARG QD   .  91 . HD*  1 1 
       3288 1 1 1 1  94 ARG H    .  91 . HN   1 1 
       3288 1 2 1 1  94 ARG QG   .  91 . HG*  1 1 
       3289 1 1 1 1  94 ARG H    .  91 . HN   1 1 
       3289 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3290 1 1 1 1  94 ARG H    .  91 . HN   1 1 
       3290 1 2 1 1  95 PHE HB2  .  92 . HB2  1 1 
       3291 1 1 1 1  94 ARG H    .  91 . HN   1 1 
       3291 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3292 1 1 1 1  94 ARG HA   .  91 . HA   1 1 
       3292 1 2 1 1  94 ARG QD   .  91 . HD*  1 1 
       3293 1 1 1 1  94 ARG HA   .  91 . HA   1 1 
       3293 1 2 1 1  94 ARG QG   .  91 . HG*  1 1 
       3294 1 1 1 1  94 ARG HA   .  91 . HA   1 1 
       3294 1 2 1 1  95 PHE HA   .  92 . HA   1 1 
       3295 1 1 1 1  94 ARG HA   .  91 . HA   1 1 
       3295 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3296 1 1 1 1  94 ARG QB   .  91 . HB2  1 1 
       3296 1 2 1 1  94 ARG QD   .  91 . HD*  1 1 
       3297 1 1 1 1  94 ARG QB   .  91 . HB2  1 1 
       3297 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3298 1 1 1 1  94 ARG QB   .  91 . HB1  1 1 
       3298 1 2 1 1  95 PHE HA   .  92 . HA   1 1 
       3299 1 1 1 1  94 ARG QB   .  91 . HB1  1 1 
       3299 1 2 1 1  95 PHE QD   .  92 . HD2  1 1 
       3300 1 1 1 1  94 ARG QD   .  91 . HD*  1 1 
       3300 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3301 1 1 1 1  94 ARG QD   .  91 . HD*  1 1 
       3301 1 2 1 1  95 PHE HA   .  92 . HA   1 1 
       3302 1 1 1 1  94 ARG QD   .  91 . HD*  1 1 
       3302 1 2 1 1  95 PHE QD   .  92 . HD2  1 1 
       3303 1 1 1 1  94 ARG QG   .  91 . HG*  1 1 
       3303 1 2 1 1  95 PHE H    .  92 . HN   1 1 
       3304 1 1 1 1  94 ARG QG   .  91 . HG*  1 1 
       3304 1 2 1 1  95 PHE QD   .  92 . HD2  1 1 
       3305 1 1 1 1  95 PHE H    .  92 . HN   1 1 
       3305 1 2 1 1  95 PHE HB2  .  92 . HB2  1 1 
       3306 1 1 1 1  95 PHE H    .  92 . HN   1 1 
       3306 1 2 1 1  95 PHE HB3  .  92 . HB1  1 1 
       3307 1 1 1 1  95 PHE H    .  92 . HN   1 1 
       3307 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3308 1 1 1 1  95 PHE H    .  92 . HN   1 1 
       3308 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3309 1 1 1 1  95 PHE HA   .  92 . HA   1 1 
       3309 1 2 1 1  95 PHE QD   .  92 . HD1  1 1 
       3310 1 1 1 1  95 PHE HA   .  92 . HA   1 1 
       3310 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3311 1 1 1 1  95 PHE HB2  .  92 . HB2  1 1 
       3311 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3312 1 1 1 1  95 PHE HB2  .  92 . HB2  1 1 
       3312 1 2 1 1  96 ASP QB   .  93 . HB*  1 1 
       3313 1 1 1 1  95 PHE HB3  .  92 . HB1  1 1 
       3313 1 2 1 1  96 ASP H    .  93 . HN   1 1 
       3314 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3314 1 2 1 1  96 ASP HB2  .  93 . HB2  1 1 
       3315 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3315 1 2 1 1  96 ASP QB   .  93 . HB*  1 1 
       3316 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3316 1 2 1 1  96 ASP HB3  .  93 . HB1  1 1 
       3317 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3317 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3318 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3318 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3319 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3319 1 2 1 1  97 SER QB   .  94 . HB*  1 1 
       3320 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3320 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3321 1 1 1 1  96 ASP H    .  93 . HN   1 1 
       3321 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3322 1 1 1 1  96 ASP HA   .  93 . HA   1 1 
       3322 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3323 1 1 1 1  96 ASP HA   .  93 . HA   1 1 
       3323 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3324 1 1 1 1  96 ASP HA   .  93 . HA   1 1 
       3324 1 2 1 1  97 SER HB2  .  94 . HB2  1 1 
       3325 1 1 1 1  96 ASP HA   .  93 . HA   1 1 
       3325 1 2 1 1  97 SER HB3  .  94 . HB1  1 1 
       3326 1 1 1 1  96 ASP HA   .  93 . HA   1 1 
       3326 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3327 1 1 1 1  96 ASP HA   .  93 . HA   1 1 
       3327 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3328 1 1 1 1  96 ASP QB   .  93 . HB*  1 1 
       3328 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3329 1 1 1 1  96 ASP QB   .  93 . HB*  1 1 
       3329 1 2 1 1  97 SER HA   .  94 . HA   1 1 
       3330 1 1 1 1  96 ASP QB   .  93 . HB*  1 1 
       3330 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3331 1 1 1 1  96 ASP QB   .  93 . HB*  1 1 
       3331 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3332 1 1 1 1  96 ASP QB   .  93 . HB*  1 1 
       3332 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3333 1 1 1 1  96 ASP HB2  .  93 . HB2  1 1 
       3333 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3334 1 1 1 1  96 ASP HB3  .  93 . HB1  1 1 
       3334 1 2 1 1  97 SER H    .  94 . HN   1 1 
       3335 1 1 1 1  97 SER H    .  94 . HN   1 1 
       3335 1 2 1 1  97 SER HB2  .  94 . HB2  1 1 
       3336 1 1 1 1  97 SER H    .  94 . HN   1 1 
       3336 1 2 1 1  97 SER HB3  .  94 . HB1  1 1 
       3337 1 1 1 1  97 SER H    .  94 . HN   1 1 
       3337 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3338 1 1 1 1  97 SER H    .  94 . HN   1 1 
       3338 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       3339 1 1 1 1  97 SER H    .  94 . HN   1 1 
       3339 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3340 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3340 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       3341 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3341 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       3342 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3342 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3343 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3343 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3344 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3344 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3345 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3345 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3346 1 1 1 1  97 SER HA   .  94 . HA   1 1 
       3346 1 2 1 1  99 LEU HG   .  96 . HG   1 1 
       3347 1 1 1 1  97 SER QB   .  94 . HB*  1 1 
       3347 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3348 1 1 1 1  97 SER QB   .  94 . HB*  1 1 
       3348 1 2 1 1  98 ASP HA   .  95 . HA   1 1 
       3349 1 1 1 1  97 SER HB2  .  94 . HB2  1 1 
       3349 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3350 1 1 1 1  97 SER HB3  .  94 . HB1  1 1 
       3350 1 2 1 1  98 ASP H    .  95 . HN   1 1 
       3351 1 1 1 1  98 ASP H    .  95 . HN   1 1 
       3351 1 2 1 1  98 ASP QB   .  95 . HB*  1 1 
       3352 1 1 1 1  98 ASP H    .  95 . HN   1 1 
       3352 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3353 1 1 1 1  98 ASP H    .  95 . HN   1 1 
       3353 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       3354 1 1 1 1  98 ASP H    .  95 . HN   1 1 
       3354 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3355 1 1 1 1  98 ASP HA   .  95 . HA   1 1 
       3355 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       3356 1 1 1 1  98 ASP QB   .  95 . HB*  1 1 
       3356 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3357 1 1 1 1  98 ASP HB2  .  95 . HB2  1 1 
       3357 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3358 1 1 1 1  98 ASP HB3  .  95 . HB1  1 1 
       3358 1 2 1 1  99 LEU H    .  96 . HN   1 1 
       3359 1 1 1 1  99 LEU H    .  96 . HN   1 1 
       3359 1 2 1 1  99 LEU QB   .  96 . HB*  1 1 
       3360 1 1 1 1  99 LEU H    .  96 . HN   1 1 
       3360 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3361 1 1 1 1  99 LEU H    .  96 . HN   1 1 
       3361 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3362 1 1 1 1  99 LEU H    .  96 . HN   1 1 
       3362 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3363 1 1 1 1  99 LEU H    .  96 . HN   1 1 
       3363 1 2 1 1  99 LEU HG   .  96 . HG   1 1 
       3364 1 1 1 1  99 LEU H    .  96 . HN   1 1 
       3364 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3365 1 1 1 1  99 LEU HA   .  96 . HA   1 1 
       3365 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3366 1 1 1 1  99 LEU HA   .  96 . HA   1 1 
       3366 1 2 1 1  99 LEU QD   .  96 . HD*  1 1 
       3367 1 1 1 1  99 LEU HA   .  96 . HA   1 1 
       3367 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3368 1 1 1 1  99 LEU HA   .  96 . HA   1 1 
       3368 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3369 1 1 1 1  99 LEU HA   .  96 . HA   1 1 
       3369 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       3370 1 1 1 1  99 LEU HA   .  96 . HA   1 1 
       3370 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       3371 1 1 1 1  99 LEU QB   .  96 . HB*  1 1 
       3371 1 2 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3372 1 1 1 1  99 LEU QB   .  96 . HB*  1 1 
       3372 1 2 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3373 1 1 1 1  99 LEU QB   .  96 . HB*  1 1 
       3373 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3374 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3374 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3375 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3375 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       3376 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3376 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       3377 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3377 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       3378 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3378 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       3379 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3379 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3380 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3380 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3381 1 1 1 1  99 LEU QD   .  96 . HD*  1 1 
       3381 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       3382 1 1 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3382 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3383 1 1 1 1  99 LEU MD1  .  96 . HD1* 1 1 
       3383 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       3384 1 1 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3384 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3385 1 1 1 1  99 LEU MD2  .  96 . HD2* 1 1 
       3385 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       3386 1 1 1 1  99 LEU HG   .  96 . HG   1 1 
       3386 1 2 1 1 100 TRP H    .  97 . HN   1 1 
       3387 1 1 1 1  99 LEU HG   .  96 . HG   1 1 
       3387 1 2 1 1 100 TRP HA   .  97 . HA   1 1 
       3388 1 1 1 1 100 TRP H    .  97 . HN   1 1 
       3388 1 2 1 1 100 TRP HB2  .  97 . HB2  1 1 
       3389 1 1 1 1 100 TRP H    .  97 . HN   1 1 
       3389 1 2 1 1 100 TRP HB3  .  97 . HB1  1 1 
       3390 1 1 1 1 100 TRP H    .  97 . HN   1 1 
       3390 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       3391 1 1 1 1 100 TRP H    .  97 . HN   1 1 
       3391 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       3392 1 1 1 1 100 TRP H    .  97 . HN   1 1 
       3392 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       3393 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3393 1 2 1 1 100 TRP HD1  .  97 . HD1  1 1 
       3394 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3394 1 2 1 1 100 TRP HE1  .  97 . HE1  1 1 
       3395 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3395 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       3396 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3396 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       3397 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3397 1 2 1 1 101 VAL HA   .  98 . HA   1 1 
       3398 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3398 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       3399 1 1 1 1 100 TRP HA   .  97 . HA   1 1 
       3399 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3400 1 1 1 1 100 TRP QB   .  97 . HB*  1 1 
       3400 1 2 1 1 100 TRP HE3  .  97 . HE3  1 1 
       3401 1 1 1 1 100 TRP QB   .  97 . HB*  1 1 
       3401 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3402 1 1 1 1 100 TRP QB   .  97 . HB*  1 1 
       3402 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3403 1 1 1 1 100 TRP HB2  .  97 . HB2  1 1 
       3403 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       3404 1 1 1 1 100 TRP HB3  .  97 . HB1  1 1 
       3404 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       3405 1 1 1 1 100 TRP HE3  .  97 . HE3  1 1 
       3405 1 2 1 1 101 VAL H    .  98 . HN   1 1 
       3406 1 1 1 1 100 TRP HE3  .  97 . HE3  1 1 
       3406 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3407 1 1 1 1 100 TRP HZ3  .  97 . HZ3  1 1 
       3407 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3408 1 1 1 1 101 VAL H    .  98 . HN   1 1 
       3408 1 2 1 1 101 VAL HB   .  98 . HB   1 1 
       3409 1 1 1 1 101 VAL H    .  98 . HN   1 1 
       3409 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3410 1 1 1 1 101 VAL H    .  98 . HN   1 1 
       3410 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3411 1 1 1 1 101 VAL HA   .  98 . HA   1 1 
       3411 1 2 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3412 1 1 1 1 101 VAL HA   .  98 . HA   1 1 
       3412 1 2 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3413 1 1 1 1 101 VAL HA   .  98 . HA   1 1 
       3413 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       3414 1 1 1 1 101 VAL HA   .  98 . HA   1 1 
       3414 1 2 1 1 102 VAL HA   .  99 . HA   1 1 
       3415 1 1 1 1 101 VAL HA   .  98 . HA   1 1 
       3415 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       3416 1 1 1 1 101 VAL HA   .  98 . HA   1 1 
       3416 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3417 1 1 1 1 101 VAL HB   .  98 . HB   1 1 
       3417 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       3418 1 1 1 1 101 VAL HB   .  98 . HB   1 1 
       3418 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3419 1 1 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3419 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       3420 1 1 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3420 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       3421 1 1 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3421 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       3422 1 1 1 1 101 VAL MG1  .  98 . HG1* 1 1 
       3422 1 2 1 1 103 GLU HB3  . 100 . HB1  1 1 
       3423 1 1 1 1 101 VAL MG2  .  98 . HG2* 1 1 
       3423 1 2 1 1 102 VAL H    .  99 . HN   1 1 
       3424 1 1 1 1 102 VAL H    .  99 . HN   1 1 
       3424 1 2 1 1 102 VAL HB   .  99 . HB   1 1 
       3425 1 1 1 1 102 VAL H    .  99 . HN   1 1 
       3425 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
       3426 1 1 1 1 102 VAL H    .  99 . HN   1 1 
       3426 1 2 1 1 102 VAL QG   .  99 . HG*  1 1 
       3427 1 1 1 1 102 VAL H    .  99 . HN   1 1 
       3427 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
       3428 1 1 1 1 102 VAL HA   .  99 . HA   1 1 
       3428 1 2 1 1 102 VAL MG1  .  99 . HG1* 1 1 
       3429 1 1 1 1 102 VAL HA   .  99 . HA   1 1 
       3429 1 2 1 1 102 VAL MG2  .  99 . HG2* 1 1 
       3430 1 1 1 1 102 VAL HA   .  99 . HA   1 1 
       3430 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       3431 1 1 1 1 102 VAL HA   .  99 . HA   1 1 
       3431 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       3432 1 1 1 1 102 VAL HA   .  99 . HA   1 1 
       3432 1 2 1 1 103 GLU HB3  . 100 . HB1  1 1 
       3433 1 1 1 1 102 VAL HA   .  99 . HA   1 1 
       3433 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
       3434 1 1 1 1 102 VAL HB   .  99 . HB   1 1 
       3434 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       3435 1 1 1 1 102 VAL HB   .  99 . HB   1 1 
       3435 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3436 1 1 1 1 102 VAL HB   .  99 . HB   1 1 
       3436 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       3437 1 1 1 1 102 VAL HB   .  99 . HB   1 1 
       3437 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3438 1 1 1 1 102 VAL QG   .  99 . HG*  1 1 
       3438 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       3439 1 1 1 1 102 VAL QG   .  99 . HG*  1 1 
       3439 1 2 1 1 103 GLU HA   . 100 . HA   1 1 
       3440 1 1 1 1 102 VAL QG   .  99 . HG*  1 1 
       3440 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
       3441 1 1 1 1 102 VAL QG   .  99 . HG*  1 1 
       3441 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3442 1 1 1 1 102 VAL QG   .  99 . HG*  1 1 
       3442 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
       3443 1 1 1 1 102 VAL QG   .  99 . HG*  1 1 
       3443 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3444 1 1 1 1 102 VAL MG1  .  99 . HG1* 1 1 
       3444 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       3445 1 1 1 1 102 VAL MG2  .  99 . HG2* 1 1 
       3445 1 2 1 1 103 GLU H    . 100 . HN   1 1 
       3446 1 1 1 1 103 GLU H    . 100 . HN   1 1 
       3446 1 2 1 1 103 GLU HB2  . 100 . HB2  1 1 
       3447 1 1 1 1 103 GLU H    . 100 . HN   1 1 
       3447 1 2 1 1 103 GLU HB3  . 100 . HB1  1 1 
       3448 1 1 1 1 103 GLU H    . 100 . HN   1 1 
       3448 1 2 1 1 103 GLU HG2  . 100 . HG2  1 1 
       3449 1 1 1 1 103 GLU H    . 100 . HN   1 1 
       3449 1 2 1 1 103 GLU QG   . 100 . HG*  1 1 
       3450 1 1 1 1 103 GLU H    . 100 . HN   1 1 
       3450 1 2 1 1 103 GLU HG3  . 100 . HG1  1 1 
       3451 1 1 1 1 103 GLU H    . 100 . HN   1 1 
       3451 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3452 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3452 1 2 1 1 103 GLU HG2  . 100 . HG2  1 1 
       3453 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3453 1 2 1 1 103 GLU HG3  . 100 . HG1  1 1 
       3454 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3454 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3455 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3455 1 2 1 1 104 ILE HA   . 101 . HA   1 1 
       3456 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3456 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3457 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3457 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       3458 1 1 1 1 103 GLU HA   . 100 . HA   1 1 
       3458 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3459 1 1 1 1 103 GLU HB2  . 100 . HB2  1 1 
       3459 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3460 1 1 1 1 103 GLU HB3  . 100 . HB1  1 1 
       3460 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3461 1 1 1 1 103 GLU QG   . 100 . HG*  1 1 
       3461 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3462 1 1 1 1 103 GLU HG2  . 100 . HG2  1 1 
       3462 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3463 1 1 1 1 103 GLU HG3  . 100 . HG1  1 1 
       3463 1 2 1 1 104 ILE H    . 101 . HN   1 1 
       3464 1 1 1 1 104 ILE H    . 101 . HN   1 1 
       3464 1 2 1 1 104 ILE HB   . 101 . HB   1 1 
       3465 1 1 1 1 104 ILE H    . 101 . HN   1 1 
       3465 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3466 1 1 1 1 104 ILE H    . 101 . HN   1 1 
       3466 1 2 1 1 104 ILE HG12 . 101 . HG12 1 1 
       3467 1 1 1 1 104 ILE H    . 101 . HN   1 1 
       3467 1 2 1 1 104 ILE HG13 . 101 . HG11 1 1 
       3468 1 1 1 1 104 ILE H    . 101 . HN   1 1 
       3468 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3469 1 1 1 1 104 ILE HA   . 101 . HA   1 1 
       3469 1 2 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3470 1 1 1 1 104 ILE HA   . 101 . HA   1 1 
       3470 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3471 1 1 1 1 104 ILE HA   . 101 . HA   1 1 
       3471 1 2 1 1 105 GLU H    . 102 . HN   1 1 
       3472 1 1 1 1 104 ILE HA   . 101 . HA   1 1 
       3472 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       3473 1 1 1 1 104 ILE HA   . 101 . HA   1 1 
       3473 1 2 1 1 105 GLU HB2  . 102 . HB2  1 1 
       3474 1 1 1 1 104 ILE HB   . 101 . HB   1 1 
       3474 1 2 1 1 105 GLU H    . 102 . HN   1 1 
       3475 1 1 1 1 104 ILE HB   . 101 . HB   1 1 
       3475 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3476 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3476 1 2 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3477 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3477 1 2 1 1 105 GLU H    . 102 . HN   1 1 
       3478 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3478 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       3479 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3479 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3480 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3480 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3481 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3481 1 2 1 1 109 ILE HA   . 106 . HA   1 1 
       3482 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3482 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       3483 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3483 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3484 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3484 1 2 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3485 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3485 1 2 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3486 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3486 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3487 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3487 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3488 1 1 1 1 104 ILE MD   . 101 . HD1* 1 1 
       3488 1 2 1 1 113 LEU QD   . 110 . HD1* 1 1 
       3489 1 1 1 1 104 ILE HG12 . 101 . HG12 1 1 
       3489 1 2 1 1 105 GLU H    . 102 . HN   1 1 
       3490 1 1 1 1 104 ILE HG13 . 101 . HG11 1 1 
       3490 1 2 1 1 105 GLU H    . 102 . HN   1 1 
       3491 1 1 1 1 104 ILE HG13 . 101 . HG11 1 1 
       3491 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3492 1 1 1 1 104 ILE HG13 . 101 . HG11 1 1 
       3492 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3493 1 1 1 1 104 ILE HG13 . 101 . HG11 1 1 
       3493 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3494 1 1 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3494 1 2 1 1 105 GLU H    . 102 . HN   1 1 
       3495 1 1 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3495 1 2 1 1 105 GLU HA   . 102 . HA   1 1 
       3496 1 1 1 1 104 ILE MG   . 101 . HG2* 1 1 
       3496 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       3497 1 1 1 1 105 GLU H    . 102 . HN   1 1 
       3497 1 2 1 1 105 GLU HB2  . 102 . HB2  1 1 
       3498 1 1 1 1 105 GLU H    . 102 . HN   1 1 
       3498 1 2 1 1 105 GLU HB3  . 102 . HB1  1 1 
       3499 1 1 1 1 105 GLU H    . 102 . HN   1 1 
       3499 1 2 1 1 105 GLU QG   . 102 . HG*  1 1 
       3500 1 1 1 1 105 GLU H    . 102 . HN   1 1 
       3500 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3501 1 1 1 1 105 GLU H    . 102 . HN   1 1 
       3501 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3502 1 1 1 1 105 GLU HA   . 102 . HA   1 1 
       3502 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3503 1 1 1 1 105 GLU HA   . 102 . HA   1 1 
       3503 1 2 1 1 106 THR HA   . 103 . HA   1 1 
       3504 1 1 1 1 105 GLU HA   . 102 . HA   1 1 
       3504 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3505 1 1 1 1 105 GLU HB2  . 102 . HB2  1 1 
       3505 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3506 1 1 1 1 105 GLU HB3  . 102 . HB1  1 1 
       3506 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3507 1 1 1 1 105 GLU HB3  . 102 . HB1  1 1 
       3507 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3508 1 1 1 1 105 GLU QG   . 102 . HG*  1 1 
       3508 1 2 1 1 106 THR H    . 103 . HN   1 1 
       3509 1 1 1 1 105 GLU QG   . 102 . HG*  1 1 
       3509 1 2 1 1 106 THR HA   . 103 . HA   1 1 
       3510 1 1 1 1 106 THR H    . 103 . HN   1 1 
       3510 1 2 1 1 106 THR HB   . 103 . HB   1 1 
       3511 1 1 1 1 106 THR H    . 103 . HN   1 1 
       3511 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3512 1 1 1 1 106 THR H    . 103 . HN   1 1 
       3512 1 2 1 1 107 ASP H    . 104 . HN   1 1 
       3513 1 1 1 1 106 THR H    . 103 . HN   1 1 
       3513 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3514 1 1 1 1 106 THR H    . 103 . HN   1 1 
       3514 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3515 1 1 1 1 106 THR HA   . 103 . HA   1 1 
       3515 1 2 1 1 106 THR HB   . 103 . HB   1 1 
       3516 1 1 1 1 106 THR HA   . 103 . HA   1 1 
       3516 1 2 1 1 106 THR MG   . 103 . HG2* 1 1 
       3517 1 1 1 1 106 THR HA   . 103 . HA   1 1 
       3517 1 2 1 1 107 ASP H    . 104 . HN   1 1 
       3518 1 1 1 1 106 THR HA   . 103 . HA   1 1 
       3518 1 2 1 1 107 ASP QB   . 104 . HB*  1 1 
       3519 1 1 1 1 106 THR HA   . 103 . HA   1 1 
       3519 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3520 1 1 1 1 106 THR HA   . 103 . HA   1 1 
       3520 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3521 1 1 1 1 106 THR HB   . 103 . HB   1 1 
       3521 1 2 1 1 107 ASP H    . 104 . HN   1 1 
       3522 1 1 1 1 106 THR HB   . 103 . HB   1 1 
       3522 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3523 1 1 1 1 106 THR HB   . 103 . HB   1 1 
       3523 1 2 1 1 109 ILE HA   . 106 . HA   1 1 
       3524 1 1 1 1 106 THR HB   . 103 . HB   1 1 
       3524 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3525 1 1 1 1 106 THR HB   . 103 . HB   1 1 
       3525 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3526 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3526 1 2 1 1 107 ASP H    . 104 . HN   1 1 
       3527 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3527 1 2 1 1 107 ASP HA   . 104 . HA   1 1 
       3528 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3528 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3529 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3529 1 2 1 1 108 GLU HA   . 105 . HA   1 1 
       3530 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3530 1 2 1 1 108 GLU QB   . 105 . HB*  1 1 
       3531 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3531 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3532 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3532 1 2 1 1 109 ILE H    . 106 . HN   1 1 
       3533 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3533 1 2 1 1 109 ILE HA   . 106 . HA   1 1 
       3534 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3534 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       3535 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3535 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3536 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3536 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3537 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3537 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3538 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3538 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3539 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3539 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3540 1 1 1 1 106 THR MG   . 103 . HG2* 1 1 
       3540 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3541 1 1 1 1 107 ASP H    . 104 . HN   1 1 
       3541 1 2 1 1 107 ASP HB2  . 104 . HB2  1 1 
       3542 1 1 1 1 107 ASP H    . 104 . HN   1 1 
       3542 1 2 1 1 107 ASP QB   . 104 . HB*  1 1 
       3543 1 1 1 1 107 ASP H    . 104 . HN   1 1 
       3543 1 2 1 1 107 ASP HB3  . 104 . HB1  1 1 
       3544 1 1 1 1 107 ASP H    . 104 . HN   1 1 
       3544 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3545 1 1 1 1 107 ASP H    . 104 . HN   1 1 
       3545 1 2 1 1 108 GLU QB   . 105 . HB*  1 1 
       3546 1 1 1 1 107 ASP H    . 104 . HN   1 1 
       3546 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3547 1 1 1 1 107 ASP QB   . 104 . HB*  1 1 
       3547 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3548 1 1 1 1 107 ASP HB2  . 104 . HB2  1 1 
       3548 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3549 1 1 1 1 107 ASP HB2  . 104 . HB2  1 1 
       3549 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3550 1 1 1 1 107 ASP HB3  . 104 . HB1  1 1 
       3550 1 2 1 1 108 GLU H    . 105 . HN   1 1 
       3551 1 1 1 1 107 ASP HB3  . 104 . HB1  1 1 
       3551 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3552 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3552 1 2 1 1 108 GLU HB2  . 105 . HB2  1 1 
       3553 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3553 1 2 1 1 108 GLU HB3  . 105 . HB1  1 1 
       3554 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3554 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3555 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3555 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       3556 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3556 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3557 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3557 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3558 1 1 1 1 108 GLU H    . 105 . HN   1 1 
       3558 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3559 1 1 1 1 108 GLU HA   . 105 . HA   1 1 
       3559 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3560 1 1 1 1 108 GLU HA   . 105 . HA   1 1 
       3560 1 2 1 1 109 ILE H    . 106 . HN   1 1 
       3561 1 1 1 1 108 GLU HA   . 105 . HA   1 1 
       3561 1 2 1 1 109 ILE HA   . 106 . HA   1 1 
       3562 1 1 1 1 108 GLU HA   . 105 . HA   1 1 
       3562 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       3563 1 1 1 1 108 GLU HA   . 105 . HA   1 1 
       3563 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3564 1 1 1 1 108 GLU HA   . 105 . HA   1 1 
       3564 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3565 1 1 1 1 108 GLU QB   . 105 . HB*  1 1 
       3565 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3566 1 1 1 1 108 GLU QB   . 105 . HB*  1 1 
       3566 1 2 1 1 109 ILE H    . 106 . HN   1 1 
       3567 1 1 1 1 108 GLU QB   . 105 . HB*  1 1 
       3567 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3568 1 1 1 1 108 GLU QB   . 105 . HB*  1 1 
       3568 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3569 1 1 1 1 108 GLU HB2  . 105 . HB2  1 1 
       3569 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3570 1 1 1 1 108 GLU HB2  . 105 . HB2  1 1 
       3570 1 2 1 1 109 ILE H    . 106 . HN   1 1 
       3571 1 1 1 1 108 GLU HB2  . 105 . HB2  1 1 
       3571 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3572 1 1 1 1 108 GLU HB2  . 105 . HB2  1 1 
       3572 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3573 1 1 1 1 108 GLU HB3  . 105 . HB1  1 1 
       3573 1 2 1 1 108 GLU QG   . 105 . HG*  1 1 
       3574 1 1 1 1 108 GLU HB3  . 105 . HB1  1 1 
       3574 1 2 1 1 109 ILE H    . 106 . HN   1 1 
       3575 1 1 1 1 108 GLU HB3  . 105 . HB1  1 1 
       3575 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3576 1 1 1 1 108 GLU HB3  . 105 . HB1  1 1 
       3576 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3577 1 1 1 1 108 GLU QG   . 105 . HG*  1 1 
       3577 1 2 1 1 109 ILE H    . 106 . HN   1 1 
       3578 1 1 1 1 108 GLU QG   . 105 . HG*  1 1 
       3578 1 2 1 1 111 THR H    . 108 . HN   1 1 
       3579 1 1 1 1 108 GLU QG   . 105 . HG*  1 1 
       3579 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3580 1 1 1 1 108 GLU QG   . 105 . HG*  1 1 
       3580 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3581 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3581 1 2 1 1 109 ILE HB   . 106 . HB   1 1 
       3582 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3582 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3583 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3583 1 2 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3584 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3584 1 2 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3585 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3585 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3586 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3586 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3587 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3587 1 2 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3588 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3588 1 2 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3589 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3589 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3590 1 1 1 1 109 ILE H    . 106 . HN   1 1 
       3590 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3591 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3591 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3592 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3592 1 2 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3593 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3593 1 2 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3594 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3594 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3595 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3595 1 2 1 1 111 THR H    . 108 . HN   1 1 
       3596 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3596 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3597 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3597 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3598 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3598 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3599 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3599 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3600 1 1 1 1 109 ILE HA   . 106 . HA   1 1 
       3600 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3601 1 1 1 1 109 ILE HB   . 106 . HB   1 1 
       3601 1 2 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3602 1 1 1 1 109 ILE HB   . 106 . HB   1 1 
       3602 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3603 1 1 1 1 109 ILE HB   . 106 . HB   1 1 
       3603 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3604 1 1 1 1 109 ILE HB   . 106 . HB   1 1 
       3604 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       3605 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3605 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3606 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3606 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3607 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3607 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3608 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3608 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
       3609 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3609 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3610 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3610 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3611 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3611 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3612 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3612 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3613 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3613 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3614 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3614 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3615 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3615 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       3616 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3616 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
       3617 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3617 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3618 1 1 1 1 109 ILE MD   . 106 . HD1* 1 1 
       3618 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3619 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3619 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3620 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3620 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3621 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3621 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3622 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3622 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       3623 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3623 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3624 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3624 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3625 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3625 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3626 1 1 1 1 109 ILE HG12 . 106 . HG12 1 1 
       3626 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3627 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3627 1 2 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3628 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3628 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3629 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3629 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3630 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3630 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3631 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3631 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3632 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3632 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       3633 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3633 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3634 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3634 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3635 1 1 1 1 109 ILE HG13 . 106 . HG11 1 1 
       3635 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3636 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3636 1 2 1 1 110 GLY H    . 107 . HN   1 1 
       3637 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3637 1 2 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3638 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3638 1 2 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3639 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3639 1 2 1 1 111 THR H    . 108 . HN   1 1 
       3640 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3640 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       3641 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3641 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       3642 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3642 1 2 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3643 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3643 1 2 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3644 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3644 1 2 1 1 118 GLN QE   . 115 . HE2* 1 1 
       3645 1 1 1 1 109 ILE MG   . 106 . HG2* 1 1 
       3645 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3646 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3646 1 2 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3647 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3647 1 2 1 1 111 THR H    . 108 . HN   1 1 
       3648 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3648 1 2 1 1 111 THR HB   . 108 . HB   1 1 
       3649 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3649 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3650 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3650 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3651 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3651 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3652 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3652 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3653 1 1 1 1 110 GLY H    . 107 . HN   1 1 
       3653 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3654 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3654 1 2 1 1 111 THR HA   . 108 . HA   1 1 
       3655 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3655 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3656 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3656 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3657 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3657 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3658 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3658 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3659 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3659 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3660 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3660 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3661 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3661 1 2 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3662 1 1 1 1 110 GLY HA2  . 107 . HA2  1 1 
       3662 1 2 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3663 1 1 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3663 1 2 1 1 111 THR HA   . 108 . HA   1 1 
       3664 1 1 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3664 1 2 1 1 111 THR HB   . 108 . HB   1 1 
       3665 1 1 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3665 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3666 1 1 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3666 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3667 1 1 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3667 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3668 1 1 1 1 110 GLY HA3  . 107 . HA1  1 1 
       3668 1 2 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3669 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3669 1 2 1 1 111 THR HB   . 108 . HB   1 1 
       3670 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3670 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3671 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3671 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3672 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3672 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3673 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3673 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3674 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3674 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3675 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3675 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3676 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3676 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3677 1 1 1 1 111 THR H    . 108 . HN   1 1 
       3677 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3678 1 1 1 1 111 THR HA   . 108 . HA   1 1 
       3678 1 2 1 1 111 THR MG   . 108 . HG2* 1 1 
       3679 1 1 1 1 111 THR HA   . 108 . HA   1 1 
       3679 1 2 1 1 112 LEU HA   . 109 . HA   1 1 
       3680 1 1 1 1 111 THR HA   . 108 . HA   1 1 
       3680 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3681 1 1 1 1 111 THR HA   . 108 . HA   1 1 
       3681 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3682 1 1 1 1 111 THR HA   . 108 . HA   1 1 
       3682 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3683 1 1 1 1 111 THR HA   . 108 . HA   1 1 
       3683 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3684 1 1 1 1 111 THR HB   . 108 . HB   1 1 
       3684 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3685 1 1 1 1 111 THR HB   . 108 . HB   1 1 
       3685 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3686 1 1 1 1 111 THR HB   . 108 . HB   1 1 
       3686 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3687 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3687 1 2 1 1 112 LEU H    . 109 . HN   1 1 
       3688 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3688 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3689 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3689 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3690 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3690 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3691 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3691 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3692 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3692 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3693 1 1 1 1 111 THR MG   . 108 . HG2* 1 1 
       3693 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3694 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3694 1 2 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3695 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3695 1 2 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3696 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3696 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3697 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3697 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3698 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3698 1 2 1 1 112 LEU HG   . 109 . HG   1 1 
       3699 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3699 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3700 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3700 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3701 1 1 1 1 112 LEU H    . 109 . HN   1 1 
       3701 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       3702 1 1 1 1 112 LEU HA   . 109 . HA   1 1 
       3702 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3703 1 1 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3703 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3704 1 1 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3704 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3705 1 1 1 1 112 LEU HB2  . 109 . HB2  1 1 
       3705 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3706 1 1 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3706 1 2 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3707 1 1 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3707 1 2 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3708 1 1 1 1 112 LEU HB3  . 109 . HB1  1 1 
       3708 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3709 1 1 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3709 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3710 1 1 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3710 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3711 1 1 1 1 112 LEU MD1  . 109 . HD1* 1 1 
       3711 1 2 1 1 113 LEU QD   . 110 . HD*  1 1 
       3712 1 1 1 1 112 LEU MD2  . 109 . HD2* 1 1 
       3712 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3713 1 1 1 1 112 LEU HG   . 109 . HG   1 1 
       3713 1 2 1 1 113 LEU H    . 110 . HN   1 1 
       3714 1 1 1 1 112 LEU HG   . 109 . HG   1 1 
       3714 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3715 1 1 1 1 113 LEU H    . 110 . HN   1 1 
       3715 1 2 1 1 113 LEU QB   . 110 . HB*  1 1 
       3716 1 1 1 1 113 LEU H    . 110 . HN   1 1 
       3716 1 2 1 1 113 LEU QD   . 110 . HD2* 1 1 
       3717 1 1 1 1 113 LEU H    . 110 . HN   1 1 
       3717 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
       3718 1 1 1 1 113 LEU H    . 110 . HN   1 1 
       3718 1 2 1 1 114 THR H    . 111 . HN   1 1 
       3719 1 1 1 1 113 LEU H    . 110 . HN   1 1 
       3719 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3720 1 1 1 1 113 LEU H    . 110 . HN   1 1 
       3720 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3721 1 1 1 1 113 LEU HA   . 110 . HA   1 1 
       3721 1 2 1 1 113 LEU QD   . 110 . HD1* 1 1 
       3722 1 1 1 1 113 LEU HA   . 110 . HA   1 1 
       3722 1 2 1 1 113 LEU HG   . 110 . HG   1 1 
       3723 1 1 1 1 113 LEU HA   . 110 . HA   1 1 
       3723 1 2 1 1 114 THR H    . 111 . HN   1 1 
       3724 1 1 1 1 113 LEU HA   . 110 . HA   1 1 
       3724 1 2 1 1 114 THR HA   . 111 . HA   1 1 
       3725 1 1 1 1 113 LEU HA   . 110 . HA   1 1 
       3725 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       3726 1 1 1 1 113 LEU HA   . 110 . HA   1 1 
       3726 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3727 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3727 1 2 1 1 114 THR H    . 111 . HN   1 1 
       3728 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3728 1 2 1 1 114 THR HA   . 111 . HA   1 1 
       3729 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3729 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       3730 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3730 1 2 1 1 115 LEU H    . 112 . HN   1 1 
       3731 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3731 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3732 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3732 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3733 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3733 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3734 1 1 1 1 113 LEU QB   . 110 . HB*  1 1 
       3734 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       3735 1 1 1 1 113 LEU QD   . 110 . HD1* 1 1 
       3735 1 2 1 1 114 THR H    . 111 . HN   1 1 
       3736 1 1 1 1 113 LEU QD   . 110 . HD*  1 1 
       3736 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       3737 1 1 1 1 113 LEU QD   . 110 . HD*  1 1 
       3737 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3738 1 1 1 1 113 LEU QD   . 110 . HD*  1 1 
       3738 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       3739 1 1 1 1 113 LEU HG   . 110 . HG   1 1 
       3739 1 2 1 1 114 THR H    . 111 . HN   1 1 
       3740 1 1 1 1 113 LEU HG   . 110 . HG   1 1 
       3740 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       3741 1 1 1 1 113 LEU HG   . 110 . HG   1 1 
       3741 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3742 1 1 1 1 114 THR H    . 111 . HN   1 1 
       3742 1 2 1 1 114 THR HB   . 111 . HB   1 1 
       3743 1 1 1 1 114 THR H    . 111 . HN   1 1 
       3743 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       3744 1 1 1 1 114 THR H    . 111 . HN   1 1 
       3744 1 2 1 1 115 LEU H    . 112 . HN   1 1 
       3745 1 1 1 1 114 THR H    . 111 . HN   1 1 
       3745 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3746 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3746 1 2 1 1 114 THR MG   . 111 . HG2* 1 1 
       3747 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3747 1 2 1 1 115 LEU H    . 112 . HN   1 1 
       3748 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3748 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       3749 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3749 1 2 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3750 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3750 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3751 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3751 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3752 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3752 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3753 1 1 1 1 114 THR HA   . 111 . HA   1 1 
       3753 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       3754 1 1 1 1 114 THR HB   . 111 . HB   1 1 
       3754 1 2 1 1 115 LEU H    . 112 . HN   1 1 
       3755 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3755 1 2 1 1 115 LEU H    . 112 . HN   1 1 
       3756 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3756 1 2 1 1 115 LEU HA   . 112 . HA   1 1 
       3757 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3757 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3758 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3758 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3759 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3759 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3760 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3760 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3761 1 1 1 1 114 THR MG   . 111 . HG2* 1 1 
       3761 1 2 1 1 116 VAL HA   . 113 . HA   1 1 
       3762 1 1 1 1 115 LEU H    . 112 . HN   1 1 
       3762 1 2 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3763 1 1 1 1 115 LEU H    . 112 . HN   1 1 
       3763 1 2 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3764 1 1 1 1 115 LEU H    . 112 . HN   1 1 
       3764 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3765 1 1 1 1 115 LEU H    . 112 . HN   1 1 
       3765 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3766 1 1 1 1 115 LEU H    . 112 . HN   1 1 
       3766 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3767 1 1 1 1 115 LEU H    . 112 . HN   1 1 
       3767 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       3768 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3768 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3769 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3769 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3770 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3770 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3771 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3771 1 2 1 1 115 LEU HG   . 112 . HG   1 1 
       3772 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3772 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3773 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3773 1 2 1 1 116 VAL HA   . 113 . HA   1 1 
       3774 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3774 1 2 1 1 116 VAL HB   . 113 . HB   1 1 
       3775 1 1 1 1 115 LEU HA   . 112 . HA   1 1 
       3775 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3776 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3776 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3777 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3777 1 2 1 1 115 LEU QD   . 112 . HD*  1 1 
       3778 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3778 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3779 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3779 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3780 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3780 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       3781 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3781 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3782 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3782 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3783 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3783 1 2 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3784 1 1 1 1 115 LEU HB2  . 112 . HB2  1 1 
       3784 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3785 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3785 1 2 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3786 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3786 1 2 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3787 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3787 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3788 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3788 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       3789 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3789 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3790 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3790 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3791 1 1 1 1 115 LEU HB3  . 112 . HB1  1 1 
       3791 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3792 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3792 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3793 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3793 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       3794 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3794 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3795 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3795 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       3796 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3796 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3797 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3797 1 2 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3798 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3798 1 2 1 1 118 GLN QE   . 115 . HE2* 1 1 
       3799 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3799 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3800 1 1 1 1 115 LEU QD   . 112 . HD*  1 1 
       3800 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3801 1 1 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3801 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3802 1 1 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3802 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3803 1 1 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3803 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3804 1 1 1 1 115 LEU MD1  . 112 . HD1* 1 1 
       3804 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3805 1 1 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3805 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3806 1 1 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3806 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3807 1 1 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3807 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3808 1 1 1 1 115 LEU MD2  . 112 . HD2* 1 1 
       3808 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3809 1 1 1 1 115 LEU HG   . 112 . HG   1 1 
       3809 1 2 1 1 116 VAL H    . 113 . HN   1 1 
       3810 1 1 1 1 115 LEU HG   . 112 . HG   1 1 
       3810 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3811 1 1 1 1 116 VAL H    . 113 . HN   1 1 
       3811 1 2 1 1 116 VAL HB   . 113 . HB   1 1 
       3812 1 1 1 1 116 VAL H    . 113 . HN   1 1 
       3812 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       3813 1 1 1 1 116 VAL H    . 113 . HN   1 1 
       3813 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3814 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3814 1 2 1 1 116 VAL HB   . 113 . HB   1 1 
       3815 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3815 1 2 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       3816 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3816 1 2 1 1 116 VAL QG   . 113 . HG*  1 1 
       3817 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3817 1 2 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       3818 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3818 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3819 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3819 1 2 1 1 117 ASP HA   . 114 . HA   1 1 
       3820 1 1 1 1 116 VAL HA   . 113 . HA   1 1 
       3820 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3821 1 1 1 1 116 VAL HB   . 113 . HB   1 1 
       3821 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3822 1 1 1 1 116 VAL HB   . 113 . HB   1 1 
       3822 1 2 1 1 117 ASP HA   . 114 . HA   1 1 
       3823 1 1 1 1 116 VAL QG   . 113 . HG*  1 1 
       3823 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3824 1 1 1 1 116 VAL QG   . 113 . HG*  1 1 
       3824 1 2 1 1 117 ASP HA   . 114 . HA   1 1 
       3825 1 1 1 1 116 VAL QG   . 113 . HG*  1 1 
       3825 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       3826 1 1 1 1 116 VAL QG   . 113 . HG*  1 1 
       3826 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3827 1 1 1 1 116 VAL MG1  . 113 . HG1* 1 1 
       3827 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3828 1 1 1 1 116 VAL MG2  . 113 . HG2* 1 1 
       3828 1 2 1 1 117 ASP H    . 114 . HN   1 1 
       3829 1 1 1 1 117 ASP H    . 114 . HN   1 1 
       3829 1 2 1 1 117 ASP QB   . 114 . HB*  1 1 
       3830 1 1 1 1 117 ASP H    . 114 . HN   1 1 
       3830 1 2 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3831 1 1 1 1 117 ASP QB   . 114 . HB*  1 1 
       3831 1 2 1 1 118 GLN H    . 115 . HN   1 1 
       3832 1 1 1 1 118 GLN H    . 115 . HN   1 1 
       3832 1 2 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3833 1 1 1 1 118 GLN H    . 115 . HN   1 1 
       3833 1 2 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3834 1 1 1 1 118 GLN H    . 115 . HN   1 1 
       3834 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3835 1 1 1 1 118 GLN H    . 115 . HN   1 1 
       3835 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3836 1 1 1 1 118 GLN H    . 115 . HN   1 1 
       3836 1 2 1 1 119 PRO HD3  . 116 . HD1  1 1 
       3837 1 1 1 1 118 GLN HA   . 115 . HA   1 1 
       3837 1 2 1 1 118 GLN QE   . 115 . HE2* 1 1 
       3838 1 1 1 1 118 GLN HA   . 115 . HA   1 1 
       3838 1 2 1 1 118 GLN QG   . 115 . HG*  1 1 
       3839 1 1 1 1 118 GLN HA   . 115 . HA   1 1 
       3839 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3840 1 1 1 1 118 GLN HA   . 115 . HA   1 1 
       3840 1 2 1 1 119 PRO HD3  . 116 . HD1  1 1 
       3841 1 1 1 1 118 GLN HA   . 115 . HA   1 1 
       3841 1 2 1 1 119 PRO QG   . 116 . HG*  1 1 
       3842 1 1 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3842 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3843 1 1 1 1 118 GLN HB2  . 115 . HB2  1 1 
       3843 1 2 1 1 119 PRO HD3  . 116 . HD1  1 1 
       3844 1 1 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3844 1 2 1 1 119 PRO HA   . 116 . HA   1 1 
       3845 1 1 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3845 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3846 1 1 1 1 118 GLN HB3  . 115 . HB1  1 1 
       3846 1 2 1 1 119 PRO HD3  . 116 . HD1  1 1 
       3847 1 1 1 1 118 GLN QG   . 115 . HG*  1 1 
       3847 1 2 1 1 119 PRO HD2  . 116 . HD2  1 1 
       3848 1 1 1 1 118 GLN QG   . 115 . HG*  1 1 
       3848 1 2 1 1 119 PRO HD3  . 116 . HD1  1 1 
       3849 1 1 1 1 118 GLN QG   . 115 . HG*  1 1 
       3849 1 2 1 1 119 PRO QG   . 116 . HG*  1 1 
       3850 1 1 1 1 119 PRO HA   . 116 . HA   1 1 
       3850 1 2 1 1 120 GLN H    . 117 . HN   1 1 
       3851 1 1 1 1 119 PRO HA   . 116 . HA   1 1 
       3851 1 2 1 1 120 GLN HA   . 117 . HA   1 1 
       3852 1 1 1 1 119 PRO HA   . 116 . HA   1 1 
       3852 1 2 1 1 120 GLN QB   . 117 . HB*  1 1 
       3853 1 1 1 1 119 PRO HA   . 116 . HA   1 1 
       3853 1 2 1 1 120 GLN QG   . 117 . HG*  1 1 
       3854 1 1 1 1 119 PRO QB   . 116 . HB*  1 1 
       3854 1 2 1 1 120 GLN H    . 117 . HN   1 1 
       3855 1 1 1 1 119 PRO HB2  . 116 . HB2  1 1 
       3855 1 2 1 1 120 GLN H    . 117 . HN   1 1 
       3856 1 1 1 1 119 PRO HB3  . 116 . HB1  1 1 
       3856 1 2 1 1 120 GLN H    . 117 . HN   1 1 
       3857 1 1 1 1 119 PRO QG   . 116 . HG*  1 1 
       3857 1 2 1 1 120 GLN H    . 117 . HN   1 1 
       3858 1 1 1 1 120 GLN H    . 117 . HN   1 1 
       3858 1 2 1 1 120 GLN HB2  . 117 . HB2  1 1 
       3859 1 1 1 1 120 GLN H    . 117 . HN   1 1 
       3859 1 2 1 1 120 GLN HB3  . 117 . HB1  1 1 
       3860 1 1 1 1 120 GLN H    . 117 . HN   1 1 
       3860 1 2 1 1 120 GLN QG   . 117 . HG*  1 1 
       3861 1 1 1 1 120 GLN H    . 117 . HN   1 1 
       3861 1 2 1 1 121 ALA H    . 118 . HN   1 1 
       3862 1 1 1 1 120 GLN HA   . 117 . HA   1 1 
       3862 1 2 1 1 121 ALA H    . 118 . HN   1 1 
       3863 1 1 1 1 120 GLN HA   . 117 . HA   1 1 
       3863 1 2 1 1 121 ALA HA   . 118 . HA   1 1 
       3864 1 1 1 1 120 GLN QB   . 117 . HB*  1 1 
       3864 1 2 1 1 121 ALA H    . 118 . HN   1 1 
       3865 1 1 1 1 120 GLN QB   . 117 . HB*  1 1 
       3865 1 2 1 1 121 ALA MB   . 118 . HB*  1 1 
       3866 1 1 1 1 120 GLN HB2  . 117 . HB2  1 1 
       3866 1 2 1 1 121 ALA H    . 118 . HN   1 1 
       3867 1 1 1 1 120 GLN HB2  . 117 . HB2  1 1 
       3867 1 2 1 1 121 ALA MB   . 118 . HB*  1 1 
       3868 1 1 1 1 120 GLN HB3  . 117 . HB1  1 1 
       3868 1 2 1 1 121 ALA H    . 118 . HN   1 1 
       3869 1 1 1 1 120 GLN HB3  . 117 . HB1  1 1 
       3869 1 2 1 1 121 ALA MB   . 118 . HB*  1 1 
       3870 1 1 1 1 120 GLN QG   . 117 . HG*  1 1 
       3870 1 2 1 1 121 ALA MB   . 118 . HB*  1 1 
       3871 1 1 1 1 121 ALA H    . 118 . HN   1 1 
       3871 1 2 1 1 121 ALA MB   . 118 . HB*  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 3.0 1.8 3.5 1 1 
          2 1 . . . . . 3.0 1.8 3.5 1 1 
          3 1 . . . . . 4.0 1.8 5.0 1 1 
          4 1 . . . . . 4.0 1.8 6.0 1 1 
          5 1 . . . . . 4.0 1.8 5.0 1 1 
          6 1 . . . . . 4.0 1.8 6.0 1 1 
          7 1 . . . . . 4.0 1.8 6.0 1 1 
          8 1 . . . . . 4.0 1.8 5.0 1 1 
          9 1 . . . . . 4.0 1.8 6.0 1 1 
         10 1 . . . . . 4.0 1.8 6.0 1 1 
         11 1 . . . . . 3.0 1.8 3.5 1 1 
         12 1 . . . . . 4.0 1.8 6.0 1 1 
         13 1 . . . . . 4.0 1.8 5.0 1 1 
         14 1 . . . . . 4.0 1.8 5.0 1 1 
         15 1 . . . . . 3.0 1.8 3.5 1 1 
         16 1 . . . . . 4.0 1.8 6.0 1 1 
         17 1 . . . . . 4.0 1.8 5.0 1 1 
         18 1 . . . . . 4.0 1.8 5.0 1 1 
         19 1 . . . . . 4.0 1.8 5.0 1 1 
         20 1 . . . . . 4.0 1.8 6.0 1 1 
         21 1 . . . . . 4.0 1.8 5.0 1 1 
         22 1 . . . . . 4.0 1.8 5.0 1 1 
         23 1 . . . . . 4.0 1.8 6.0 1 1 
         24 1 . . . . . 4.0 1.8 5.0 1 1 
         25 1 . . . . . 4.0 1.8 6.0 1 1 
         26 1 . . . . . 4.0 1.8 6.0 1 1 
         27 1 . . . . . 4.0 1.8 5.0 1 1 
         28 1 . . . . . 4.0 1.8 6.0 1 1 
         29 1 . . . . . 3.0 1.8 3.5 1 1 
         30 1 . . . . . 3.0 1.8 3.5 1 1 
         31 1 . . . . . 4.0 1.8 5.0 1 1 
         32 1 . . . . . 4.0 1.8 5.0 1 1 
         33 1 . . . . . 4.0 1.8 5.0 1 1 
         34 1 . . . . . 4.0 1.8 6.0 1 1 
         35 1 . . . . . 4.0 1.8 5.0 1 1 
         36 1 . . . . . 4.0 1.8 5.0 1 1 
         37 1 . . . . . 4.0 1.8 5.0 1 1 
         38 1 . . . . . 4.0 1.8 5.0 1 1 
         39 1 . . . . . 4.0 1.8 5.0 1 1 
         40 1 . . . . . 4.0 1.8 6.0 1 1 
         41 1 . . . . . 3.0 1.8 3.5 1 1 
         42 1 . . . . . 3.0 1.8 3.5 1 1 
         43 1 . . . . . 4.0 1.8 5.0 1 1 
         44 1 . . . . . 4.0 1.8 5.0 1 1 
         45 1 . . . . . 4.0 1.8 5.0 1 1 
         46 1 . . . . . 4.0 1.8 6.0 1 1 
         47 1 . . . . . 4.0 1.8 5.0 1 1 
         48 1 . . . . . 4.0 1.8 6.0 1 1 
         49 1 . . . . . 4.0 1.8 5.0 1 1 
         50 1 . . . . . 4.0 1.8 6.0 1 1 
         51 1 . . . . . 4.0 1.8 5.0 1 1 
         52 1 . . . . . 4.0 1.8 5.0 1 1 
         53 1 . . . . . 4.0 1.8 6.0 1 1 
         54 1 . . . . . 4.0 1.8 5.0 1 1 
         55 1 . . . . . 4.0 1.8 5.0 1 1 
         56 1 . . . . . 4.0 1.8 5.0 1 1 
         57 1 . . . . . 4.0 1.8 5.0 1 1 
         58 1 . . . . . 3.0 1.8 3.5 1 1 
         59 1 . . . . . 4.0 1.8 5.0 1 1 
         60 1 . . . . . 4.0 1.8 5.0 1 1 
         61 1 . . . . . 4.0 1.8 5.0 1 1 
         62 1 . . . . . 4.0 1.8 5.0 1 1 
         63 1 . . . . .   . 1.8 3.5 1 1 
         64 1 . . . . . 3.0 1.8 3.5 1 1 
         65 1 . . . . . 4.0 1.8 5.0 1 1 
         66 1 . . . . . 4.0 1.8 5.0 1 1 
         67 1 . . . . . 4.0 1.8 5.0 1 1 
         68 1 . . . . . 4.0 1.8 5.0 1 1 
         69 1 . . . . .   . 1.8 3.5 1 1 
         70 1 . . . . . 4.0 1.8 5.0 1 1 
         71 1 . . . . . 3.0 1.8 3.5 1 1 
         72 1 . . . . . 4.0 1.8 5.0 1 1 
         73 1 . . . . . 4.0 1.8 6.0 1 1 
         74 1 . . . . . 4.0 1.8 5.0 1 1 
         75 1 . . . . . 4.0 1.8 5.0 1 1 
         76 1 . . . . . 4.0 1.8 5.0 1 1 
         77 1 . . . . . 4.0 1.8 5.0 1 1 
         78 1 . . . . . 4.0 1.8 5.0 1 1 
         79 1 . . . . . 4.0 1.8 6.0 1 1 
         80 1 . . . . . 4.0 1.8 5.0 1 1 
         81 1 . . . . . 4.0 1.8 5.0 1 1 
         82 1 . . . . . 4.0 1.8 5.0 1 1 
         83 1 . . . . . 4.0 1.8 6.0 1 1 
         84 1 . . . . . 4.0 1.8 6.0 1 1 
         85 1 . . . . . 4.0 1.8 5.0 1 1 
         86 1 . . . . . 4.0 1.8 5.0 1 1 
         87 1 . . . . . 4.0 1.8 5.0 1 1 
         88 1 . . . . . 4.0 1.8 5.0 1 1 
         89 1 . . . . . 4.0 1.8 5.0 1 1 
         90 1 . . . . . 3.0 1.8 3.5 1 1 
         91 1 . . . . . 4.0 1.8 5.0 1 1 
         92 1 . . . . . 4.0 1.8 5.0 1 1 
         93 1 . . . . .   . 1.8 3.5 1 1 
         94 1 . . . . . 4.0 1.8 5.0 1 1 
         95 1 . . . . . 4.0 1.8 5.0 1 1 
         96 1 . . . . .   . 1.8 3.5 1 1 
         97 1 . . . . . 4.0 1.8 5.0 1 1 
         98 1 . . . . . 4.0 1.8 6.0 1 1 
         99 1 . . . . . 4.0 1.8 5.0 1 1 
        100 1 . . . . . 4.0 1.8 6.0 1 1 
        101 1 . . . . .   . 1.8 3.5 1 1 
        102 1 . . . . . 4.0 1.8 6.0 1 1 
        103 1 . . . . . 4.0 1.8 5.0 1 1 
        104 1 . . . . . 4.0 1.8 6.0 1 1 
        105 1 . . . . . 4.0 1.8 6.0 1 1 
        106 1 . . . . . 4.0 1.8 6.0 1 1 
        107 1 . . . . . 4.0 1.8 5.0 1 1 
        108 1 . . . . . 4.0 1.8 6.0 1 1 
        109 1 . . . . . 4.0 1.8 5.0 1 1 
        110 1 . . . . . 3.0 1.8 3.5 1 1 
        111 1 . . . . . 4.0 1.8 5.0 1 1 
        112 1 . . . . . 4.0 1.8 6.0 1 1 
        113 1 . . . . . 3.0 1.8 3.5 1 1 
        114 1 . . . . . 4.0 1.8 5.0 1 1 
        115 1 . . . . . 4.0 1.8 5.0 1 1 
        116 1 . . . . . 4.0 1.8 5.0 1 1 
        117 1 . . . . . 4.0 1.8 5.0 1 1 
        118 1 . . . . . 4.0 1.8 5.0 1 1 
        119 1 . . . . . 3.0 1.8 3.5 1 1 
        120 1 . . . . . 4.0 1.8 5.0 1 1 
        121 1 . . . . . 3.0 1.8 3.5 1 1 
        122 1 . . . . . 4.0 1.8 5.0 1 1 
        123 1 . . . . . 4.0 1.8 6.0 1 1 
        124 1 . . . . . 4.0 1.8 6.0 1 1 
        125 1 . . . . . 4.0 1.8 5.0 1 1 
        126 1 . . . . . 4.0 1.8 5.0 1 1 
        127 1 . . . . . 3.0 1.8 3.5 1 1 
        128 1 . . . . . 3.0 1.8 3.5 1 1 
        129 1 . . . . . 4.0 1.8 5.0 1 1 
        130 1 . . . . . 4.0 1.8 5.0 1 1 
        131 1 . . . . . 4.0 1.8 5.0 1 1 
        132 1 . . . . . 4.0 1.8 5.0 1 1 
        133 1 . . . . . 4.0 1.8 5.0 1 1 
        134 1 . . . . . 4.0 1.8 6.0 1 1 
        135 1 . . . . . 4.0 1.8 5.0 1 1 
        136 1 . . . . . 4.0 1.8 5.0 1 1 
        137 1 . . . . . 3.0 1.8 3.5 1 1 
        138 1 . . . . . 3.0 1.8 3.5 1 1 
        139 1 . . . . . 3.0 1.8 3.5 1 1 
        140 1 . . . . . 4.0 1.8 5.0 1 1 
        141 1 . . . . . 4.0 1.8 5.0 1 1 
        142 1 . . . . . 4.0 1.8 5.0 1 1 
        143 1 . . . . . 4.0 1.8 5.0 1 1 
        144 1 . . . . . 3.0 1.8 3.5 1 1 
        145 1 . . . . . 4.0 1.8 5.0 1 1 
        146 1 . . . . . 4.0 1.8 5.0 1 1 
        147 1 . . . . . 4.0 1.8 5.0 1 1 
        148 1 . . . . . 4.0 1.8 5.0 1 1 
        149 1 . . . . . 4.0 1.8 5.0 1 1 
        150 1 . . . . . 4.0 1.8 6.0 1 1 
        151 1 . . . . . 4.0 1.8 5.0 1 1 
        152 1 . . . . . 4.0 1.8 5.0 1 1 
        153 1 . . . . . 4.0 1.8 6.0 1 1 
        154 1 . . . . . 4.0 1.8 5.0 1 1 
        155 1 . . . . . 4.0 1.8 5.0 1 1 
        156 1 . . . . . 4.0 1.8 6.0 1 1 
        157 1 . . . . . 4.0 1.8 6.0 1 1 
        158 1 . . . . . 4.0 1.8 5.0 1 1 
        159 1 . . . . . 3.0 1.8 3.5 1 1 
        160 1 . . . . . 3.0 1.8 3.5 1 1 
        161 1 . . . . . 3.0 1.8 3.5 1 1 
        162 1 . . . . . 4.0 1.8 6.0 1 1 
        163 1 . . . . . 4.0 1.8 6.0 1 1 
        164 1 . . . . . 4.0 1.8 5.0 1 1 
        165 1 . . . . . 4.0 1.8 5.0 1 1 
        166 1 . . . . . 4.0 1.8 6.0 1 1 
        167 1 . . . . . 4.0 1.8 5.0 1 1 
        168 1 . . . . . 4.0 1.8 5.0 1 1 
        169 1 . . . . . 4.0 1.8 5.0 1 1 
        170 1 . . . . . 4.0 1.8 6.0 1 1 
        171 1 . . . . . 4.0 1.8 5.0 1 1 
        172 1 . . . . . 4.0 1.8 6.0 1 1 
        173 1 . . . . . 4.0 1.8 5.0 1 1 
        174 1 . . . . . 4.0 1.8 5.0 1 1 
        175 1 . . . . . 4.0 1.8 5.0 1 1 
        176 1 . . . . . 4.0 1.8 6.0 1 1 
        177 1 . . . . . 4.0 1.8 5.0 1 1 
        178 1 . . . . . 4.0 1.8 6.0 1 1 
        179 1 . . . . . 4.0 1.8 5.0 1 1 
        180 1 . . . . . 3.0 1.8 3.5 1 1 
        181 1 . . . . . 4.0 1.8 5.0 1 1 
        182 1 . . . . . 4.0 1.8 5.0 1 1 
        183 1 . . . . . 4.0 1.8 6.0 1 1 
        184 1 . . . . . 4.0 1.8 6.0 1 1 
        185 1 . . . . . 4.0 1.8 5.0 1 1 
        186 1 . . . . . 4.0 1.8 6.0 1 1 
        187 1 . . . . . 4.0 1.8 6.0 1 1 
        188 1 . . . . . 4.0 1.8 5.0 1 1 
        189 1 . . . . . 4.0 1.8 6.0 1 1 
        190 1 . . . . . 4.0 1.8 5.0 1 1 
        191 1 . . . . . 4.0 1.8 5.0 1 1 
        192 1 . . . . . 4.0 1.8 5.0 1 1 
        193 1 . . . . . 4.0 1.8 5.0 1 1 
        194 1 . . . . . 4.0 1.8 5.0 1 1 
        195 1 . . . . . 4.0 1.8 5.0 1 1 
        196 1 . . . . . 4.0 1.8 5.0 1 1 
        197 1 . . . . . 4.0 1.8 5.0 1 1 
        198 1 . . . . . 4.0 1.8 5.0 1 1 
        199 1 . . . . . 4.0 1.8 6.0 1 1 
        200 1 . . . . . 4.0 1.8 5.0 1 1 
        201 1 . . . . . 4.0 1.8 5.0 1 1 
        202 1 . . . . . 4.0 1.8 6.0 1 1 
        203 1 . . . . . 4.0 1.8 6.0 1 1 
        204 1 . . . . . 3.0 1.8 3.5 1 1 
        205 1 . . . . . 4.0 1.8 5.0 1 1 
        206 1 . . . . . 4.0 1.8 6.0 1 1 
        207 1 . . . . . 4.0 1.8 5.0 1 1 
        208 1 . . . . . 4.0 1.8 6.0 1 1 
        209 1 . . . . . 4.0 1.8 6.0 1 1 
        210 1 . . . . . 4.0 1.8 5.0 1 1 
        211 1 . . . . . 4.0 1.8 6.0 1 1 
        212 1 . . . . . 4.0 1.8 6.0 1 1 
        213 1 . . . . . 3.0 1.8 3.5 1 1 
        214 1 . . . . . 4.0 1.8 5.0 1 1 
        215 1 . . . . . 4.0 1.8 6.0 1 1 
        216 1 . . . . . 4.0 1.8 5.0 1 1 
        217 1 . . . . . 4.0 1.8 5.0 1 1 
        218 1 . . . . . 4.0 1.8 5.0 1 1 
        219 1 . . . . . 4.0 1.8 5.0 1 1 
        220 1 . . . . . 4.0 1.8 6.0 1 1 
        221 1 . . . . . 4.0 1.8 5.0 1 1 
        222 1 . . . . . 4.0 1.8 5.0 1 1 
        223 1 . . . . . 4.0 1.8 6.0 1 1 
        224 1 . . . . . 4.0 1.8 6.0 1 1 
        225 1 . . . . . 4.0 1.8 5.0 1 1 
        226 1 . . . . . 4.0 1.8 6.0 1 1 
        227 1 . . . . . 4.0 1.8 5.0 1 1 
        228 1 . . . . . 4.0 1.8 5.0 1 1 
        229 1 . . . . . 4.0 1.8 6.0 1 1 
        230 1 . . . . . 4.0 1.8 6.0 1 1 
        231 1 . . . . . 3.0 1.8 3.5 1 1 
        232 1 . . . . . 3.0 1.8 3.5 1 1 
        233 1 . . . . . 4.0 1.8 5.0 1 1 
        234 1 . . . . . 4.0 1.8 5.0 1 1 
        235 1 . . . . . 4.0 1.8 5.0 1 1 
        236 1 . . . . . 3.0 1.8 3.5 1 1 
        237 1 . . . . . 4.0 1.8 6.0 1 1 
        238 1 . . . . . 4.0 1.8 5.0 1 1 
        239 1 . . . . . 4.0 1.8 6.0 1 1 
        240 1 . . . . . 4.0 1.8 5.0 1 1 
        241 1 . . . . . 4.0 1.8 6.0 1 1 
        242 1 . . . . . 4.0 1.8 5.0 1 1 
        243 1 . . . . . 4.0 1.8 6.0 1 1 
        244 1 . . . . . 4.0 1.8 5.0 1 1 
        245 1 . . . . . 4.0 1.8 6.0 1 1 
        246 1 . . . . . 4.0 1.8 6.0 1 1 
        247 1 . . . . . 4.0 1.8 6.0 1 1 
        248 1 . . . . . 4.0 1.8 5.0 1 1 
        249 1 . . . . . 4.0 1.8 6.0 1 1 
        250 1 . . . . . 4.0 1.8 6.0 1 1 
        251 1 . . . . . 4.0 1.8 5.0 1 1 
        252 1 . . . . . 4.0 1.8 5.0 1 1 
        253 1 . . . . . 4.0 1.8 5.0 1 1 
        254 1 . . . . . 4.0 1.8 5.0 1 1 
        255 1 . . . . . 4.0 1.8 5.0 1 1 
        256 1 . . . . . 4.0 1.8 5.0 1 1 
        257 1 . . . . . 4.0 1.8 5.0 1 1 
        258 1 . . . . . 4.0 1.8 5.0 1 1 
        259 1 . . . . . 4.0 1.8 5.0 1 1 
        260 1 . . . . . 4.0 1.8 6.0 1 1 
        261 1 . . . . . 4.0 1.8 5.0 1 1 
        262 1 . . . . . 4.0 1.8 5.0 1 1 
        263 1 . . . . . 4.0 1.8 5.0 1 1 
        264 1 . . . . . 4.0 1.8 5.0 1 1 
        265 1 . . . . . 4.0 1.8 5.0 1 1 
        266 1 . . . . . 3.0 1.8 3.5 1 1 
        267 1 . . . . . 3.0 1.8 3.5 1 1 
        268 1 . . . . . 4.0 1.8 5.0 1 1 
        269 1 . . . . . 4.0 1.8 5.0 1 1 
        270 1 . . . . . 4.0 1.8 5.0 1 1 
        271 1 . . . . . 3.0 1.8 3.5 1 1 
        272 1 . . . . . 4.0 1.8 6.0 1 1 
        273 1 . . . . . 4.0 1.8 5.0 1 1 
        274 1 . . . . . 4.0 1.8 5.0 1 1 
        275 1 . . . . . 4.0 1.8 6.0 1 1 
        276 1 . . . . . 4.0 1.8 5.0 1 1 
        277 1 . . . . . 4.0 1.8 5.0 1 1 
        278 1 . . . . . 4.0 1.8 5.0 1 1 
        279 1 . . . . . 4.0 1.8 5.0 1 1 
        280 1 . . . . . 4.0 1.8 5.0 1 1 
        281 1 . . . . . 4.0 1.8 5.0 1 1 
        282 1 . . . . . 4.0 1.8 5.0 1 1 
        283 1 . . . . . 4.0 1.8 5.0 1 1 
        284 1 . . . . . 4.0 1.8 6.0 1 1 
        285 1 . . . . . 4.0 1.8 5.0 1 1 
        286 1 . . . . . 4.0 1.8 5.0 1 1 
        287 1 . . . . . 4.0 1.8 6.0 1 1 
        288 1 . . . . . 4.0 1.8 5.0 1 1 
        289 1 . . . . . 4.0 1.8 5.0 1 1 
        290 1 . . . . . 4.0 1.8 5.0 1 1 
        291 1 . . . . . 4.0 1.8 5.0 1 1 
        292 1 . . . . . 3.0 1.8 3.5 1 1 
        293 1 . . . . . 4.0 1.8 6.0 1 1 
        294 1 . . . . . 4.0 1.8 5.0 1 1 
        295 1 . . . . . 4.0 1.8 6.0 1 1 
        296 1 . . . . . 4.0 1.8 6.0 1 1 
        297 1 . . . . . 4.0 1.8 5.0 1 1 
        298 1 . . . . . 4.0 1.8 5.0 1 1 
        299 1 . . . . . 4.0 1.8 5.0 1 1 
        300 1 . . . . . 4.0 1.8 6.0 1 1 
        301 1 . . . . . 4.0 1.8 5.0 1 1 
        302 1 . . . . . 4.0 1.8 5.0 1 1 
        303 1 . . . . . 4.0 1.8 5.0 1 1 
        304 1 . . . . . 4.0 1.8 5.0 1 1 
        305 1 . . . . . 2.0 1.8 2.7 1 1 
        306 1 . . . . . 4.0 1.8 5.0 1 1 
        307 1 . . . . . 3.0 1.8 3.5 1 1 
        308 1 . . . . . 4.0 1.8 6.0 1 1 
        309 1 . . . . . 4.0 1.8 6.0 1 1 
        310 1 . . . . . 4.0 1.8 5.0 1 1 
        311 1 . . . . . 4.0 1.8 5.0 1 1 
        312 1 . . . . . 4.0 1.8 5.0 1 1 
        313 1 . . . . . 4.0 1.8 5.0 1 1 
        314 1 . . . . . 4.0 1.8 5.0 1 1 
        315 1 . . . . . 4.0 1.8 5.0 1 1 
        316 1 . . . . . 4.0 1.8 6.0 1 1 
        317 1 . . . . . 3.0 1.8 3.5 1 1 
        318 1 . . . . . 3.0 1.8 3.5 1 1 
        319 1 . . . . . 4.0 1.8 6.0 1 1 
        320 1 . . . . . 3.0 1.8 3.5 1 1 
        321 1 . . . . . 4.0 1.8 6.0 1 1 
        322 1 . . . . . 4.0 1.8 6.0 1 1 
        323 1 . . . . . 4.0 1.8 5.0 1 1 
        324 1 . . . . . 4.0 1.8 5.0 1 1 
        325 1 . . . . . 4.0 1.8 6.0 1 1 
        326 1 . . . . . 4.0 1.8 5.0 1 1 
        327 1 . . . . . 4.0 1.8 6.0 1 1 
        328 1 . . . . . 4.0 1.8 5.0 1 1 
        329 1 . . . . . 4.0 1.8 5.0 1 1 
        330 1 . . . . . 4.0 1.8 5.0 1 1 
        331 1 . . . . . 3.0 1.8 3.5 1 1 
        332 1 . . . . . 4.0 1.8 5.0 1 1 
        333 1 . . . . . 4.0 1.8 5.0 1 1 
        334 1 . . . . . 4.0 1.8 5.0 1 1 
        335 1 . . . . . 4.0 1.8 5.0 1 1 
        336 1 . . . . . 4.0 1.8 5.0 1 1 
        337 1 . . . . . 4.0 1.8 5.0 1 1 
        338 1 . . . . . 4.0 1.8 6.0 1 1 
        339 1 . . . . . 4.0 1.8 6.0 1 1 
        340 1 . . . . . 4.0 1.8 5.0 1 1 
        341 1 . . . . . 4.0 1.8 5.0 1 1 
        342 1 . . . . . 4.0 1.8 5.0 1 1 
        343 1 . . . . . 3.0 1.8 3.5 1 1 
        344 1 . . . . . 4.0 1.8 6.0 1 1 
        345 1 . . . . . 4.0 1.8 6.0 1 1 
        346 1 . . . . . 4.0 1.8 5.0 1 1 
        347 1 . . . . . 4.0 1.8 5.0 1 1 
        348 1 . . . . . 4.0 1.8 5.0 1 1 
        349 1 . . . . . 4.0 1.8 5.0 1 1 
        350 1 . . . . . 4.0 1.8 5.0 1 1 
        351 1 . . . . . 4.0 1.8 5.0 1 1 
        352 1 . . . . . 4.0 1.8 6.0 1 1 
        353 1 . . . . . 4.0 1.8 5.0 1 1 
        354 1 . . . . . 4.0 1.8 5.0 1 1 
        355 1 . . . . .   . 1.8 3.5 1 1 
        356 1 . . . . . 4.0 1.8 5.0 1 1 
        357 1 . . . . . 4.0 1.8 5.0 1 1 
        358 1 . . . . . 4.0 1.8 6.0 1 1 
        359 1 . . . . .   . 1.8 3.5 1 1 
        360 1 . . . . . 4.0 1.8 6.0 1 1 
        361 1 . . . . . 4.0 1.8 5.0 1 1 
        362 1 . . . . . 4.0 1.8 5.0 1 1 
        363 1 . . . . . 3.0 1.8 3.5 1 1 
        364 1 . . . . . 4.0 1.8 5.0 1 1 
        365 1 . . . . . 3.0 1.8 3.5 1 1 
        366 1 . . . . . 4.0 1.8 5.0 1 1 
        367 1 . . . . . 4.0 1.8 5.0 1 1 
        368 1 . . . . . 4.0 1.8 6.0 1 1 
        369 1 . . . . . 4.0 1.8 6.0 1 1 
        370 1 . . . . . 4.0 1.8 6.0 1 1 
        371 1 . . . . . 4.0 1.8 6.0 1 1 
        372 1 . . . . . 4.0 1.8 5.0 1 1 
        373 1 . . . . . 4.0 1.8 5.0 1 1 
        374 1 . . . . . 3.0 1.8 3.5 1 1 
        375 1 . . . . . 3.0 1.8 3.5 1 1 
        376 1 . . . . . 3.0 1.8 3.5 1 1 
        377 1 . . . . . 4.0 1.8 5.0 1 1 
        378 1 . . . . . 4.0 1.8 6.0 1 1 
        379 1 . . . . . 4.0 1.8 5.0 1 1 
        380 1 . . . . . 4.0 1.8 5.0 1 1 
        381 1 . . . . . 4.0 1.8 5.0 1 1 
        382 1 . . . . . 4.0 1.8 5.0 1 1 
        383 1 . . . . . 4.0 1.8 6.0 1 1 
        384 1 . . . . . 4.0 1.8 5.0 1 1 
        385 1 . . . . . 4.0 1.8 5.0 1 1 
        386 1 . . . . . 4.0 1.8 6.0 1 1 
        387 1 . . . . . 4.0 1.8 5.0 1 1 
        388 1 . . . . . 4.0 1.8 5.0 1 1 
        389 1 . . . . . 4.0 1.8 6.0 1 1 
        390 1 . . . . . 4.0 1.8 6.0 1 1 
        391 1 . . . . . 4.0 1.8 5.0 1 1 
        392 1 . . . . . 4.0 1.8 6.0 1 1 
        393 1 . . . . . 4.0 1.8 5.0 1 1 
        394 1 . . . . . 4.0 1.8 6.0 1 1 
        395 1 . . . . . 4.0 1.8 5.0 1 1 
        396 1 . . . . . 4.0 1.8 6.0 1 1 
        397 1 . . . . . 4.0 1.8 5.0 1 1 
        398 1 . . . . . 4.0 1.8 6.0 1 1 
        399 1 . . . . . 4.0 1.8 6.0 1 1 
        400 1 . . . . . 4.0 1.8 5.0 1 1 
        401 1 . . . . . 4.0 1.8 5.0 1 1 
        402 1 . . . . . 4.0 1.8 5.0 1 1 
        403 1 . . . . . 4.0 1.8 5.0 1 1 
        404 1 . . . . . 3.0 1.8 3.5 1 1 
        405 1 . . . . . 4.0 1.8 5.0 1 1 
        406 1 . . . . . 4.0 1.8 5.0 1 1 
        407 1 . . . . . 4.0 1.8 5.0 1 1 
        408 1 . . . . . 4.0 1.8 5.0 1 1 
        409 1 . . . . . 4.0 1.8 5.0 1 1 
        410 1 . . . . . 4.0 1.8 5.0 1 1 
        411 1 . . . . . 4.0 1.8 5.0 1 1 
        412 1 . . . . . 4.0 1.8 6.0 1 1 
        413 1 . . . . . 4.0 1.8 5.0 1 1 
        414 1 . . . . . 4.0 1.8 6.0 1 1 
        415 1 . . . . . 2.0 1.8 2.7 1 1 
        416 1 . . . . . 4.0 1.8 6.0 1 1 
        417 1 . . . . . 4.0 1.8 5.0 1 1 
        418 1 . . . . . 4.0 1.8 5.0 1 1 
        419 1 . . . . . 3.0 1.8 3.5 1 1 
        420 1 . . . . . 4.0 1.8 5.0 1 1 
        421 1 . . . . . 3.0 1.8 3.5 1 1 
        422 1 . . . . . 4.0 1.8 5.0 1 1 
        423 1 . . . . . 4.0 1.8 6.0 1 1 
        424 1 . . . . . 4.0 1.8 5.0 1 1 
        425 1 . . . . . 4.0 1.8 6.0 1 1 
        426 1 . . . . . 4.0 1.8 6.0 1 1 
        427 1 . . . . . 3.0 1.8 3.5 1 1 
        428 1 . . . . . 3.0 1.8 3.5 1 1 
        429 1 . . . . . 4.0 1.8 5.0 1 1 
        430 1 . . . . . 4.0 1.8 6.0 1 1 
        431 1 . . . . . 4.0 1.8 6.0 1 1 
        432 1 . . . . . 4.0 1.8 6.0 1 1 
        433 1 . . . . . 4.0 1.8 5.0 1 1 
        434 1 . . . . . 4.0 1.8 5.0 1 1 
        435 1 . . . . . 4.0 1.8 5.0 1 1 
        436 1 . . . . . 4.0 1.8 5.0 1 1 
        437 1 . . . . . 4.0 1.8 5.0 1 1 
        438 1 . . . . . 4.0 1.8 5.0 1 1 
        439 1 . . . . . 4.0 1.8 6.0 1 1 
        440 1 . . . . . 4.0 1.8 6.0 1 1 
        441 1 . . . . . 4.0 1.8 6.0 1 1 
        442 1 . . . . . 4.0 1.8 5.0 1 1 
        443 1 . . . . . 4.0 1.8 5.0 1 1 
        444 1 . . . . . 4.0 1.8 5.0 1 1 
        445 1 . . . . . 4.0 1.8 5.0 1 1 
        446 1 . . . . . 4.0 1.8 5.0 1 1 
        447 1 . . . . . 3.0 1.8 3.5 1 1 
        448 1 . . . . . 4.0 1.8 5.0 1 1 
        449 1 . . . . . 4.0 1.8 6.0 1 1 
        450 1 . . . . . 4.0 1.8 5.0 1 1 
        451 1 . . . . . 4.0 1.8 5.0 1 1 
        452 1 . . . . . 4.0 1.8 6.0 1 1 
        453 1 . . . . . 4.0 1.8 6.0 1 1 
        454 1 . . . . . 4.0 1.8 6.0 1 1 
        455 1 . . . . . 4.0 1.8 5.0 1 1 
        456 1 . . . . . 4.0 1.8 5.0 1 1 
        457 1 . . . . . 4.0 1.8 5.0 1 1 
        458 1 . . . . . 4.0 1.8 5.0 1 1 
        459 1 . . . . . 4.0 1.8 6.0 1 1 
        460 1 . . . . . 4.0 1.8 6.0 1 1 
        461 1 . . . . . 4.0 1.8 6.0 1 1 
        462 1 . . . . . 3.0 1.8 3.5 1 1 
        463 1 . . . . . 4.0 1.8 5.0 1 1 
        464 1 . . . . . 4.0 1.8 6.0 1 1 
        465 1 . . . . . 4.0 1.8 6.0 1 1 
        466 1 . . . . . 4.0 1.8 6.0 1 1 
        467 1 . . . . . 4.0 1.8 6.0 1 1 
        468 1 . . . . . 4.0 1.8 6.0 1 1 
        469 1 . . . . . 2.0 1.8 2.7 1 1 
        470 1 . . . . . 4.0 1.8 6.0 1 1 
        471 1 . . . . . 4.0 1.8 5.0 1 1 
        472 1 . . . . . 4.0 1.8 5.0 1 1 
        473 1 . . . . . 4.0 1.8 6.0 1 1 
        474 1 . . . . . 4.0 1.8 5.0 1 1 
        475 1 . . . . . 4.0 1.8 6.0 1 1 
        476 1 . . . . . 4.0 1.8 6.0 1 1 
        477 1 . . . . . 4.0 1.8 6.0 1 1 
        478 1 . . . . . 4.0 1.8 5.0 1 1 
        479 1 . . . . . 3.0 1.8 3.5 1 1 
        480 1 . . . . . 4.0 1.8 5.0 1 1 
        481 1 . . . . . 4.0 1.8 6.0 1 1 
        482 1 . . . . . 3.0 1.8 3.5 1 1 
        483 1 . . . . . 4.0 1.8 5.0 1 1 
        484 1 . . . . . 4.0 1.8 5.0 1 1 
        485 1 . . . . . 4.0 1.8 5.0 1 1 
        486 1 . . . . . 4.0 1.8 5.0 1 1 
        487 1 . . . . . 4.0 1.8 5.0 1 1 
        488 1 . . . . . 4.0 1.8 6.0 1 1 
        489 1 . . . . . 4.0 1.8 6.0 1 1 
        490 1 . . . . . 4.0 1.8 5.0 1 1 
        491 1 . . . . . 4.0 1.8 5.0 1 1 
        492 1 . . . . . 4.0 1.8 5.0 1 1 
        493 1 . . . . . 4.0 1.8 5.0 1 1 
        494 1 . . . . . 3.0 1.8 3.5 1 1 
        495 1 . . . . . 3.0 1.8 3.5 1 1 
        496 1 . . . . . 4.0 1.8 5.0 1 1 
        497 1 . . . . . 4.0 1.8 5.0 1 1 
        498 1 . . . . . 3.0 1.8 3.5 1 1 
        499 1 . . . . . 4.0 1.8 6.0 1 1 
        500 1 . . . . . 4.0 1.8 5.0 1 1 
        501 1 . . . . . 4.0 1.8 5.0 1 1 
        502 1 . . . . . 4.0 1.8 5.0 1 1 
        503 1 . . . . . 4.0 1.8 6.0 1 1 
        504 1 . . . . . 4.0 1.8 5.0 1 1 
        505 1 . . . . . 4.0 1.8 6.0 1 1 
        506 1 . . . . .   . 1.8 3.5 1 1 
        507 1 . . . . . 4.0 1.8 5.0 1 1 
        508 1 . . . . . 4.0 1.8 6.0 1 1 
        509 1 . . . . . 4.0 1.8 5.0 1 1 
        510 1 . . . . . 4.0 1.8 6.0 1 1 
        511 1 . . . . . 4.0 1.8 5.0 1 1 
        512 1 . . . . . 4.0 1.8 6.0 1 1 
        513 1 . . . . . 4.0 1.8 5.0 1 1 
        514 1 . . . . . 4.0 1.8 5.0 1 1 
        515 1 . . . . . 3.0 1.8 3.5 1 1 
        516 1 . . . . . 4.0 1.8 6.0 1 1 
        517 1 . . . . . 4.0 1.8 5.0 1 1 
        518 1 . . . . . 4.0 1.8 6.0 1 1 
        519 1 . . . . . 4.0 1.8 5.0 1 1 
        520 1 . . . . . 2.0 1.8 2.7 1 1 
        521 1 . . . . . 3.0 1.8 3.5 1 1 
        522 1 . . . . . 4.0 1.8 5.0 1 1 
        523 1 . . . . . 4.0 1.8 6.0 1 1 
        524 1 . . . . . 4.0 1.8 5.0 1 1 
        525 1 . . . . . 3.0 1.8 3.5 1 1 
        526 1 . . . . . 3.0 1.8 3.5 1 1 
        527 1 . . . . . 4.0 1.8 5.0 1 1 
        528 1 . . . . . 4.0 1.8 5.0 1 1 
        529 1 . . . . . 4.0 1.8 5.0 1 1 
        530 1 . . . . . 4.0 1.8 6.0 1 1 
        531 1 . . . . . 4.0 1.8 5.0 1 1 
        532 1 . . . . . 4.0 1.8 5.0 1 1 
        533 1 . . . . . 3.0 1.8 3.5 1 1 
        534 1 . . . . .   . 1.8 3.5 1 1 
        535 1 . . . . . 4.0 1.8 5.0 1 1 
        536 1 . . . . . 4.0 1.8 5.0 1 1 
        537 1 . . . . . 3.0 1.8 3.5 1 1 
        538 1 . . . . . 4.0 1.8 5.0 1 1 
        539 1 . . . . . 4.0 1.8 6.0 1 1 
        540 1 . . . . . 3.0 1.8 3.5 1 1 
        541 1 . . . . . 4.0 1.8 6.0 1 1 
        542 1 . . . . . 4.0 1.8 6.0 1 1 
        543 1 . . . . . 2.0 1.8 2.7 1 1 
        544 1 . . . . . 4.0 1.8 6.0 1 1 
        545 1 . . . . . 4.0 1.8 6.0 1 1 
        546 1 . . . . . 4.0 1.8 5.0 1 1 
        547 1 . . . . . 3.0 1.8 3.5 1 1 
        548 1 . . . . . 3.0 1.8 3.5 1 1 
        549 1 . . . . . 4.0 1.8 5.0 1 1 
        550 1 . . . . . 4.0 1.8 5.0 1 1 
        551 1 . . . . . 4.0 1.8 5.0 1 1 
        552 1 . . . . . 4.0 1.8 5.0 1 1 
        553 1 . . . . .   . 1.8 2.7 1 1 
        554 1 . . . . . 4.0 1.8 5.0 1 1 
        555 1 . . . . . 4.0 1.8 6.0 1 1 
        556 1 . . . . . 4.0 1.8 5.0 1 1 
        557 1 . . . . . 4.0 1.8 6.0 1 1 
        558 1 . . . . . 4.0 1.8 6.0 1 1 
        559 1 . . . . . 4.0 1.8 6.0 1 1 
        560 1 . . . . . 4.0 1.8 5.0 1 1 
        561 1 . . . . . 4.0 1.8 5.0 1 1 
        562 1 . . . . . 4.0 1.8 5.0 1 1 
        563 1 . . . . . 4.0 1.8 5.0 1 1 
        564 1 . . . . . 4.0 1.8 5.0 1 1 
        565 1 . . . . . 4.0 1.8 5.0 1 1 
        566 1 . . . . . 4.0 1.8 5.0 1 1 
        567 1 . . . . . 4.0 1.8 6.0 1 1 
        568 1 . . . . . 4.0 1.8 5.0 1 1 
        569 1 . . . . . 3.0 1.8 3.5 1 1 
        570 1 . . . . . 3.0 1.8 3.5 1 1 
        571 1 . . . . . 3.0 1.8 3.5 1 1 
        572 1 . . . . . 4.0 1.8 5.0 1 1 
        573 1 . . . . . 3.0 1.8 3.5 1 1 
        574 1 . . . . . 4.0 1.8 6.0 1 1 
        575 1 . . . . . 4.0 1.8 5.0 1 1 
        576 1 . . . . . 4.0 1.8 6.0 1 1 
        577 1 . . . . . 4.0 1.8 5.0 1 1 
        578 1 . . . . . 4.0 1.8 5.0 1 1 
        579 1 . . . . . 3.0 1.8 3.5 1 1 
        580 1 . . . . . 4.0 1.8 5.0 1 1 
        581 1 . . . . . 4.0 1.8 5.0 1 1 
        582 1 . . . . . 3.0 1.8 3.5 1 1 
        583 1 . . . . . 4.0 1.8 5.0 1 1 
        584 1 . . . . . 4.0 1.8 5.0 1 1 
        585 1 . . . . . 3.0 1.8 3.5 1 1 
        586 1 . . . . . 4.0 1.8 6.0 1 1 
        587 1 . . . . . 4.0 1.8 5.0 1 1 
        588 1 . . . . . 3.0 1.8 3.5 1 1 
        589 1 . . . . . 3.0 1.8 3.5 1 1 
        590 1 . . . . . 3.0 1.8 3.5 1 1 
        591 1 . . . . . 4.0 1.8 5.0 1 1 
        592 1 . . . . . 4.0 1.8 5.0 1 1 
        593 1 . . . . . 4.0 1.8 6.0 1 1 
        594 1 . . . . . 3.0 1.8 3.5 1 1 
        595 1 . . . . . 4.0 1.8 5.0 1 1 
        596 1 . . . . . 4.0 1.8 6.0 1 1 
        597 1 . . . . . 4.0 1.8 6.0 1 1 
        598 1 . . . . . 4.0 1.8 5.0 1 1 
        599 1 . . . . . 3.0 1.8 3.5 1 1 
        600 1 . . . . . 4.0 1.8 5.0 1 1 
        601 1 . . . . . 3.0 1.8 3.5 1 1 
        602 1 . . . . . 4.0 1.8 5.0 1 1 
        603 1 . . . . . 4.0 1.8 5.0 1 1 
        604 1 . . . . . 2.0 1.8 2.7 1 1 
        605 1 . . . . . 4.0 1.8 5.0 1 1 
        606 1 . . . . . 4.0 1.8 6.0 1 1 
        607 1 . . . . . 4.0 1.8 5.0 1 1 
        608 1 . . . . . 3.0 1.8 3.5 1 1 
        609 1 . . . . . 2.0 1.8 2.7 1 1 
        610 1 . . . . . 3.0 1.8 3.5 1 1 
        611 1 . . . . . 3.0 1.8 3.5 1 1 
        612 1 . . . . . 4.0 1.8 5.0 1 1 
        613 1 . . . . . 4.0 1.8 5.0 1 1 
        614 1 . . . . . 4.0 1.8 5.0 1 1 
        615 1 . . . . . 4.0 1.8 5.0 1 1 
        616 1 . . . . . 4.0 1.8 5.0 1 1 
        617 1 . . . . . 4.0 1.8 6.0 1 1 
        618 1 . . . . . 4.0 1.8 6.0 1 1 
        619 1 . . . . . 4.0 1.8 5.0 1 1 
        620 1 . . . . . 4.0 1.8 6.0 1 1 
        621 1 . . . . . 4.0 1.8 6.0 1 1 
        622 1 . . . . . 4.0 1.8 5.0 1 1 
        623 1 . . . . . 4.0 1.8 5.0 1 1 
        624 1 . . . . . 4.0 1.8 5.0 1 1 
        625 1 . . . . . 4.0 1.8 5.0 1 1 
        626 1 . . . . . 4.0 1.8 5.0 1 1 
        627 1 . . . . . 4.0 1.8 5.0 1 1 
        628 1 . . . . . 4.0 1.8 5.0 1 1 
        629 1 . . . . . 4.0 1.8 5.0 1 1 
        630 1 . . . . . 4.0 1.8 6.0 1 1 
        631 1 . . . . . 4.0 1.8 5.0 1 1 
        632 1 . . . . . 4.0 1.8 5.0 1 1 
        633 1 . . . . . 4.0 1.8 5.0 1 1 
        634 1 . . . . . 3.0 1.8 3.5 1 1 
        635 1 . . . . . 3.0 1.8 3.5 1 1 
        636 1 . . . . . 4.0 1.8 5.0 1 1 
        637 1 . . . . . 4.0 1.8 6.0 1 1 
        638 1 . . . . . 4.0 1.8 5.0 1 1 
        639 1 . . . . . 4.0 1.8 5.0 1 1 
        640 1 . . . . . 3.0 1.8 3.5 1 1 
        641 1 . . . . . 4.0 1.8 5.0 1 1 
        642 1 . . . . . 4.0 1.8 5.0 1 1 
        643 1 . . . . . 4.0 1.8 5.0 1 1 
        644 1 . . . . . 4.0 1.8 5.0 1 1 
        645 1 . . . . . 3.0 1.8 3.5 1 1 
        646 1 . . . . . 4.0 1.8 5.0 1 1 
        647 1 . . . . . 4.0 1.8 5.0 1 1 
        648 1 . . . . . 3.0 1.8 3.5 1 1 
        649 1 . . . . . 4.0 1.8 6.0 1 1 
        650 1 . . . . . 4.0 1.8 5.0 1 1 
        651 1 . . . . . 4.0 1.8 5.0 1 1 
        652 1 . . . . . 4.0 1.8 5.0 1 1 
        653 1 . . . . . 4.0 1.8 5.0 1 1 
        654 1 . . . . . 4.0 1.8 5.0 1 1 
        655 1 . . . . . 4.0 1.8 5.0 1 1 
        656 1 . . . . . 4.0 1.8 5.0 1 1 
        657 1 . . . . . 4.0 1.8 5.0 1 1 
        658 1 . . . . . 4.0 1.8 5.0 1 1 
        659 1 . . . . . 4.0 1.8 6.0 1 1 
        660 1 . . . . . 4.0 1.8 5.0 1 1 
        661 1 . . . . . 3.0 1.8 3.5 1 1 
        662 1 . . . . . 3.0 1.8 3.5 1 1 
        663 1 . . . . . 4.0 1.8 5.0 1 1 
        664 1 . . . . . 4.0 1.8 5.0 1 1 
        665 1 . . . . . 4.0 1.8 6.0 1 1 
        666 1 . . . . . 4.0 1.8 6.0 1 1 
        667 1 . . . . . 3.0 1.8 3.5 1 1 
        668 1 . . . . . 4.0 1.8 5.0 1 1 
        669 1 . . . . . 3.0 1.8 3.5 1 1 
        670 1 . . . . . 2.0 1.8 2.7 1 1 
        671 1 . . . . . 3.0 1.8 3.5 1 1 
        672 1 . . . . . 3.0 1.8 3.5 1 1 
        673 1 . . . . . 4.0 1.8 5.0 1 1 
        674 1 . . . . . 4.0 1.8 5.0 1 1 
        675 1 . . . . . 4.0 1.8 5.0 1 1 
        676 1 . . . . . 4.0 1.8 6.0 1 1 
        677 1 . . . . . 4.0 1.8 5.0 1 1 
        678 1 . . . . . 3.0 1.8 3.5 1 1 
        679 1 . . . . . 4.0 1.8 6.0 1 1 
        680 1 . . . . . 4.0 1.8 5.0 1 1 
        681 1 . . . . . 4.0 1.8 5.0 1 1 
        682 1 . . . . . 3.0 1.8 3.5 1 1 
        683 1 . . . . . 4.0 1.8 6.0 1 1 
        684 1 . . . . . 3.0 1.8 3.5 1 1 
        685 1 . . . . . 3.0 1.8 3.5 1 1 
        686 1 . . . . . 4.0 1.8 5.0 1 1 
        687 1 . . . . . 4.0 1.8 6.0 1 1 
        688 1 . . . . . 4.0 1.8 6.0 1 1 
        689 1 . . . . . 3.0 1.8 3.5 1 1 
        690 1 . . . . . 4.0 1.8 5.0 1 1 
        691 1 . . . . . 4.0 1.8 5.0 1 1 
        692 1 . . . . . 4.0 1.8 5.0 1 1 
        693 1 . . . . . 3.0 1.8 3.5 1 1 
        694 1 . . . . . 4.0 1.8 5.0 1 1 
        695 1 . . . . . 4.0 1.8 5.0 1 1 
        696 1 . . . . . 3.0 1.8 3.5 1 1 
        697 1 . . . . . 4.0 1.8 5.0 1 1 
        698 1 . . . . . 4.0 1.8 5.0 1 1 
        699 1 . . . . . 4.0 1.8 5.0 1 1 
        700 1 . . . . . 4.0 1.8 5.0 1 1 
        701 1 . . . . . 4.0 1.8 5.0 1 1 
        702 1 . . . . . 4.0 1.8 6.0 1 1 
        703 1 . . . . . 4.0 1.8 6.0 1 1 
        704 1 . . . . . 4.0 1.8 6.0 1 1 
        705 1 . . . . . 4.0 1.8 6.0 1 1 
        706 1 . . . . . 4.0 1.8 5.0 1 1 
        707 1 . . . . . 4.0 1.8 6.0 1 1 
        708 1 . . . . . 4.0 1.8 6.0 1 1 
        709 1 . . . . . 3.0 1.8 3.5 1 1 
        710 1 . . . . . 3.0 1.8 3.5 1 1 
        711 1 . . . . . 3.0 1.8 3.5 1 1 
        712 1 . . . . . 3.0 1.8 3.5 1 1 
        713 1 . . . . . 4.0 1.8 6.0 1 1 
        714 1 . . . . . 4.0 1.8 6.0 1 1 
        715 1 . . . . . 4.0 1.8 6.0 1 1 
        716 1 . . . . . 4.0 1.8 6.0 1 1 
        717 1 . . . . . 4.0 1.8 5.0 1 1 
        718 1 . . . . . 4.0 1.8 5.0 1 1 
        719 1 . . . . . 4.0 1.8 5.0 1 1 
        720 1 . . . . . 4.0 1.8 5.0 1 1 
        721 1 . . . . . 3.0 1.8 3.5 1 1 
        722 1 . . . . . 3.0 1.8 3.5 1 1 
        723 1 . . . . . 3.0 1.8 3.5 1 1 
        724 1 . . . . . 4.0 1.8 6.0 1 1 
        725 1 . . . . . 4.0 1.8 5.0 1 1 
        726 1 . . . . . 4.0 1.8 5.0 1 1 
        727 1 . . . . . 3.0 1.8 3.5 1 1 
        728 1 . . . . . 4.0 1.8 6.0 1 1 
        729 1 . . . . . 4.0 1.8 6.0 1 1 
        730 1 . . . . . 4.0 1.8 6.0 1 1 
        731 1 . . . . . 4.0 1.8 6.0 1 1 
        732 1 . . . . . 4.0 1.8 6.0 1 1 
        733 1 . . . . . 4.0 1.8 5.0 1 1 
        734 1 . . . . . 4.0 1.8 6.0 1 1 
        735 1 . . . . . 4.0 1.8 6.0 1 1 
        736 1 . . . . . 4.0 1.8 6.0 1 1 
        737 1 . . . . . 4.0 1.8 5.0 1 1 
        738 1 . . . . . 3.0 1.8 3.5 1 1 
        739 1 . . . . . 4.0 1.8 5.0 1 1 
        740 1 . . . . . 4.0 1.8 5.0 1 1 
        741 1 . . . . . 4.0 1.8 6.0 1 1 
        742 1 . . . . . 4.0 1.8 5.0 1 1 
        743 1 . . . . . 4.0 1.8 6.0 1 1 
        744 1 . . . . . 4.0 1.8 5.0 1 1 
        745 1 . . . . . 4.0 1.8 5.0 1 1 
        746 1 . . . . . 4.0 1.8 5.0 1 1 
        747 1 . . . . . 4.0 1.8 5.0 1 1 
        748 1 . . . . . 3.0 1.8 3.5 1 1 
        749 1 . . . . . 3.0 1.8 3.5 1 1 
        750 1 . . . . . 4.0 1.8 5.0 1 1 
        751 1 . . . . . 4.0 1.8 5.0 1 1 
        752 1 . . . . . 4.0 1.8 5.0 1 1 
        753 1 . . . . . 4.0 1.8 5.0 1 1 
        754 1 . . . . . 4.0 1.8 5.0 1 1 
        755 1 . . . . . 4.0 1.8 5.0 1 1 
        756 1 . . . . . 4.0 1.8 5.0 1 1 
        757 1 . . . . . 3.0 1.8 3.5 1 1 
        758 1 . . . . . 4.0 1.8 5.0 1 1 
        759 1 . . . . . 4.0 1.8 5.0 1 1 
        760 1 . . . . . 4.0 1.8 5.0 1 1 
        761 1 . . . . . 2.0 1.8 2.7 1 1 
        762 1 . . . . . 4.0 1.8 6.0 1 1 
        763 1 . . . . . 4.0 1.8 5.0 1 1 
        764 1 . . . . . 3.0 1.8 3.5 1 1 
        765 1 . . . . . 3.0 1.8 3.5 1 1 
        766 1 . . . . . 4.0 1.8 6.0 1 1 
        767 1 . . . . . 2.0 1.8 2.7 1 1 
        768 1 . . . . . 3.0 1.8 3.5 1 1 
        769 1 . . . . . 4.0 1.8 5.0 1 1 
        770 1 . . . . . 4.0 1.8 6.0 1 1 
        771 1 . . . . . 4.0 1.8 5.0 1 1 
        772 1 . . . . . 4.0 1.8 5.0 1 1 
        773 1 . . . . . 3.0 1.8 3.5 1 1 
        774 1 . . . . . 2.0 1.8 2.7 1 1 
        775 1 . . . . . 3.0 1.8 3.5 1 1 
        776 1 . . . . . 4.0 1.8 5.0 1 1 
        777 1 . . . . . 4.0 1.8 6.0 1 1 
        778 1 . . . . . 4.0 1.8 6.0 1 1 
        779 1 . . . . . 4.0 1.8 5.0 1 1 
        780 1 . . . . . 4.0 1.8 5.0 1 1 
        781 1 . . . . . 3.0 1.8 3.5 1 1 
        782 1 . . . . . 4.0 1.8 5.0 1 1 
        783 1 . . . . . 4.0 1.8 5.0 1 1 
        784 1 . . . . . 3.0 1.8 3.5 1 1 
        785 1 . . . . . 4.0 1.8 5.0 1 1 
        786 1 . . . . . 4.0 1.8 5.0 1 1 
        787 1 . . . . . 4.0 1.8 5.0 1 1 
        788 1 . . . . . 4.0 1.8 5.0 1 1 
        789 1 . . . . . 4.0 1.8 5.0 1 1 
        790 1 . . . . . 4.0 1.8 6.0 1 1 
        791 1 . . . . . 4.0 1.8 6.0 1 1 
        792 1 . . . . . 4.0 1.8 5.0 1 1 
        793 1 . . . . . 4.0 1.8 5.0 1 1 
        794 1 . . . . . 3.0 1.8 3.5 1 1 
        795 1 . . . . . 4.0 1.8 5.0 1 1 
        796 1 . . . . . 4.0 1.8 5.0 1 1 
        797 1 . . . . . 3.0 1.8 3.5 1 1 
        798 1 . . . . . 4.0 1.8 5.0 1 1 
        799 1 . . . . . 4.0 1.8 5.0 1 1 
        800 1 . . . . . 4.0 1.8 5.0 1 1 
        801 1 . . . . . 4.0 1.8 5.0 1 1 
        802 1 . . . . . 4.0 1.8 5.0 1 1 
        803 1 . . . . . 3.0 1.8 3.5 1 1 
        804 1 . . . . . 4.0 1.8 5.0 1 1 
        805 1 . . . . . 4.0 1.8 5.0 1 1 
        806 1 . . . . . 3.0 1.8 3.5 1 1 
        807 1 . . . . . 4.0 1.8 5.0 1 1 
        808 1 . . . . . 4.0 1.8 5.0 1 1 
        809 1 . . . . . 4.0 1.8 6.0 1 1 
        810 1 . . . . . 4.0 1.8 6.0 1 1 
        811 1 . . . . . 4.0 1.8 5.0 1 1 
        812 1 . . . . . 4.0 1.8 5.0 1 1 
        813 1 . . . . . 4.0 1.8 6.0 1 1 
        814 1 . . . . . 4.0 1.8 6.0 1 1 
        815 1 . . . . . 3.0 1.8 3.5 1 1 
        816 1 . . . . . 4.0 1.8 6.0 1 1 
        817 1 . . . . . 4.0 1.8 5.0 1 1 
        818 1 . . . . . 4.0 1.8 6.0 1 1 
        819 1 . . . . . 4.0 1.8 5.0 1 1 
        820 1 . . . . . 3.0 1.8 3.5 1 1 
        821 1 . . . . . 4.0 1.8 6.0 1 1 
        822 1 . . . . . 4.0 1.8 5.0 1 1 
        823 1 . . . . . 4.0 1.8 5.0 1 1 
        824 1 . . . . . 4.0 1.8 5.0 1 1 
        825 1 . . . . . 4.0 1.8 6.0 1 1 
        826 1 . . . . . 4.0 1.8 5.0 1 1 
        827 1 . . . . . 4.0 1.8 5.0 1 1 
        828 1 . . . . . 4.0 1.8 5.0 1 1 
        829 1 . . . . . 4.0 1.8 5.0 1 1 
        830 1 . . . . . 4.0 1.8 6.0 1 1 
        831 1 . . . . . 4.0 1.8 5.0 1 1 
        832 1 . . . . . 4.0 1.8 6.0 1 1 
        833 1 . . . . . 4.0 1.8 5.0 1 1 
        834 1 . . . . . 4.0 1.8 5.0 1 1 
        835 1 . . . . . 4.0 1.8 5.0 1 1 
        836 1 . . . . . 4.0 1.8 5.0 1 1 
        837 1 . . . . . 4.0 1.8 5.0 1 1 
        838 1 . . . . . 4.0 1.8 5.0 1 1 
        839 1 . . . . . 4.0 1.8 5.0 1 1 
        840 1 . . . . . 4.0 1.8 6.0 1 1 
        841 1 . . . . . 4.0 1.8 5.0 1 1 
        842 1 . . . . . 4.0 1.8 5.0 1 1 
        843 1 . . . . . 3.0 1.8 3.5 1 1 
        844 1 . . . . . 3.0 1.8 3.5 1 1 
        845 1 . . . . . 3.0 1.8 3.5 1 1 
        846 1 . . . . . 4.0 1.8 5.0 1 1 
        847 1 . . . . . 4.0 1.8 5.0 1 1 
        848 1 . . . . . 2.0 1.8 2.7 1 1 
        849 1 . . . . . 3.0 1.8 3.5 1 1 
        850 1 . . . . . 4.0 1.8 6.0 1 1 
        851 1 . . . . . 4.0 1.8 5.0 1 1 
        852 1 . . . . . 4.0 1.8 6.0 1 1 
        853 1 . . . . . 4.0 1.8 6.0 1 1 
        854 1 . . . . . 4.0 1.8 5.0 1 1 
        855 1 . . . . . 4.0 1.8 5.0 1 1 
        856 1 . . . . . 4.0 1.8 5.0 1 1 
        857 1 . . . . . 3.0 1.8 3.5 1 1 
        858 1 . . . . . 4.0 1.8 5.0 1 1 
        859 1 . . . . . 2.0 1.8 2.7 1 1 
        860 1 . . . . . 3.0 1.8 3.5 1 1 
        861 1 . . . . . 4.0 1.8 5.0 1 1 
        862 1 . . . . . 4.0 1.8 5.0 1 1 
        863 1 . . . . . 4.0 1.8 5.0 1 1 
        864 1 . . . . . 4.0 1.8 5.0 1 1 
        865 1 . . . . . 4.0 1.8 5.0 1 1 
        866 1 . . . . . 4.0 1.8 5.0 1 1 
        867 1 . . . . . 4.0 1.8 6.0 1 1 
        868 1 . . . . . 3.0 1.8 3.5 1 1 
        869 1 . . . . . 4.0 1.8 5.0 1 1 
        870 1 . . . . . 4.0 1.8 5.0 1 1 
        871 1 . . . . . 4.0 1.8 5.0 1 1 
        872 1 . . . . . 4.0 1.8 6.0 1 1 
        873 1 . . . . . 4.0 1.8 5.0 1 1 
        874 1 . . . . . 4.0 1.8 6.0 1 1 
        875 1 . . . . . 4.0 1.8 6.0 1 1 
        876 1 . . . . . 4.0 1.8 5.0 1 1 
        877 1 . . . . . 4.0 1.8 5.0 1 1 
        878 1 . . . . . 4.0 1.8 6.0 1 1 
        879 1 . . . . . 4.0 1.8 6.0 1 1 
        880 1 . . . . . 3.0 1.8 3.5 1 1 
        881 1 . . . . . 4.0 1.8 6.0 1 1 
        882 1 . . . . . 4.0 1.8 6.0 1 1 
        883 1 . . . . . 4.0 1.8 5.0 1 1 
        884 1 . . . . . 4.0 1.8 5.0 1 1 
        885 1 . . . . . 4.0 1.8 6.0 1 1 
        886 1 . . . . . 4.0 1.8 6.0 1 1 
        887 1 . . . . . 3.0 1.8 3.5 1 1 
        888 1 . . . . . 4.0 1.8 5.0 1 1 
        889 1 . . . . . 4.0 1.8 6.0 1 1 
        890 1 . . . . . 3.0 1.8 3.5 1 1 
        891 1 . . . . . 4.0 1.8 6.0 1 1 
        892 1 . . . . . 4.0 1.8 5.0 1 1 
        893 1 . . . . . 4.0 1.8 5.0 1 1 
        894 1 . . . . . 4.0 1.8 5.0 1 1 
        895 1 . . . . . 4.0 1.8 6.0 1 1 
        896 1 . . . . . 4.0 1.8 5.0 1 1 
        897 1 . . . . . 3.0 1.8 3.5 1 1 
        898 1 . . . . . 4.0 1.8 5.0 1 1 
        899 1 . . . . . 4.0 1.8 5.0 1 1 
        900 1 . . . . . 4.0 1.8 6.0 1 1 
        901 1 . . . . . 4.0 1.8 5.0 1 1 
        902 1 . . . . . 4.0 1.8 6.0 1 1 
        903 1 . . . . . 4.0 1.8 5.0 1 1 
        904 1 . . . . . 4.0 1.8 5.0 1 1 
        905 1 . . . . . 4.0 1.8 5.0 1 1 
        906 1 . . . . . 4.0 1.8 5.0 1 1 
        907 1 . . . . . 4.0 1.8 5.0 1 1 
        908 1 . . . . . 4.0 1.8 5.0 1 1 
        909 1 . . . . . 4.0 1.8 6.0 1 1 
        910 1 . . . . . 4.0 1.8 6.0 1 1 
        911 1 . . . . . 4.0 1.8 5.0 1 1 
        912 1 . . . . . 4.0 1.8 6.0 1 1 
        913 1 . . . . . 3.0 1.8 3.5 1 1 
        914 1 . . . . . 4.0 1.8 5.0 1 1 
        915 1 . . . . . 4.0 1.8 5.0 1 1 
        916 1 . . . . . 3.0 1.8 3.5 1 1 
        917 1 . . . . . 4.0 1.8 5.0 1 1 
        918 1 . . . . . 4.0 1.8 6.0 1 1 
        919 1 . . . . . 4.0 1.8 6.0 1 1 
        920 1 . . . . . 4.0 1.8 5.0 1 1 
        921 1 . . . . . 4.0 1.8 5.0 1 1 
        922 1 . . . . . 4.0 1.8 5.0 1 1 
        923 1 . . . . . 4.0 1.8 5.0 1 1 
        924 1 . . . . . 4.0 1.8 5.0 1 1 
        925 1 . . . . . 4.0 1.8 5.0 1 1 
        926 1 . . . . . 4.0 1.8 6.0 1 1 
        927 1 . . . . . 4.0 1.8 5.0 1 1 
        928 1 . . . . . 4.0 1.8 6.0 1 1 
        929 1 . . . . . 4.0 1.8 6.0 1 1 
        930 1 . . . . . 4.0 1.8 5.0 1 1 
        931 1 . . . . . 4.0 1.8 6.0 1 1 
        932 1 . . . . . 4.0 1.8 6.0 1 1 
        933 1 . . . . . 4.0 1.8 5.0 1 1 
        934 1 . . . . . 4.0 1.8 5.0 1 1 
        935 1 . . . . . 4.0 1.8 6.0 1 1 
        936 1 . . . . . 4.0 1.8 5.0 1 1 
        937 1 . . . . . 4.0 1.8 5.0 1 1 
        938 1 . . . . . 4.0 1.8 6.0 1 1 
        939 1 . . . . . 4.0 1.8 5.0 1 1 
        940 1 . . . . . 3.0 1.8 3.5 1 1 
        941 1 . . . . . 4.0 1.8 5.0 1 1 
        942 1 . . . . . 3.0 1.8 3.5 1 1 
        943 1 . . . . . 4.0 1.8 5.0 1 1 
        944 1 . . . . . 4.0 1.8 5.0 1 1 
        945 1 . . . . . 4.0 1.8 6.0 1 1 
        946 1 . . . . . 4.0 1.8 5.0 1 1 
        947 1 . . . . . 4.0 1.8 6.0 1 1 
        948 1 . . . . . 4.0 1.8 5.0 1 1 
        949 1 . . . . . 4.0 1.8 5.0 1 1 
        950 1 . . . . . 3.0 1.8 3.5 1 1 
        951 1 . . . . . 4.0 1.8 5.0 1 1 
        952 1 . . . . . 4.0 1.8 5.0 1 1 
        953 1 . . . . . 4.0 1.8 5.0 1 1 
        954 1 . . . . . 3.0 1.8 3.5 1 1 
        955 1 . . . . . 4.0 1.8 5.0 1 1 
        956 1 . . . . . 4.0 1.8 5.0 1 1 
        957 1 . . . . . 4.0 1.8 6.0 1 1 
        958 1 . . . . . 4.0 1.8 5.0 1 1 
        959 1 . . . . . 3.0 1.8 3.5 1 1 
        960 1 . . . . . 4.0 1.8 6.0 1 1 
        961 1 . . . . . 4.0 1.8 5.0 1 1 
        962 1 . . . . . 3.0 1.8 3.5 1 1 
        963 1 . . . . . 4.0 1.8 5.0 1 1 
        964 1 . . . . . 4.0 1.8 5.0 1 1 
        965 1 . . . . . 3.0 1.8 3.5 1 1 
        966 1 . . . . . 4.0 1.8 5.0 1 1 
        967 1 . . . . . 3.0 1.8 3.5 1 1 
        968 1 . . . . . 4.0 1.8 5.0 1 1 
        969 1 . . . . . 4.0 1.8 6.0 1 1 
        970 1 . . . . . 4.0 1.8 5.0 1 1 
        971 1 . . . . . 4.0 1.8 5.0 1 1 
        972 1 . . . . . 3.0 1.8 3.5 1 1 
        973 1 . . . . . 3.0 1.8 3.5 1 1 
        974 1 . . . . . 4.0 1.8 6.0 1 1 
        975 1 . . . . . 4.0 1.8 5.0 1 1 
        976 1 . . . . . 3.0 1.8 3.5 1 1 
        977 1 . . . . . 4.0 1.8 5.0 1 1 
        978 1 . . . . . 4.0 1.8 6.0 1 1 
        979 1 . . . . . 4.0 1.8 5.0 1 1 
        980 1 . . . . . 4.0 1.8 5.0 1 1 
        981 1 . . . . . 3.0 1.8 3.5 1 1 
        982 1 . . . . . 4.0 1.8 5.0 1 1 
        983 1 . . . . . 4.0 1.8 5.0 1 1 
        984 1 . . . . . 4.0 1.8 5.0 1 1 
        985 1 . . . . . 4.0 1.8 6.0 1 1 
        986 1 . . . . . 4.0 1.8 5.0 1 1 
        987 1 . . . . . 4.0 1.8 6.0 1 1 
        988 1 . . . . . 3.0 1.8 3.5 1 1 
        989 1 . . . . . 4.0 1.8 5.0 1 1 
        990 1 . . . . . 4.0 1.8 5.0 1 1 
        991 1 . . . . . 4.0 1.8 5.0 1 1 
        992 1 . . . . . 4.0 1.8 6.0 1 1 
        993 1 . . . . . 4.0 1.8 5.0 1 1 
        994 1 . . . . . 4.0 1.8 5.0 1 1 
        995 1 . . . . . 4.0 1.8 5.0 1 1 
        996 1 . . . . . 4.0 1.8 6.0 1 1 
        997 1 . . . . . 4.0 1.8 5.0 1 1 
        998 1 . . . . . 3.0 1.8 3.5 1 1 
        999 1 . . . . . 4.0 1.8 5.0 1 1 
       1000 1 . . . . . 3.0 1.8 3.5 1 1 
       1001 1 . . . . . 4.0 1.8 5.0 1 1 
       1002 1 . . . . . 3.0 1.8 3.5 1 1 
       1003 1 . . . . . 4.0 1.8 5.0 1 1 
       1004 1 . . . . . 4.0 1.8 5.0 1 1 
       1005 1 . . . . . 4.0 1.8 5.0 1 1 
       1006 1 . . . . . 4.0 1.8 5.0 1 1 
       1007 1 . . . . . 3.0 1.8 3.5 1 1 
       1008 1 . . . . . 3.0 1.8 3.5 1 1 
       1009 1 . . . . . 3.0 1.8 3.5 1 1 
       1010 1 . . . . . 3.0 1.8 3.5 1 1 
       1011 1 . . . . . 4.0 1.8 5.0 1 1 
       1012 1 . . . . . 4.0 1.8 6.0 1 1 
       1013 1 . . . . . 4.0 1.8 5.0 1 1 
       1014 1 . . . . . 4.0 1.8 5.0 1 1 
       1015 1 . . . . . 4.0 1.8 6.0 1 1 
       1016 1 . . . . . 4.0 1.8 5.0 1 1 
       1017 1 . . . . . 4.0 1.8 6.0 1 1 
       1018 1 . . . . . 4.0 1.8 5.0 1 1 
       1019 1 . . . . . 4.0 1.8 5.0 1 1 
       1020 1 . . . . . 4.0 1.8 5.0 1 1 
       1021 1 . . . . . 4.0 1.8 6.0 1 1 
       1022 1 . . . . . 4.0 1.8 5.0 1 1 
       1023 1 . . . . . 4.0 1.8 6.0 1 1 
       1024 1 . . . . . 4.0 1.8 5.0 1 1 
       1025 1 . . . . . 3.0 1.8 3.5 1 1 
       1026 1 . . . . . 4.0 1.8 5.0 1 1 
       1027 1 . . . . . 4.0 1.8 5.0 1 1 
       1028 1 . . . . . 4.0 1.8 6.0 1 1 
       1029 1 . . . . . 4.0 1.8 6.0 1 1 
       1030 1 . . . . . 3.0 1.8 3.5 1 1 
       1031 1 . . . . . 4.0 1.8 5.0 1 1 
       1032 1 . . . . . 4.0 1.8 6.0 1 1 
       1033 1 . . . . . 4.0 1.8 5.0 1 1 
       1034 1 . . . . . 3.0 1.8 3.5 1 1 
       1035 1 . . . . . 4.0 1.8 5.0 1 1 
       1036 1 . . . . . 4.0 1.8 5.0 1 1 
       1037 1 . . . . . 4.0 1.8 5.0 1 1 
       1038 1 . . . . . 3.0 1.8 3.5 1 1 
       1039 1 . . . . . 4.0 1.8 6.0 1 1 
       1040 1 . . . . . 3.0 1.8 3.5 1 1 
       1041 1 . . . . . 4.0 1.8 5.0 1 1 
       1042 1 . . . . . 4.0 1.8 6.0 1 1 
       1043 1 . . . . . 4.0 1.8 5.0 1 1 
       1044 1 . . . . . 4.0 1.8 6.0 1 1 
       1045 1 . . . . . 3.0 1.8 3.5 1 1 
       1046 1 . . . . . 4.0 1.8 5.0 1 1 
       1047 1 . . . . . 4.0 1.8 6.0 1 1 
       1048 1 . . . . . 4.0 1.8 5.0 1 1 
       1049 1 . . . . . 3.0 1.8 3.5 1 1 
       1050 1 . . . . . 4.0 1.8 5.0 1 1 
       1051 1 . . . . . 4.0 1.8 6.0 1 1 
       1052 1 . . . . . 4.0 1.8 5.0 1 1 
       1053 1 . . . . . 3.0 1.8 3.5 1 1 
       1054 1 . . . . . 4.0 1.8 5.0 1 1 
       1055 1 . . . . . 4.0 1.8 5.0 1 1 
       1056 1 . . . . . 4.0 1.8 5.0 1 1 
       1057 1 . . . . . 4.0 1.8 5.0 1 1 
       1058 1 . . . . . 4.0 1.8 5.0 1 1 
       1059 1 . . . . . 3.0 1.8 3.5 1 1 
       1060 1 . . . . . 4.0 1.8 6.0 1 1 
       1061 1 . . . . . 4.0 1.8 6.0 1 1 
       1062 1 . . . . . 4.0 1.8 6.0 1 1 
       1063 1 . . . . . 4.0 1.8 5.0 1 1 
       1064 1 . . . . . 4.0 1.8 5.0 1 1 
       1065 1 . . . . . 4.0 1.8 5.0 1 1 
       1066 1 . . . . . 4.0 1.8 6.0 1 1 
       1067 1 . . . . . 4.0 1.8 5.0 1 1 
       1068 1 . . . . . 4.0 1.8 5.0 1 1 
       1069 1 . . . . . 4.0 1.8 5.0 1 1 
       1070 1 . . . . . 4.0 1.8 5.0 1 1 
       1071 1 . . . . . 4.0 1.8 5.0 1 1 
       1072 1 . . . . . 4.0 1.8 5.0 1 1 
       1073 1 . . . . . 3.0 1.8 3.5 1 1 
       1074 1 . . . . . 4.0 1.8 5.0 1 1 
       1075 1 . . . . . 4.0 1.8 6.0 1 1 
       1076 1 . . . . . 4.0 1.8 6.0 1 1 
       1077 1 . . . . . 4.0 1.8 5.0 1 1 
       1078 1 . . . . . 4.0 1.8 5.0 1 1 
       1079 1 . . . . . 4.0 1.8 6.0 1 1 
       1080 1 . . . . . 4.0 1.8 6.0 1 1 
       1081 1 . . . . . 3.0 1.8 3.5 1 1 
       1082 1 . . . . . 4.0 1.8 5.0 1 1 
       1083 1 . . . . . 4.0 1.8 5.0 1 1 
       1084 1 . . . . . 4.0 1.8 5.0 1 1 
       1085 1 . . . . . 4.0 1.8 5.0 1 1 
       1086 1 . . . . . 4.0 1.8 5.0 1 1 
       1087 1 . . . . . 4.0 1.8 5.0 1 1 
       1088 1 . . . . . 4.0 1.8 5.0 1 1 
       1089 1 . . . . . 4.0 1.8 5.0 1 1 
       1090 1 . . . . . 4.0 1.8 6.0 1 1 
       1091 1 . . . . . 4.0 1.8 5.0 1 1 
       1092 1 . . . . . 4.0 1.8 6.0 1 1 
       1093 1 . . . . . 4.0 1.8 5.0 1 1 
       1094 1 . . . . . 4.0 1.8 5.0 1 1 
       1095 1 . . . . . 4.0 1.8 5.0 1 1 
       1096 1 . . . . . 4.0 1.8 5.0 1 1 
       1097 1 . . . . . 4.0 1.8 5.0 1 1 
       1098 1 . . . . . 4.0 1.8 5.0 1 1 
       1099 1 . . . . . 4.0 1.8 6.0 1 1 
       1100 1 . . . . . 4.0 1.8 6.0 1 1 
       1101 1 . . . . . 4.0 1.8 6.0 1 1 
       1102 1 . . . . . 4.0 1.8 6.0 1 1 
       1103 1 . . . . . 4.0 1.8 5.0 1 1 
       1104 1 . . . . . 3.0 1.8 3.5 1 1 
       1105 1 . . . . . 4.0 1.8 5.0 1 1 
       1106 1 . . . . . 3.0 1.8 3.5 1 1 
       1107 1 . . . . . 4.0 1.8 5.0 1 1 
       1108 1 . . . . . 4.0 1.8 5.0 1 1 
       1109 1 . . . . . 4.0 1.8 5.0 1 1 
       1110 1 . . . . . 4.0 1.8 5.0 1 1 
       1111 1 . . . . . 4.0 1.8 5.0 1 1 
       1112 1 . . . . . 4.0 1.8 5.0 1 1 
       1113 1 . . . . . 4.0 1.8 5.0 1 1 
       1114 1 . . . . . 3.0 1.8 3.5 1 1 
       1115 1 . . . . . 4.0 1.8 5.0 1 1 
       1116 1 . . . . . 4.0 1.8 5.0 1 1 
       1117 1 . . . . . 4.0 1.8 5.0 1 1 
       1118 1 . . . . . 4.0 1.8 5.0 1 1 
       1119 1 . . . . . 4.0 1.8 6.0 1 1 
       1120 1 . . . . . 4.0 1.8 5.0 1 1 
       1121 1 . . . . . 4.0 1.8 5.0 1 1 
       1122 1 . . . . . 4.0 1.8 5.0 1 1 
       1123 1 . . . . . 4.0 1.8 5.0 1 1 
       1124 1 . . . . . 3.0 1.8 3.5 1 1 
       1125 1 . . . . . 4.0 1.8 5.0 1 1 
       1126 1 . . . . . 4.0 1.8 6.0 1 1 
       1127 1 . . . . . 4.0 1.8 6.0 1 1 
       1128 1 . . . . . 4.0 1.8 5.0 1 1 
       1129 1 . . . . . 4.0 1.8 6.0 1 1 
       1130 1 . . . . . 4.0 1.8 5.0 1 1 
       1131 1 . . . . . 4.0 1.8 5.0 1 1 
       1132 1 . . . . . 4.0 1.8 5.0 1 1 
       1133 1 . . . . . 3.0 1.8 3.5 1 1 
       1134 1 . . . . . 4.0 1.8 5.0 1 1 
       1135 1 . . . . . 4.0 1.8 6.0 1 1 
       1136 1 . . . . . 4.0 1.8 5.0 1 1 
       1137 1 . . . . . 4.0 1.8 5.0 1 1 
       1138 1 . . . . . 4.0 1.8 5.0 1 1 
       1139 1 . . . . . 4.0 1.8 6.0 1 1 
       1140 1 . . . . . 4.0 1.8 6.0 1 1 
       1141 1 . . . . . 3.0 1.8 3.5 1 1 
       1142 1 . . . . . 3.0 1.8 3.5 1 1 
       1143 1 . . . . . 4.0 1.8 5.0 1 1 
       1144 1 . . . . . 4.0 1.8 5.0 1 1 
       1145 1 . . . . . 4.0 1.8 5.0 1 1 
       1146 1 . . . . . 3.0 1.8 3.5 1 1 
       1147 1 . . . . . 4.0 1.8 5.0 1 1 
       1148 1 . . . . . 4.0 1.8 5.0 1 1 
       1149 1 . . . . . 4.0 1.8 5.0 1 1 
       1150 1 . . . . . 4.0 1.8 5.0 1 1 
       1151 1 . . . . . 4.0 1.8 6.0 1 1 
       1152 1 . . . . . 4.0 1.8 5.0 1 1 
       1153 1 . . . . . 4.0 1.8 5.0 1 1 
       1154 1 . . . . . 4.0 1.8 6.0 1 1 
       1155 1 . . . . . 4.0 1.8 6.0 1 1 
       1156 1 . . . . . 4.0 1.8 5.0 1 1 
       1157 1 . . . . . 4.0 1.8 5.0 1 1 
       1158 1 . . . . . 4.0 1.8 6.0 1 1 
       1159 1 . . . . . 4.0 1.8 6.0 1 1 
       1160 1 . . . . . 4.0 1.8 5.0 1 1 
       1161 1 . . . . . 4.0 1.8 5.0 1 1 
       1162 1 . . . . . 4.0 1.8 6.0 1 1 
       1163 1 . . . . . 4.0 1.8 6.0 1 1 
       1164 1 . . . . . 4.0 1.8 5.0 1 1 
       1165 1 . . . . . 4.0 1.8 6.0 1 1 
       1166 1 . . . . . 4.0 1.8 5.0 1 1 
       1167 1 . . . . . 4.0 1.8 5.0 1 1 
       1168 1 . . . . . 4.0 1.8 5.0 1 1 
       1169 1 . . . . . 4.0 1.8 5.0 1 1 
       1170 1 . . . . . 4.0 1.8 5.0 1 1 
       1171 1 . . . . . 4.0 1.8 6.0 1 1 
       1172 1 . . . . . 4.0 1.8 5.0 1 1 
       1173 1 . . . . . 4.0 1.8 5.0 1 1 
       1174 1 . . . . . 4.0 1.8 5.0 1 1 
       1175 1 . . . . . 4.0 1.8 5.0 1 1 
       1176 1 . . . . . 4.0 1.8 5.0 1 1 
       1177 1 . . . . . 3.0 1.8 3.5 1 1 
       1178 1 . . . . . 4.0 1.8 5.0 1 1 
       1179 1 . . . . . 4.0 1.8 5.0 1 1 
       1180 1 . . . . . 4.0 1.8 5.0 1 1 
       1181 1 . . . . . 4.0 1.8 6.0 1 1 
       1182 1 . . . . . 4.0 1.8 5.0 1 1 
       1183 1 . . . . . 4.0 1.8 5.0 1 1 
       1184 1 . . . . . 4.0 1.8 5.0 1 1 
       1185 1 . . . . . 4.0 1.8 5.0 1 1 
       1186 1 . . . . . 4.0 1.8 5.0 1 1 
       1187 1 . . . . . 3.0 1.8 3.5 1 1 
       1188 1 . . . . . 4.0 1.8 5.0 1 1 
       1189 1 . . . . . 4.0 1.8 5.0 1 1 
       1190 1 . . . . . 4.0 1.8 5.0 1 1 
       1191 1 . . . . . 4.0 1.8 5.0 1 1 
       1192 1 . . . . . 4.0 1.8 5.0 1 1 
       1193 1 . . . . . 4.0 1.8 6.0 1 1 
       1194 1 . . . . . 4.0 1.8 6.0 1 1 
       1195 1 . . . . . 4.0 1.8 5.0 1 1 
       1196 1 . . . . . 4.0 1.8 5.0 1 1 
       1197 1 . . . . . 3.0 1.8 3.5 1 1 
       1198 1 . . . . . 3.0 1.8 3.5 1 1 
       1199 1 . . . . . 4.0 1.8 5.0 1 1 
       1200 1 . . . . . 4.0 1.8 5.0 1 1 
       1201 1 . . . . . 4.0 1.8 6.0 1 1 
       1202 1 . . . . . 4.0 1.8 5.0 1 1 
       1203 1 . . . . . 4.0 1.8 6.0 1 1 
       1204 1 . . . . . 4.0 1.8 5.0 1 1 
       1205 1 . . . . . 4.0 1.8 6.0 1 1 
       1206 1 . . . . . 4.0 1.8 6.0 1 1 
       1207 1 . . . . . 4.0 1.8 5.0 1 1 
       1208 1 . . . . . 4.0 1.8 6.0 1 1 
       1209 1 . . . . . 4.0 1.8 6.0 1 1 
       1210 1 . . . . . 3.0 1.8 3.5 1 1 
       1211 1 . . . . . 4.0 1.8 6.0 1 1 
       1212 1 . . . . . 4.0 1.8 5.0 1 1 
       1213 1 . . . . . 4.0 1.8 5.0 1 1 
       1214 1 . . . . . 4.0 1.8 5.0 1 1 
       1215 1 . . . . . 4.0 1.8 5.0 1 1 
       1216 1 . . . . . 4.0 1.8 5.0 1 1 
       1217 1 . . . . . 4.0 1.8 6.0 1 1 
       1218 1 . . . . . 4.0 1.8 5.0 1 1 
       1219 1 . . . . . 4.0 1.8 6.0 1 1 
       1220 1 . . . . . 4.0 1.8 5.0 1 1 
       1221 1 . . . . . 4.0 1.8 5.0 1 1 
       1222 1 . . . . . 4.0 1.8 5.0 1 1 
       1223 1 . . . . . 4.0 1.8 6.0 1 1 
       1224 1 . . . . . 4.0 1.8 6.0 1 1 
       1225 1 . . . . . 4.0 1.8 6.0 1 1 
       1226 1 . . . . . 4.0 1.8 5.0 1 1 
       1227 1 . . . . . 4.0 1.8 5.0 1 1 
       1228 1 . . . . . 4.0 1.8 5.0 1 1 
       1229 1 . . . . . 4.0 1.8 5.0 1 1 
       1230 1 . . . . . 4.0 1.8 6.0 1 1 
       1231 1 . . . . . 4.0 1.8 6.0 1 1 
       1232 1 . . . . . 4.0 1.8 6.0 1 1 
       1233 1 . . . . . 3.0 1.8 3.5 1 1 
       1234 1 . . . . . 4.0 1.8 5.0 1 1 
       1235 1 . . . . . 4.0 1.8 6.0 1 1 
       1236 1 . . . . . 4.0 1.8 5.0 1 1 
       1237 1 . . . . . 4.0 1.8 6.0 1 1 
       1238 1 . . . . . 4.0 1.8 5.0 1 1 
       1239 1 . . . . . 3.0 1.8 3.5 1 1 
       1240 1 . . . . . 4.0 1.8 5.0 1 1 
       1241 1 . . . . . 4.0 1.8 5.0 1 1 
       1242 1 . . . . . 4.0 1.8 5.0 1 1 
       1243 1 . . . . . 4.0 1.8 5.0 1 1 
       1244 1 . . . . . 4.0 1.8 6.0 1 1 
       1245 1 . . . . . 4.0 1.8 5.0 1 1 
       1246 1 . . . . . 4.0 1.8 5.0 1 1 
       1247 1 . . . . . 4.0 1.8 5.0 1 1 
       1248 1 . . . . . 3.0 1.8 3.5 1 1 
       1249 1 . . . . . 4.0 1.8 5.0 1 1 
       1250 1 . . . . . 4.0 1.8 6.0 1 1 
       1251 1 . . . . . 4.0 1.8 5.0 1 1 
       1252 1 . . . . . 4.0 1.8 5.0 1 1 
       1253 1 . . . . . 4.0 1.8 5.0 1 1 
       1254 1 . . . . . 4.0 1.8 5.0 1 1 
       1255 1 . . . . . 3.0 1.8 3.5 1 1 
       1256 1 . . . . . 4.0 1.8 5.0 1 1 
       1257 1 . . . . . 4.0 1.8 5.0 1 1 
       1258 1 . . . . . 4.0 1.8 5.0 1 1 
       1259 1 . . . . . 4.0 1.8 5.0 1 1 
       1260 1 . . . . . 3.0 1.8 3.5 1 1 
       1261 1 . . . . . 4.0 1.8 5.0 1 1 
       1262 1 . . . . . 4.0 1.8 5.0 1 1 
       1263 1 . . . . . 4.0 1.8 6.0 1 1 
       1264 1 . . . . . 4.0 1.8 5.0 1 1 
       1265 1 . . . . . 3.0 1.8 3.5 1 1 
       1266 1 . . . . . 4.0 1.8 5.0 1 1 
       1267 1 . . . . . 4.0 1.8 5.0 1 1 
       1268 1 . . . . . 4.0 1.8 6.0 1 1 
       1269 1 . . . . . 4.0 1.8 6.0 1 1 
       1270 1 . . . . . 4.0 1.8 5.0 1 1 
       1271 1 . . . . . 4.0 1.8 5.0 1 1 
       1272 1 . . . . . 4.0 1.8 5.0 1 1 
       1273 1 . . . . . 4.0 1.8 5.0 1 1 
       1274 1 . . . . . 3.0 1.8 3.5 1 1 
       1275 1 . . . . . 3.0 1.8 3.5 1 1 
       1276 1 . . . . . 3.0 1.8 3.5 1 1 
       1277 1 . . . . . 4.0 1.8 5.0 1 1 
       1278 1 . . . . . 4.0 1.8 5.0 1 1 
       1279 1 . . . . . 4.0 1.8 5.0 1 1 
       1280 1 . . . . . 3.0 1.8 3.5 1 1 
       1281 1 . . . . . 4.0 1.8 6.0 1 1 
       1282 1 . . . . . 4.0 1.8 5.0 1 1 
       1283 1 . . . . . 4.0 1.8 5.0 1 1 
       1284 1 . . . . . 4.0 1.8 5.0 1 1 
       1285 1 . . . . . 4.0 1.8 5.0 1 1 
       1286 1 . . . . . 4.0 1.8 5.0 1 1 
       1287 1 . . . . . 4.0 1.8 5.0 1 1 
       1288 1 . . . . . 4.0 1.8 5.0 1 1 
       1289 1 . . . . . 4.0 1.8 5.0 1 1 
       1290 1 . . . . . 4.0 1.8 5.0 1 1 
       1291 1 . . . . . 4.0 1.8 5.0 1 1 
       1292 1 . . . . . 4.0 1.8 5.0 1 1 
       1293 1 . . . . . 4.0 1.8 5.0 1 1 
       1294 1 . . . . . 4.0 1.8 6.0 1 1 
       1295 1 . . . . . 4.0 1.8 5.0 1 1 
       1296 1 . . . . . 4.0 1.8 5.0 1 1 
       1297 1 . . . . . 3.0 1.8 3.5 1 1 
       1298 1 . . . . . 4.0 1.8 5.0 1 1 
       1299 1 . . . . . 4.0 1.8 5.0 1 1 
       1300 1 . . . . . 4.0 1.8 5.0 1 1 
       1301 1 . . . . . 4.0 1.8 6.0 1 1 
       1302 1 . . . . . 4.0 1.8 5.0 1 1 
       1303 1 . . . . . 4.0 1.8 5.0 1 1 
       1304 1 . . . . . 4.0 1.8 5.0 1 1 
       1305 1 . . . . . 4.0 1.8 5.0 1 1 
       1306 1 . . . . . 4.0 1.8 5.0 1 1 
       1307 1 . . . . . 4.0 1.8 5.0 1 1 
       1308 1 . . . . . 4.0 1.8 5.0 1 1 
       1309 1 . . . . . 4.0 1.8 6.0 1 1 
       1310 1 . . . . . 4.0 1.8 6.0 1 1 
       1311 1 . . . . . 4.0 1.8 5.0 1 1 
       1312 1 . . . . . 3.0 1.8 3.5 1 1 
       1313 1 . . . . . 4.0 1.8 5.0 1 1 
       1314 1 . . . . . 4.0 1.8 5.0 1 1 
       1315 1 . . . . . 4.0 1.8 6.0 1 1 
       1316 1 . . . . . 4.0 1.8 6.0 1 1 
       1317 1 . . . . . 4.0 1.8 5.0 1 1 
       1318 1 . . . . . 4.0 1.8 5.0 1 1 
       1319 1 . . . . . 4.0 1.8 5.0 1 1 
       1320 1 . . . . . 3.0 1.8 3.5 1 1 
       1321 1 . . . . . 4.0 1.8 5.0 1 1 
       1322 1 . . . . . 4.0 1.8 5.0 1 1 
       1323 1 . . . . . 3.0 1.8 3.5 1 1 
       1324 1 . . . . . 4.0 1.8 5.0 1 1 
       1325 1 . . . . . 4.0 1.8 5.0 1 1 
       1326 1 . . . . . 4.0 1.8 5.0 1 1 
       1327 1 . . . . . 3.0 1.8 3.5 1 1 
       1328 1 . . . . . 4.0 1.8 5.0 1 1 
       1329 1 . . . . . 4.0 1.8 5.0 1 1 
       1330 1 . . . . . 4.0 1.8 5.0 1 1 
       1331 1 . . . . . 4.0 1.8 5.0 1 1 
       1332 1 . . . . . 4.0 1.8 5.0 1 1 
       1333 1 . . . . . 4.0 1.8 5.0 1 1 
       1334 1 . . . . . 4.0 1.8 5.0 1 1 
       1335 1 . . . . . 4.0 1.8 5.0 1 1 
       1336 1 . . . . . 4.0 1.8 6.0 1 1 
       1337 1 . . . . . 4.0 1.8 5.0 1 1 
       1338 1 . . . . . 4.0 1.8 6.0 1 1 
       1339 1 . . . . . 4.0 1.8 5.0 1 1 
       1340 1 . . . . . 4.0 1.8 5.0 1 1 
       1341 1 . . . . . 3.0 1.8 3.5 1 1 
       1342 1 . . . . . 4.0 1.8 6.0 1 1 
       1343 1 . . . . . 4.0 1.8 5.0 1 1 
       1344 1 . . . . . 4.0 1.8 6.0 1 1 
       1345 1 . . . . . 4.0 1.8 5.0 1 1 
       1346 1 . . . . . 3.0 1.8 3.5 1 1 
       1347 1 . . . . . 4.0 1.8 5.0 1 1 
       1348 1 . . . . . 4.0 1.8 6.0 1 1 
       1349 1 . . . . . 4.0 1.8 6.0 1 1 
       1350 1 . . . . . 3.0 1.8 3.5 1 1 
       1351 1 . . . . . 4.0 1.8 5.0 1 1 
       1352 1 . . . . . 4.0 1.8 5.0 1 1 
       1353 1 . . . . . 4.0 1.8 5.0 1 1 
       1354 1 . . . . . 4.0 1.8 5.0 1 1 
       1355 1 . . . . . 4.0 1.8 5.0 1 1 
       1356 1 . . . . . 4.0 1.8 5.0 1 1 
       1357 1 . . . . . 4.0 1.8 6.0 1 1 
       1358 1 . . . . . 4.0 1.8 6.0 1 1 
       1359 1 . . . . . 3.0 1.8 3.5 1 1 
       1360 1 . . . . . 4.0 1.8 6.0 1 1 
       1361 1 . . . . . 4.0 1.8 5.0 1 1 
       1362 1 . . . . . 4.0 1.8 5.0 1 1 
       1363 1 . . . . . 4.0 1.8 5.0 1 1 
       1364 1 . . . . . 3.0 1.8 3.5 1 1 
       1365 1 . . . . . 4.0 1.8 6.0 1 1 
       1366 1 . . . . . 4.0 1.8 5.0 1 1 
       1367 1 . . . . . 4.0 1.8 5.0 1 1 
       1368 1 . . . . . 3.0 1.8 3.5 1 1 
       1369 1 . . . . . 4.0 1.8 6.0 1 1 
       1370 1 . . . . . 4.0 1.8 6.0 1 1 
       1371 1 . . . . . 4.0 1.8 6.0 1 1 
       1372 1 . . . . . 4.0 1.8 5.0 1 1 
       1373 1 . . . . . 3.0 1.8 3.5 1 1 
       1374 1 . . . . . 3.0 1.8 3.5 1 1 
       1375 1 . . . . . 4.0 1.8 5.0 1 1 
       1376 1 . . . . . 4.0 1.8 5.0 1 1 
       1377 1 . . . . . 4.0 1.8 5.0 1 1 
       1378 1 . . . . . 4.0 1.8 6.0 1 1 
       1379 1 . . . . . 4.0 1.8 5.0 1 1 
       1380 1 . . . . . 3.0 1.8 3.5 1 1 
       1381 1 . . . . . 4.0 1.8 5.0 1 1 
       1382 1 . . . . . 4.0 1.8 5.0 1 1 
       1383 1 . . . . . 4.0 1.8 5.0 1 1 
       1384 1 . . . . . 4.0 1.8 5.0 1 1 
       1385 1 . . . . . 4.0 1.8 5.0 1 1 
       1386 1 . . . . . 4.0 1.8 6.0 1 1 
       1387 1 . . . . . 4.0 1.8 5.0 1 1 
       1388 1 . . . . . 4.0 1.8 5.0 1 1 
       1389 1 . . . . . 4.0 1.8 5.0 1 1 
       1390 1 . . . . . 4.0 1.8 5.0 1 1 
       1391 1 . . . . . 4.0 1.8 5.0 1 1 
       1392 1 . . . . . 4.0 1.8 5.0 1 1 
       1393 1 . . . . . 4.0 1.8 5.0 1 1 
       1394 1 . . . . . 3.0 1.8 3.5 1 1 
       1395 1 . . . . . 3.0 1.8 3.5 1 1 
       1396 1 . . . . . 4.0 1.8 5.0 1 1 
       1397 1 . . . . . 4.0 1.8 5.0 1 1 
       1398 1 . . . . . 4.0 1.8 5.0 1 1 
       1399 1 . . . . . 4.0 1.8 5.0 1 1 
       1400 1 . . . . . 4.0 1.8 5.0 1 1 
       1401 1 . . . . . 4.0 1.8 5.0 1 1 
       1402 1 . . . . . 4.0 1.8 5.0 1 1 
       1403 1 . . . . . 4.0 1.8 5.0 1 1 
       1404 1 . . . . . 4.0 1.8 6.0 1 1 
       1405 1 . . . . . 3.0 1.8 3.5 1 1 
       1406 1 . . . . . 4.0 1.8 5.0 1 1 
       1407 1 . . . . . 4.0 1.8 6.0 1 1 
       1408 1 . . . . . 4.0 1.8 5.0 1 1 
       1409 1 . . . . . 4.0 1.8 5.0 1 1 
       1410 1 . . . . . 4.0 1.8 5.0 1 1 
       1411 1 . . . . . 3.0 1.8 3.5 1 1 
       1412 1 . . . . . 4.0 1.8 5.0 1 1 
       1413 1 . . . . . 4.0 1.8 5.0 1 1 
       1414 1 . . . . . 4.0 1.8 6.0 1 1 
       1415 1 . . . . . 4.0 1.8 5.0 1 1 
       1416 1 . . . . . 4.0 1.8 5.0 1 1 
       1417 1 . . . . . 4.0 1.8 5.0 1 1 
       1418 1 . . . . . 4.0 1.8 5.0 1 1 
       1419 1 . . . . . 4.0 1.8 5.0 1 1 
       1420 1 . . . . . 4.0 1.8 5.0 1 1 
       1421 1 . . . . . 4.0 1.8 5.0 1 1 
       1422 1 . . . . . 4.0 1.8 6.0 1 1 
       1423 1 . . . . . 4.0 1.8 5.0 1 1 
       1424 1 . . . . . 3.0 1.8 3.5 1 1 
       1425 1 . . . . . 4.0 1.8 5.0 1 1 
       1426 1 . . . . . 4.0 1.8 6.0 1 1 
       1427 1 . . . . . 4.0 1.8 5.0 1 1 
       1428 1 . . . . . 4.0 1.8 6.0 1 1 
       1429 1 . . . . . 3.0 1.8 3.5 1 1 
       1430 1 . . . . . 4.0 1.8 5.0 1 1 
       1431 1 . . . . . 4.0 1.8 6.0 1 1 
       1432 1 . . . . . 4.0 1.8 5.0 1 1 
       1433 1 . . . . . 3.0 1.8 3.5 1 1 
       1434 1 . . . . . 4.0 1.8 5.0 1 1 
       1435 1 . . . . . 4.0 1.8 5.0 1 1 
       1436 1 . . . . . 4.0 1.8 6.0 1 1 
       1437 1 . . . . . 4.0 1.8 5.0 1 1 
       1438 1 . . . . . 4.0 1.8 5.0 1 1 
       1439 1 . . . . . 4.0 1.8 5.0 1 1 
       1440 1 . . . . . 4.0 1.8 6.0 1 1 
       1441 1 . . . . . 4.0 1.8 6.0 1 1 
       1442 1 . . . . . 3.0 1.8 3.5 1 1 
       1443 1 . . . . . 4.0 1.8 5.0 1 1 
       1444 1 . . . . . 4.0 1.8 5.0 1 1 
       1445 1 . . . . . 4.0 1.8 5.0 1 1 
       1446 1 . . . . . 4.0 1.8 5.0 1 1 
       1447 1 . . . . . 4.0 1.8 5.0 1 1 
       1448 1 . . . . . 4.0 1.8 5.0 1 1 
       1449 1 . . . . . 4.0 1.8 5.0 1 1 
       1450 1 . . . . . 4.0 1.8 5.0 1 1 
       1451 1 . . . . . 4.0 1.8 5.0 1 1 
       1452 1 . . . . . 4.0 1.8 5.0 1 1 
       1453 1 . . . . . 4.0 1.8 5.0 1 1 
       1454 1 . . . . . 4.0 1.8 5.0 1 1 
       1455 1 . . . . . 4.0 1.8 5.0 1 1 
       1456 1 . . . . . 4.0 1.8 5.0 1 1 
       1457 1 . . . . . 4.0 1.8 5.0 1 1 
       1458 1 . . . . . 4.0 1.8 5.0 1 1 
       1459 1 . . . . . 3.0 1.8 3.5 1 1 
       1460 1 . . . . . 4.0 1.8 5.0 1 1 
       1461 1 . . . . . 4.0 1.8 6.0 1 1 
       1462 1 . . . . . 4.0 1.8 6.0 1 1 
       1463 1 . . . . . 4.0 1.8 5.0 1 1 
       1464 1 . . . . . 4.0 1.8 6.0 1 1 
       1465 1 . . . . . 4.0 1.8 5.0 1 1 
       1466 1 . . . . . 4.0 1.8 5.0 1 1 
       1467 1 . . . . . 4.0 1.8 5.0 1 1 
       1468 1 . . . . . 4.0 1.8 5.0 1 1 
       1469 1 . . . . . 4.0 1.8 5.0 1 1 
       1470 1 . . . . . 4.0 1.8 5.0 1 1 
       1471 1 . . . . . 4.0 1.8 6.0 1 1 
       1472 1 . . . . . 4.0 1.8 6.0 1 1 
       1473 1 . . . . . 4.0 1.8 5.0 1 1 
       1474 1 . . . . . 4.0 1.8 5.0 1 1 
       1475 1 . . . . . 4.0 1.8 5.0 1 1 
       1476 1 . . . . . 4.0 1.8 6.0 1 1 
       1477 1 . . . . . 4.0 1.8 5.0 1 1 
       1478 1 . . . . . 4.0 1.8 6.0 1 1 
       1479 1 . . . . . 4.0 1.8 5.0 1 1 
       1480 1 . . . . . 4.0 1.8 5.0 1 1 
       1481 1 . . . . . 4.0 1.8 5.0 1 1 
       1482 1 . . . . . 4.0 1.8 5.0 1 1 
       1483 1 . . . . . 4.0 1.8 5.0 1 1 
       1484 1 . . . . . 4.0 1.8 5.0 1 1 
       1485 1 . . . . . 4.0 1.8 6.0 1 1 
       1486 1 . . . . . 3.0 1.8 3.5 1 1 
       1487 1 . . . . . 4.0 1.8 5.0 1 1 
       1488 1 . . . . . 4.0 1.8 5.0 1 1 
       1489 1 . . . . . 4.0 1.8 5.0 1 1 
       1490 1 . . . . . 4.0 1.8 5.0 1 1 
       1491 1 . . . . . 4.0 1.8 5.0 1 1 
       1492 1 . . . . . 4.0 1.8 5.0 1 1 
       1493 1 . . . . . 4.0 1.8 5.0 1 1 
       1494 1 . . . . . 4.0 1.8 5.0 1 1 
       1495 1 . . . . . 3.0 1.8 3.5 1 1 
       1496 1 . . . . . 4.0 1.8 5.0 1 1 
       1497 1 . . . . . 4.0 1.8 5.0 1 1 
       1498 1 . . . . . 4.0 1.8 5.0 1 1 
       1499 1 . . . . . 4.0 1.8 5.0 1 1 
       1500 1 . . . . . 4.0 1.8 5.0 1 1 
       1501 1 . . . . . 4.0 1.8 5.0 1 1 
       1502 1 . . . . . 4.0 1.8 6.0 1 1 
       1503 1 . . . . . 4.0 1.8 6.0 1 1 
       1504 1 . . . . . 4.0 1.8 5.0 1 1 
       1505 1 . . . . . 4.0 1.8 6.0 1 1 
       1506 1 . . . . . 4.0 1.8 5.0 1 1 
       1507 1 . . . . . 4.0 1.8 5.0 1 1 
       1508 1 . . . . . 4.0 1.8 5.0 1 1 
       1509 1 . . . . . 3.0 1.8 3.5 1 1 
       1510 1 . . . . . 4.0 1.8 5.0 1 1 
       1511 1 . . . . . 4.0 1.8 6.0 1 1 
       1512 1 . . . . . 4.0 1.8 5.0 1 1 
       1513 1 . . . . . 4.0 1.8 5.0 1 1 
       1514 1 . . . . . 4.0 1.8 5.0 1 1 
       1515 1 . . . . . 3.0 1.8 3.5 1 1 
       1516 1 . . . . . 4.0 1.8 5.0 1 1 
       1517 1 . . . . . 4.0 1.8 5.0 1 1 
       1518 1 . . . . . 4.0 1.8 6.0 1 1 
       1519 1 . . . . . 4.0 1.8 5.0 1 1 
       1520 1 . . . . . 4.0 1.8 5.0 1 1 
       1521 1 . . . . . 4.0 1.8 6.0 1 1 
       1522 1 . . . . . 4.0 1.8 5.0 1 1 
       1523 1 . . . . . 4.0 1.8 5.0 1 1 
       1524 1 . . . . . 4.0 1.8 5.0 1 1 
       1525 1 . . . . . 4.0 1.8 5.0 1 1 
       1526 1 . . . . . 4.0 1.8 6.0 1 1 
       1527 1 . . . . . 4.0 1.8 6.0 1 1 
       1528 1 . . . . . 4.0 1.8 6.0 1 1 
       1529 1 . . . . . 3.0 1.8 3.5 1 1 
       1530 1 . . . . . 3.0 1.8 3.5 1 1 
       1531 1 . . . . . 3.0 1.8 3.5 1 1 
       1532 1 . . . . . 4.0 1.8 5.0 1 1 
       1533 1 . . . . . 4.0 1.8 5.0 1 1 
       1534 1 . . . . . 4.0 1.8 5.0 1 1 
       1535 1 . . . . . 4.0 1.8 5.0 1 1 
       1536 1 . . . . . 4.0 1.8 5.0 1 1 
       1537 1 . . . . . 4.0 1.8 6.0 1 1 
       1538 1 . . . . . 4.0 1.8 5.0 1 1 
       1539 1 . . . . . 4.0 1.8 6.0 1 1 
       1540 1 . . . . . 4.0 1.8 5.0 1 1 
       1541 1 . . . . . 4.0 1.8 6.0 1 1 
       1542 1 . . . . . 4.0 1.8 6.0 1 1 
       1543 1 . . . . . 4.0 1.8 6.0 1 1 
       1544 1 . . . . . 4.0 1.8 5.0 1 1 
       1545 1 . . . . . 4.0 1.8 6.0 1 1 
       1546 1 . . . . . 4.0 1.8 6.0 1 1 
       1547 1 . . . . . 4.0 1.8 5.0 1 1 
       1548 1 . . . . . 4.0 1.8 6.0 1 1 
       1549 1 . . . . . 4.0 1.8 5.0 1 1 
       1550 1 . . . . . 4.0 1.8 6.0 1 1 
       1551 1 . . . . . 4.0 1.8 6.0 1 1 
       1552 1 . . . . . 4.0 1.8 6.0 1 1 
       1553 1 . . . . . 4.0 1.8 6.0 1 1 
       1554 1 . . . . . 4.0 1.8 5.0 1 1 
       1555 1 . . . . . 4.0 1.8 6.0 1 1 
       1556 1 . . . . . 4.0 1.8 5.0 1 1 
       1557 1 . . . . . 4.0 1.8 5.0 1 1 
       1558 1 . . . . . 3.0 1.8 3.5 1 1 
       1559 1 . . . . . 4.0 1.8 5.0 1 1 
       1560 1 . . . . . 4.0 1.8 6.0 1 1 
       1561 1 . . . . . 4.0 1.8 5.0 1 1 
       1562 1 . . . . . 4.0 1.8 5.0 1 1 
       1563 1 . . . . . 4.0 1.8 5.0 1 1 
       1564 1 . . . . . 4.0 1.8 5.0 1 1 
       1565 1 . . . . . 4.0 1.8 6.0 1 1 
       1566 1 . . . . . 4.0 1.8 6.0 1 1 
       1567 1 . . . . . 4.0 1.8 5.0 1 1 
       1568 1 . . . . . 4.0 1.8 5.0 1 1 
       1569 1 . . . . . 3.0 1.8 3.5 1 1 
       1570 1 . . . . . 4.0 1.8 5.0 1 1 
       1571 1 . . . . . 4.0 1.8 5.0 1 1 
       1572 1 . . . . . 4.0 1.8 5.0 1 1 
       1573 1 . . . . . 4.0 1.8 5.0 1 1 
       1574 1 . . . . . 4.0 1.8 5.0 1 1 
       1575 1 . . . . . 4.0 1.8 6.0 1 1 
       1576 1 . . . . . 4.0 1.8 5.0 1 1 
       1577 1 . . . . . 3.0 1.8 3.5 1 1 
       1578 1 . . . . . 3.0 1.8 3.5 1 1 
       1579 1 . . . . . 4.0 1.8 5.0 1 1 
       1580 1 . . . . . 4.0 1.8 5.0 1 1 
       1581 1 . . . . . 4.0 1.8 5.0 1 1 
       1582 1 . . . . . 3.0 1.8 3.5 1 1 
       1583 1 . . . . . 3.0 1.8 3.5 1 1 
       1584 1 . . . . . 4.0 1.8 5.0 1 1 
       1585 1 . . . . . 3.0 1.8 3.5 1 1 
       1586 1 . . . . . 4.0 1.8 6.0 1 1 
       1587 1 . . . . . 2.0 1.8 2.7 1 1 
       1588 1 . . . . . 4.0 1.8 6.0 1 1 
       1589 1 . . . . . 4.0 1.8 5.0 1 1 
       1590 1 . . . . . 4.0 1.8 6.0 1 1 
       1591 1 . . . . . 4.0 1.8 5.0 1 1 
       1592 1 . . . . . 4.0 1.8 6.0 1 1 
       1593 1 . . . . . 4.0 1.8 5.0 1 1 
       1594 1 . . . . . 4.0 1.8 6.0 1 1 
       1595 1 . . . . . 4.0 1.8 5.0 1 1 
       1596 1 . . . . . 4.0 1.8 6.0 1 1 
       1597 1 . . . . . 4.0 1.8 6.0 1 1 
       1598 1 . . . . . 4.0 1.8 5.0 1 1 
       1599 1 . . . . . 4.0 1.8 5.0 1 1 
       1600 1 . . . . . 4.0 1.8 6.0 1 1 
       1601 1 . . . . . 4.0 1.8 5.0 1 1 
       1602 1 . . . . . 4.0 1.8 6.0 1 1 
       1603 1 . . . . . 4.0 1.8 5.0 1 1 
       1604 1 . . . . . 4.0 1.8 6.0 1 1 
       1605 1 . . . . . 4.0 1.8 5.0 1 1 
       1606 1 . . . . . 4.0 1.8 6.0 1 1 
       1607 1 . . . . . 4.0 1.8 6.0 1 1 
       1608 1 . . . . . 4.0 1.8 5.0 1 1 
       1609 1 . . . . . 4.0 1.8 5.0 1 1 
       1610 1 . . . . . 4.0 1.8 5.0 1 1 
       1611 1 . . . . . 4.0 1.8 6.0 1 1 
       1612 1 . . . . . 4.0 1.8 5.0 1 1 
       1613 1 . . . . . 3.0 1.8 3.5 1 1 
       1614 1 . . . . . 4.0 1.8 5.0 1 1 
       1615 1 . . . . . 4.0 1.8 6.0 1 1 
       1616 1 . . . . . 4.0 1.8 5.0 1 1 
       1617 1 . . . . . 4.0 1.8 6.0 1 1 
       1618 1 . . . . . 4.0 1.8 6.0 1 1 
       1619 1 . . . . . 4.0 1.8 5.0 1 1 
       1620 1 . . . . . 4.0 1.8 5.0 1 1 
       1621 1 . . . . . 4.0 1.8 5.0 1 1 
       1622 1 . . . . . 4.0 1.8 6.0 1 1 
       1623 1 . . . . . 4.0 1.8 6.0 1 1 
       1624 1 . . . . . 4.0 1.8 5.0 1 1 
       1625 1 . . . . . 4.0 1.8 5.0 1 1 
       1626 1 . . . . . 4.0 1.8 5.0 1 1 
       1627 1 . . . . . 4.0 1.8 5.0 1 1 
       1628 1 . . . . . 3.0 1.8 3.5 1 1 
       1629 1 . . . . . 4.0 1.8 5.0 1 1 
       1630 1 . . . . . 4.0 1.8 5.0 1 1 
       1631 1 . . . . . 4.0 1.8 6.0 1 1 
       1632 1 . . . . . 3.0 1.8 3.5 1 1 
       1633 1 . . . . . 4.0 1.8 5.0 1 1 
       1634 1 . . . . . 4.0 1.8 5.0 1 1 
       1635 1 . . . . . 4.0 1.8 5.0 1 1 
       1636 1 . . . . . 4.0 1.8 6.0 1 1 
       1637 1 . . . . . 4.0 1.8 6.0 1 1 
       1638 1 . . . . . 4.0 1.8 5.0 1 1 
       1639 1 . . . . . 4.0 1.8 5.0 1 1 
       1640 1 . . . . . 4.0 1.8 6.0 1 1 
       1641 1 . . . . . 4.0 1.8 5.0 1 1 
       1642 1 . . . . . 4.0 1.8 5.0 1 1 
       1643 1 . . . . . 4.0 1.8 5.0 1 1 
       1644 1 . . . . . 4.0 1.8 5.0 1 1 
       1645 1 . . . . . 4.0 1.8 6.0 1 1 
       1646 1 . . . . . 4.0 1.8 5.0 1 1 
       1647 1 . . . . . 3.0 1.8 3.5 1 1 
       1648 1 . . . . . 4.0 1.8 6.0 1 1 
       1649 1 . . . . . 4.0 1.8 6.0 1 1 
       1650 1 . . . . . 4.0 1.8 5.0 1 1 
       1651 1 . . . . . 4.0 1.8 5.0 1 1 
       1652 1 . . . . . 4.0 1.8 6.0 1 1 
       1653 1 . . . . . 4.0 1.8 5.0 1 1 
       1654 1 . . . . . 4.0 1.8 5.0 1 1 
       1655 1 . . . . . 4.0 1.8 5.0 1 1 
       1656 1 . . . . . 4.0 1.8 5.0 1 1 
       1657 1 . . . . . 3.0 1.8 3.5 1 1 
       1658 1 . . . . . 4.0 1.8 5.0 1 1 
       1659 1 . . . . . 4.0 1.8 6.0 1 1 
       1660 1 . . . . . 4.0 1.8 6.0 1 1 
       1661 1 . . . . . 4.0 1.8 5.0 1 1 
       1662 1 . . . . . 4.0 1.8 5.0 1 1 
       1663 1 . . . . . 4.0 1.8 5.0 1 1 
       1664 1 . . . . . 4.0 1.8 5.0 1 1 
       1665 1 . . . . . 4.0 1.8 5.0 1 1 
       1666 1 . . . . . 4.0 1.8 5.0 1 1 
       1667 1 . . . . . 4.0 1.8 5.0 1 1 
       1668 1 . . . . . 4.0 1.8 5.0 1 1 
       1669 1 . . . . . 4.0 1.8 5.0 1 1 
       1670 1 . . . . . 4.0 1.8 6.0 1 1 
       1671 1 . . . . . 4.0 1.8 5.0 1 1 
       1672 1 . . . . . 4.0 1.8 5.0 1 1 
       1673 1 . . . . . 4.0 1.8 6.0 1 1 
       1674 1 . . . . . 4.0 1.8 6.0 1 1 
       1675 1 . . . . . 4.0 1.8 6.0 1 1 
       1676 1 . . . . . 4.0 1.8 6.0 1 1 
       1677 1 . . . . . 4.0 1.8 5.0 1 1 
       1678 1 . . . . . 4.0 1.8 5.0 1 1 
       1679 1 . . . . . 4.0 1.8 5.0 1 1 
       1680 1 . . . . . 4.0 1.8 5.0 1 1 
       1681 1 . . . . . 4.0 1.8 5.0 1 1 
       1682 1 . . . . . 4.0 1.8 5.0 1 1 
       1683 1 . . . . . 4.0 1.8 5.0 1 1 
       1684 1 . . . . . 4.0 1.8 5.0 1 1 
       1685 1 . . . . . 4.0 1.8 5.0 1 1 
       1686 1 . . . . . 4.0 1.8 5.0 1 1 
       1687 1 . . . . . 4.0 1.8 5.0 1 1 
       1688 1 . . . . . 4.0 1.8 6.0 1 1 
       1689 1 . . . . . 4.0 1.8 5.0 1 1 
       1690 1 . . . . . 4.0 1.8 5.0 1 1 
       1691 1 . . . . . 4.0 1.8 5.0 1 1 
       1692 1 . . . . . 4.0 1.8 5.0 1 1 
       1693 1 . . . . . 4.0 1.8 5.0 1 1 
       1694 1 . . . . . 4.0 1.8 6.0 1 1 
       1695 1 . . . . . 4.0 1.8 6.0 1 1 
       1696 1 . . . . . 4.0 1.8 5.0 1 1 
       1697 1 . . . . . 4.0 1.8 5.0 1 1 
       1698 1 . . . . . 4.0 1.8 5.0 1 1 
       1699 1 . . . . . 4.0 1.8 6.0 1 1 
       1700 1 . . . . . 4.0 1.8 5.0 1 1 
       1701 1 . . . . . 4.0 1.8 5.0 1 1 
       1702 1 . . . . . 4.0 1.8 5.0 1 1 
       1703 1 . . . . . 4.0 1.8 5.0 1 1 
       1704 1 . . . . . 4.0 1.8 5.0 1 1 
       1705 1 . . . . . 3.0 1.8 3.5 1 1 
       1706 1 . . . . . 4.0 1.8 5.0 1 1 
       1707 1 . . . . . 4.0 1.8 6.0 1 1 
       1708 1 . . . . . 4.0 1.8 5.0 1 1 
       1709 1 . . . . . 4.0 1.8 5.0 1 1 
       1710 1 . . . . . 4.0 1.8 5.0 1 1 
       1711 1 . . . . . 4.0 1.8 5.0 1 1 
       1712 1 . . . . . 4.0 1.8 5.0 1 1 
       1713 1 . . . . . 4.0 1.8 5.0 1 1 
       1714 1 . . . . . 4.0 1.8 5.0 1 1 
       1715 1 . . . . . 4.0 1.8 5.0 1 1 
       1716 1 . . . . . 4.0 1.8 6.0 1 1 
       1717 1 . . . . . 4.0 1.8 6.0 1 1 
       1718 1 . . . . . 4.0 1.8 5.0 1 1 
       1719 1 . . . . . 4.0 1.8 6.0 1 1 
       1720 1 . . . . . 4.0 1.8 5.0 1 1 
       1721 1 . . . . . 4.0 1.8 5.0 1 1 
       1722 1 . . . . . 4.0 1.8 6.0 1 1 
       1723 1 . . . . . 4.0 1.8 5.0 1 1 
       1724 1 . . . . . 4.0 1.8 5.0 1 1 
       1725 1 . . . . . 3.0 1.8 3.5 1 1 
       1726 1 . . . . . 4.0 1.8 6.0 1 1 
       1727 1 . . . . . 4.0 1.8 6.0 1 1 
       1728 1 . . . . . 3.0 1.8 3.5 1 1 
       1729 1 . . . . . 4.0 1.8 6.0 1 1 
       1730 1 . . . . . 4.0 1.8 5.0 1 1 
       1731 1 . . . . . 4.0 1.8 6.0 1 1 
       1732 1 . . . . . 3.0 1.8 3.5 1 1 
       1733 1 . . . . . 4.0 1.8 5.0 1 1 
       1734 1 . . . . . 4.0 1.8 5.0 1 1 
       1735 1 . . . . . 4.0 1.8 6.0 1 1 
       1736 1 . . . . . 4.0 1.8 5.0 1 1 
       1737 1 . . . . . 4.0 1.8 6.0 1 1 
       1738 1 . . . . . 4.0 1.8 5.0 1 1 
       1739 1 . . . . . 4.0 1.8 5.0 1 1 
       1740 1 . . . . . 4.0 1.8 5.0 1 1 
       1741 1 . . . . . 4.0 1.8 6.0 1 1 
       1742 1 . . . . . 4.0 1.8 5.0 1 1 
       1743 1 . . . . . 4.0 1.8 5.0 1 1 
       1744 1 . . . . . 4.0 1.8 5.0 1 1 
       1745 1 . . . . . 4.0 1.8 6.0 1 1 
       1746 1 . . . . . 4.0 1.8 6.0 1 1 
       1747 1 . . . . . 4.0 1.8 5.0 1 1 
       1748 1 . . . . . 4.0 1.8 5.0 1 1 
       1749 1 . . . . . 4.0 1.8 5.0 1 1 
       1750 1 . . . . . 4.0 1.8 6.0 1 1 
       1751 1 . . . . . 4.0 1.8 6.0 1 1 
       1752 1 . . . . . 4.0 1.8 5.0 1 1 
       1753 1 . . . . . 4.0 1.8 6.0 1 1 
       1754 1 . . . . . 4.0 1.8 6.0 1 1 
       1755 1 . . . . . 3.0 1.8 3.5 1 1 
       1756 1 . . . . . 4.0 1.8 5.0 1 1 
       1757 1 . . . . . 4.0 1.8 5.0 1 1 
       1758 1 . . . . . 4.0 1.8 5.0 1 1 
       1759 1 . . . . . 4.0 1.8 6.0 1 1 
       1760 1 . . . . . 4.0 1.8 5.0 1 1 
       1761 1 . . . . . 4.0 1.8 5.0 1 1 
       1762 1 . . . . . 4.0 1.8 5.0 1 1 
       1763 1 . . . . . 4.0 1.8 6.0 1 1 
       1764 1 . . . . . 4.0 1.8 5.0 1 1 
       1765 1 . . . . . 4.0 1.8 6.0 1 1 
       1766 1 . . . . . 4.0 1.8 6.0 1 1 
       1767 1 . . . . . 4.0 1.8 6.0 1 1 
       1768 1 . . . . . 4.0 1.8 5.0 1 1 
       1769 1 . . . . . 4.0 1.8 5.0 1 1 
       1770 1 . . . . . 4.0 1.8 6.0 1 1 
       1771 1 . . . . . 4.0 1.8 6.0 1 1 
       1772 1 . . . . . 4.0 1.8 6.0 1 1 
       1773 1 . . . . . 4.0 1.8 5.0 1 1 
       1774 1 . . . . . 4.0 1.8 5.0 1 1 
       1775 1 . . . . . 4.0 1.8 5.0 1 1 
       1776 1 . . . . . 4.0 1.8 5.0 1 1 
       1777 1 . . . . . 4.0 1.8 5.0 1 1 
       1778 1 . . . . . 4.0 1.8 6.0 1 1 
       1779 1 . . . . . 4.0 1.8 5.0 1 1 
       1780 1 . . . . . 4.0 1.8 6.0 1 1 
       1781 1 . . . . . 4.0 1.8 5.0 1 1 
       1782 1 . . . . . 4.0 1.8 6.0 1 1 
       1783 1 . . . . . 4.0 1.8 5.0 1 1 
       1784 1 . . . . . 4.0 1.8 5.0 1 1 
       1785 1 . . . . . 4.0 1.8 5.0 1 1 
       1786 1 . . . . . 4.0 1.8 5.0 1 1 
       1787 1 . . . . . 4.0 1.8 5.0 1 1 
       1788 1 . . . . . 4.0 1.8 5.0 1 1 
       1789 1 . . . . . 4.0 1.8 5.0 1 1 
       1790 1 . . . . . 3.0 1.8 3.5 1 1 
       1791 1 . . . . . 4.0 1.8 6.0 1 1 
       1792 1 . . . . . 4.0 1.8 5.0 1 1 
       1793 1 . . . . . 4.0 1.8 6.0 1 1 
       1794 1 . . . . . 4.0 1.8 6.0 1 1 
       1795 1 . . . . . 4.0 1.8 5.0 1 1 
       1796 1 . . . . . 4.0 1.8 5.0 1 1 
       1797 1 . . . . . 4.0 1.8 5.0 1 1 
       1798 1 . . . . . 4.0 1.8 5.0 1 1 
       1799 1 . . . . . 4.0 1.8 5.0 1 1 
       1800 1 . . . . . 3.0 1.8 3.5 1 1 
       1801 1 . . . . . 4.0 1.8 5.0 1 1 
       1802 1 . . . . . 4.0 1.8 6.0 1 1 
       1803 1 . . . . . 4.0 1.8 5.0 1 1 
       1804 1 . . . . . 4.0 1.8 5.0 1 1 
       1805 1 . . . . . 4.0 1.8 5.0 1 1 
       1806 1 . . . . . 4.0 1.8 5.0 1 1 
       1807 1 . . . . . 3.0 1.8 3.5 1 1 
       1808 1 . . . . . 2.0 1.8 2.7 1 1 
       1809 1 . . . . . 4.0 1.8 5.0 1 1 
       1810 1 . . . . . 4.0 1.8 6.0 1 1 
       1811 1 . . . . . 4.0 1.8 6.0 1 1 
       1812 1 . . . . . 4.0 1.8 6.0 1 1 
       1813 1 . . . . . 4.0 1.8 5.0 1 1 
       1814 1 . . . . . 4.0 1.8 5.0 1 1 
       1815 1 . . . . . 4.0 1.8 5.0 1 1 
       1816 1 . . . . . 4.0 1.8 5.0 1 1 
       1817 1 . . . . . 3.0 1.8 3.5 1 1 
       1818 1 . . . . . 4.0 1.8 6.0 1 1 
       1819 1 . . . . . 4.0 1.8 6.0 1 1 
       1820 1 . . . . . 4.0 1.8 5.0 1 1 
       1821 1 . . . . . 4.0 1.8 5.0 1 1 
       1822 1 . . . . . 4.0 1.8 6.0 1 1 
       1823 1 . . . . . 4.0 1.8 5.0 1 1 
       1824 1 . . . . . 4.0 1.8 5.0 1 1 
       1825 1 . . . . . 3.0 1.8 3.5 1 1 
       1826 1 . . . . . 4.0 1.8 5.0 1 1 
       1827 1 . . . . . 3.0 1.8 3.5 1 1 
       1828 1 . . . . . 4.0 1.8 5.0 1 1 
       1829 1 . . . . . 4.0 1.8 5.0 1 1 
       1830 1 . . . . . 4.0 1.8 6.0 1 1 
       1831 1 . . . . . 4.0 1.8 5.0 1 1 
       1832 1 . . . . . 4.0 1.8 5.0 1 1 
       1833 1 . . . . . 4.0 1.8 6.0 1 1 
       1834 1 . . . . . 4.0 1.8 5.0 1 1 
       1835 1 . . . . . 4.0 1.8 6.0 1 1 
       1836 1 . . . . . 4.0 1.8 6.0 1 1 
       1837 1 . . . . . 4.0 1.8 5.0 1 1 
       1838 1 . . . . . 4.0 1.8 5.0 1 1 
       1839 1 . . . . . 4.0 1.8 5.0 1 1 
       1840 1 . . . . . 3.0 1.8 3.5 1 1 
       1841 1 . . . . . 4.0 1.8 5.0 1 1 
       1842 1 . . . . . 3.0 1.8 3.5 1 1 
       1843 1 . . . . . 4.0 1.8 5.0 1 1 
       1844 1 . . . . . 4.0 1.8 5.0 1 1 
       1845 1 . . . . . 4.0 1.8 6.0 1 1 
       1846 1 . . . . . 4.0 1.8 5.0 1 1 
       1847 1 . . . . . 4.0 1.8 5.0 1 1 
       1848 1 . . . . . 4.0 1.8 5.0 1 1 
       1849 1 . . . . . 4.0 1.8 6.0 1 1 
       1850 1 . . . . . 3.0 1.8 3.5 1 1 
       1851 1 . . . . . 3.0 1.8 3.5 1 1 
       1852 1 . . . . . 3.0 1.8 3.5 1 1 
       1853 1 . . . . . 3.0 1.8 3.5 1 1 
       1854 1 . . . . . 4.0 1.8 5.0 1 1 
       1855 1 . . . . . 4.0 1.8 5.0 1 1 
       1856 1 . . . . . 4.0 1.8 5.0 1 1 
       1857 1 . . . . . 3.0 1.8 3.5 1 1 
       1858 1 . . . . . 4.0 1.8 5.0 1 1 
       1859 1 . . . . . 4.0 1.8 6.0 1 1 
       1860 1 . . . . . 4.0 1.8 5.0 1 1 
       1861 1 . . . . . 4.0 1.8 5.0 1 1 
       1862 1 . . . . . 4.0 1.8 5.0 1 1 
       1863 1 . . . . . 4.0 1.8 6.0 1 1 
       1864 1 . . . . . 4.0 1.8 6.0 1 1 
       1865 1 . . . . . 4.0 1.8 5.0 1 1 
       1866 1 . . . . . 4.0 1.8 6.0 1 1 
       1867 1 . . . . . 4.0 1.8 5.0 1 1 
       1868 1 . . . . . 4.0 1.8 5.0 1 1 
       1869 1 . . . . . 4.0 1.8 5.0 1 1 
       1870 1 . . . . . 3.0 1.8 3.5 1 1 
       1871 1 . . . . . 3.0 1.8 3.5 1 1 
       1872 1 . . . . . 4.0 1.8 6.0 1 1 
       1873 1 . . . . . 4.0 1.8 5.0 1 1 
       1874 1 . . . . . 4.0 1.8 5.0 1 1 
       1875 1 . . . . . 4.0 1.8 5.0 1 1 
       1876 1 . . . . . 4.0 1.8 5.0 1 1 
       1877 1 . . . . . 4.0 1.8 6.0 1 1 
       1878 1 . . . . . 3.0 1.8 3.5 1 1 
       1879 1 . . . . . 3.0 1.8 3.5 1 1 
       1880 1 . . . . . 4.0 1.8 5.0 1 1 
       1881 1 . . . . . 4.0 1.8 5.0 1 1 
       1882 1 . . . . . 4.0 1.8 6.0 1 1 
       1883 1 . . . . . 4.0 1.8 5.0 1 1 
       1884 1 . . . . . 4.0 1.8 6.0 1 1 
       1885 1 . . . . . 4.0 1.8 6.0 1 1 
       1886 1 . . . . . 4.0 1.8 5.0 1 1 
       1887 1 . . . . . 4.0 1.8 6.0 1 1 
       1888 1 . . . . . 4.0 1.8 5.0 1 1 
       1889 1 . . . . . 4.0 1.8 6.0 1 1 
       1890 1 . . . . . 4.0 1.8 5.0 1 1 
       1891 1 . . . . . 4.0 1.8 5.0 1 1 
       1892 1 . . . . . 4.0 1.8 5.0 1 1 
       1893 1 . . . . . 4.0 1.8 6.0 1 1 
       1894 1 . . . . . 4.0 1.8 5.0 1 1 
       1895 1 . . . . . 4.0 1.8 6.0 1 1 
       1896 1 . . . . . 4.0 1.8 5.0 1 1 
       1897 1 . . . . . 4.0 1.8 5.0 1 1 
       1898 1 . . . . . 4.0 1.8 5.0 1 1 
       1899 1 . . . . . 4.0 1.8 6.0 1 1 
       1900 1 . . . . . 4.0 1.8 5.0 1 1 
       1901 1 . . . . . 4.0 1.8 6.0 1 1 
       1902 1 . . . . . 4.0 1.8 6.0 1 1 
       1903 1 . . . . . 4.0 1.8 5.0 1 1 
       1904 1 . . . . . 3.0 1.8 3.5 1 1 
       1905 1 . . . . . 4.0 1.8 5.0 1 1 
       1906 1 . . . . . 3.0 1.8 3.5 1 1 
       1907 1 . . . . . 4.0 1.8 5.0 1 1 
       1908 1 . . . . . 4.0 1.8 5.0 1 1 
       1909 1 . . . . . 3.0 1.8 3.5 1 1 
       1910 1 . . . . . 4.0 1.8 5.0 1 1 
       1911 1 . . . . . 4.0 1.8 5.0 1 1 
       1912 1 . . . . . 3.0 1.8 3.5 1 1 
       1913 1 . . . . . 4.0 1.8 5.0 1 1 
       1914 1 . . . . . 4.0 1.8 5.0 1 1 
       1915 1 . . . . . 4.0 1.8 5.0 1 1 
       1916 1 . . . . . 4.0 1.8 5.0 1 1 
       1917 1 . . . . . 4.0 1.8 5.0 1 1 
       1918 1 . . . . . 4.0 1.8 6.0 1 1 
       1919 1 . . . . . 4.0 1.8 5.0 1 1 
       1920 1 . . . . . 3.0 1.8 3.5 1 1 
       1921 1 . . . . . 4.0 1.8 5.0 1 1 
       1922 1 . . . . . 3.0 1.8 3.5 1 1 
       1923 1 . . . . . 4.0 1.8 5.0 1 1 
       1924 1 . . . . . 4.0 1.8 6.0 1 1 
       1925 1 . . . . . 4.0 1.8 5.0 1 1 
       1926 1 . . . . . 4.0 1.8 5.0 1 1 
       1927 1 . . . . . 4.0 1.8 5.0 1 1 
       1928 1 . . . . . 4.0 1.8 5.0 1 1 
       1929 1 . . . . . 4.0 1.8 5.0 1 1 
       1930 1 . . . . . 4.0 1.8 5.0 1 1 
       1931 1 . . . . . 4.0 1.8 5.0 1 1 
       1932 1 . . . . . 4.0 1.8 5.0 1 1 
       1933 1 . . . . . 4.0 1.8 5.0 1 1 
       1934 1 . . . . . 3.0 1.8 3.5 1 1 
       1935 1 . . . . . 4.0 1.8 6.0 1 1 
       1936 1 . . . . . 4.0 1.8 6.0 1 1 
       1937 1 . . . . . 4.0 1.8 5.0 1 1 
       1938 1 . . . . . 4.0 1.8 5.0 1 1 
       1939 1 . . . . . 4.0 1.8 6.0 1 1 
       1940 1 . . . . . 3.0 1.8 3.5 1 1 
       1941 1 . . . . . 4.0 1.8 5.0 1 1 
       1942 1 . . . . . 4.0 1.8 5.0 1 1 
       1943 1 . . . . . 4.0 1.8 5.0 1 1 
       1944 1 . . . . . 4.0 1.8 5.0 1 1 
       1945 1 . . . . . 3.0 1.8 3.5 1 1 
       1946 1 . . . . . 4.0 1.8 5.0 1 1 
       1947 1 . . . . . 4.0 1.8 5.0 1 1 
       1948 1 . . . . . 4.0 1.8 5.0 1 1 
       1949 1 . . . . . 4.0 1.8 5.0 1 1 
       1950 1 . . . . . 4.0 1.8 5.0 1 1 
       1951 1 . . . . . 3.0 1.8 3.5 1 1 
       1952 1 . . . . . 4.0 1.8 5.0 1 1 
       1953 1 . . . . . 3.0 1.8 3.5 1 1 
       1954 1 . . . . . 4.0 1.8 5.0 1 1 
       1955 1 . . . . . 4.0 1.8 6.0 1 1 
       1956 1 . . . . . 4.0 1.8 5.0 1 1 
       1957 1 . . . . . 4.0 1.8 5.0 1 1 
       1958 1 . . . . . 4.0 1.8 5.0 1 1 
       1959 1 . . . . . 3.0 1.8 3.5 1 1 
       1960 1 . . . . . 4.0 1.8 5.0 1 1 
       1961 1 . . . . . 4.0 1.8 5.0 1 1 
       1962 1 . . . . . 4.0 1.8 5.0 1 1 
       1963 1 . . . . . 4.0 1.8 5.0 1 1 
       1964 1 . . . . . 3.0 1.8 3.5 1 1 
       1965 1 . . . . . 4.0 1.8 5.0 1 1 
       1966 1 . . . . . 3.0 1.8 3.5 1 1 
       1967 1 . . . . . 4.0 1.8 5.0 1 1 
       1968 1 . . . . . 4.0 1.8 5.0 1 1 
       1969 1 . . . . . 4.0 1.8 5.0 1 1 
       1970 1 . . . . . 4.0 1.8 6.0 1 1 
       1971 1 . . . . . 4.0 1.8 5.0 1 1 
       1972 1 . . . . . 4.0 1.8 5.0 1 1 
       1973 1 . . . . . 4.0 1.8 6.0 1 1 
       1974 1 . . . . . 4.0 1.8 6.0 1 1 
       1975 1 . . . . . 4.0 1.8 6.0 1 1 
       1976 1 . . . . . 4.0 1.8 5.0 1 1 
       1977 1 . . . . . 4.0 1.8 5.0 1 1 
       1978 1 . . . . . 3.0 1.8 3.5 1 1 
       1979 1 . . . . . 4.0 1.8 5.0 1 1 
       1980 1 . . . . . 4.0 1.8 6.0 1 1 
       1981 1 . . . . . 4.0 1.8 5.0 1 1 
       1982 1 . . . . . 4.0 1.8 5.0 1 1 
       1983 1 . . . . . 4.0 1.8 5.0 1 1 
       1984 1 . . . . . 4.0 1.8 5.0 1 1 
       1985 1 . . . . . 3.0 1.8 3.5 1 1 
       1986 1 . . . . . 4.0 1.8 6.0 1 1 
       1987 1 . . . . . 4.0 1.8 6.0 1 1 
       1988 1 . . . . . 4.0 1.8 5.0 1 1 
       1989 1 . . . . . 4.0 1.8 5.0 1 1 
       1990 1 . . . . . 4.0 1.8 5.0 1 1 
       1991 1 . . . . . 3.0 1.8 3.5 1 1 
       1992 1 . . . . . 4.0 1.8 5.0 1 1 
       1993 1 . . . . . 4.0 1.8 5.0 1 1 
       1994 1 . . . . . 4.0 1.8 5.0 1 1 
       1995 1 . . . . . 4.0 1.8 5.0 1 1 
       1996 1 . . . . . 4.0 1.8 5.0 1 1 
       1997 1 . . . . . 4.0 1.8 5.0 1 1 
       1998 1 . . . . . 4.0 1.8 5.0 1 1 
       1999 1 . . . . . 4.0 1.8 5.0 1 1 
       2000 1 . . . . . 4.0 1.8 5.0 1 1 
       2001 1 . . . . . 4.0 1.8 5.0 1 1 
       2002 1 . . . . . 4.0 1.8 5.0 1 1 
       2003 1 . . . . . 4.0 1.8 5.0 1 1 
       2004 1 . . . . . 4.0 1.8 6.0 1 1 
       2005 1 . . . . . 4.0 1.8 5.0 1 1 
       2006 1 . . . . . 4.0 1.8 6.0 1 1 
       2007 1 . . . . . 3.0 1.8 3.5 1 1 
       2008 1 . . . . . 4.0 1.8 5.0 1 1 
       2009 1 . . . . . 4.0 1.8 5.0 1 1 
       2010 1 . . . . . 4.0 1.8 5.0 1 1 
       2011 1 . . . . . 4.0 1.8 5.0 1 1 
       2012 1 . . . . . 4.0 1.8 5.0 1 1 
       2013 1 . . . . . 4.0 1.8 5.0 1 1 
       2014 1 . . . . . 4.0 1.8 5.0 1 1 
       2015 1 . . . . . 4.0 1.8 5.0 1 1 
       2016 1 . . . . . 4.0 1.8 6.0 1 1 
       2017 1 . . . . . 4.0 1.8 5.0 1 1 
       2018 1 . . . . . 4.0 1.8 5.0 1 1 
       2019 1 . . . . . 4.0 1.8 5.0 1 1 
       2020 1 . . . . . 4.0 1.8 6.0 1 1 
       2021 1 . . . . . 3.0 1.8 3.5 1 1 
       2022 1 . . . . . 4.0 1.8 5.0 1 1 
       2023 1 . . . . . 4.0 1.8 5.0 1 1 
       2024 1 . . . . . 4.0 1.8 5.0 1 1 
       2025 1 . . . . . 4.0 1.8 5.0 1 1 
       2026 1 . . . . . 4.0 1.8 5.0 1 1 
       2027 1 . . . . . 4.0 1.8 5.0 1 1 
       2028 1 . . . . . 4.0 1.8 6.0 1 1 
       2029 1 . . . . . 4.0 1.8 5.0 1 1 
       2030 1 . . . . . 3.0 1.8 3.5 1 1 
       2031 1 . . . . . 4.0 1.8 5.0 1 1 
       2032 1 . . . . . 4.0 1.8 5.0 1 1 
       2033 1 . . . . . 4.0 1.8 5.0 1 1 
       2034 1 . . . . . 4.0 1.8 6.0 1 1 
       2035 1 . . . . . 4.0 1.8 5.0 1 1 
       2036 1 . . . . . 4.0 1.8 5.0 1 1 
       2037 1 . . . . . 3.0 1.8 3.5 1 1 
       2038 1 . . . . . 4.0 1.8 5.0 1 1 
       2039 1 . . . . . 4.0 1.8 5.0 1 1 
       2040 1 . . . . . 4.0 1.8 5.0 1 1 
       2041 1 . . . . . 4.0 1.8 5.0 1 1 
       2042 1 . . . . . 4.0 1.8 5.0 1 1 
       2043 1 . . . . . 4.0 1.8 5.0 1 1 
       2044 1 . . . . . 4.0 1.8 6.0 1 1 
       2045 1 . . . . . 4.0 1.8 5.0 1 1 
       2046 1 . . . . . 4.0 1.8 5.0 1 1 
       2047 1 . . . . . 4.0 1.8 5.0 1 1 
       2048 1 . . . . . 4.0 1.8 6.0 1 1 
       2049 1 . . . . . 4.0 1.8 6.0 1 1 
       2050 1 . . . . . 4.0 1.8 6.0 1 1 
       2051 1 . . . . . 4.0 1.8 5.0 1 1 
       2052 1 . . . . . 4.0 1.8 5.0 1 1 
       2053 1 . . . . . 4.0 1.8 5.0 1 1 
       2054 1 . . . . . 4.0 1.8 5.0 1 1 
       2055 1 . . . . . 4.0 1.8 5.0 1 1 
       2056 1 . . . . . 4.0 1.8 5.0 1 1 
       2057 1 . . . . . 4.0 1.8 5.0 1 1 
       2058 1 . . . . . 4.0 1.8 5.0 1 1 
       2059 1 . . . . . 3.0 1.8 3.5 1 1 
       2060 1 . . . . . 4.0 1.8 5.0 1 1 
       2061 1 . . . . . 4.0 1.8 5.0 1 1 
       2062 1 . . . . . 4.0 1.8 5.0 1 1 
       2063 1 . . . . . 4.0 1.8 5.0 1 1 
       2064 1 . . . . . 4.0 1.8 5.0 1 1 
       2065 1 . . . . . 4.0 1.8 5.0 1 1 
       2066 1 . . . . . 4.0 1.8 5.0 1 1 
       2067 1 . . . . . 4.0 1.8 5.0 1 1 
       2068 1 . . . . . 4.0 1.8 5.0 1 1 
       2069 1 . . . . . 4.0 1.8 5.0 1 1 
       2070 1 . . . . . 3.0 1.8 3.5 1 1 
       2071 1 . . . . . 4.0 1.8 5.0 1 1 
       2072 1 . . . . . 4.0 1.8 5.0 1 1 
       2073 1 . . . . . 3.0 1.8 3.5 1 1 
       2074 1 . . . . . 4.0 1.8 5.0 1 1 
       2075 1 . . . . . 4.0 1.8 6.0 1 1 
       2076 1 . . . . . 4.0 1.8 5.0 1 1 
       2077 1 . . . . . 4.0 1.8 5.0 1 1 
       2078 1 . . . . . 4.0 1.8 6.0 1 1 
       2079 1 . . . . . 3.0 1.8 3.5 1 1 
       2080 1 . . . . . 3.0 1.8 3.5 1 1 
       2081 1 . . . . . 3.0 1.8 3.5 1 1 
       2082 1 . . . . . 4.0 1.8 5.0 1 1 
       2083 1 . . . . . 4.0 1.8 5.0 1 1 
       2084 1 . . . . . 4.0 1.8 5.0 1 1 
       2085 1 . . . . . 4.0 1.8 5.0 1 1 
       2086 1 . . . . . 4.0 1.8 6.0 1 1 
       2087 1 . . . . . 4.0 1.8 5.0 1 1 
       2088 1 . . . . . 4.0 1.8 5.0 1 1 
       2089 1 . . . . .   . 1.8 3.5 1 1 
       2090 1 . . . . . 4.0 1.8 5.0 1 1 
       2091 1 . . . . . 4.0 1.8 5.0 1 1 
       2092 1 . . . . . 3.0 1.8 3.5 1 1 
       2093 1 . . . . . 3.0 1.8 3.5 1 1 
       2094 1 . . . . . 3.0 1.8 3.5 1 1 
       2095 1 . . . . . 4.0 1.8 5.0 1 1 
       2096 1 . . . . . 4.0 1.8 6.0 1 1 
       2097 1 . . . . . 4.0 1.8 5.0 1 1 
       2098 1 . . . . . 4.0 1.8 5.0 1 1 
       2099 1 . . . . . 4.0 1.8 5.0 1 1 
       2100 1 . . . . . 4.0 1.8 6.0 1 1 
       2101 1 . . . . . 4.0 1.8 5.0 1 1 
       2102 1 . . . . . 3.0 1.8 3.5 1 1 
       2103 1 . . . . . 4.0 1.8 6.0 1 1 
       2104 1 . . . . . 4.0 1.8 5.0 1 1 
       2105 1 . . . . . 4.0 1.8 5.0 1 1 
       2106 1 . . . . . 4.0 1.8 6.0 1 1 
       2107 1 . . . . . 3.0 1.8 3.5 1 1 
       2108 1 . . . . . 4.0 1.8 6.0 1 1 
       2109 1 . . . . . 4.0 1.8 5.0 1 1 
       2110 1 . . . . . 4.0 1.8 5.0 1 1 
       2111 1 . . . . . 2.0 1.8 2.7 1 1 
       2112 1 . . . . . 4.0 1.8 5.0 1 1 
       2113 1 . . . . . 4.0 1.8 5.0 1 1 
       2114 1 . . . . . 3.0 1.8 3.5 1 1 
       2115 1 . . . . . 2.0 1.8 2.7 1 1 
       2116 1 . . . . . 4.0 1.8 5.0 1 1 
       2117 1 . . . . . 4.0 1.8 5.0 1 1 
       2118 1 . . . . . 2.0 1.8 2.7 1 1 
       2119 1 . . . . . 4.0 1.8 5.0 1 1 
       2120 1 . . . . . 4.0 1.8 6.0 1 1 
       2121 1 . . . . . 2.0 1.8 2.7 1 1 
       2122 1 . . . . . 4.0 1.8 5.0 1 1 
       2123 1 . . . . . 4.0 1.8 5.0 1 1 
       2124 1 . . . . . 4.0 1.8 5.0 1 1 
       2125 1 . . . . . 4.0 1.8 6.0 1 1 
       2126 1 . . . . . 4.0 1.8 5.0 1 1 
       2127 1 . . . . . 4.0 1.8 5.0 1 1 
       2128 1 . . . . . 4.0 1.8 5.0 1 1 
       2129 1 . . . . . 3.0 1.8 3.5 1 1 
       2130 1 . . . . . 4.0 1.8 5.0 1 1 
       2131 1 . . . . . 4.0 1.8 5.0 1 1 
       2132 1 . . . . . 4.0 1.8 5.0 1 1 
       2133 1 . . . . . 4.0 1.8 5.0 1 1 
       2134 1 . . . . . 4.0 1.8 6.0 1 1 
       2135 1 . . . . . 4.0 1.8 5.0 1 1 
       2136 1 . . . . . 4.0 1.8 5.0 1 1 
       2137 1 . . . . . 4.0 1.8 5.0 1 1 
       2138 1 . . . . . 3.0 1.8 3.5 1 1 
       2139 1 . . . . . 4.0 1.8 5.0 1 1 
       2140 1 . . . . . 4.0 1.8 5.0 1 1 
       2141 1 . . . . . 4.0 1.8 5.0 1 1 
       2142 1 . . . . . 4.0 1.8 5.0 1 1 
       2143 1 . . . . . 4.0 1.8 5.0 1 1 
       2144 1 . . . . . 4.0 1.8 5.0 1 1 
       2145 1 . . . . . 4.0 1.8 5.0 1 1 
       2146 1 . . . . . 4.0 1.8 5.0 1 1 
       2147 1 . . . . . 4.0 1.8 5.0 1 1 
       2148 1 . . . . . 4.0 1.8 5.0 1 1 
       2149 1 . . . . . 4.0 1.8 6.0 1 1 
       2150 1 . . . . . 4.0 1.8 6.0 1 1 
       2151 1 . . . . . 4.0 1.8 6.0 1 1 
       2152 1 . . . . . 4.0 1.8 6.0 1 1 
       2153 1 . . . . . 4.0 1.8 6.0 1 1 
       2154 1 . . . . . 4.0 1.8 6.0 1 1 
       2155 1 . . . . . 4.0 1.8 5.0 1 1 
       2156 1 . . . . . 4.0 1.8 6.0 1 1 
       2157 1 . . . . . 3.0 1.8 3.5 1 1 
       2158 1 . . . . . 4.0 1.8 6.0 1 1 
       2159 1 . . . . . 4.0 1.8 5.0 1 1 
       2160 1 . . . . . 4.0 1.8 6.0 1 1 
       2161 1 . . . . . 4.0 1.8 5.0 1 1 
       2162 1 . . . . . 4.0 1.8 5.0 1 1 
       2163 1 . . . . . 4.0 1.8 5.0 1 1 
       2164 1 . . . . . 4.0 1.8 6.0 1 1 
       2165 1 . . . . . 4.0 1.8 5.0 1 1 
       2166 1 . . . . . 4.0 1.8 5.0 1 1 
       2167 1 . . . . . 4.0 1.8 6.0 1 1 
       2168 1 . . . . . 4.0 1.8 5.0 1 1 
       2169 1 . . . . . 4.0 1.8 6.0 1 1 
       2170 1 . . . . . 4.0 1.8 5.0 1 1 
       2171 1 . . . . . 4.0 1.8 5.0 1 1 
       2172 1 . . . . . 4.0 1.8 5.0 1 1 
       2173 1 . . . . . 4.0 1.8 5.0 1 1 
       2174 1 . . . . . 4.0 1.8 5.0 1 1 
       2175 1 . . . . . 4.0 1.8 5.0 1 1 
       2176 1 . . . . . 4.0 1.8 5.0 1 1 
       2177 1 . . . . . 4.0 1.8 6.0 1 1 
       2178 1 . . . . . 4.0 1.8 5.0 1 1 
       2179 1 . . . . . 4.0 1.8 5.0 1 1 
       2180 1 . . . . . 4.0 1.8 5.0 1 1 
       2181 1 . . . . . 4.0 1.8 6.0 1 1 
       2182 1 . . . . . 4.0 1.8 5.0 1 1 
       2183 1 . . . . . 4.0 1.8 6.0 1 1 
       2184 1 . . . . . 4.0 1.8 6.0 1 1 
       2185 1 . . . . . 4.0 1.8 5.0 1 1 
       2186 1 . . . . . 4.0 1.8 5.0 1 1 
       2187 1 . . . . . 4.0 1.8 5.0 1 1 
       2188 1 . . . . . 4.0 1.8 5.0 1 1 
       2189 1 . . . . . 4.0 1.8 5.0 1 1 
       2190 1 . . . . . 4.0 1.8 5.0 1 1 
       2191 1 . . . . . 3.0 1.8 3.5 1 1 
       2192 1 . . . . . 4.0 1.8 5.0 1 1 
       2193 1 . . . . . 4.0 1.8 5.0 1 1 
       2194 1 . . . . . 4.0 1.8 5.0 1 1 
       2195 1 . . . . . 4.0 1.8 5.0 1 1 
       2196 1 . . . . . 4.0 1.8 5.0 1 1 
       2197 1 . . . . . 4.0 1.8 5.0 1 1 
       2198 1 . . . . . 4.0 1.8 6.0 1 1 
       2199 1 . . . . . 4.0 1.8 5.0 1 1 
       2200 1 . . . . . 4.0 1.8 5.0 1 1 
       2201 1 . . . . . 3.0 1.8 3.5 1 1 
       2202 1 . . . . . 4.0 1.8 5.0 1 1 
       2203 1 . . . . . 4.0 1.8 5.0 1 1 
       2204 1 . . . . . 4.0 1.8 5.0 1 1 
       2205 1 . . . . . 4.0 1.8 6.0 1 1 
       2206 1 . . . . . 3.0 1.8 3.5 1 1 
       2207 1 . . . . . 4.0 1.8 5.0 1 1 
       2208 1 . . . . . 4.0 1.8 5.0 1 1 
       2209 1 . . . . . 4.0 1.8 6.0 1 1 
       2210 1 . . . . . 4.0 1.8 6.0 1 1 
       2211 1 . . . . . 4.0 1.8 5.0 1 1 
       2212 1 . . . . . 4.0 1.8 5.0 1 1 
       2213 1 . . . . . 4.0 1.8 6.0 1 1 
       2214 1 . . . . . 4.0 1.8 5.0 1 1 
       2215 1 . . . . . 4.0 1.8 5.0 1 1 
       2216 1 . . . . . 4.0 1.8 5.0 1 1 
       2217 1 . . . . . 4.0 1.8 5.0 1 1 
       2218 1 . . . . . 4.0 1.8 6.0 1 1 
       2219 1 . . . . . 4.0 1.8 5.0 1 1 
       2220 1 . . . . . 4.0 1.8 5.0 1 1 
       2221 1 . . . . . 4.0 1.8 5.0 1 1 
       2222 1 . . . . . 4.0 1.8 5.0 1 1 
       2223 1 . . . . . 4.0 1.8 5.0 1 1 
       2224 1 . . . . . 4.0 1.8 5.0 1 1 
       2225 1 . . . . . 4.0 1.8 5.0 1 1 
       2226 1 . . . . . 4.0 1.8 5.0 1 1 
       2227 1 . . . . . 4.0 1.8 6.0 1 1 
       2228 1 . . . . . 4.0 1.8 6.0 1 1 
       2229 1 . . . . . 4.0 1.8 5.0 1 1 
       2230 1 . . . . . 4.0 1.8 6.0 1 1 
       2231 1 . . . . . 4.0 1.8 5.0 1 1 
       2232 1 . . . . . 4.0 1.8 5.0 1 1 
       2233 1 . . . . . 4.0 1.8 5.0 1 1 
       2234 1 . . . . . 4.0 1.8 5.0 1 1 
       2235 1 . . . . . 3.0 1.8 3.5 1 1 
       2236 1 . . . . . 4.0 1.8 5.0 1 1 
       2237 1 . . . . . 4.0 1.8 5.0 1 1 
       2238 1 . . . . . 4.0 1.8 5.0 1 1 
       2239 1 . . . . . 4.0 1.8 5.0 1 1 
       2240 1 . . . . . 4.0 1.8 5.0 1 1 
       2241 1 . . . . . 4.0 1.8 5.0 1 1 
       2242 1 . . . . . 4.0 1.8 5.0 1 1 
       2243 1 . . . . . 4.0 1.8 5.0 1 1 
       2244 1 . . . . . 4.0 1.8 5.0 1 1 
       2245 1 . . . . . 4.0 1.8 6.0 1 1 
       2246 1 . . . . . 3.0 1.8 3.5 1 1 
       2247 1 . . . . . 4.0 1.8 6.0 1 1 
       2248 1 . . . . . 4.0 1.8 5.0 1 1 
       2249 1 . . . . . 4.0 1.8 6.0 1 1 
       2250 1 . . . . . 4.0 1.8 5.0 1 1 
       2251 1 . . . . . 4.0 1.8 6.0 1 1 
       2252 1 . . . . . 4.0 1.8 6.0 1 1 
       2253 1 . . . . . 4.0 1.8 5.0 1 1 
       2254 1 . . . . . 4.0 1.8 5.0 1 1 
       2255 1 . . . . . 3.0 1.8 3.5 1 1 
       2256 1 . . . . . 4.0 1.8 6.0 1 1 
       2257 1 . . . . . 4.0 1.8 5.0 1 1 
       2258 1 . . . . . 4.0 1.8 5.0 1 1 
       2259 1 . . . . . 4.0 1.8 6.0 1 1 
       2260 1 . . . . . 4.0 1.8 6.0 1 1 
       2261 1 . . . . . 4.0 1.8 6.0 1 1 
       2262 1 . . . . . 3.0 1.8 3.5 1 1 
       2263 1 . . . . . 3.0 1.8 3.5 1 1 
       2264 1 . . . . . 3.0 1.8 3.5 1 1 
       2265 1 . . . . . 4.0 1.8 5.0 1 1 
       2266 1 . . . . . 4.0 1.8 5.0 1 1 
       2267 1 . . . . . 4.0 1.8 5.0 1 1 
       2268 1 . . . . . 4.0 1.8 5.0 1 1 
       2269 1 . . . . . 4.0 1.8 5.0 1 1 
       2270 1 . . . . . 4.0 1.8 5.0 1 1 
       2271 1 . . . . . 4.0 1.8 5.0 1 1 
       2272 1 . . . . . 4.0 1.8 5.0 1 1 
       2273 1 . . . . . 4.0 1.8 6.0 1 1 
       2274 1 . . . . . 3.0 1.8 3.5 1 1 
       2275 1 . . . . . 3.0 1.8 3.5 1 1 
       2276 1 . . . . . 4.0 1.8 5.0 1 1 
       2277 1 . . . . . 4.0 1.8 6.0 1 1 
       2278 1 . . . . . 4.0 1.8 5.0 1 1 
       2279 1 . . . . . 3.0 1.8 3.5 1 1 
       2280 1 . . . . . 4.0 1.8 5.0 1 1 
       2281 1 . . . . . 4.0 1.8 5.0 1 1 
       2282 1 . . . . . 3.0 1.8 3.5 1 1 
       2283 1 . . . . . 4.0 1.8 6.0 1 1 
       2284 1 . . . . . 4.0 1.8 5.0 1 1 
       2285 1 . . . . . 4.0 1.8 5.0 1 1 
       2286 1 . . . . . 4.0 1.8 5.0 1 1 
       2287 1 . . . . . 4.0 1.8 5.0 1 1 
       2288 1 . . . . . 4.0 1.8 5.0 1 1 
       2289 1 . . . . . 3.0 1.8 3.5 1 1 
       2290 1 . . . . . 4.0 1.8 5.0 1 1 
       2291 1 . . . . . 4.0 1.8 5.0 1 1 
       2292 1 . . . . . 4.0 1.8 6.0 1 1 
       2293 1 . . . . . 3.0 1.8 3.5 1 1 
       2294 1 . . . . . 2.0 1.8 2.7 1 1 
       2295 1 . . . . . 3.0 1.8 3.5 1 1 
       2296 1 . . . . . 3.0 1.8 3.5 1 1 
       2297 1 . . . . . 4.0 1.8 5.0 1 1 
       2298 1 . . . . . 4.0 1.8 5.0 1 1 
       2299 1 . . . . . 4.0 1.8 5.0 1 1 
       2300 1 . . . . . 4.0 1.8 5.0 1 1 
       2301 1 . . . . . 4.0 1.8 6.0 1 1 
       2302 1 . . . . . 4.0 1.8 5.0 1 1 
       2303 1 . . . . . 4.0 1.8 6.0 1 1 
       2304 1 . . . . . 3.0 1.8 3.5 1 1 
       2305 1 . . . . . 4.0 1.8 5.0 1 1 
       2306 1 . . . . . 4.0 1.8 5.0 1 1 
       2307 1 . . . . . 4.0 1.8 6.0 1 1 
       2308 1 . . . . . 4.0 1.8 5.0 1 1 
       2309 1 . . . . . 3.0 1.8 3.5 1 1 
       2310 1 . . . . . 4.0 1.8 5.0 1 1 
       2311 1 . . . . . 4.0 1.8 6.0 1 1 
       2312 1 . . . . . 4.0 1.8 6.0 1 1 
       2313 1 . . . . . 4.0 1.8 6.0 1 1 
       2314 1 . . . . . 4.0 1.8 5.0 1 1 
       2315 1 . . . . . 4.0 1.8 5.0 1 1 
       2316 1 . . . . . 2.0 1.8 2.7 1 1 
       2317 1 . . . . . 4.0 1.8 5.0 1 1 
       2318 1 . . . . . 4.0 1.8 5.0 1 1 
       2319 1 . . . . . 4.0 1.8 6.0 1 1 
       2320 1 . . . . . 4.0 1.8 6.0 1 1 
       2321 1 . . . . . 4.0 1.8 5.0 1 1 
       2322 1 . . . . . 4.0 1.8 5.0 1 1 
       2323 1 . . . . . 4.0 1.8 6.0 1 1 
       2324 1 . . . . . 4.0 1.8 5.0 1 1 
       2325 1 . . . . . 4.0 1.8 5.0 1 1 
       2326 1 . . . . . 4.0 1.8 5.0 1 1 
       2327 1 . . . . . 4.0 1.8 6.0 1 1 
       2328 1 . . . . . 4.0 1.8 6.0 1 1 
       2329 1 . . . . . 4.0 1.8 5.0 1 1 
       2330 1 . . . . . 4.0 1.8 6.0 1 1 
       2331 1 . . . . . 4.0 1.8 6.0 1 1 
       2332 1 . . . . . 4.0 1.8 5.0 1 1 
       2333 1 . . . . . 4.0 1.8 5.0 1 1 
       2334 1 . . . . . 4.0 1.8 5.0 1 1 
       2335 1 . . . . . 3.0 1.8 3.5 1 1 
       2336 1 . . . . . 4.0 1.8 5.0 1 1 
       2337 1 . . . . . 4.0 1.8 6.0 1 1 
       2338 1 . . . . . 4.0 1.8 6.0 1 1 
       2339 1 . . . . . 4.0 1.8 6.0 1 1 
       2340 1 . . . . . 4.0 1.8 6.0 1 1 
       2341 1 . . . . . 4.0 1.8 6.0 1 1 
       2342 1 . . . . . 4.0 1.8 6.0 1 1 
       2343 1 . . . . . 4.0 1.8 5.0 1 1 
       2344 1 . . . . . 3.0 1.8 3.5 1 1 
       2345 1 . . . . . 4.0 1.8 5.0 1 1 
       2346 1 . . . . . 4.0 1.8 5.0 1 1 
       2347 1 . . . . . 4.0 1.8 5.0 1 1 
       2348 1 . . . . . 4.0 1.8 5.0 1 1 
       2349 1 . . . . . 4.0 1.8 5.0 1 1 
       2350 1 . . . . . 4.0 1.8 5.0 1 1 
       2351 1 . . . . . 4.0 1.8 6.0 1 1 
       2352 1 . . . . . 4.0 1.8 5.0 1 1 
       2353 1 . . . . . 4.0 1.8 5.0 1 1 
       2354 1 . . . . . 4.0 1.8 5.0 1 1 
       2355 1 . . . . . 4.0 1.8 5.0 1 1 
       2356 1 . . . . . 4.0 1.8 5.0 1 1 
       2357 1 . . . . . 4.0 1.8 5.0 1 1 
       2358 1 . . . . . 4.0 1.8 5.0 1 1 
       2359 1 . . . . . 4.0 1.8 6.0 1 1 
       2360 1 . . . . . 4.0 1.8 5.0 1 1 
       2361 1 . . . . . 4.0 1.8 5.0 1 1 
       2362 1 . . . . . 4.0 1.8 6.0 1 1 
       2363 1 . . . . . 4.0 1.8 5.0 1 1 
       2364 1 . . . . . 4.0 1.8 5.0 1 1 
       2365 1 . . . . . 4.0 1.8 6.0 1 1 
       2366 1 . . . . . 4.0 1.8 5.0 1 1 
       2367 1 . . . . . 4.0 1.8 6.0 1 1 
       2368 1 . . . . . 4.0 1.8 5.0 1 1 
       2369 1 . . . . . 4.0 1.8 5.0 1 1 
       2370 1 . . . . . 4.0 1.8 6.0 1 1 
       2371 1 . . . . . 4.0 1.8 6.0 1 1 
       2372 1 . . . . . 4.0 1.8 5.0 1 1 
       2373 1 . . . . . 4.0 1.8 6.0 1 1 
       2374 1 . . . . . 4.0 1.8 6.0 1 1 
       2375 1 . . . . . 3.0 1.8 3.5 1 1 
       2376 1 . . . . . 4.0 1.8 5.0 1 1 
       2377 1 . . . . . 4.0 1.8 5.0 1 1 
       2378 1 . . . . . 4.0 1.8 6.0 1 1 
       2379 1 . . . . . 4.0 1.8 5.0 1 1 
       2380 1 . . . . . 4.0 1.8 6.0 1 1 
       2381 1 . . . . . 4.0 1.8 5.0 1 1 
       2382 1 . . . . . 4.0 1.8 5.0 1 1 
       2383 1 . . . . . 4.0 1.8 6.0 1 1 
       2384 1 . . . . . 3.0 1.8 3.5 1 1 
       2385 1 . . . . . 4.0 1.8 5.0 1 1 
       2386 1 . . . . . 4.0 1.8 5.0 1 1 
       2387 1 . . . . . 4.0 1.8 6.0 1 1 
       2388 1 . . . . . 4.0 1.8 5.0 1 1 
       2389 1 . . . . . 4.0 1.8 5.0 1 1 
       2390 1 . . . . . 4.0 1.8 6.0 1 1 
       2391 1 . . . . . 4.0 1.8 5.0 1 1 
       2392 1 . . . . . 4.0 1.8 5.0 1 1 
       2393 1 . . . . . 4.0 1.8 5.0 1 1 
       2394 1 . . . . . 4.0 1.8 5.0 1 1 
       2395 1 . . . . . 4.0 1.8 5.0 1 1 
       2396 1 . . . . . 4.0 1.8 5.0 1 1 
       2397 1 . . . . . 3.0 1.8 3.5 1 1 
       2398 1 . . . . . 4.0 1.8 5.0 1 1 
       2399 1 . . . . . 3.0 1.8 3.5 1 1 
       2400 1 . . . . . 3.0 1.8 3.5 1 1 
       2401 1 . . . . . 3.0 1.8 3.5 1 1 
       2402 1 . . . . . 4.0 1.8 5.0 1 1 
       2403 1 . . . . . 4.0 1.8 5.0 1 1 
       2404 1 . . . . . 4.0 1.8 5.0 1 1 
       2405 1 . . . . . 4.0 1.8 5.0 1 1 
       2406 1 . . . . . 4.0 1.8 6.0 1 1 
       2407 1 . . . . . 4.0 1.8 6.0 1 1 
       2408 1 . . . . . 3.0 1.8 3.5 1 1 
       2409 1 . . . . . 4.0 1.8 5.0 1 1 
       2410 1 . . . . . 4.0 1.8 5.0 1 1 
       2411 1 . . . . . 4.0 1.8 6.0 1 1 
       2412 1 . . . . . 4.0 1.8 5.0 1 1 
       2413 1 . . . . . 4.0 1.8 5.0 1 1 
       2414 1 . . . . . 4.0 1.8 5.0 1 1 
       2415 1 . . . . . 4.0 1.8 5.0 1 1 
       2416 1 . . . . . 4.0 1.8 5.0 1 1 
       2417 1 . . . . . 4.0 1.8 5.0 1 1 
       2418 1 . . . . . 4.0 1.8 6.0 1 1 
       2419 1 . . . . . 4.0 1.8 5.0 1 1 
       2420 1 . . . . . 4.0 1.8 5.0 1 1 
       2421 1 . . . . . 4.0 1.8 5.0 1 1 
       2422 1 . . . . . 4.0 1.8 5.0 1 1 
       2423 1 . . . . . 4.0 1.8 5.0 1 1 
       2424 1 . . . . . 4.0 1.8 6.0 1 1 
       2425 1 . . . . . 3.0 1.8 3.5 1 1 
       2426 1 . . . . . 4.0 1.8 5.0 1 1 
       2427 1 . . . . . 3.0 1.8 3.5 1 1 
       2428 1 . . . . . 4.0 1.8 5.0 1 1 
       2429 1 . . . . . 4.0 1.8 5.0 1 1 
       2430 1 . . . . . 4.0 1.8 5.0 1 1 
       2431 1 . . . . . 4.0 1.8 6.0 1 1 
       2432 1 . . . . . 4.0 1.8 6.0 1 1 
       2433 1 . . . . . 4.0 1.8 5.0 1 1 
       2434 1 . . . . . 4.0 1.8 5.0 1 1 
       2435 1 . . . . . 4.0 1.8 6.0 1 1 
       2436 1 . . . . . 4.0 1.8 5.0 1 1 
       2437 1 . . . . . 4.0 1.8 6.0 1 1 
       2438 1 . . . . . 4.0 1.8 5.0 1 1 
       2439 1 . . . . . 4.0 1.8 5.0 1 1 
       2440 1 . . . . . 4.0 1.8 6.0 1 1 
       2441 1 . . . . . 4.0 1.8 5.0 1 1 
       2442 1 . . . . . 4.0 1.8 6.0 1 1 
       2443 1 . . . . . 4.0 1.8 6.0 1 1 
       2444 1 . . . . . 4.0 1.8 6.0 1 1 
       2445 1 . . . . . 4.0 1.8 5.0 1 1 
       2446 1 . . . . . 3.0 1.8 3.5 1 1 
       2447 1 . . . . . 3.0 1.8 3.5 1 1 
       2448 1 . . . . . 4.0 1.8 6.0 1 1 
       2449 1 . . . . . 4.0 1.8 5.0 1 1 
       2450 1 . . . . . 4.0 1.8 5.0 1 1 
       2451 1 . . . . . 4.0 1.8 6.0 1 1 
       2452 1 . . . . . 4.0 1.8 6.0 1 1 
       2453 1 . . . . . 4.0 1.8 6.0 1 1 
       2454 1 . . . . . 4.0 1.8 5.0 1 1 
       2455 1 . . . . . 4.0 1.8 5.0 1 1 
       2456 1 . . . . . 4.0 1.8 5.0 1 1 
       2457 1 . . . . . 4.0 1.8 5.0 1 1 
       2458 1 . . . . . 4.0 1.8 6.0 1 1 
       2459 1 . . . . . 4.0 1.8 5.0 1 1 
       2460 1 . . . . . 4.0 1.8 5.0 1 1 
       2461 1 . . . . . 3.0 1.8 3.5 1 1 
       2462 1 . . . . . 4.0 1.8 5.0 1 1 
       2463 1 . . . . . 4.0 1.8 5.0 1 1 
       2464 1 . . . . . 4.0 1.8 5.0 1 1 
       2465 1 . . . . . 4.0 1.8 5.0 1 1 
       2466 1 . . . . . 4.0 1.8 6.0 1 1 
       2467 1 . . . . . 4.0 1.8 5.0 1 1 
       2468 1 . . . . . 4.0 1.8 5.0 1 1 
       2469 1 . . . . . 3.0 1.8 3.5 1 1 
       2470 1 . . . . . 3.0 1.8 3.5 1 1 
       2471 1 . . . . . 3.0 1.8 3.5 1 1 
       2472 1 . . . . . 4.0 1.8 5.0 1 1 
       2473 1 . . . . . 4.0 1.8 5.0 1 1 
       2474 1 . . . . . 3.0 1.8 3.5 1 1 
       2475 1 . . . . . 4.0 1.8 6.0 1 1 
       2476 1 . . . . . 4.0 1.8 5.0 1 1 
       2477 1 . . . . . 4.0 1.8 5.0 1 1 
       2478 1 . . . . . 4.0 1.8 5.0 1 1 
       2479 1 . . . . . 4.0 1.8 6.0 1 1 
       2480 1 . . . . . 4.0 1.8 6.0 1 1 
       2481 1 . . . . . 3.0 1.8 3.5 1 1 
       2482 1 . . . . . 4.0 1.8 5.0 1 1 
       2483 1 . . . . . 4.0 1.8 5.0 1 1 
       2484 1 . . . . . 3.0 1.8 3.5 1 1 
       2485 1 . . . . . 4.0 1.8 5.0 1 1 
       2486 1 . . . . . 4.0 1.8 6.0 1 1 
       2487 1 . . . . . 4.0 1.8 6.0 1 1 
       2488 1 . . . . . 4.0 1.8 5.0 1 1 
       2489 1 . . . . . 4.0 1.8 6.0 1 1 
       2490 1 . . . . . 3.0 1.8 3.5 1 1 
       2491 1 . . . . . 4.0 1.8 5.0 1 1 
       2492 1 . . . . . 4.0 1.8 5.0 1 1 
       2493 1 . . . . . 4.0 1.8 6.0 1 1 
       2494 1 . . . . . 4.0 1.8 6.0 1 1 
       2495 1 . . . . . 4.0 1.8 5.0 1 1 
       2496 1 . . . . . 4.0 1.8 5.0 1 1 
       2497 1 . . . . . 4.0 1.8 5.0 1 1 
       2498 1 . . . . . 4.0 1.8 6.0 1 1 
       2499 1 . . . . . 4.0 1.8 5.0 1 1 
       2500 1 . . . . . 4.0 1.8 5.0 1 1 
       2501 1 . . . . . 4.0 1.8 5.0 1 1 
       2502 1 . . . . . 3.0 1.8 3.5 1 1 
       2503 1 . . . . . 4.0 1.8 6.0 1 1 
       2504 1 . . . . . 4.0 1.8 5.0 1 1 
       2505 1 . . . . . 4.0 1.8 5.0 1 1 
       2506 1 . . . . . 4.0 1.8 5.0 1 1 
       2507 1 . . . . . 4.0 1.8 5.0 1 1 
       2508 1 . . . . . 4.0 1.8 5.0 1 1 
       2509 1 . . . . . 4.0 1.8 6.0 1 1 
       2510 1 . . . . . 4.0 1.8 5.0 1 1 
       2511 1 . . . . . 4.0 1.8 5.0 1 1 
       2512 1 . . . . . 3.0 1.8 3.5 1 1 
       2513 1 . . . . . 4.0 1.8 5.0 1 1 
       2514 1 . . . . . 3.0 1.8 3.5 1 1 
       2515 1 . . . . . 4.0 1.8 5.0 1 1 
       2516 1 . . . . . 4.0 1.8 5.0 1 1 
       2517 1 . . . . . 3.0 1.8 3.5 1 1 
       2518 1 . . . . . 3.0 1.8 3.5 1 1 
       2519 1 . . . . . 4.0 1.8 5.0 1 1 
       2520 1 . . . . . 4.0 1.8 5.0 1 1 
       2521 1 . . . . . 4.0 1.8 6.0 1 1 
       2522 1 . . . . . 3.0 1.8 3.5 1 1 
       2523 1 . . . . . 4.0 1.8 5.0 1 1 
       2524 1 . . . . . 4.0 1.8 5.0 1 1 
       2525 1 . . . . . 4.0 1.8 5.0 1 1 
       2526 1 . . . . . 4.0 1.8 5.0 1 1 
       2527 1 . . . . . 4.0 1.8 5.0 1 1 
       2528 1 . . . . . 4.0 1.8 6.0 1 1 
       2529 1 . . . . . 3.0 1.8 3.5 1 1 
       2530 1 . . . . . 4.0 1.8 5.0 1 1 
       2531 1 . . . . . 4.0 1.8 5.0 1 1 
       2532 1 . . . . . 4.0 1.8 5.0 1 1 
       2533 1 . . . . . 4.0 1.8 5.0 1 1 
       2534 1 . . . . . 4.0 1.8 5.0 1 1 
       2535 1 . . . . . 3.0 1.8 3.5 1 1 
       2536 1 . . . . . 4.0 1.8 5.0 1 1 
       2537 1 . . . . . 4.0 1.8 5.0 1 1 
       2538 1 . . . . . 3.0 1.8 3.5 1 1 
       2539 1 . . . . . 4.0 1.8 5.0 1 1 
       2540 1 . . . . . 4.0 1.8 6.0 1 1 
       2541 1 . . . . . 3.0 1.8 3.5 1 1 
       2542 1 . . . . . 4.0 1.8 5.0 1 1 
       2543 1 . . . . . 2.0 1.8 2.7 1 1 
       2544 1 . . . . . 4.0 1.8 5.0 1 1 
       2545 1 . . . . . 4.0 1.8 6.0 1 1 
       2546 1 . . . . . 3.0 1.8 3.5 1 1 
       2547 1 . . . . . 4.0 1.8 6.0 1 1 
       2548 1 . . . . . 4.0 1.8 5.0 1 1 
       2549 1 . . . . . 4.0 1.8 5.0 1 1 
       2550 1 . . . . . 3.0 1.8 3.5 1 1 
       2551 1 . . . . . 4.0 1.8 5.0 1 1 
       2552 1 . . . . . 4.0 1.8 5.0 1 1 
       2553 1 . . . . . 4.0 1.8 5.0 1 1 
       2554 1 . . . . . 3.0 1.8 3.5 1 1 
       2555 1 . . . . . 3.0 1.8 3.5 1 1 
       2556 1 . . . . . 4.0 1.8 5.0 1 1 
       2557 1 . . . . . 4.0 1.8 5.0 1 1 
       2558 1 . . . . . 4.0 1.8 5.0 1 1 
       2559 1 . . . . . 4.0 1.8 5.0 1 1 
       2560 1 . . . . . 4.0 1.8 5.0 1 1 
       2561 1 . . . . . 4.0 1.8 5.0 1 1 
       2562 1 . . . . . 4.0 1.8 5.0 1 1 
       2563 1 . . . . . 4.0 1.8 5.0 1 1 
       2564 1 . . . . . 4.0 1.8 6.0 1 1 
       2565 1 . . . . . 4.0 1.8 6.0 1 1 
       2566 1 . . . . . 4.0 1.8 5.0 1 1 
       2567 1 . . . . . 4.0 1.8 5.0 1 1 
       2568 1 . . . . . 4.0 1.8 5.0 1 1 
       2569 1 . . . . . 4.0 1.8 5.0 1 1 
       2570 1 . . . . . 4.0 1.8 5.0 1 1 
       2571 1 . . . . . 4.0 1.8 5.0 1 1 
       2572 1 . . . . . 3.0 1.8 3.5 1 1 
       2573 1 . . . . . 4.0 1.8 5.0 1 1 
       2574 1 . . . . . 4.0 1.8 5.0 1 1 
       2575 1 . . . . . 4.0 1.8 6.0 1 1 
       2576 1 . . . . . 4.0 1.8 5.0 1 1 
       2577 1 . . . . . 4.0 1.8 6.0 1 1 
       2578 1 . . . . . 4.0 1.8 5.0 1 1 
       2579 1 . . . . . 4.0 1.8 6.0 1 1 
       2580 1 . . . . . 4.0 1.8 5.0 1 1 
       2581 1 . . . . . 4.0 1.8 5.0 1 1 
       2582 1 . . . . . 3.0 1.8 3.5 1 1 
       2583 1 . . . . . 4.0 1.8 6.0 1 1 
       2584 1 . . . . . 4.0 1.8 6.0 1 1 
       2585 1 . . . . . 4.0 1.8 6.0 1 1 
       2586 1 . . . . . 4.0 1.8 6.0 1 1 
       2587 1 . . . . . 4.0 1.8 6.0 1 1 
       2588 1 . . . . . 4.0 1.8 6.0 1 1 
       2589 1 . . . . . 4.0 1.8 5.0 1 1 
       2590 1 . . . . . 4.0 1.8 6.0 1 1 
       2591 1 . . . . . 4.0 1.8 5.0 1 1 
       2592 1 . . . . . 4.0 1.8 5.0 1 1 
       2593 1 . . . . . 3.0 1.8 3.5 1 1 
       2594 1 . . . . . 4.0 1.8 5.0 1 1 
       2595 1 . . . . . 4.0 1.8 6.0 1 1 
       2596 1 . . . . . 4.0 1.8 5.0 1 1 
       2597 1 . . . . . 4.0 1.8 5.0 1 1 
       2598 1 . . . . . 3.0 1.8 3.5 1 1 
       2599 1 . . . . . 4.0 1.8 5.0 1 1 
       2600 1 . . . . . 4.0 1.8 5.0 1 1 
       2601 1 . . . . . 4.0 1.8 5.0 1 1 
       2602 1 . . . . . 4.0 1.8 6.0 1 1 
       2603 1 . . . . . 4.0 1.8 6.0 1 1 
       2604 1 . . . . . 4.0 1.8 5.0 1 1 
       2605 1 . . . . . 3.0 1.8 3.5 1 1 
       2606 1 . . . . . 4.0 1.8 5.0 1 1 
       2607 1 . . . . . 4.0 1.8 5.0 1 1 
       2608 1 . . . . . 3.0 1.8 3.5 1 1 
       2609 1 . . . . . 4.0 1.8 5.0 1 1 
       2610 1 . . . . . 3.0 1.8 3.5 1 1 
       2611 1 . . . . . 4.0 1.8 5.0 1 1 
       2612 1 . . . . . 4.0 1.8 5.0 1 1 
       2613 1 . . . . . 4.0 1.8 5.0 1 1 
       2614 1 . . . . . 4.0 1.8 5.0 1 1 
       2615 1 . . . . . 3.0 1.8 3.5 1 1 
       2616 1 . . . . . 4.0 1.8 5.0 1 1 
       2617 1 . . . . . 4.0 1.8 5.0 1 1 
       2618 1 . . . . . 4.0 1.8 5.0 1 1 
       2619 1 . . . . . 3.0 1.8 3.5 1 1 
       2620 1 . . . . . 4.0 1.8 5.0 1 1 
       2621 1 . . . . . 4.0 1.8 5.0 1 1 
       2622 1 . . . . . 4.0 1.8 6.0 1 1 
       2623 1 . . . . . 4.0 1.8 5.0 1 1 
       2624 1 . . . . . 3.0 1.8 3.5 1 1 
       2625 1 . . . . . 4.0 1.8 5.0 1 1 
       2626 1 . . . . . 4.0 1.8 5.0 1 1 
       2627 1 . . . . . 4.0 1.8 5.0 1 1 
       2628 1 . . . . . 4.0 1.8 5.0 1 1 
       2629 1 . . . . . 4.0 1.8 6.0 1 1 
       2630 1 . . . . . 4.0 1.8 6.0 1 1 
       2631 1 . . . . . 4.0 1.8 5.0 1 1 
       2632 1 . . . . . 4.0 1.8 5.0 1 1 
       2633 1 . . . . . 4.0 1.8 5.0 1 1 
       2634 1 . . . . . 4.0 1.8 5.0 1 1 
       2635 1 . . . . . 4.0 1.8 5.0 1 1 
       2636 1 . . . . . 4.0 1.8 5.0 1 1 
       2637 1 . . . . . 4.0 1.8 5.0 1 1 
       2638 1 . . . . . 4.0 1.8 5.0 1 1 
       2639 1 . . . . . 4.0 1.8 5.0 1 1 
       2640 1 . . . . . 3.0 1.8 3.5 1 1 
       2641 1 . . . . . 4.0 1.8 6.0 1 1 
       2642 1 . . . . . 4.0 1.8 5.0 1 1 
       2643 1 . . . . . 4.0 1.8 6.0 1 1 
       2644 1 . . . . . 4.0 1.8 5.0 1 1 
       2645 1 . . . . . 4.0 1.8 6.0 1 1 
       2646 1 . . . . . 4.0 1.8 6.0 1 1 
       2647 1 . . . . . 4.0 1.8 5.0 1 1 
       2648 1 . . . . . 4.0 1.8 6.0 1 1 
       2649 1 . . . . . 4.0 1.8 5.0 1 1 
       2650 1 . . . . . 4.0 1.8 6.0 1 1 
       2651 1 . . . . . 4.0 1.8 5.0 1 1 
       2652 1 . . . . . 3.0 1.8 3.5 1 1 
       2653 1 . . . . . 4.0 1.8 6.0 1 1 
       2654 1 . . . . . 4.0 1.8 5.0 1 1 
       2655 1 . . . . . 4.0 1.8 5.0 1 1 
       2656 1 . . . . . 4.0 1.8 5.0 1 1 
       2657 1 . . . . . 4.0 1.8 5.0 1 1 
       2658 1 . . . . . 4.0 1.8 6.0 1 1 
       2659 1 . . . . . 4.0 1.8 6.0 1 1 
       2660 1 . . . . . 4.0 1.8 6.0 1 1 
       2661 1 . . . . . 4.0 1.8 6.0 1 1 
       2662 1 . . . . . 4.0 1.8 6.0 1 1 
       2663 1 . . . . . 4.0 1.8 5.0 1 1 
       2664 1 . . . . . 4.0 1.8 5.0 1 1 
       2665 1 . . . . . 4.0 1.8 6.0 1 1 
       2666 1 . . . . . 4.0 1.8 5.0 1 1 
       2667 1 . . . . . 4.0 1.8 6.0 1 1 
       2668 1 . . . . . 4.0 1.8 5.0 1 1 
       2669 1 . . . . . 4.0 1.8 5.0 1 1 
       2670 1 . . . . . 4.0 1.8 5.0 1 1 
       2671 1 . . . . . 4.0 1.8 5.0 1 1 
       2672 1 . . . . . 4.0 1.8 5.0 1 1 
       2673 1 . . . . . 4.0 1.8 6.0 1 1 
       2674 1 . . . . . 4.0 1.8 5.0 1 1 
       2675 1 . . . . . 4.0 1.8 5.0 1 1 
       2676 1 . . . . . 4.0 1.8 5.0 1 1 
       2677 1 . . . . . 3.0 1.8 3.5 1 1 
       2678 1 . . . . . 4.0 1.8 5.0 1 1 
       2679 1 . . . . . 4.0 1.8 5.0 1 1 
       2680 1 . . . . . 3.0 1.8 3.5 1 1 
       2681 1 . . . . . 4.0 1.8 6.0 1 1 
       2682 1 . . . . . 3.0 1.8 3.5 1 1 
       2683 1 . . . . . 4.0 1.8 5.0 1 1 
       2684 1 . . . . . 4.0 1.8 5.0 1 1 
       2685 1 . . . . . 4.0 1.8 6.0 1 1 
       2686 1 . . . . . 4.0 1.8 5.0 1 1 
       2687 1 . . . . . 4.0 1.8 6.0 1 1 
       2688 1 . . . . . 4.0 1.8 5.0 1 1 
       2689 1 . . . . . 3.0 1.8 3.5 1 1 
       2690 1 . . . . . 4.0 1.8 6.0 1 1 
       2691 1 . . . . . 4.0 1.8 6.0 1 1 
       2692 1 . . . . . 4.0 1.8 5.0 1 1 
       2693 1 . . . . . 4.0 1.8 6.0 1 1 
       2694 1 . . . . . 4.0 1.8 5.0 1 1 
       2695 1 . . . . . 3.0 1.8 3.5 1 1 
       2696 1 . . . . . 4.0 1.8 5.0 1 1 
       2697 1 . . . . . 4.0 1.8 6.0 1 1 
       2698 1 . . . . . 4.0 1.8 6.0 1 1 
       2699 1 . . . . . 4.0 1.8 6.0 1 1 
       2700 1 . . . . . 4.0 1.8 5.0 1 1 
       2701 1 . . . . . 4.0 1.8 6.0 1 1 
       2702 1 . . . . . 4.0 1.8 5.0 1 1 
       2703 1 . . . . . 4.0 1.8 5.0 1 1 
       2704 1 . . . . . 3.0 1.8 3.5 1 1 
       2705 1 . . . . . 3.0 1.8 3.5 1 1 
       2706 1 . . . . . 4.0 1.8 5.0 1 1 
       2707 1 . . . . . 4.0 1.8 5.0 1 1 
       2708 1 . . . . . 4.0 1.8 5.0 1 1 
       2709 1 . . . . . 4.0 1.8 5.0 1 1 
       2710 1 . . . . . 4.0 1.8 6.0 1 1 
       2711 1 . . . . . 4.0 1.8 5.0 1 1 
       2712 1 . . . . . 4.0 1.8 6.0 1 1 
       2713 1 . . . . . 4.0 1.8 6.0 1 1 
       2714 1 . . . . . 4.0 1.8 6.0 1 1 
       2715 1 . . . . . 4.0 1.8 5.0 1 1 
       2716 1 . . . . . 4.0 1.8 5.0 1 1 
       2717 1 . . . . . 4.0 1.8 6.0 1 1 
       2718 1 . . . . . 4.0 1.8 6.0 1 1 
       2719 1 . . . . . 3.0 1.8 3.5 1 1 
       2720 1 . . . . . 4.0 1.8 5.0 1 1 
       2721 1 . . . . . 4.0 1.8 5.0 1 1 
       2722 1 . . . . . 4.0 1.8 5.0 1 1 
       2723 1 . . . . . 4.0 1.8 5.0 1 1 
       2724 1 . . . . . 4.0 1.8 6.0 1 1 
       2725 1 . . . . . 4.0 1.8 5.0 1 1 
       2726 1 . . . . . 4.0 1.8 5.0 1 1 
       2727 1 . . . . . 2.0 1.8 2.7 1 1 
       2728 1 . . . . . 4.0 1.8 6.0 1 1 
       2729 1 . . . . . 4.0 1.8 6.0 1 1 
       2730 1 . . . . . 4.0 1.8 6.0 1 1 
       2731 1 . . . . . 4.0 1.8 6.0 1 1 
       2732 1 . . . . . 4.0 1.8 6.0 1 1 
       2733 1 . . . . . 4.0 1.8 5.0 1 1 
       2734 1 . . . . . 4.0 1.8 5.0 1 1 
       2735 1 . . . . . 4.0 1.8 5.0 1 1 
       2736 1 . . . . . 4.0 1.8 5.0 1 1 
       2737 1 . . . . . 3.0 1.8 3.5 1 1 
       2738 1 . . . . . 4.0 1.8 6.0 1 1 
       2739 1 . . . . . 4.0 1.8 6.0 1 1 
       2740 1 . . . . . 4.0 1.8 6.0 1 1 
       2741 1 . . . . . 4.0 1.8 5.0 1 1 
       2742 1 . . . . . 3.0 1.8 3.5 1 1 
       2743 1 . . . . . 4.0 1.8 5.0 1 1 
       2744 1 . . . . . 4.0 1.8 5.0 1 1 
       2745 1 . . . . . 4.0 1.8 6.0 1 1 
       2746 1 . . . . . 3.0 1.8 3.5 1 1 
       2747 1 . . . . . 4.0 1.8 5.0 1 1 
       2748 1 . . . . . 4.0 1.8 5.0 1 1 
       2749 1 . . . . . 4.0 1.8 5.0 1 1 
       2750 1 . . . . . 4.0 1.8 5.0 1 1 
       2751 1 . . . . . 3.0 1.8 3.5 1 1 
       2752 1 . . . . . 4.0 1.8 5.0 1 1 
       2753 1 . . . . . 4.0 1.8 5.0 1 1 
       2754 1 . . . . . 4.0 1.8 6.0 1 1 
       2755 1 . . . . . 4.0 1.8 5.0 1 1 
       2756 1 . . . . . 4.0 1.8 6.0 1 1 
       2757 1 . . . . . 4.0 1.8 6.0 1 1 
       2758 1 . . . . . 4.0 1.8 6.0 1 1 
       2759 1 . . . . . 4.0 1.8 6.0 1 1 
       2760 1 . . . . . 4.0 1.8 5.0 1 1 
       2761 1 . . . . . 4.0 1.8 6.0 1 1 
       2762 1 . . . . . 4.0 1.8 6.0 1 1 
       2763 1 . . . . . 4.0 1.8 5.0 1 1 
       2764 1 . . . . . 3.0 1.8 3.5 1 1 
       2765 1 . . . . . 4.0 1.8 5.0 1 1 
       2766 1 . . . . . 4.0 1.8 6.0 1 1 
       2767 1 . . . . . 4.0 1.8 5.0 1 1 
       2768 1 . . . . . 4.0 1.8 5.0 1 1 
       2769 1 . . . . . 3.0 1.8 3.5 1 1 
       2770 1 . . . . . 3.0 1.8 3.5 1 1 
       2771 1 . . . . . 4.0 1.8 5.0 1 1 
       2772 1 . . . . . 4.0 1.8 5.0 1 1 
       2773 1 . . . . . 4.0 1.8 5.0 1 1 
       2774 1 . . . . . 4.0 1.8 6.0 1 1 
       2775 1 . . . . . 3.0 1.8 3.5 1 1 
       2776 1 . . . . . 4.0 1.8 5.0 1 1 
       2777 1 . . . . . 4.0 1.8 6.0 1 1 
       2778 1 . . . . . 4.0 1.8 5.0 1 1 
       2779 1 . . . . . 4.0 1.8 6.0 1 1 
       2780 1 . . . . . 3.0 1.8 3.5 1 1 
       2781 1 . . . . . 3.0 1.8 3.5 1 1 
       2782 1 . . . . . 4.0 1.8 5.0 1 1 
       2783 1 . . . . . 4.0 1.8 5.0 1 1 
       2784 1 . . . . . 4.0 1.8 6.0 1 1 
       2785 1 . . . . . 4.0 1.8 5.0 1 1 
       2786 1 . . . . . 3.0 1.8 3.5 1 1 
       2787 1 . . . . . 4.0 1.8 5.0 1 1 
       2788 1 . . . . . 4.0 1.8 6.0 1 1 
       2789 1 . . . . . 4.0 1.8 6.0 1 1 
       2790 1 . . . . . 4.0 1.8 5.0 1 1 
       2791 1 . . . . . 4.0 1.8 5.0 1 1 
       2792 1 . . . . . 4.0 1.8 5.0 1 1 
       2793 1 . . . . . 3.0 1.8 3.5 1 1 
       2794 1 . . . . . 4.0 1.8 6.0 1 1 
       2795 1 . . . . . 4.0 1.8 5.0 1 1 
       2796 1 . . . . . 4.0 1.8 5.0 1 1 
       2797 1 . . . . . 4.0 1.8 5.0 1 1 
       2798 1 . . . . . 4.0 1.8 5.0 1 1 
       2799 1 . . . . . 4.0 1.8 5.0 1 1 
       2800 1 . . . . . 3.0 1.8 3.5 1 1 
       2801 1 . . . . . 3.0 1.8 3.5 1 1 
       2802 1 . . . . . 4.0 1.8 5.0 1 1 
       2803 1 . . . . . 4.0 1.8 5.0 1 1 
       2804 1 . . . . . 4.0 1.8 5.0 1 1 
       2805 1 . . . . . 4.0 1.8 5.0 1 1 
       2806 1 . . . . . 4.0 1.8 5.0 1 1 
       2807 1 . . . . . 4.0 1.8 6.0 1 1 
       2808 1 . . . . . 4.0 1.8 5.0 1 1 
       2809 1 . . . . . 4.0 1.8 5.0 1 1 
       2810 1 . . . . . 3.0 1.8 3.5 1 1 
       2811 1 . . . . . 4.0 1.8 5.0 1 1 
       2812 1 . . . . . 4.0 1.8 5.0 1 1 
       2813 1 . . . . . 4.0 1.8 6.0 1 1 
       2814 1 . . . . . 3.0 1.8 3.5 1 1 
       2815 1 . . . . . 4.0 1.8 5.0 1 1 
       2816 1 . . . . . 3.0 1.8 3.5 1 1 
       2817 1 . . . . . 4.0 1.8 5.0 1 1 
       2818 1 . . . . . 4.0 1.8 5.0 1 1 
       2819 1 . . . . . 4.0 1.8 5.0 1 1 
       2820 1 . . . . . 4.0 1.8 5.0 1 1 
       2821 1 . . . . . 4.0 1.8 5.0 1 1 
       2822 1 . . . . . 4.0 1.8 5.0 1 1 
       2823 1 . . . . . 3.0 1.8 3.5 1 1 
       2824 1 . . . . . 4.0 1.8 5.0 1 1 
       2825 1 . . . . . 4.0 1.8 5.0 1 1 
       2826 1 . . . . . 4.0 1.8 5.0 1 1 
       2827 1 . . . . . 4.0 1.8 5.0 1 1 
       2828 1 . . . . . 3.0 1.8 3.5 1 1 
       2829 1 . . . . . 4.0 1.8 5.0 1 1 
       2830 1 . . . . . 4.0 1.8 5.0 1 1 
       2831 1 . . . . . 4.0 1.8 6.0 1 1 
       2832 1 . . . . . 4.0 1.8 5.0 1 1 
       2833 1 . . . . . 4.0 1.8 6.0 1 1 
       2834 1 . . . . . 4.0 1.8 5.0 1 1 
       2835 1 . . . . . 3.0 1.8 3.5 1 1 
       2836 1 . . . . . 3.0 1.8 3.5 1 1 
       2837 1 . . . . . 4.0 1.8 6.0 1 1 
       2838 1 . . . . . 4.0 1.8 5.0 1 1 
       2839 1 . . . . . 3.0 1.8 3.5 1 1 
       2840 1 . . . . . 3.0 1.8 3.5 1 1 
       2841 1 . . . . . 3.0 1.8 3.5 1 1 
       2842 1 . . . . . 3.0 1.8 3.5 1 1 
       2843 1 . . . . . 4.0 1.8 5.0 1 1 
       2844 1 . . . . . 4.0 1.8 5.0 1 1 
       2845 1 . . . . . 4.0 1.8 6.0 1 1 
       2846 1 . . . . . 4.0 1.8 5.0 1 1 
       2847 1 . . . . . 4.0 1.8 5.0 1 1 
       2848 1 . . . . . 4.0 1.8 5.0 1 1 
       2849 1 . . . . . 4.0 1.8 5.0 1 1 
       2850 1 . . . . . 4.0 1.8 5.0 1 1 
       2851 1 . . . . . 4.0 1.8 5.0 1 1 
       2852 1 . . . . . 4.0 1.8 5.0 1 1 
       2853 1 . . . . . 4.0 1.8 6.0 1 1 
       2854 1 . . . . . 4.0 1.8 5.0 1 1 
       2855 1 . . . . . 4.0 1.8 6.0 1 1 
       2856 1 . . . . . 3.0 1.8 3.5 1 1 
       2857 1 . . . . . 3.0 1.8 3.5 1 1 
       2858 1 . . . . . 4.0 1.8 5.0 1 1 
       2859 1 . . . . . 4.0 1.8 5.0 1 1 
       2860 1 . . . . . 4.0 1.8 5.0 1 1 
       2861 1 . . . . . 4.0 1.8 5.0 1 1 
       2862 1 . . . . . 2.0 1.8 2.7 1 1 
       2863 1 . . . . . 3.0 1.8 3.5 1 1 
       2864 1 . . . . . 4.0 1.8 5.0 1 1 
       2865 1 . . . . . 3.0 1.8 3.5 1 1 
       2866 1 . . . . . 3.0 1.8 3.5 1 1 
       2867 1 . . . . . 4.0 1.8 5.0 1 1 
       2868 1 . . . . . 4.0 1.8 6.0 1 1 
       2869 1 . . . . . 4.0 1.8 5.0 1 1 
       2870 1 . . . . . 4.0 1.8 6.0 1 1 
       2871 1 . . . . . 4.0 1.8 6.0 1 1 
       2872 1 . . . . . 4.0 1.8 5.0 1 1 
       2873 1 . . . . . 4.0 1.8 5.0 1 1 
       2874 1 . . . . . 4.0 1.8 6.0 1 1 
       2875 1 . . . . . 4.0 1.8 5.0 1 1 
       2876 1 . . . . . 3.0 1.8 3.5 1 1 
       2877 1 . . . . . 4.0 1.8 5.0 1 1 
       2878 1 . . . . . 3.0 1.8 3.5 1 1 
       2879 1 . . . . . 4.0 1.8 5.0 1 1 
       2880 1 . . . . . 4.0 1.8 5.0 1 1 
       2881 1 . . . . . 4.0 1.8 5.0 1 1 
       2882 1 . . . . . 4.0 1.8 6.0 1 1 
       2883 1 . . . . . 4.0 1.8 6.0 1 1 
       2884 1 . . . . . 4.0 1.8 6.0 1 1 
       2885 1 . . . . . 3.0 1.8 3.5 1 1 
       2886 1 . . . . . 4.0 1.8 5.0 1 1 
       2887 1 . . . . . 4.0 1.8 5.0 1 1 
       2888 1 . . . . . 4.0 1.8 5.0 1 1 
       2889 1 . . . . . 4.0 1.8 5.0 1 1 
       2890 1 . . . . . 4.0 1.8 5.0 1 1 
       2891 1 . . . . . 4.0 1.8 6.0 1 1 
       2892 1 . . . . . 3.0 1.8 3.5 1 1 
       2893 1 . . . . . 3.0 1.8 3.5 1 1 
       2894 1 . . . . . 3.0 1.8 3.5 1 1 
       2895 1 . . . . . 3.0 1.8 3.5 1 1 
       2896 1 . . . . . 4.0 1.8 5.0 1 1 
       2897 1 . . . . . 4.0 1.8 5.0 1 1 
       2898 1 . . . . . 4.0 1.8 5.0 1 1 
       2899 1 . . . . . 4.0 1.8 5.0 1 1 
       2900 1 . . . . . 4.0 1.8 5.0 1 1 
       2901 1 . . . . . 3.0 1.8 3.5 1 1 
       2902 1 . . . . . 4.0 1.8 5.0 1 1 
       2903 1 . . . . . 4.0 1.8 6.0 1 1 
       2904 1 . . . . . 4.0 1.8 5.0 1 1 
       2905 1 . . . . . 4.0 1.8 5.0 1 1 
       2906 1 . . . . . 4.0 1.8 5.0 1 1 
       2907 1 . . . . . 4.0 1.8 5.0 1 1 
       2908 1 . . . . . 4.0 1.8 5.0 1 1 
       2909 1 . . . . . 4.0 1.8 5.0 1 1 
       2910 1 . . . . . 4.0 1.8 5.0 1 1 
       2911 1 . . . . . 4.0 1.8 5.0 1 1 
       2912 1 . . . . . 4.0 1.8 5.0 1 1 
       2913 1 . . . . . 4.0 1.8 5.0 1 1 
       2914 1 . . . . . 4.0 1.8 6.0 1 1 
       2915 1 . . . . . 4.0 1.8 6.0 1 1 
       2916 1 . . . . . 4.0 1.8 5.0 1 1 
       2917 1 . . . . . 4.0 1.8 6.0 1 1 
       2918 1 . . . . . 4.0 1.8 6.0 1 1 
       2919 1 . . . . . 4.0 1.8 6.0 1 1 
       2920 1 . . . . . 3.0 1.8 3.5 1 1 
       2921 1 . . . . . 4.0 1.8 5.0 1 1 
       2922 1 . . . . . 3.0 1.8 3.5 1 1 
       2923 1 . . . . . 4.0 1.8 5.0 1 1 
       2924 1 . . . . . 4.0 1.8 5.0 1 1 
       2925 1 . . . . . 4.0 1.8 6.0 1 1 
       2926 1 . . . . . 4.0 1.8 6.0 1 1 
       2927 1 . . . . . 4.0 1.8 5.0 1 1 
       2928 1 . . . . . 3.0 1.8 3.5 1 1 
       2929 1 . . . . . 4.0 1.8 5.0 1 1 
       2930 1 . . . . . 4.0 1.8 5.0 1 1 
       2931 1 . . . . . 4.0 1.8 5.0 1 1 
       2932 1 . . . . . 3.0 1.8 3.5 1 1 
       2933 1 . . . . . 4.0 1.8 5.0 1 1 
       2934 1 . . . . . 4.0 1.8 5.0 1 1 
       2935 1 . . . . . 4.0 1.8 5.0 1 1 
       2936 1 . . . . . 3.0 1.8 3.5 1 1 
       2937 1 . . . . . 4.0 1.8 5.0 1 1 
       2938 1 . . . . . 3.0 1.8 3.5 1 1 
       2939 1 . . . . . 3.0 1.8 3.5 1 1 
       2940 1 . . . . . 4.0 1.8 6.0 1 1 
       2941 1 . . . . . 4.0 1.8 6.0 1 1 
       2942 1 . . . . . 4.0 1.8 5.0 1 1 
       2943 1 . . . . . 4.0 1.8 5.0 1 1 
       2944 1 . . . . . 4.0 1.8 5.0 1 1 
       2945 1 . . . . . 4.0 1.8 5.0 1 1 
       2946 1 . . . . . 4.0 1.8 5.0 1 1 
       2947 1 . . . . . 4.0 1.8 5.0 1 1 
       2948 1 . . . . . 4.0 1.8 6.0 1 1 
       2949 1 . . . . . 4.0 1.8 5.0 1 1 
       2950 1 . . . . . 2.0 1.8 2.7 1 1 
       2951 1 . . . . . 4.0 1.8 5.0 1 1 
       2952 1 . . . . . 3.0 1.8 3.5 1 1 
       2953 1 . . . . . 3.0 1.8 3.5 1 1 
       2954 1 . . . . . 4.0 1.8 5.0 1 1 
       2955 1 . . . . . 4.0 1.8 5.0 1 1 
       2956 1 . . . . . 4.0 1.8 5.0 1 1 
       2957 1 . . . . . 4.0 1.8 5.0 1 1 
       2958 1 . . . . . 4.0 1.8 5.0 1 1 
       2959 1 . . . . . 4.0 1.8 5.0 1 1 
       2960 1 . . . . . 4.0 1.8 6.0 1 1 
       2961 1 . . . . . 4.0 1.8 5.0 1 1 
       2962 1 . . . . . 4.0 1.8 6.0 1 1 
       2963 1 . . . . . 4.0 1.8 6.0 1 1 
       2964 1 . . . . . 4.0 1.8 6.0 1 1 
       2965 1 . . . . . 3.0 1.8 3.5 1 1 
       2966 1 . . . . . 4.0 1.8 5.0 1 1 
       2967 1 . . . . . 3.0 1.8 3.5 1 1 
       2968 1 . . . . . 4.0 1.8 5.0 1 1 
       2969 1 . . . . . 4.0 1.8 5.0 1 1 
       2970 1 . . . . . 3.0 1.8 3.5 1 1 
       2971 1 . . . . . 4.0 1.8 6.0 1 1 
       2972 1 . . . . . 4.0 1.8 5.0 1 1 
       2973 1 . . . . . 4.0 1.8 5.0 1 1 
       2974 1 . . . . . 4.0 1.8 6.0 1 1 
       2975 1 . . . . . 4.0 1.8 5.0 1 1 
       2976 1 . . . . . 4.0 1.8 5.0 1 1 
       2977 1 . . . . . 4.0 1.8 5.0 1 1 
       2978 1 . . . . . 3.0 1.8 3.5 1 1 
       2979 1 . . . . . 4.0 1.8 5.0 1 1 
       2980 1 . . . . . 4.0 1.8 5.0 1 1 
       2981 1 . . . . . 4.0 1.8 5.0 1 1 
       2982 1 . . . . . 4.0 1.8 5.0 1 1 
       2983 1 . . . . . 4.0 1.8 6.0 1 1 
       2984 1 . . . . . 3.0 1.8 3.5 1 1 
       2985 1 . . . . . 4.0 1.8 6.0 1 1 
       2986 1 . . . . . 4.0 1.8 5.0 1 1 
       2987 1 . . . . . 4.0 1.8 5.0 1 1 
       2988 1 . . . . . 4.0 1.8 5.0 1 1 
       2989 1 . . . . . 3.0 1.8 3.5 1 1 
       2990 1 . . . . . 4.0 1.8 5.0 1 1 
       2991 1 . . . . . 3.0 1.8 3.5 1 1 
       2992 1 . . . . . 4.0 1.8 5.0 1 1 
       2993 1 . . . . . 3.0 1.8 3.5 1 1 
       2994 1 . . . . . 4.0 1.8 5.0 1 1 
       2995 1 . . . . . 4.0 1.8 5.0 1 1 
       2996 1 . . . . . 4.0 1.8 5.0 1 1 
       2997 1 . . . . . 4.0 1.8 5.0 1 1 
       2998 1 . . . . . 4.0 1.8 6.0 1 1 
       2999 1 . . . . . 4.0 1.8 5.0 1 1 
       3000 1 . . . . . 4.0 1.8 5.0 1 1 
       3001 1 . . . . . 4.0 1.8 5.0 1 1 
       3002 1 . . . . . 2.0 1.8 2.7 1 1 
       3003 1 . . . . . 3.0 1.8 3.5 1 1 
       3004 1 . . . . . 4.0 1.8 6.0 1 1 
       3005 1 . . . . . 4.0 1.8 5.0 1 1 
       3006 1 . . . . . 4.0 1.8 6.0 1 1 
       3007 1 . . . . . 4.0 1.8 5.0 1 1 
       3008 1 . . . . . 4.0 1.8 6.0 1 1 
       3009 1 . . . . . 4.0 1.8 5.0 1 1 
       3010 1 . . . . . 4.0 1.8 6.0 1 1 
       3011 1 . . . . . 4.0 1.8 5.0 1 1 
       3012 1 . . . . . 4.0 1.8 5.0 1 1 
       3013 1 . . . . . 4.0 1.8 5.0 1 1 
       3014 1 . . . . . 4.0 1.8 5.0 1 1 
       3015 1 . . . . . 4.0 1.8 5.0 1 1 
       3016 1 . . . . . 4.0 1.8 5.0 1 1 
       3017 1 . . . . . 4.0 1.8 5.0 1 1 
       3018 1 . . . . . 4.0 1.8 5.0 1 1 
       3019 1 . . . . . 4.0 1.8 5.0 1 1 
       3020 1 . . . . . 4.0 1.8 5.0 1 1 
       3021 1 . . . . . 4.0 1.8 5.0 1 1 
       3022 1 . . . . . 4.0 1.8 6.0 1 1 
       3023 1 . . . . . 4.0 1.8 5.0 1 1 
       3024 1 . . . . . 4.0 1.8 5.0 1 1 
       3025 1 . . . . . 4.0 1.8 5.0 1 1 
       3026 1 . . . . . 3.0 1.8 3.5 1 1 
       3027 1 . . . . . 2.0 1.8 2.7 1 1 
       3028 1 . . . . . 3.0 1.8 3.5 1 1 
       3029 1 . . . . . 4.0 1.8 6.0 1 1 
       3030 1 . . . . . 4.0 1.8 5.0 1 1 
       3031 1 . . . . . 4.0 1.8 5.0 1 1 
       3032 1 . . . . . 4.0 1.8 6.0 1 1 
       3033 1 . . . . . 4.0 1.8 6.0 1 1 
       3034 1 . . . . . 4.0 1.8 6.0 1 1 
       3035 1 . . . . . 4.0 1.8 6.0 1 1 
       3036 1 . . . . . 4.0 1.8 5.0 1 1 
       3037 1 . . . . . 4.0 1.8 5.0 1 1 
       3038 1 . . . . . 4.0 1.8 5.0 1 1 
       3039 1 . . . . . 4.0 1.8 5.0 1 1 
       3040 1 . . . . . 4.0 1.8 6.0 1 1 
       3041 1 . . . . . 3.0 1.8 3.5 1 1 
       3042 1 . . . . . 4.0 1.8 5.0 1 1 
       3043 1 . . . . . 4.0 1.8 6.0 1 1 
       3044 1 . . . . . 4.0 1.8 5.0 1 1 
       3045 1 . . . . . 4.0 1.8 6.0 1 1 
       3046 1 . . . . . 3.0 1.8 3.5 1 1 
       3047 1 . . . . . 4.0 1.8 6.0 1 1 
       3048 1 . . . . . 4.0 1.8 5.0 1 1 
       3049 1 . . . . . 4.0 1.8 6.0 1 1 
       3050 1 . . . . . 4.0 1.8 5.0 1 1 
       3051 1 . . . . . 3.0 1.8 3.5 1 1 
       3052 1 . . . . . 4.0 1.8 6.0 1 1 
       3053 1 . . . . . 4.0 1.8 5.0 1 1 
       3054 1 . . . . . 4.0 1.8 6.0 1 1 
       3055 1 . . . . . 4.0 1.8 5.0 1 1 
       3056 1 . . . . . 4.0 1.8 6.0 1 1 
       3057 1 . . . . . 4.0 1.8 5.0 1 1 
       3058 1 . . . . . 4.0 1.8 6.0 1 1 
       3059 1 . . . . . 4.0 1.8 6.0 1 1 
       3060 1 . . . . . 4.0 1.8 6.0 1 1 
       3061 1 . . . . . 4.0 1.8 6.0 1 1 
       3062 1 . . . . . 4.0 1.8 6.0 1 1 
       3063 1 . . . . . 4.0 1.8 5.0 1 1 
       3064 1 . . . . . 3.0 1.8 3.5 1 1 
       3065 1 . . . . . 4.0 1.8 5.0 1 1 
       3066 1 . . . . . 4.0 1.8 5.0 1 1 
       3067 1 . . . . . 4.0 1.8 5.0 1 1 
       3068 1 . . . . . 4.0 1.8 6.0 1 1 
       3069 1 . . . . . 4.0 1.8 5.0 1 1 
       3070 1 . . . . . 4.0 1.8 5.0 1 1 
       3071 1 . . . . . 4.0 1.8 5.0 1 1 
       3072 1 . . . . . 4.0 1.8 5.0 1 1 
       3073 1 . . . . . 4.0 1.8 5.0 1 1 
       3074 1 . . . . . 3.0 1.8 3.5 1 1 
       3075 1 . . . . . 3.0 1.8 3.5 1 1 
       3076 1 . . . . . 3.0 1.8 3.5 1 1 
       3077 1 . . . . . 4.0 1.8 5.0 1 1 
       3078 1 . . . . . 4.0 1.8 5.0 1 1 
       3079 1 . . . . . 4.0 1.8 6.0 1 1 
       3080 1 . . . . . 4.0 1.8 5.0 1 1 
       3081 1 . . . . . 3.0 1.8 3.5 1 1 
       3082 1 . . . . . 4.0 1.8 5.0 1 1 
       3083 1 . . . . . 3.0 1.8 3.5 1 1 
       3084 1 . . . . . 4.0 1.8 6.0 1 1 
       3085 1 . . . . . 3.0 1.8 3.5 1 1 
       3086 1 . . . . . 3.0 1.8 3.5 1 1 
       3087 1 . . . . . 4.0 1.8 5.0 1 1 
       3088 1 . . . . . 4.0 1.8 5.0 1 1 
       3089 1 . . . . . 3.0 1.8 3.5 1 1 
       3090 1 . . . . . 3.0 1.8 3.5 1 1 
       3091 1 . . . . . 4.0 1.8 5.0 1 1 
       3092 1 . . . . . 4.0 1.8 5.0 1 1 
       3093 1 . . . . . 4.0 1.8 6.0 1 1 
       3094 1 . . . . . 4.0 1.8 5.0 1 1 
       3095 1 . . . . . 4.0 1.8 5.0 1 1 
       3096 1 . . . . . 4.0 1.8 5.0 1 1 
       3097 1 . . . . . 4.0 1.8 5.0 1 1 
       3098 1 . . . . . 4.0 1.8 5.0 1 1 
       3099 1 . . . . . 4.0 1.8 5.0 1 1 
       3100 1 . . . . . 4.0 1.8 6.0 1 1 
       3101 1 . . . . . 4.0 1.8 5.0 1 1 
       3102 1 . . . . . 4.0 1.8 5.0 1 1 
       3103 1 . . . . . 4.0 1.8 5.0 1 1 
       3104 1 . . . . . 4.0 1.8 5.0 1 1 
       3105 1 . . . . . 4.0 1.8 5.0 1 1 
       3106 1 . . . . . 4.0 1.8 5.0 1 1 
       3107 1 . . . . . 4.0 1.8 5.0 1 1 
       3108 1 . . . . . 4.0 1.8 6.0 1 1 
       3109 1 . . . . . 4.0 1.8 6.0 1 1 
       3110 1 . . . . . 4.0 1.8 5.0 1 1 
       3111 1 . . . . . 3.0 1.8 3.5 1 1 
       3112 1 . . . . . 4.0 1.8 5.0 1 1 
       3113 1 . . . . . 4.0 1.8 5.0 1 1 
       3114 1 . . . . . 3.0 1.8 3.5 1 1 
       3115 1 . . . . . 4.0 1.8 5.0 1 1 
       3116 1 . . . . . 4.0 1.8 5.0 1 1 
       3117 1 . . . . . 3.0 1.8 3.5 1 1 
       3118 1 . . . . . 4.0 1.8 6.0 1 1 
       3119 1 . . . . . 4.0 1.8 5.0 1 1 
       3120 1 . . . . . 4.0 1.8 5.0 1 1 
       3121 1 . . . . . 3.0 1.8 3.5 1 1 
       3122 1 . . . . . 4.0 1.8 5.0 1 1 
       3123 1 . . . . . 4.0 1.8 5.0 1 1 
       3124 1 . . . . . 4.0 1.8 6.0 1 1 
       3125 1 . . . . . 4.0 1.8 5.0 1 1 
       3126 1 . . . . . 4.0 1.8 6.0 1 1 
       3127 1 . . . . . 4.0 1.8 5.0 1 1 
       3128 1 . . . . . 4.0 1.8 5.0 1 1 
       3129 1 . . . . . 4.0 1.8 5.0 1 1 
       3130 1 . . . . . 4.0 1.8 5.0 1 1 
       3131 1 . . . . . 4.0 1.8 5.0 1 1 
       3132 1 . . . . . 4.0 1.8 5.0 1 1 
       3133 1 . . . . . 4.0 1.8 5.0 1 1 
       3134 1 . . . . . 4.0 1.8 6.0 1 1 
       3135 1 . . . . . 3.0 1.8 3.5 1 1 
       3136 1 . . . . . 3.0 1.8 3.5 1 1 
       3137 1 . . . . . 4.0 1.8 5.0 1 1 
       3138 1 . . . . . 4.0 1.8 5.0 1 1 
       3139 1 . . . . . 4.0 1.8 5.0 1 1 
       3140 1 . . . . . 3.0 1.8 3.5 1 1 
       3141 1 . . . . . 3.0 1.8 3.5 1 1 
       3142 1 . . . . . 4.0 1.8 5.0 1 1 
       3143 1 . . . . . 4.0 1.8 6.0 1 1 
       3144 1 . . . . . 4.0 1.8 6.0 1 1 
       3145 1 . . . . . 4.0 1.8 6.0 1 1 
       3146 1 . . . . . 4.0 1.8 5.0 1 1 
       3147 1 . . . . . 4.0 1.8 6.0 1 1 
       3148 1 . . . . . 4.0 1.8 5.0 1 1 
       3149 1 . . . . . 4.0 1.8 5.0 1 1 
       3150 1 . . . . . 4.0 1.8 6.0 1 1 
       3151 1 . . . . . 4.0 1.8 5.0 1 1 
       3152 1 . . . . . 4.0 1.8 5.0 1 1 
       3153 1 . . . . . 4.0 1.8 6.0 1 1 
       3154 1 . . . . . 4.0 1.8 6.0 1 1 
       3155 1 . . . . . 4.0 1.8 5.0 1 1 
       3156 1 . . . . . 4.0 1.8 6.0 1 1 
       3157 1 . . . . . 3.0 1.8 3.5 1 1 
       3158 1 . . . . . 4.0 1.8 5.0 1 1 
       3159 1 . . . . . 2.0 1.8 2.7 1 1 
       3160 1 . . . . . 3.0 1.8 3.5 1 1 
       3161 1 . . . . . 4.0 1.8 5.0 1 1 
       3162 1 . . . . . 4.0 1.8 6.0 1 1 
       3163 1 . . . . . 4.0 1.8 5.0 1 1 
       3164 1 . . . . . 4.0 1.8 5.0 1 1 
       3165 1 . . . . . 4.0 1.8 6.0 1 1 
       3166 1 . . . . . 4.0 1.8 5.0 1 1 
       3167 1 . . . . . 3.0 1.8 3.5 1 1 
       3168 1 . . . . . 4.0 1.8 5.0 1 1 
       3169 1 . . . . . 3.0 1.8 3.5 1 1 
       3170 1 . . . . . 4.0 1.8 5.0 1 1 
       3171 1 . . . . . 3.0 1.8 3.5 1 1 
       3172 1 . . . . . 4.0 1.8 5.0 1 1 
       3173 1 . . . . . 4.0 1.8 5.0 1 1 
       3174 1 . . . . . 4.0 1.8 6.0 1 1 
       3175 1 . . . . . 4.0 1.8 6.0 1 1 
       3176 1 . . . . . 4.0 1.8 5.0 1 1 
       3177 1 . . . . . 4.0 1.8 5.0 1 1 
       3178 1 . . . . . 4.0 1.8 5.0 1 1 
       3179 1 . . . . . 4.0 1.8 5.0 1 1 
       3180 1 . . . . . 4.0 1.8 5.0 1 1 
       3181 1 . . . . . 4.0 1.8 5.0 1 1 
       3182 1 . . . . . 4.0 1.8 5.0 1 1 
       3183 1 . . . . . 4.0 1.8 5.0 1 1 
       3184 1 . . . . . 4.0 1.8 5.0 1 1 
       3185 1 . . . . . 4.0 1.8 5.0 1 1 
       3186 1 . . . . . 4.0 1.8 5.0 1 1 
       3187 1 . . . . . 4.0 1.8 5.0 1 1 
       3188 1 . . . . . 4.0 1.8 5.0 1 1 
       3189 1 . . . . . 4.0 1.8 5.0 1 1 
       3190 1 . . . . . 2.0 1.8 2.7 1 1 
       3191 1 . . . . . 4.0 1.8 5.0 1 1 
       3192 1 . . . . . 4.0 1.8 5.0 1 1 
       3193 1 . . . . . 3.0 1.8 3.5 1 1 
       3194 1 . . . . . 4.0 1.8 5.0 1 1 
       3195 1 . . . . . 3.0 1.8 3.5 1 1 
       3196 1 . . . . . 4.0 1.8 5.0 1 1 
       3197 1 . . . . . 4.0 1.8 6.0 1 1 
       3198 1 . . . . . 4.0 1.8 5.0 1 1 
       3199 1 . . . . . 4.0 1.8 5.0 1 1 
       3200 1 . . . . . 4.0 1.8 5.0 1 1 
       3201 1 . . . . . 4.0 1.8 5.0 1 1 
       3202 1 . . . . . 3.0 1.8 3.5 1 1 
       3203 1 . . . . . 4.0 1.8 5.0 1 1 
       3204 1 . . . . . 4.0 1.8 5.0 1 1 
       3205 1 . . . . . 4.0 1.8 5.0 1 1 
       3206 1 . . . . .   . 1.8 3.5 1 1 
       3207 1 . . . . . 4.0 1.8 5.0 1 1 
       3208 1 . . . . . 4.0 1.8 5.0 1 1 
       3209 1 . . . . . 3.0 1.8 3.5 1 1 
       3210 1 . . . . . 3.0 1.8 3.5 1 1 
       3211 1 . . . . . 4.0 1.8 5.0 1 1 
       3212 1 . . . . . 4.0 1.8 5.0 1 1 
       3213 1 . . . . . 4.0 1.8 6.0 1 1 
       3214 1 . . . . . 4.0 1.8 6.0 1 1 
       3215 1 . . . . . 4.0 1.8 5.0 1 1 
       3216 1 . . . . . 4.0 1.8 5.0 1 1 
       3217 1 . . . . . 3.0 1.8 3.5 1 1 
       3218 1 . . . . . 3.0 1.8 3.5 1 1 
       3219 1 . . . . . 4.0 1.8 5.0 1 1 
       3220 1 . . . . . 3.0 1.8 3.5 1 1 
       3221 1 . . . . . 4.0 1.8 5.0 1 1 
       3222 1 . . . . . 4.0 1.8 5.0 1 1 
       3223 1 . . . . . 4.0 1.8 6.0 1 1 
       3224 1 . . . . . 4.0 1.8 6.0 1 1 
       3225 1 . . . . . 4.0 1.8 5.0 1 1 
       3226 1 . . . . . 4.0 1.8 6.0 1 1 
       3227 1 . . . . . 4.0 1.8 5.0 1 1 
       3228 1 . . . . . 4.0 1.8 5.0 1 1 
       3229 1 . . . . . 4.0 1.8 5.0 1 1 
       3230 1 . . . . . 4.0 1.8 5.0 1 1 
       3231 1 . . . . . 3.0 1.8 3.5 1 1 
       3232 1 . . . . . 4.0 1.8 5.0 1 1 
       3233 1 . . . . . 4.0 1.8 6.0 1 1 
       3234 1 . . . . . 3.0 1.8 3.5 1 1 
       3235 1 . . . . . 4.0 1.8 5.0 1 1 
       3236 1 . . . . . 4.0 1.8 5.0 1 1 
       3237 1 . . . . . 4.0 1.8 6.0 1 1 
       3238 1 . . . . . 4.0 1.8 5.0 1 1 
       3239 1 . . . . . 3.0 1.8 3.5 1 1 
       3240 1 . . . . . 4.0 1.8 5.0 1 1 
       3241 1 . . . . . 3.0 1.8 3.5 1 1 
       3242 1 . . . . . 4.0 1.8 5.0 1 1 
       3243 1 . . . . . 3.0 1.8 3.5 1 1 
       3244 1 . . . . . 4.0 1.8 6.0 1 1 
       3245 1 . . . . . 4.0 1.8 5.0 1 1 
       3246 1 . . . . . 4.0 1.8 5.0 1 1 
       3247 1 . . . . . 4.0 1.8 6.0 1 1 
       3248 1 . . . . . 4.0 1.8 5.0 1 1 
       3249 1 . . . . . 4.0 1.8 5.0 1 1 
       3250 1 . . . . . 4.0 1.8 5.0 1 1 
       3251 1 . . . . . 4.0 1.8 6.0 1 1 
       3252 1 . . . . . 4.0 1.8 5.0 1 1 
       3253 1 . . . . . 4.0 1.8 6.0 1 1 
       3254 1 . . . . . 4.0 1.8 5.0 1 1 
       3255 1 . . . . . 4.0 1.8 5.0 1 1 
       3256 1 . . . . . 4.0 1.8 5.0 1 1 
       3257 1 . . . . . 4.0 1.8 5.0 1 1 
       3258 1 . . . . . 3.0 1.8 3.5 1 1 
       3259 1 . . . . . 4.0 1.8 6.0 1 1 
       3260 1 . . . . . 4.0 1.8 5.0 1 1 
       3261 1 . . . . . 4.0 1.8 5.0 1 1 
       3262 1 . . . . . 4.0 1.8 5.0 1 1 
       3263 1 . . . . . 4.0 1.8 5.0 1 1 
       3264 1 . . . . . 4.0 1.8 5.0 1 1 
       3265 1 . . . . . 3.0 1.8 3.5 1 1 
       3266 1 . . . . . 4.0 1.8 5.0 1 1 
       3267 1 . . . . . 3.0 1.8 3.5 1 1 
       3268 1 . . . . . 4.0 1.8 5.0 1 1 
       3269 1 . . . . . 4.0 1.8 5.0 1 1 
       3270 1 . . . . . 4.0 1.8 6.0 1 1 
       3271 1 . . . . . 4.0 1.8 5.0 1 1 
       3272 1 . . . . . 4.0 1.8 5.0 1 1 
       3273 1 . . . . . 3.0 1.8 3.5 1 1 
       3274 1 . . . . . 4.0 1.8 5.0 1 1 
       3275 1 . . . . . 4.0 1.8 5.0 1 1 
       3276 1 . . . . . 3.0 1.8 3.5 1 1 
       3277 1 . . . . . 4.0 1.8 5.0 1 1 
       3278 1 . . . . . 4.0 1.8 5.0 1 1 
       3279 1 . . . . . 4.0 1.8 5.0 1 1 
       3280 1 . . . . . 4.0 1.8 6.0 1 1 
       3281 1 . . . . . 4.0 1.8 6.0 1 1 
       3282 1 . . . . . 3.0 1.8 3.5 1 1 
       3283 1 . . . . . 4.0 1.8 5.0 1 1 
       3284 1 . . . . . 4.0 1.8 5.0 1 1 
       3285 1 . . . . . 4.0 1.8 6.0 1 1 
       3286 1 . . . . .   . 1.8 3.5 1 1 
       3287 1 . . . . . 4.0 1.8 5.0 1 1 
       3288 1 . . . . . 4.0 1.8 5.0 1 1 
       3289 1 . . . . . 3.0 1.8 3.5 1 1 
       3290 1 . . . . . 4.0 1.8 6.0 1 1 
       3291 1 . . . . . 4.0 1.8 5.0 1 1 
       3292 1 . . . . . 4.0 1.8 5.0 1 1 
       3293 1 . . . . . 3.0 1.8 3.5 1 1 
       3294 1 . . . . . 4.0 1.8 5.0 1 1 
       3295 1 . . . . . 4.0 1.8 5.0 1 1 
       3296 1 . . . . . 3.0 1.8 3.5 1 1 
       3297 1 . . . . .   . 1.8 3.5 1 1 
       3298 1 . . . . . 4.0 1.8 6.0 1 1 
       3299 1 . . . . . 4.0 1.8 5.0 1 1 
       3300 1 . . . . . 4.0 1.8 5.0 1 1 
       3301 1 . . . . . 4.0 1.8 5.0 1 1 
       3302 1 . . . . . 4.0 1.8 6.0 1 1 
       3303 1 . . . . . 4.0 1.8 5.0 1 1 
       3304 1 . . . . . 4.0 1.8 5.0 1 1 
       3305 1 . . . . . 3.0 1.8 3.5 1 1 
       3306 1 . . . . . 3.0 1.8 3.5 1 1 
       3307 1 . . . . . 3.0 1.8 3.5 1 1 
       3308 1 . . . . . 4.0 1.8 6.0 1 1 
       3309 1 . . . . . 4.0 1.8 5.0 1 1 
       3310 1 . . . . . 4.0 1.8 6.0 1 1 
       3311 1 . . . . . 4.0 1.8 5.0 1 1 
       3312 1 . . . . . 4.0 1.8 6.0 1 1 
       3313 1 . . . . . 4.0 1.8 5.0 1 1 
       3314 1 . . . . . 4.0 1.8 5.0 1 1 
       3315 1 . . . . . 3.0 1.8 3.5 1 1 
       3316 1 . . . . . 4.0 1.8 5.0 1 1 
       3317 1 . . . . . 4.0 1.8 5.0 1 1 
       3318 1 . . . . . 4.0 1.8 5.0 1 1 
       3319 1 . . . . . 4.0 1.8 6.0 1 1 
       3320 1 . . . . . 4.0 1.8 6.0 1 1 
       3321 1 . . . . . 4.0 1.8 5.0 1 1 
       3322 1 . . . . . 3.0 1.8 3.5 1 1 
       3323 1 . . . . . 4.0 1.8 5.0 1 1 
       3324 1 . . . . . 4.0 1.8 5.0 1 1 
       3325 1 . . . . . 4.0 1.8 5.0 1 1 
       3326 1 . . . . . 4.0 1.8 5.0 1 1 
       3327 1 . . . . . 4.0 1.8 6.0 1 1 
       3328 1 . . . . . 4.0 1.8 5.0 1 1 
       3329 1 . . . . . 4.0 1.8 6.0 1 1 
       3330 1 . . . . . 4.0 1.8 5.0 1 1 
       3331 1 . . . . . 4.0 1.8 5.0 1 1 
       3332 1 . . . . . 4.0 1.8 5.0 1 1 
       3333 1 . . . . . 4.0 1.8 5.0 1 1 
       3334 1 . . . . . 4.0 1.8 5.0 1 1 
       3335 1 . . . . . 3.0 1.8 3.5 1 1 
       3336 1 . . . . . 3.0 1.8 3.5 1 1 
       3337 1 . . . . . 3.0 1.8 3.5 1 1 
       3338 1 . . . . . 4.0 1.8 6.0 1 1 
       3339 1 . . . . . 4.0 1.8 5.0 1 1 
       3340 1 . . . . . 4.0 1.8 6.0 1 1 
       3341 1 . . . . . 4.0 1.8 6.0 1 1 
       3342 1 . . . . . 4.0 1.8 5.0 1 1 
       3343 1 . . . . . 4.0 1.8 6.0 1 1 
       3344 1 . . . . . 4.0 1.8 5.0 1 1 
       3345 1 . . . . . 4.0 1.8 6.0 1 1 
       3346 1 . . . . . 4.0 1.8 5.0 1 1 
       3347 1 . . . . . 4.0 1.8 5.0 1 1 
       3348 1 . . . . . 4.0 1.8 6.0 1 1 
       3349 1 . . . . . 4.0 1.8 5.0 1 1 
       3350 1 . . . . . 4.0 1.8 5.0 1 1 
       3351 1 . . . . . 3.0 1.8 3.5 1 1 
       3352 1 . . . . . 3.0 1.8 3.5 1 1 
       3353 1 . . . . . 4.0 1.8 5.0 1 1 
       3354 1 . . . . . 4.0 1.8 6.0 1 1 
       3355 1 . . . . . 4.0 1.8 5.0 1 1 
       3356 1 . . . . . 4.0 1.8 5.0 1 1 
       3357 1 . . . . . 4.0 1.8 5.0 1 1 
       3358 1 . . . . . 4.0 1.8 5.0 1 1 
       3359 1 . . . . . 3.0 1.8 3.5 1 1 
       3360 1 . . . . . 4.0 1.8 5.0 1 1 
       3361 1 . . . . . 3.0 1.8 3.5 1 1 
       3362 1 . . . . . 4.0 1.8 5.0 1 1 
       3363 1 . . . . . 3.0 1.8 3.5 1 1 
       3364 1 . . . . . 4.0 1.8 5.0 1 1 
       3365 1 . . . . . 4.0 1.8 5.0 1 1 
       3366 1 . . . . . 4.0 1.8 5.0 1 1 
       3367 1 . . . . . 4.0 1.8 5.0 1 1 
       3368 1 . . . . . 3.0 1.8 3.5 1 1 
       3369 1 . . . . . 4.0 1.8 5.0 1 1 
       3370 1 . . . . . 4.0 1.8 6.0 1 1 
       3371 1 . . . . . 3.0 1.8 3.5 1 1 
       3372 1 . . . . . 3.0 1.8 3.5 1 1 
       3373 1 . . . . . 4.0 1.8 5.0 1 1 
       3374 1 . . . . . 4.0 1.8 5.0 1 1 
       3375 1 . . . . . 4.0 1.8 5.0 1 1 
       3376 1 . . . . . 4.0 1.8 6.0 1 1 
       3377 1 . . . . . 4.0 1.8 5.0 1 1 
       3378 1 . . . . . 4.0 1.8 5.0 1 1 
       3379 1 . . . . . 4.0 1.8 5.0 1 1 
       3380 1 . . . . . 3.0 1.8 3.5 1 1 
       3381 1 . . . . . 4.0 1.8 6.0 1 1 
       3382 1 . . . . . 4.0 1.8 6.0 1 1 
       3383 1 . . . . . 4.0 1.8 6.0 1 1 
       3384 1 . . . . . 4.0 1.8 6.0 1 1 
       3385 1 . . . . . 4.0 1.8 6.0 1 1 
       3386 1 . . . . . 4.0 1.8 6.0 1 1 
       3387 1 . . . . . 4.0 1.8 6.0 1 1 
       3388 1 . . . . . 4.0 1.8 5.0 1 1 
       3389 1 . . . . . 4.0 1.8 5.0 1 1 
       3390 1 . . . . . 4.0 1.8 5.0 1 1 
       3391 1 . . . . . 4.0 1.8 6.0 1 1 
       3392 1 . . . . . 4.0 1.8 5.0 1 1 
       3393 1 . . . . . 4.0 1.8 5.0 1 1 
       3394 1 . . . . . 4.0 1.8 6.0 1 1 
       3395 1 . . . . . 4.0 1.8 5.0 1 1 
       3396 1 . . . . . 3.0 1.8 3.5 1 1 
       3397 1 . . . . . 4.0 1.8 5.0 1 1 
       3398 1 . . . . . 4.0 1.8 5.0 1 1 
       3399 1 . . . . . 4.0 1.8 5.0 1 1 
       3400 1 . . . . . 3.0 1.8 3.5 1 1 
       3401 1 . . . . . 4.0 1.8 6.0 1 1 
       3402 1 . . . . . 4.0 1.8 5.0 1 1 
       3403 1 . . . . . 4.0 1.8 5.0 1 1 
       3404 1 . . . . . 4.0 1.8 5.0 1 1 
       3405 1 . . . . . 4.0 1.8 5.0 1 1 
       3406 1 . . . . . 4.0 1.8 5.0 1 1 
       3407 1 . . . . . 4.0 1.8 6.0 1 1 
       3408 1 . . . . . 4.0 1.8 5.0 1 1 
       3409 1 . . . . . 3.0 1.8 3.5 1 1 
       3410 1 . . . . . 4.0 1.8 5.0 1 1 
       3411 1 . . . . . 3.0 1.8 3.5 1 1 
       3412 1 . . . . . 3.0 1.8 3.5 1 1 
       3413 1 . . . . . 3.0 1.8 3.5 1 1 
       3414 1 . . . . . 4.0 1.8 5.0 1 1 
       3415 1 . . . . . 4.0 1.8 6.0 1 1 
       3416 1 . . . . . 4.0 1.8 5.0 1 1 
       3417 1 . . . . . 4.0 1.8 5.0 1 1 
       3418 1 . . . . . 4.0 1.8 6.0 1 1 
       3419 1 . . . . . 3.0 1.8 3.5 1 1 
       3420 1 . . . . . 4.0 1.8 5.0 1 1 
       3421 1 . . . . . 4.0 1.8 5.0 1 1 
       3422 1 . . . . . 4.0 1.8 5.0 1 1 
       3423 1 . . . . . 4.0 1.8 5.0 1 1 
       3424 1 . . . . . 3.0 1.8 3.5 1 1 
       3425 1 . . . . . 4.0 1.8 5.0 1 1 
       3426 1 . . . . . 3.0 1.8 3.5 1 1 
       3427 1 . . . . . 4.0 1.8 5.0 1 1 
       3428 1 . . . . . 3.0 1.8 3.5 1 1 
       3429 1 . . . . . 3.0 1.8 3.5 1 1 
       3430 1 . . . . . 3.0 1.8 3.5 1 1 
       3431 1 . . . . . 4.0 1.8 5.0 1 1 
       3432 1 . . . . . 4.0 1.8 5.0 1 1 
       3433 1 . . . . . 4.0 1.8 6.0 1 1 
       3434 1 . . . . . 4.0 1.8 6.0 1 1 
       3435 1 . . . . . 4.0 1.8 6.0 1 1 
       3436 1 . . . . . 4.0 1.8 6.0 1 1 
       3437 1 . . . . . 4.0 1.8 5.0 1 1 
       3438 1 . . . . . 3.0 1.8 3.5 1 1 
       3439 1 . . . . . 4.0 1.8 5.0 1 1 
       3440 1 . . . . . 4.0 1.8 5.0 1 1 
       3441 1 . . . . . 4.0 1.8 5.0 1 1 
       3442 1 . . . . . 4.0 1.8 6.0 1 1 
       3443 1 . . . . . 3.0 1.8 3.5 1 1 
       3444 1 . . . . . 4.0 1.8 5.0 1 1 
       3445 1 . . . . . 4.0 1.8 5.0 1 1 
       3446 1 . . . . . 4.0 1.8 5.0 1 1 
       3447 1 . . . . . 3.0 1.8 3.5 1 1 
       3448 1 . . . . . 4.0 1.8 5.0 1 1 
       3449 1 . . . . . 3.0 1.8 3.5 1 1 
       3450 1 . . . . . 4.0 1.8 5.0 1 1 
       3451 1 . . . . . 4.0 1.8 5.0 1 1 
       3452 1 . . . . . 4.0 1.8 5.0 1 1 
       3453 1 . . . . . 4.0 1.8 5.0 1 1 
       3454 1 . . . . . 3.0 1.8 3.5 1 1 
       3455 1 . . . . . 4.0 1.8 5.0 1 1 
       3456 1 . . . . . 4.0 1.8 6.0 1 1 
       3457 1 . . . . . 4.0 1.8 5.0 1 1 
       3458 1 . . . . . 4.0 1.8 5.0 1 1 
       3459 1 . . . . . 4.0 1.8 5.0 1 1 
       3460 1 . . . . . 4.0 1.8 5.0 1 1 
       3461 1 . . . . . 4.0 1.8 5.0 1 1 
       3462 1 . . . . . 4.0 1.8 6.0 1 1 
       3463 1 . . . . . 4.0 1.8 6.0 1 1 
       3464 1 . . . . . 4.0 1.8 5.0 1 1 
       3465 1 . . . . . 4.0 1.8 5.0 1 1 
       3466 1 . . . . . 4.0 1.8 5.0 1 1 
       3467 1 . . . . . 4.0 1.8 5.0 1 1 
       3468 1 . . . . . 4.0 1.8 5.0 1 1 
       3469 1 . . . . . 4.0 1.8 5.0 1 1 
       3470 1 . . . . . 3.0 1.8 3.5 1 1 
       3471 1 . . . . . 3.0 1.8 3.5 1 1 
       3472 1 . . . . . 4.0 1.8 5.0 1 1 
       3473 1 . . . . . 4.0 1.8 5.0 1 1 
       3474 1 . . . . . 4.0 1.8 5.0 1 1 
       3475 1 . . . . . 4.0 1.8 6.0 1 1 
       3476 1 . . . . . 3.0 1.8 3.5 1 1 
       3477 1 . . . . . 4.0 1.8 5.0 1 1 
       3478 1 . . . . . 4.0 1.8 6.0 1 1 
       3479 1 . . . . . 4.0 1.8 5.0 1 1 
       3480 1 . . . . . 3.0 1.8 3.5 1 1 
       3481 1 . . . . . 4.0 1.8 5.0 1 1 
       3482 1 . . . . . 4.0 1.8 5.0 1 1 
       3483 1 . . . . . 3.0 1.8 3.5 1 1 
       3484 1 . . . . . 4.0 1.8 5.0 1 1 
       3485 1 . . . . . 4.0 1.8 5.0 1 1 
       3486 1 . . . . . 4.0 1.8 6.0 1 1 
       3487 1 . . . . . 3.0 1.8 3.5 1 1 
       3488 1 . . . . .   . 1.8 3.5 1 1 
       3489 1 . . . . . 4.0 1.8 6.0 1 1 
       3490 1 . . . . . 4.0 1.8 5.0 1 1 
       3491 1 . . . . . 4.0 1.8 5.0 1 1 
       3492 1 . . . . . 4.0 1.8 6.0 1 1 
       3493 1 . . . . . 4.0 1.8 5.0 1 1 
       3494 1 . . . . . 4.0 1.8 5.0 1 1 
       3495 1 . . . . . 4.0 1.8 6.0 1 1 
       3496 1 . . . . . 4.0 1.8 6.0 1 1 
       3497 1 . . . . . 3.0 1.8 3.5 1 1 
       3498 1 . . . . . 4.0 1.8 5.0 1 1 
       3499 1 . . . . . 4.0 1.8 5.0 1 1 
       3500 1 . . . . . 4.0 1.8 5.0 1 1 
       3501 1 . . . . . 4.0 1.8 5.0 1 1 
       3502 1 . . . . . 3.0 1.8 3.5 1 1 
       3503 1 . . . . . 4.0 1.8 5.0 1 1 
       3504 1 . . . . . 4.0 1.8 5.0 1 1 
       3505 1 . . . . . 4.0 1.8 5.0 1 1 
       3506 1 . . . . . 4.0 1.8 5.0 1 1 
       3507 1 . . . . . 4.0 1.8 6.0 1 1 
       3508 1 . . . . . 4.0 1.8 5.0 1 1 
       3509 1 . . . . . 4.0 1.8 6.0 1 1 
       3510 1 . . . . . 4.0 1.8 5.0 1 1 
       3511 1 . . . . . 3.0 1.8 3.5 1 1 
       3512 1 . . . . . 4.0 1.8 5.0 1 1 
       3513 1 . . . . . 4.0 1.8 6.0 1 1 
       3514 1 . . . . . 4.0 1.8 6.0 1 1 
       3515 1 . . . . . 3.0 1.8 3.5 1 1 
       3516 1 . . . . . 3.0 1.8 3.5 1 1 
       3517 1 . . . . . 3.0 1.8 3.5 1 1 
       3518 1 . . . . . 4.0 1.8 5.0 1 1 
       3519 1 . . . . . 4.0 1.8 5.0 1 1 
       3520 1 . . . . . 4.0 1.8 6.0 1 1 
       3521 1 . . . . . 4.0 1.8 5.0 1 1 
       3522 1 . . . . . 4.0 1.8 5.0 1 1 
       3523 1 . . . . . 4.0 1.8 6.0 1 1 
       3524 1 . . . . . 4.0 1.8 5.0 1 1 
       3525 1 . . . . . 4.0 1.8 5.0 1 1 
       3526 1 . . . . . 4.0 1.8 5.0 1 1 
       3527 1 . . . . . 4.0 1.8 5.0 1 1 
       3528 1 . . . . . 3.0 1.8 3.5 1 1 
       3529 1 . . . . . 4.0 1.8 5.0 1 1 
       3530 1 . . . . . 4.0 1.8 5.0 1 1 
       3531 1 . . . . . 4.0 1.8 5.0 1 1 
       3532 1 . . . . . 4.0 1.8 5.0 1 1 
       3533 1 . . . . . 3.0 1.8 3.5 1 1 
       3534 1 . . . . . 4.0 1.8 5.0 1 1 
       3535 1 . . . . . 3.0 1.8 3.5 1 1 
       3536 1 . . . . . 4.0 1.8 5.0 1 1 
       3537 1 . . . . . 4.0 1.8 6.0 1 1 
       3538 1 . . . . . 3.0 1.8 3.5 1 1 
       3539 1 . . . . . 2.0 1.8 2.7 1 1 
       3540 1 . . . . . 4.0 1.8 5.0 1 1 
       3541 1 . . . . . 4.0 1.8 5.0 1 1 
       3542 1 . . . . . 3.0 1.8 3.5 1 1 
       3543 1 . . . . . 4.0 1.8 5.0 1 1 
       3544 1 . . . . . 3.0 1.8 3.5 1 1 
       3545 1 . . . . . 4.0 1.8 6.0 1 1 
       3546 1 . . . . . 4.0 1.8 5.0 1 1 
       3547 1 . . . . . 4.0 1.8 5.0 1 1 
       3548 1 . . . . . 4.0 1.8 5.0 1 1 
       3549 1 . . . . . 4.0 1.8 5.0 1 1 
       3550 1 . . . . . 4.0 1.8 5.0 1 1 
       3551 1 . . . . . 4.0 1.8 5.0 1 1 
       3552 1 . . . . . 4.0 1.8 5.0 1 1 
       3553 1 . . . . . 4.0 1.8 5.0 1 1 
       3554 1 . . . . . 3.0 1.8 3.5 1 1 
       3555 1 . . . . . 4.0 1.8 6.0 1 1 
       3556 1 . . . . . 4.0 1.8 5.0 1 1 
       3557 1 . . . . . 4.0 1.8 5.0 1 1 
       3558 1 . . . . . 4.0 1.8 6.0 1 1 
       3559 1 . . . . . 3.0 1.8 3.5 1 1 
       3560 1 . . . . . 3.0 1.8 3.5 1 1 
       3561 1 . . . . . 4.0 1.8 5.0 1 1 
       3562 1 . . . . . 4.0 1.8 5.0 1 1 
       3563 1 . . . . . 4.0 1.8 5.0 1 1 
       3564 1 . . . . . 4.0 1.8 5.0 1 1 
       3565 1 . . . . . 2.0 1.8 2.7 1 1 
       3566 1 . . . . . 4.0 1.8 5.0 1 1 
       3567 1 . . . . . 4.0 1.8 5.0 1 1 
       3568 1 . . . . . 4.0 1.8 6.0 1 1 
       3569 1 . . . . . 2.0 1.8 2.7 1 1 
       3570 1 . . . . . 4.0 1.8 5.0 1 1 
       3571 1 . . . . . 4.0 1.8 5.0 1 1 
       3572 1 . . . . . 4.0 1.8 5.0 1 1 
       3573 1 . . . . . 2.0 1.8 2.7 1 1 
       3574 1 . . . . . 4.0 1.8 5.0 1 1 
       3575 1 . . . . . 4.0 1.8 5.0 1 1 
       3576 1 . . . . . 4.0 1.8 5.0 1 1 
       3577 1 . . . . . 4.0 1.8 5.0 1 1 
       3578 1 . . . . . 4.0 1.8 5.0 1 1 
       3579 1 . . . . . 4.0 1.8 5.0 1 1 
       3580 1 . . . . . 4.0 1.8 6.0 1 1 
       3581 1 . . . . . 3.0 1.8 3.5 1 1 
       3582 1 . . . . . 4.0 1.8 5.0 1 1 
       3583 1 . . . . . 4.0 1.8 5.0 1 1 
       3584 1 . . . . . 4.0 1.8 5.0 1 1 
       3585 1 . . . . . 3.0 1.8 3.5 1 1 
       3586 1 . . . . . 3.0 1.8 3.5 1 1 
       3587 1 . . . . . 4.0 1.8 5.0 1 1 
       3588 1 . . . . . 4.0 1.8 5.0 1 1 
       3589 1 . . . . . 4.0 1.8 5.0 1 1 
       3590 1 . . . . . 4.0 1.8 6.0 1 1 
       3591 1 . . . . . 3.0 1.8 3.5 1 1 
       3592 1 . . . . . 4.0 1.8 5.0 1 1 
       3593 1 . . . . . 4.0 1.8 5.0 1 1 
       3594 1 . . . . . 3.0 1.8 3.5 1 1 
       3595 1 . . . . . 4.0 1.8 5.0 1 1 
       3596 1 . . . . . 4.0 1.8 5.0 1 1 
       3597 1 . . . . . 3.0 1.8 3.5 1 1 
       3598 1 . . . . . 4.0 1.8 5.0 1 1 
       3599 1 . . . . . 4.0 1.8 5.0 1 1 
       3600 1 . . . . . 4.0 1.8 5.0 1 1 
       3601 1 . . . . . 3.0 1.8 3.5 1 1 
       3602 1 . . . . . 4.0 1.8 5.0 1 1 
       3603 1 . . . . . 4.0 1.8 5.0 1 1 
       3604 1 . . . . . 4.0 1.8 5.0 1 1 
       3605 1 . . . . . 3.0 1.8 3.5 1 1 
       3606 1 . . . . . 4.0 1.8 5.0 1 1 
       3607 1 . . . . . 4.0 1.8 5.0 1 1 
       3608 1 . . . . . 4.0 1.8 6.0 1 1 
       3609 1 . . . . . 4.0 1.8 5.0 1 1 
       3610 1 . . . . . 4.0 1.8 6.0 1 1 
       3611 1 . . . . . 3.0 1.8 3.5 1 1 
       3612 1 . . . . . 4.0 1.8 5.0 1 1 
       3613 1 . . . . . 4.0 1.8 5.0 1 1 
       3614 1 . . . . . 3.0 1.8 3.5 1 1 
       3615 1 . . . . .   . 1.8 3.5 1 1 
       3616 1 . . . . . 4.0 1.8 5.0 1 1 
       3617 1 . . . . . 4.0 1.8 5.0 1 1 
       3618 1 . . . . . 4.0 1.8 6.0 1 1 
       3619 1 . . . . . 3.0 1.8 3.5 1 1 
       3620 1 . . . . . 4.0 1.8 6.0 1 1 
       3621 1 . . . . . 4.0 1.8 6.0 1 1 
       3622 1 . . . . . 4.0 1.8 5.0 1 1 
       3623 1 . . . . . 4.0 1.8 5.0 1 1 
       3624 1 . . . . . 4.0 1.8 5.0 1 1 
       3625 1 . . . . . 4.0 1.8 5.0 1 1 
       3626 1 . . . . . 4.0 1.8 5.0 1 1 
       3627 1 . . . . . 3.0 1.8 3.5 1 1 
       3628 1 . . . . . 4.0 1.8 5.0 1 1 
       3629 1 . . . . . 4.0 1.8 5.0 1 1 
       3630 1 . . . . . 4.0 1.8 5.0 1 1 
       3631 1 . . . . . 3.0 1.8 3.5 1 1 
       3632 1 . . . . . 4.0 1.8 5.0 1 1 
       3633 1 . . . . . 4.0 1.8 5.0 1 1 
       3634 1 . . . . . 3.0 1.8 3.5 1 1 
       3635 1 . . . . . 4.0 1.8 5.0 1 1 
       3636 1 . . . . . 3.0 1.8 3.5 1 1 
       3637 1 . . . . . 4.0 1.8 5.0 1 1 
       3638 1 . . . . . 4.0 1.8 5.0 1 1 
       3639 1 . . . . . 4.0 1.8 5.0 1 1 
       3640 1 . . . . . 4.0 1.8 5.0 1 1 
       3641 1 . . . . . 4.0 1.8 5.0 1 1 
       3642 1 . . . . . 4.0 1.8 5.0 1 1 
       3643 1 . . . . . 4.0 1.8 5.0 1 1 
       3644 1 . . . . . 4.0 1.8 6.0 1 1 
       3645 1 . . . . . 4.0 1.8 6.0 1 1 
       3646 1 . . . . . 3.0 1.8 3.5 1 1 
       3647 1 . . . . . 4.0 1.8 5.0 1 1 
       3648 1 . . . . . 4.0 1.8 5.0 1 1 
       3649 1 . . . . . 4.0 1.8 5.0 1 1 
       3650 1 . . . . . 4.0 1.8 5.0 1 1 
       3651 1 . . . . . 4.0 1.8 6.0 1 1 
       3652 1 . . . . . 4.0 1.8 6.0 1 1 
       3653 1 . . . . . 4.0 1.8 6.0 1 1 
       3654 1 . . . . . 4.0 1.8 5.0 1 1 
       3655 1 . . . . . 4.0 1.8 6.0 1 1 
       3656 1 . . . . . 4.0 1.8 5.0 1 1 
       3657 1 . . . . . 4.0 1.8 6.0 1 1 
       3658 1 . . . . . 4.0 1.8 5.0 1 1 
       3659 1 . . . . . 4.0 1.8 5.0 1 1 
       3660 1 . . . . . 4.0 1.8 5.0 1 1 
       3661 1 . . . . . 4.0 1.8 6.0 1 1 
       3662 1 . . . . . 4.0 1.8 6.0 1 1 
       3663 1 . . . . . 4.0 1.8 6.0 1 1 
       3664 1 . . . . . 4.0 1.8 6.0 1 1 
       3665 1 . . . . . 4.0 1.8 6.0 1 1 
       3666 1 . . . . . 4.0 1.8 5.0 1 1 
       3667 1 . . . . . 4.0 1.8 6.0 1 1 
       3668 1 . . . . . 4.0 1.8 6.0 1 1 
       3669 1 . . . . . 4.0 1.8 5.0 1 1 
       3670 1 . . . . . 4.0 1.8 5.0 1 1 
       3671 1 . . . . . 3.0 1.8 3.5 1 1 
       3672 1 . . . . . 4.0 1.8 6.0 1 1 
       3673 1 . . . . . 4.0 1.8 5.0 1 1 
       3674 1 . . . . . 4.0 1.8 5.0 1 1 
       3675 1 . . . . . 4.0 1.8 5.0 1 1 
       3676 1 . . . . . 4.0 1.8 5.0 1 1 
       3677 1 . . . . . 4.0 1.8 6.0 1 1 
       3678 1 . . . . . 3.0 1.8 3.5 1 1 
       3679 1 . . . . . 4.0 1.8 5.0 1 1 
       3680 1 . . . . . 4.0 1.8 6.0 1 1 
       3681 1 . . . . . 4.0 1.8 6.0 1 1 
       3682 1 . . . . . 4.0 1.8 6.0 1 1 
       3683 1 . . . . . 4.0 1.8 5.0 1 1 
       3684 1 . . . . . 4.0 1.8 5.0 1 1 
       3685 1 . . . . . 4.0 1.8 5.0 1 1 
       3686 1 . . . . . 4.0 1.8 6.0 1 1 
       3687 1 . . . . . 4.0 1.8 5.0 1 1 
       3688 1 . . . . . 4.0 1.8 6.0 1 1 
       3689 1 . . . . . 3.0 1.8 3.5 1 1 
       3690 1 . . . . . 4.0 1.8 5.0 1 1 
       3691 1 . . . . . 3.0 1.8 3.5 1 1 
       3692 1 . . . . . 4.0 1.8 5.0 1 1 
       3693 1 . . . . . 4.0 1.8 5.0 1 1 
       3694 1 . . . . . 4.0 1.8 5.0 1 1 
       3695 1 . . . . . 4.0 1.8 5.0 1 1 
       3696 1 . . . . . 3.0 1.8 3.5 1 1 
       3697 1 . . . . . 4.0 1.8 5.0 1 1 
       3698 1 . . . . . 3.0 1.8 3.5 1 1 
       3699 1 . . . . . 3.0 1.8 3.5 1 1 
       3700 1 . . . . . 4.0 1.8 5.0 1 1 
       3701 1 . . . . . 4.0 1.8 6.0 1 1 
       3702 1 . . . . . 4.0 1.8 5.0 1 1 
       3703 1 . . . . . 3.0 1.8 3.5 1 1 
       3704 1 . . . . . 4.0 1.8 5.0 1 1 
       3705 1 . . . . . 4.0 1.8 5.0 1 1 
       3706 1 . . . . . 3.0 1.8 3.5 1 1 
       3707 1 . . . . . 3.0 1.8 3.5 1 1 
       3708 1 . . . . . 4.0 1.8 5.0 1 1 
       3709 1 . . . . . 4.0 1.8 5.0 1 1 
       3710 1 . . . . . 4.0 1.8 5.0 1 1 
       3711 1 . . . . . 4.0 1.8 5.0 1 1 
       3712 1 . . . . . 4.0 1.8 6.0 1 1 
       3713 1 . . . . . 4.0 1.8 5.0 1 1 
       3714 1 . . . . . 4.0 1.8 5.0 1 1 
       3715 1 . . . . . 3.0 1.8 3.5 1 1 
       3716 1 . . . . . 4.0 1.8 5.0 1 1 
       3717 1 . . . . . 4.0 1.8 5.0 1 1 
       3718 1 . . . . . 4.0 1.8 5.0 1 1 
       3719 1 . . . . . 4.0 1.8 6.0 1 1 
       3720 1 . . . . . 4.0 1.8 6.0 1 1 
       3721 1 . . . . .   . 1.8 3.5 1 1 
       3722 1 . . . . . 4.0 1.8 5.0 1 1 
       3723 1 . . . . . 3.0 1.8 3.5 1 1 
       3724 1 . . . . . 4.0 1.8 5.0 1 1 
       3725 1 . . . . . 4.0 1.8 6.0 1 1 
       3726 1 . . . . . 4.0 1.8 6.0 1 1 
       3727 1 . . . . . 4.0 1.8 5.0 1 1 
       3728 1 . . . . . 4.0 1.8 5.0 1 1 
       3729 1 . . . . . 4.0 1.8 6.0 1 1 
       3730 1 . . . . . 4.0 1.8 6.0 1 1 
       3731 1 . . . . . 4.0 1.8 5.0 1 1 
       3732 1 . . . . . 3.0 1.8 3.5 1 1 
       3733 1 . . . . . 4.0 1.8 5.0 1 1 
       3734 1 . . . . . 4.0 1.8 5.0 1 1 
       3735 1 . . . . . 4.0 1.8 5.0 1 1 
       3736 1 . . . . . 4.0 1.8 6.0 1 1 
       3737 1 . . . . . 3.0 1.8 3.5 1 1 
       3738 1 . . . . . 4.0 1.8 5.0 1 1 
       3739 1 . . . . . 4.0 1.8 5.0 1 1 
       3740 1 . . . . . 4.0 1.8 6.0 1 1 
       3741 1 . . . . . 4.0 1.8 5.0 1 1 
       3742 1 . . . . . 3.0 1.8 3.5 1 1 
       3743 1 . . . . . 4.0 1.8 5.0 1 1 
       3744 1 . . . . . 4.0 1.8 5.0 1 1 
       3745 1 . . . . . 4.0 1.8 5.0 1 1 
       3746 1 . . . . . 3.0 1.8 3.5 1 1 
       3747 1 . . . . . 3.0 1.8 3.5 1 1 
       3748 1 . . . . . 4.0 1.8 5.0 1 1 
       3749 1 . . . . . 4.0 1.8 6.0 1 1 
       3750 1 . . . . . 4.0 1.8 5.0 1 1 
       3751 1 . . . . . 4.0 1.8 5.0 1 1 
       3752 1 . . . . . 4.0 1.8 5.0 1 1 
       3753 1 . . . . . 4.0 1.8 5.0 1 1 
       3754 1 . . . . . 4.0 1.8 5.0 1 1 
       3755 1 . . . . . 3.0 1.8 3.5 1 1 
       3756 1 . . . . . 4.0 1.8 5.0 1 1 
       3757 1 . . . . . 4.0 1.8 5.0 1 1 
       3758 1 . . . . . 4.0 1.8 5.0 1 1 
       3759 1 . . . . . 4.0 1.8 5.0 1 1 
       3760 1 . . . . . 4.0 1.8 6.0 1 1 
       3761 1 . . . . . 4.0 1.8 5.0 1 1 
       3762 1 . . . . . 3.0 1.8 3.5 1 1 
       3763 1 . . . . . 4.0 1.8 5.0 1 1 
       3764 1 . . . . . 4.0 1.8 5.0 1 1 
       3765 1 . . . . . 3.0 1.8 3.5 1 1 
       3766 1 . . . . . 4.0 1.8 5.0 1 1 
       3767 1 . . . . . 4.0 1.8 5.0 1 1 
       3768 1 . . . . . 4.0 1.8 5.0 1 1 
       3769 1 . . . . . 3.0 1.8 3.5 1 1 
       3770 1 . . . . . 4.0 1.8 5.0 1 1 
       3771 1 . . . . . 4.0 1.8 5.0 1 1 
       3772 1 . . . . . 3.0 1.8 3.5 1 1 
       3773 1 . . . . . 4.0 1.8 5.0 1 1 
       3774 1 . . . . . 4.0 1.8 6.0 1 1 
       3775 1 . . . . . 4.0 1.8 5.0 1 1 
       3776 1 . . . . . 3.0 1.8 3.5 1 1 
       3777 1 . . . . . 3.0 1.8 3.5 1 1 
       3778 1 . . . . . 3.0 1.8 3.5 1 1 
       3779 1 . . . . . 4.0 1.8 5.0 1 1 
       3780 1 . . . . . 4.0 1.8 6.0 1 1 
       3781 1 . . . . . 4.0 1.8 5.0 1 1 
       3782 1 . . . . . 4.0 1.8 5.0 1 1 
       3783 1 . . . . . 4.0 1.8 6.0 1 1 
       3784 1 . . . . . 4.0 1.8 5.0 1 1 
       3785 1 . . . . . 3.0 1.8 3.5 1 1 
       3786 1 . . . . . 3.0 1.8 3.5 1 1 
       3787 1 . . . . . 4.0 1.8 5.0 1 1 
       3788 1 . . . . . 4.0 1.8 5.0 1 1 
       3789 1 . . . . . 3.0 1.8 3.5 1 1 
       3790 1 . . . . . 4.0 1.8 5.0 1 1 
       3791 1 . . . . . 4.0 1.8 5.0 1 1 
       3792 1 . . . . . 4.0 1.8 5.0 1 1 
       3793 1 . . . . . 4.0 1.8 5.0 1 1 
       3794 1 . . . . . 4.0 1.8 5.0 1 1 
       3795 1 . . . . . 4.0 1.8 5.0 1 1 
       3796 1 . . . . . 4.0 1.8 5.0 1 1 
       3797 1 . . . . . 4.0 1.8 5.0 1 1 
       3798 1 . . . . . 4.0 1.8 6.0 1 1 
       3799 1 . . . . . 4.0 1.8 5.0 1 1 
       3800 1 . . . . . 4.0 1.8 6.0 1 1 
       3801 1 . . . . . 4.0 1.8 5.0 1 1 
       3802 1 . . . . . 4.0 1.8 5.0 1 1 
       3803 1 . . . . . 4.0 1.8 6.0 1 1 
       3804 1 . . . . . 4.0 1.8 5.0 1 1 
       3805 1 . . . . . 4.0 1.8 5.0 1 1 
       3806 1 . . . . . 4.0 1.8 5.0 1 1 
       3807 1 . . . . . 4.0 1.8 6.0 1 1 
       3808 1 . . . . . 4.0 1.8 5.0 1 1 
       3809 1 . . . . . 4.0 1.8 6.0 1 1 
       3810 1 . . . . . 4.0 1.8 5.0 1 1 
       3811 1 . . . . . 4.0 1.8 5.0 1 1 
       3812 1 . . . . . 3.0 1.8 3.5 1 1 
       3813 1 . . . . . 3.0 1.8 3.5 1 1 
       3814 1 . . . . . 3.0 1.8 3.5 1 1 
       3815 1 . . . . . 3.0 1.8 3.5 1 1 
       3816 1 . . . . . 2.0 1.8 2.7 1 1 
       3817 1 . . . . . 3.0 1.8 3.5 1 1 
       3818 1 . . . . . 4.0 1.8 5.0 1 1 
       3819 1 . . . . . 4.0 1.8 5.0 1 1 
       3820 1 . . . . . 4.0 1.8 6.0 1 1 
       3821 1 . . . . . 4.0 1.8 5.0 1 1 
       3822 1 . . . . . 4.0 1.8 5.0 1 1 
       3823 1 . . . . . 3.0 1.8 3.5 1 1 
       3824 1 . . . . . 4.0 1.8 5.0 1 1 
       3825 1 . . . . . 4.0 1.8 5.0 1 1 
       3826 1 . . . . . 4.0 1.8 5.0 1 1 
       3827 1 . . . . . 4.0 1.8 5.0 1 1 
       3828 1 . . . . . 4.0 1.8 5.0 1 1 
       3829 1 . . . . . 3.0 1.8 3.5 1 1 
       3830 1 . . . . . 4.0 1.8 5.0 1 1 
       3831 1 . . . . . 3.0 1.8 3.5 1 1 
       3832 1 . . . . . 3.0 1.8 3.5 1 1 
       3833 1 . . . . . 4.0 1.8 5.0 1 1 
       3834 1 . . . . . 3.0 1.8 3.5 1 1 
       3835 1 . . . . . 4.0 1.8 5.0 1 1 
       3836 1 . . . . . 4.0 1.8 6.0 1 1 
       3837 1 . . . . . 4.0 1.8 5.0 1 1 
       3838 1 . . . . . 3.0 1.8 3.5 1 1 
       3839 1 . . . . . 3.0 1.8 3.5 1 1 
       3840 1 . . . . . 3.0 1.8 3.5 1 1 
       3841 1 . . . . . 4.0 1.8 5.0 1 1 
       3842 1 . . . . . 4.0 1.8 5.0 1 1 
       3843 1 . . . . . 4.0 1.8 6.0 1 1 
       3844 1 . . . . . 4.0 1.8 6.0 1 1 
       3845 1 . . . . . 4.0 1.8 5.0 1 1 
       3846 1 . . . . . 4.0 1.8 5.0 1 1 
       3847 1 . . . . . 4.0 1.8 5.0 1 1 
       3848 1 . . . . . 4.0 1.8 5.0 1 1 
       3849 1 . . . . . 4.0 1.8 6.0 1 1 
       3850 1 . . . . . 3.0 1.8 3.5 1 1 
       3851 1 . . . . . 4.0 1.8 5.0 1 1 
       3852 1 . . . . . 4.0 1.8 6.0 1 1 
       3853 1 . . . . . 4.0 1.8 5.0 1 1 
       3854 1 . . . . . 4.0 1.8 5.0 1 1 
       3855 1 . . . . . 4.0 1.8 5.0 1 1 
       3856 1 . . . . . 4.0 1.8 5.0 1 1 
       3857 1 . . . . . 4.0 1.8 5.0 1 1 
       3858 1 . . . . . 4.0 1.8 5.0 1 1 
       3859 1 . . . . . 4.0 1.8 5.0 1 1 
       3860 1 . . . . . 4.0 1.8 5.0 1 1 
       3861 1 . . . . . 4.0 1.8 5.0 1 1 
       3862 1 . . . . . 3.0 1.8 3.5 1 1 
       3863 1 . . . . . 4.0 1.8 5.0 1 1 
       3864 1 . . . . . 4.0 1.8 5.0 1 1 
       3865 1 . . . . . 4.0 1.8 5.0 1 1 
       3866 1 . . . . . 4.0 1.8 5.0 1 1 
       3867 1 . . . . . 4.0 1.8 5.0 1 1 
       3868 1 . . . . . 4.0 1.8 5.0 1 1 
       3869 1 . . . . . 4.0 1.8 5.0 1 1 
       3870 1 . . . . . 4.0 1.8 6.0 1 1 
       3871 1 . . . . . 3.0 1.8 3.5 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_2
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   6 LEU C 1 1   7 LYS N  1 1   7 LYS CA 1 1   7 LYS C     -110.6       -40.6 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 1 
         2 . 1 1   7 LYS N 1 1   7 LYS CA 1 1   7 LYS C  1 1   8 SER N      106.8       182.5 .   4 . N .   4 . CA .   4 . C  .   5 . N 1 1 
         3 . 1 1   7 LYS C 1 1   8 SER N  1 1   8 SER CA 1 1   8 SER C      -73.8       -48.5 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 1 
         4 . 1 1   8 SER N 1 1   8 SER CA 1 1   8 SER C  1 1   9 GLU N      -63.8       -14.8 .   5 . N .   5 . CA .   5 . C  .   6 . N 1 1 
         5 . 1 1   8 SER C 1 1   9 GLU N  1 1   9 GLU CA 1 1   9 GLU C      -74.0       -49.3 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 1 
         6 . 1 1   9 GLU N 1 1   9 GLU CA 1 1   9 GLU C  1 1  10 MET N      -59.2  -30.899998 .   6 . N .   6 . CA .   6 . C  .   7 . N 1 1 
         7 . 1 1   9 GLU C 1 1  10 MET N  1 1  10 MET CA 1 1  10 MET C      -75.6       -54.5 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
         8 . 1 1  10 MET N 1 1  10 MET CA 1 1  10 MET C  1 1  11 PHE N      -54.1       -24.3 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 1 
         9 . 1 1  10 MET C 1 1  11 PHE N  1 1  11 PHE CA 1 1  11 PHE C      -80.2       -52.4 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 1 
        10 . 1 1  11 PHE N 1 1  11 PHE CA 1 1  11 PHE C  1 1  12 VAL N      -56.0       -26.1 .   8 . N .   8 . CA .   8 . C  .   9 . N 1 1 
        11 . 1 1  11 PHE C 1 1  12 VAL N  1 1  12 VAL CA 1 1  12 VAL C      -74.3       -54.4 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
        12 . 1 1  12 VAL N 1 1  12 VAL CA 1 1  12 VAL C  1 1  13 SER N      -57.2       -31.5 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 1 
        13 . 1 1  12 VAL C 1 1  13 SER N  1 1  13 SER CA 1 1  13 SER C      -72.3       -49.5 .   9 . C .  10 . N  .  10 . CA .  10 . C 1 1 
        14 . 1 1  13 SER N 1 1  13 SER CA 1 1  13 SER C  1 1  14 ALA N      -55.3       -27.7 .  10 . N .  10 . CA .  10 . C  .  11 . N 1 1 
        15 . 1 1  13 SER C 1 1  14 ALA N  1 1  14 ALA CA 1 1  14 ALA C      -76.8       -56.5 .  10 . C .  11 . N  .  11 . CA .  11 . C 1 1 
        16 . 1 1  14 ALA N 1 1  14 ALA CA 1 1  14 ALA C  1 1  15 LEU N -54.299995  -26.599998 .  11 . N .  11 . CA .  11 . C  .  12 . N 1 1 
        17 . 1 1  14 ALA C 1 1  15 LEU N  1 1  15 LEU CA 1 1  15 LEU C      -78.0       -53.3 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
        18 . 1 1  15 LEU N 1 1  15 LEU CA 1 1  15 LEU C  1 1  16 ILE N      -56.4       -23.9 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 1 
        19 . 1 1  15 LEU C 1 1  16 ILE N  1 1  16 ILE CA 1 1  16 ILE C      -73.0       -53.0 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        20 . 1 1  16 ILE N 1 1  16 ILE CA 1 1  16 ILE C  1 1  17 ARG N      -56.0       -33.3 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
        21 . 1 1  16 ILE C 1 1  17 ARG N  1 1  17 ARG CA 1 1  17 ARG C      -72.4  -49.099995 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        22 . 1 1  17 ARG N 1 1  17 ARG CA 1 1  17 ARG C  1 1  18 ARG N      -54.4       -26.3 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        23 . 1 1  17 ARG C 1 1  18 ARG N  1 1  18 ARG CA 1 1  18 ARG C      -77.5  -57.500004 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        24 . 1 1  18 ARG N 1 1  18 ARG CA 1 1  18 ARG C  1 1  19 VAL N      -55.9       -26.7 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        25 . 1 1  18 ARG C 1 1  19 VAL N  1 1  19 VAL CA 1 1  19 VAL C      -74.4       -54.4 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        26 . 1 1  19 VAL N 1 1  19 VAL CA 1 1  19 VAL C  1 1  20 PHE N -53.199997       -33.2 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        27 . 1 1  19 VAL C 1 1  20 PHE N  1 1  20 PHE CA 1 1  20 PHE C      -73.7  -51.299995 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        28 . 1 1  20 PHE N 1 1  20 PHE CA 1 1  20 PHE C  1 1  21 ALA N      -52.6  -30.400002 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        29 . 1 1  20 PHE C 1 1  21 ALA N  1 1  21 ALA CA 1 1  21 ALA C      -76.3       -56.3 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        30 . 1 1  21 ALA N 1 1  21 ALA CA 1 1  21 ALA C  1 1  22 ALA N      -42.1       -10.1 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
        31 . 1 1  24 GLY C 1 1  25 PHE N  1 1  25 PHE CA 1 1  25 PHE C     -186.3  -52.899998 .  21 . C .  22 . N  .  22 . CA .  22 . C 1 1 
        32 . 1 1  25 PHE N 1 1  25 PHE CA 1 1  25 PHE C  1 1  26 ALA N 117.899994       166.9 .  22 . N .  22 . CA .  22 . C  .  23 . N 1 1 
        33 . 1 1  26 ALA C 1 1  27 ALA N  1 1  27 ALA CA 1 1  27 ALA C     -185.9       -86.4 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        34 . 1 1  27 ALA N 1 1  27 ALA CA 1 1  27 ALA C  1 1  28 VAL N 122.399994       176.1 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
        35 . 1 1  27 ALA C 1 1  28 VAL N  1 1  28 VAL CA 1 1  28 VAL C     -106.9       -61.5 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        36 . 1 1  28 VAL N 1 1  28 VAL CA 1 1  28 VAL C  1 1  29 GLU N       94.4       147.6 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
        37 . 1 1  29 GLU C 1 1  30 LYS N  1 1  30 LYS CA 1 1  30 LYS C     -154.2  -91.899994 .  26 . C .  27 . N  .  27 . CA .  27 . C 1 1 
        38 . 1 1  30 LYS N 1 1  30 LYS CA 1 1  30 LYS C  1 1  31 LYS N      102.5       164.5 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
        39 . 1 1  33 ALA C 1 1  34 GLU N  1 1  34 GLU CA 1 1  34 GLU C      -76.7       -48.9 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        40 . 1 1  34 GLU N 1 1  34 GLU CA 1 1  34 GLU C  1 1  35 ALA N -61.999996       -18.1 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 1 
        41 . 1 1  34 GLU C 1 1  35 ALA N  1 1  35 ALA CA 1 1  35 ALA C      -94.3       -45.5 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        42 . 1 1  35 ALA N 1 1  35 ALA CA 1 1  35 ALA C  1 1  36 ALA N      -64.2        -2.8 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        43 . 1 1  35 ALA C 1 1  36 ALA N  1 1  36 ALA CA 1 1  36 ALA C     -117.6       -65.9 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        44 . 1 1  36 ALA N 1 1  36 ALA CA 1 1  36 ALA C  1 1  37 GLY N      -25.3        32.3 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 1 
        45 . 1 1  38 ALA C 1 1  39 ILE N  1 1  39 ILE CA 1 1  39 ILE C     -183.3       -74.2 .  35 . C .  36 . N  .  36 . CA .  36 . C 1 1 
        46 . 1 1  39 ILE N 1 1  39 ILE CA 1 1  39 ILE C  1 1  40 PHE N      101.6       176.9 .  36 . N .  36 . CA .  36 . C  .  37 . N 1 1 
        47 . 1 1  39 ILE C 1 1  40 PHE N  1 1  40 PHE CA 1 1  40 PHE C     -138.2       -92.6 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
        48 . 1 1  40 PHE N 1 1  40 PHE CA 1 1  40 PHE C  1 1  41 VAL N      114.8       175.7 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 1 
        49 . 1 1  40 PHE C 1 1  41 VAL N  1 1  41 VAL CA 1 1  41 VAL C     -141.7      -109.7 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        50 . 1 1  41 VAL N 1 1  41 VAL CA 1 1  41 VAL C  1 1  42 ARG N  108.59999       152.7 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
        51 . 1 1  41 VAL C 1 1  42 ARG N  1 1  42 ARG CA 1 1  42 ARG C     -138.7      -109.1 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        52 . 1 1  42 ARG N 1 1  42 ARG CA 1 1  42 ARG C  1 1  43 GLN N      109.8       151.5 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
        53 . 1 1  42 ARG C 1 1  43 GLN N  1 1  43 GLN CA 1 1  43 GLN C     -143.1       -83.0 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        54 . 1 1  43 GLN N 1 1  43 GLN CA 1 1  43 GLN C  1 1  44 ARG N  104.19999       158.0 .  40 . N .  40 . CA .  40 . C  .  41 . N 1 1 
        55 . 1 1  43 GLN C 1 1  44 ARG N  1 1  44 ARG CA 1 1  44 ARG C     -129.2       -58.0 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        56 . 1 1  44 ARG N 1 1  44 ARG CA 1 1  44 ARG C  1 1  45 LEU N  93.799995       158.3 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        57 . 1 1  44 ARG C 1 1  45 LEU N  1 1  45 LEU CA 1 1  45 LEU C     -141.7       -38.3 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        58 . 1 1  45 LEU N 1 1  45 LEU CA 1 1  45 LEU C  1 1  46 ARG N       71.8   190.69998 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        59 . 1 1  45 LEU C 1 1  46 ARG N  1 1  46 ARG CA 1 1  46 ARG C      -76.2       -46.2 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        60 . 1 1  46 ARG N 1 1  46 ARG CA 1 1  46 ARG C  1 1  47 ASP N      -45.8        -6.3 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 1 
        61 . 1 1  49 ARG C 1 1  50 GLU N  1 1  50 GLU CA 1 1  50 GLU C -169.89998   -94.09999 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 1 
        62 . 1 1  50 GLU N 1 1  50 GLU CA 1 1  50 GLU C  1 1  51 ASN N      133.8       182.6 .  47 . N .  47 . CA .  47 . C  .  48 . N 1 1 
        63 . 1 1  50 GLU C 1 1  51 ASN N  1 1  51 ASN CA 1 1  51 ASN C     -159.5       -96.5 .  47 . C .  48 . N  .  48 . CA .  48 . C 1 1 
        64 . 1 1  51 ASN N 1 1  51 ASN CA 1 1  51 ASN C  1 1  52 LEU N      112.9       171.0 .  48 . N .  48 . CA .  48 . C  .  49 . N 1 1 
        65 . 1 1  51 ASN C 1 1  52 LEU N  1 1  52 LEU CA 1 1  52 LEU C     -149.9 -103.899994 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        66 . 1 1  52 LEU N 1 1  52 LEU CA 1 1  52 LEU C  1 1  53 TYR N      119.3       140.2 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 1 
        67 . 1 1  52 LEU C 1 1  53 TYR N  1 1  53 TYR CA 1 1  53 TYR C -132.69998       -79.0 .  49 . C .  50 . N  .  50 . CA .  50 . C 1 1 
        68 . 1 1  53 TYR N 1 1  53 TYR CA 1 1  53 TYR C  1 1  54 GLY N  120.19999       162.7 .  50 . N .  50 . CA .  50 . C  .  51 . N 1 1 
        69 . 1 1  53 TYR C 1 1  54 GLY N  1 1  54 GLY CA 1 1  54 GLY C     -178.4       -46.0 .  50 . C .  51 . N  .  51 . CA .  51 . C 1 1 
        70 . 1 1  54 GLY N 1 1  54 GLY CA 1 1  54 GLY C  1 1  55 PRO N       90.3       198.4 .  51 . N .  51 . CA .  51 . C  .  52 . N 1 1 
        71 . 1 1  55 PRO C 1 1  56 ALA N  1 1  56 ALA CA 1 1  56 ALA C     -144.9       -42.6 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        72 . 1 1  56 ALA N 1 1  56 ALA CA 1 1  56 ALA C  1 1  57 PRO N       57.1       188.7 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
        73 . 1 1  63 ASP C 1 1  64 GLU N  1 1  64 GLU CA 1 1  64 GLU C     -103.5       -36.0 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 1 
        74 . 1 1  64 GLU N 1 1  64 GLU CA 1 1  64 GLU C  1 1  65 ASP N -60.999996  -15.699999 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 1 
        75 . 1 1  64 GLU C 1 1  65 ASP N  1 1  65 ASP CA 1 1  65 ASP C     -104.8  -44.999996 .  61 . C .  62 . N  .  62 . CA .  62 . C 1 1 
        76 . 1 1  65 ASP N 1 1  65 ASP CA 1 1  65 ASP C  1 1  66 ILE N -54.299995        -9.6 .  62 . N .  62 . CA .  62 . C  .  63 . N 1 1 
        77 . 1 1  71 ARG C 1 1  72 ARG N  1 1  72 ARG CA 1 1  72 ARG C     -170.3       -68.3 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
        78 . 1 1  72 ARG N 1 1  72 ARG CA 1 1  72 ARG C  1 1  73 PHE N      102.8       179.7 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
        79 . 1 1  72 ARG C 1 1  73 PHE N  1 1  73 PHE CA 1 1  73 PHE C     -157.4  -102.59999 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
        80 . 1 1  73 PHE N 1 1  73 PHE CA 1 1  73 PHE C  1 1  74 GLU N      129.0       173.6 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
        81 . 1 1  73 PHE C 1 1  74 GLU N  1 1  74 GLU CA 1 1  74 GLU C     -147.9       -98.3 .  70 . C .  71 . N  .  71 . CA .  71 . C 1 1 
        82 . 1 1  74 GLU N 1 1  74 GLU CA 1 1  74 GLU C  1 1  75 THR N       98.0   167.39998 .  71 . N .  71 . CA .  71 . C  .  72 . N 1 1 
        83 . 1 1  74 GLU C 1 1  75 THR N  1 1  75 THR CA 1 1  75 THR C     -103.3       -50.1 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
        84 . 1 1  75 THR N 1 1  75 THR CA 1 1  75 THR C  1 1  76 ARG N      100.9   161.69998 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
        85 . 1 1  76 ARG C 1 1  77 LEU N  1 1  77 LEU CA 1 1  77 LEU C     -189.1      -105.4 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
        86 . 1 1  77 LEU N 1 1  77 LEU CA 1 1  77 LEU C  1 1  78 ALA N  127.19999   170.59999 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
        87 . 1 1  77 LEU C 1 1  78 ALA N  1 1  78 ALA CA 1 1  78 ALA C     -154.4       -88.4 .  74 . C .  75 . N  .  75 . CA .  75 . C 1 1 
        88 . 1 1  78 ALA N 1 1  78 ALA CA 1 1  78 ALA C  1 1  79 GLY N       94.5   161.69998 .  75 . N .  75 . CA .  75 . C  .  76 . N 1 1 
        89 . 1 1  79 GLY C 1 1  80 VAL N  1 1  80 VAL CA 1 1  80 VAL C     -152.6   -66.99999 .  76 . C .  77 . N  .  77 . CA .  77 . C 1 1 
        90 . 1 1  80 VAL N 1 1  80 VAL CA 1 1  80 VAL C  1 1  81 GLU N 122.799995       191.6 .  77 . N .  77 . CA .  77 . C  .  78 . N 1 1 
        91 . 1 1  80 VAL C 1 1  81 GLU N  1 1  81 GLU CA 1 1  81 GLU C     -128.5       -42.9 .  77 . C .  78 . N  .  78 . CA .  78 . C 1 1 
        92 . 1 1  81 GLU N 1 1  81 GLU CA 1 1  81 GLU C  1 1  82 GLY N      135.3       186.6 .  78 . N .  78 . CA .  78 . C  .  79 . N 1 1 
        93 . 1 1  82 GLY C 1 1  83 GLU N  1 1  83 GLU CA 1 1  83 GLU C      -78.9       -52.2 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
        94 . 1 1  83 GLU N 1 1  83 GLU CA 1 1  83 GLU C  1 1  84 GLU N      -64.9       -18.6 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 1 
        95 . 1 1  83 GLU C 1 1  84 GLU N  1 1  84 GLU CA 1 1  84 GLU C      -82.3       -58.1 .  80 . C .  81 . N  .  81 . CA .  81 . C 1 1 
        96 . 1 1  84 GLU N 1 1  84 GLU CA 1 1  84 GLU C  1 1  85 ILE N      -51.6       -24.3 .  81 . N .  81 . CA .  81 . C  .  82 . N 1 1 
        97 . 1 1  84 GLU C 1 1  85 ILE N  1 1  85 ILE CA 1 1  85 ILE C      -79.1       -55.8 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
        98 . 1 1  85 ILE N 1 1  85 ILE CA 1 1  85 ILE C  1 1  86 ALA N      -55.9  -31.399998 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 1 
        99 . 1 1  85 ILE C 1 1  86 ALA N  1 1  86 ALA CA 1 1  86 ALA C      -71.3       -48.5 .  82 . C .  83 . N  .  83 . CA .  83 . C 1 1 
       100 . 1 1  86 ALA N 1 1  86 ALA CA 1 1  86 ALA C  1 1  87 ALA N      -54.7       -20.7 .  83 . N .  83 . CA .  83 . C  .  84 . N 1 1 
       101 . 1 1  86 ALA C 1 1  87 ALA N  1 1  87 ALA CA 1 1  87 ALA C  -81.49999       -51.4 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 1 
       102 . 1 1  87 ALA N 1 1  87 ALA CA 1 1  87 ALA C  1 1  88 LEU N -53.199997       -22.2 .  84 . N .  84 . CA .  84 . C  .  85 . N 1 1 
       103 . 1 1  87 ALA C 1 1  88 LEU N  1 1  88 LEU CA 1 1  88 LEU C      -80.2  -52.099995 .  84 . C .  85 . N  .  85 . CA .  85 . C 1 1 
       104 . 1 1  88 LEU N 1 1  88 LEU CA 1 1  88 LEU C  1 1  89 LEU N      -59.8       -25.8 .  85 . N .  85 . CA .  85 . C  .  86 . N 1 1 
       105 . 1 1  88 LEU C 1 1  89 LEU N  1 1  89 LEU CA 1 1  89 LEU C      -67.9       -47.9 .  85 . C .  86 . N  .  86 . CA .  86 . C 1 1 
       106 . 1 1  89 LEU N 1 1  89 LEU CA 1 1  89 LEU C  1 1  90 GLU N      -52.7       -29.1 .  86 . N .  86 . CA .  86 . C  .  87 . N 1 1 
       107 . 1 1  89 LEU C 1 1  90 GLU N  1 1  90 GLU CA 1 1  90 GLU C      -76.3  -53.199997 .  86 . C .  87 . N  .  87 . CA .  87 . C 1 1 
       108 . 1 1  90 GLU N 1 1  90 GLU CA 1 1  90 GLU C  1 1  91 ARG N      -52.6       -27.7 .  87 . N .  87 . CA .  87 . C  .  88 . N 1 1 
       109 . 1 1  90 GLU C 1 1  91 ARG N  1 1  91 ARG CA 1 1  91 ARG C      -72.3       -50.8 .  87 . C .  88 . N  .  88 . CA .  88 . C 1 1 
       110 . 1 1  91 ARG N 1 1  91 ARG CA 1 1  91 ARG C  1 1  92 GLU N -59.499996       -26.3 .  88 . N .  88 . CA .  88 . C  .  89 . N 1 1 
       111 . 1 1  91 ARG C 1 1  92 GLU N  1 1  92 GLU CA 1 1  92 GLU C      -78.2       -47.6 .  88 . C .  89 . N  .  89 . CA .  89 . C 1 1 
       112 . 1 1  92 GLU N 1 1  92 GLU CA 1 1  92 GLU C  1 1  93 ARG N      -54.6       -26.1 .  89 . N .  89 . CA .  89 . C  .  90 . N 1 1 
       113 . 1 1  92 GLU C 1 1  93 ARG N  1 1  93 ARG CA 1 1  93 ARG C      -74.4       -53.4 .  89 . C .  90 . N  .  90 . CA .  90 . C 1 1 
       114 . 1 1  93 ARG N 1 1  93 ARG CA 1 1  93 ARG C  1 1  94 ARG N      -51.1  -31.099998 .  90 . N .  90 . CA .  90 . C  .  91 . N 1 1 
       115 . 1 1  93 ARG C 1 1  94 ARG N  1 1  94 ARG CA 1 1  94 ARG C      -80.2       -52.7 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 1 
       116 . 1 1  94 ARG N 1 1  94 ARG CA 1 1  94 ARG C  1 1  95 PHE N      -48.9       -20.3 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 1 
       117 . 1 1  94 ARG C 1 1  95 PHE N  1 1  95 PHE CA 1 1  95 PHE C     -113.8       -54.9 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 1 
       118 . 1 1  95 PHE N 1 1  95 PHE CA 1 1  95 PHE C  1 1  96 ASP N      -67.6         9.8 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 1 
       119 . 1 1  96 ASP C 1 1  97 SER N  1 1  97 SER CA 1 1  97 SER C      -77.2       -47.4 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
       120 . 1 1  97 SER N 1 1  97 SER CA 1 1  97 SER C  1 1  98 ASP N      -63.8  -3.8000002 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
       121 . 1 1  99 LEU C 1 1 100 TRP N  1 1 100 TRP CA 1 1 100 TRP C     -174.8       -49.0 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
       122 . 1 1 100 TRP N 1 1 100 TRP CA 1 1 100 TRP C  1 1 101 VAL N      129.1       179.4 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
       123 . 1 1 100 TRP C 1 1 101 VAL N  1 1 101 VAL CA 1 1 101 VAL C     -156.3       -68.6 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
       124 . 1 1 101 VAL N 1 1 101 VAL CA 1 1 101 VAL C  1 1 102 VAL N      117.2       144.2 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
       125 . 1 1 101 VAL C 1 1 102 VAL N  1 1 102 VAL CA 1 1 102 VAL C     -150.9       -88.2 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
       126 . 1 1 102 VAL N 1 1 102 VAL CA 1 1 102 VAL C  1 1 103 GLU N      115.1       147.8 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
       127 . 1 1 102 VAL C 1 1 103 GLU N  1 1 103 GLU CA 1 1 103 GLU C     -149.8       -88.3 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
       128 . 1 1 103 GLU N 1 1 103 GLU CA 1 1 103 GLU C  1 1 104 ILE N      109.1       172.3 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
       129 . 1 1 103 GLU C 1 1 104 ILE N  1 1 104 ILE CA 1 1 104 ILE C -158.59999      -105.2 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
       130 . 1 1 104 ILE N 1 1 104 ILE CA 1 1 104 ILE C  1 1 105 GLU N      124.6       163.5 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
       131 . 1 1 104 ILE C 1 1 105 GLU N  1 1 105 GLU CA 1 1 105 GLU C     -154.0       -75.2 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
       132 . 1 1 105 GLU N 1 1 105 GLU CA 1 1 105 GLU C  1 1 106 THR N  102.59999       153.9 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
       133 . 1 1 105 GLU C 1 1 106 THR N  1 1 106 THR CA 1 1 106 THR C     -173.3       -50.4 . 102 . C . 103 . N  . 103 . CA . 103 . C 1 1 
       134 . 1 1 106 THR N 1 1 106 THR CA 1 1 106 THR C  1 1 107 ASP N       79.2       162.9 . 103 . N . 103 . CA . 103 . C  . 104 . N 1 1 
       135 . 1 1 113 LEU C 1 1 114 THR N  1 1 114 THR CA 1 1 114 THR C     -120.0       -53.8 . 110 . C . 111 . N  . 111 . CA . 111 . C 1 1 
       136 . 1 1 114 THR N 1 1 114 THR CA 1 1 114 THR C  1 1 115 LEU N       91.5       146.8 . 111 . N . 111 . CA . 111 . C  . 112 . N 1 1 
       137 . 1 1 117 ASP C 1 1 118 GLN N  1 1 118 GLN CA 1 1 118 GLN C      -95.8       -55.4 . 114 . C . 115 . N  . 115 . CA . 115 . C 1 1 
       138 . 1 1 118 GLN N 1 1 118 GLN CA 1 1 118 GLN C  1 1 119 PRO N  121.99999       165.7 . 115 . N . 115 . CA . 115 . C  . 116 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   4 MET C    C   1.606  -0.659  -1.260 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   4 MET CA   C   1.679   0.779  -0.717 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   4 MET CB   C   3.006   1.010   0.056 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   4 MET CE   C   6.033   0.935  -2.855 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   4 MET CG   C   4.286   0.663  -0.721 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   4 MET H    H   0.521   0.387   0.963 1.00 . A A .   1 MET H    1 1 
        1     7 1 1   4 MET HA   H   1.628   1.473  -1.549 1.00 . A A .   1 MET HA   1 1 
        1     8 1 1   4 MET HB2  H   3.062   2.055   0.339 1.00 . A A .   1 MET HB2  1 1 
        1     9 1 1   4 MET HB3  H   2.991   0.413   0.963 1.00 . A A .   1 MET HB3  1 1 
        1    10 1 1   4 MET HE1  H   6.008  -0.140  -2.970 1.00 . A A .   1 MET HE1  1 1 
        1    11 1 1   4 MET HE2  H   6.785   1.202  -2.127 1.00 . A A .   1 MET HE2  1 1 
        1    12 1 1   4 MET HE3  H   6.276   1.391  -3.803 1.00 . A A .   1 MET HE3  1 1 
        1    13 1 1   4 MET HG2  H   5.143   0.925  -0.115 1.00 . A A .   1 MET HG2  1 1 
        1    14 1 1   4 MET HG3  H   4.298  -0.406  -0.905 1.00 . A A .   1 MET HG3  1 1 
        1    15 1 1   4 MET N    N   0.525   1.057   0.169 1.00 . A A .   1 MET N    1 1 
        1    16 1 1   4 MET O    O   1.231  -1.587  -0.536 1.00 . A A .   1 MET O    1 1 
        1    17 1 1   4 MET SD   S   4.426   1.518  -2.304 1.00 . A A .   1 MET SD   1 1 
        1    18 1 1   5 ARG C    C   3.512  -2.660  -2.859 1.00 . A A .   2 ARG C    1 1 
        1    19 1 1   5 ARG CA   C   2.108  -2.121  -3.206 1.00 . A A .   2 ARG CA   1 1 
        1    20 1 1   5 ARG CB   C   1.939  -1.968  -4.743 1.00 . A A .   2 ARG CB   1 1 
        1    21 1 1   5 ARG CD   C   0.606  -0.975  -6.699 1.00 . A A .   2 ARG CD   1 1 
        1    22 1 1   5 ARG CG   C   0.689  -1.164  -5.177 1.00 . A A .   2 ARG CG   1 1 
        1    23 1 1   5 ARG CZ   C   2.025  -0.010  -8.512 1.00 . A A .   2 ARG CZ   1 1 
        1    24 1 1   5 ARG H    H   2.064  -0.013  -3.099 1.00 . A A .   2 ARG H    1 1 
        1    25 1 1   5 ARG HA   H   1.350  -2.803  -2.825 1.00 . A A .   2 ARG HA   1 1 
        1    26 1 1   5 ARG HB2  H   2.815  -1.464  -5.144 1.00 . A A .   2 ARG HB2  1 1 
        1    27 1 1   5 ARG HB3  H   1.880  -2.959  -5.184 1.00 . A A .   2 ARG HB3  1 1 
        1    28 1 1   5 ARG HD2  H   0.565  -1.955  -7.175 1.00 . A A .   2 ARG HD2  1 1 
        1    29 1 1   5 ARG HD3  H  -0.300  -0.428  -6.937 1.00 . A A .   2 ARG HD3  1 1 
        1    30 1 1   5 ARG HE   H   2.385   0.128  -6.556 1.00 . A A .   2 ARG HE   1 1 
        1    31 1 1   5 ARG HG2  H  -0.199  -1.688  -4.843 1.00 . A A .   2 ARG HG2  1 1 
        1    32 1 1   5 ARG HG3  H   0.720  -0.188  -4.706 1.00 . A A .   2 ARG HG3  1 1 
        1    33 1 1   5 ARG HH11 H   0.453  -1.071  -9.224 1.00 . A A .   2 ARG HH11 1 1 
        1    34 1 1   5 ARG HH12 H   1.437  -0.313 -10.427 1.00 . A A .   2 ARG HH12 1 1 
        1    35 1 1   5 ARG HH21 H   3.700   1.048  -8.131 1.00 . A A .   2 ARG HH21 1 1 
        1    36 1 1   5 ARG HH22 H   3.297   0.876  -9.810 1.00 . A A .   2 ARG HH22 1 1 
        1    37 1 1   5 ARG N    N   1.938  -0.815  -2.555 1.00 . A A .   2 ARG N    1 1 
        1    38 1 1   5 ARG NE   N   1.764  -0.234  -7.221 1.00 . A A .   2 ARG NE   1 1 
        1    39 1 1   5 ARG NH1  N   1.246  -0.508  -9.465 1.00 . A A .   2 ARG NH1  1 1 
        1    40 1 1   5 ARG NH2  N   3.093   0.690  -8.844 1.00 . A A .   2 ARG NH2  1 1 
        1    41 1 1   5 ARG O    O   4.519  -2.165  -3.381 1.00 . A A .   2 ARG O    1 1 
        1    42 1 1   6 LEU C    C   4.651  -5.744  -1.216 1.00 . A A .   3 LEU C    1 1 
        1    43 1 1   6 LEU CA   C   4.835  -4.235  -1.459 1.00 . A A .   3 LEU CA   1 1 
        1    44 1 1   6 LEU CB   C   5.379  -3.487  -0.181 1.00 . A A .   3 LEU CB   1 1 
        1    45 1 1   6 LEU CD1  C   3.363  -3.935   1.358 1.00 . A A .   3 LEU CD1  1 1 
        1    46 1 1   6 LEU CD2  C   4.995  -2.091   1.959 1.00 . A A .   3 LEU CD2  1 1 
        1    47 1 1   6 LEU CG   C   4.319  -2.875   0.806 1.00 . A A .   3 LEU CG   1 1 
        1    48 1 1   6 LEU H    H   2.733  -3.947  -1.535 1.00 . A A .   3 LEU H    1 1 
        1    49 1 1   6 LEU HA   H   5.568  -4.132  -2.257 1.00 . A A .   3 LEU HA   1 1 
        1    50 1 1   6 LEU HB2  H   6.001  -4.178   0.382 1.00 . A A .   3 LEU HB2  1 1 
        1    51 1 1   6 LEU HB3  H   6.017  -2.680  -0.523 1.00 . A A .   3 LEU HB3  1 1 
        1    52 1 1   6 LEU HD11 H   2.656  -3.470   2.032 1.00 . A A .   3 LEU HD11 1 1 
        1    53 1 1   6 LEU HD12 H   3.920  -4.694   1.892 1.00 . A A .   3 LEU HD12 1 1 
        1    54 1 1   6 LEU HD13 H   2.822  -4.396   0.542 1.00 . A A .   3 LEU HD13 1 1 
        1    55 1 1   6 LEU HD21 H   5.628  -1.315   1.548 1.00 . A A .   3 LEU HD21 1 1 
        1    56 1 1   6 LEU HD22 H   5.596  -2.759   2.563 1.00 . A A .   3 LEU HD22 1 1 
        1    57 1 1   6 LEU HD23 H   4.235  -1.634   2.582 1.00 . A A .   3 LEU HD23 1 1 
        1    58 1 1   6 LEU HG   H   3.710  -2.169   0.253 1.00 . A A .   3 LEU HG   1 1 
        1    59 1 1   6 LEU N    N   3.572  -3.624  -1.930 1.00 . A A .   3 LEU N    1 1 
        1    60 1 1   6 LEU O    O   3.545  -6.283  -1.379 1.00 . A A .   3 LEU O    1 1 
        1    61 1 1   7 LYS C    C   5.164  -8.207   0.809 1.00 . A A .   4 LYS C    1 1 
        1    62 1 1   7 LYS CA   C   5.749  -7.873  -0.589 1.00 . A A .   4 LYS CA   1 1 
        1    63 1 1   7 LYS CB   C   7.190  -8.449  -0.762 1.00 . A A .   4 LYS CB   1 1 
        1    64 1 1   7 LYS CD   C   9.534  -8.906   0.221 1.00 . A A .   4 LYS CD   1 1 
        1    65 1 1   7 LYS CE   C  10.284  -8.237  -0.938 1.00 . A A .   4 LYS CE   1 1 
        1    66 1 1   7 LYS CG   C   8.127  -8.303   0.451 1.00 . A A .   4 LYS CG   1 1 
        1    67 1 1   7 LYS H    H   6.582  -5.924  -0.707 1.00 . A A .   4 LYS H    1 1 
        1    68 1 1   7 LYS HA   H   5.107  -8.324  -1.341 1.00 . A A .   4 LYS HA   1 1 
        1    69 1 1   7 LYS HB2  H   7.108  -9.500  -0.983 1.00 . A A .   4 LYS HB2  1 1 
        1    70 1 1   7 LYS HB3  H   7.661  -7.959  -1.611 1.00 . A A .   4 LYS HB3  1 1 
        1    71 1 1   7 LYS HD2  H  10.116  -8.789   1.129 1.00 . A A .   4 LYS HD2  1 1 
        1    72 1 1   7 LYS HD3  H   9.427  -9.969   0.006 1.00 . A A .   4 LYS HD3  1 1 
        1    73 1 1   7 LYS HE2  H   9.757  -8.434  -1.863 1.00 . A A .   4 LYS HE2  1 1 
        1    74 1 1   7 LYS HE3  H  10.324  -7.168  -0.770 1.00 . A A .   4 LYS HE3  1 1 
        1    75 1 1   7 LYS HG2  H   8.226  -7.256   0.696 1.00 . A A .   4 LYS HG2  1 1 
        1    76 1 1   7 LYS HG3  H   7.668  -8.821   1.294 1.00 . A A .   4 LYS HG3  1 1 
        1    77 1 1   7 LYS HZ1  H  11.660  -9.759  -1.293 1.00 . A A .   4 LYS HZ1  1 1 
        1    78 1 1   7 LYS HZ2  H  12.196  -8.592  -0.199 1.00 . A A .   4 LYS HZ2  1 1 
        1    79 1 1   7 LYS HZ3  H  12.157  -8.245  -1.851 1.00 . A A .   4 LYS HZ3  1 1 
        1    80 1 1   7 LYS N    N   5.750  -6.419  -0.828 1.00 . A A .   4 LYS N    1 1 
        1    81 1 1   7 LYS NZ   N  11.668  -8.744  -1.080 1.00 . A A .   4 LYS NZ   1 1 
        1    82 1 1   7 LYS O    O   4.966  -7.311   1.637 1.00 . A A .   4 LYS O    1 1 
        1    83 1 1   8 SER C    C   5.214  -9.681   3.541 1.00 . A A .   5 SER C    1 1 
        1    84 1 1   8 SER CA   C   4.339 -10.032   2.308 1.00 . A A .   5 SER CA   1 1 
        1    85 1 1   8 SER CB   C   4.195 -11.565   2.174 1.00 . A A .   5 SER CB   1 1 
        1    86 1 1   8 SER H    H   5.141 -10.155   0.351 1.00 . A A .   5 SER H    1 1 
        1    87 1 1   8 SER HA   H   3.354  -9.598   2.436 1.00 . A A .   5 SER HA   1 1 
        1    88 1 1   8 SER HB2  H   5.174 -12.024   2.151 1.00 . A A .   5 SER HB2  1 1 
        1    89 1 1   8 SER HB3  H   3.635 -11.956   3.010 1.00 . A A .   5 SER HB3  1 1 
        1    90 1 1   8 SER HG   H   2.603 -12.095   1.178 1.00 . A A .   5 SER HG   1 1 
        1    91 1 1   8 SER N    N   4.918  -9.506   1.050 1.00 . A A .   5 SER N    1 1 
        1    92 1 1   8 SER O    O   4.705  -9.208   4.563 1.00 . A A .   5 SER O    1 1 
        1    93 1 1   8 SER OG   O   3.522 -11.904   0.978 1.00 . A A .   5 SER OG   1 1 
        1    94 1 1   9 GLU C    C   7.634  -8.115   4.758 1.00 . A A .   6 GLU C    1 1 
        1    95 1 1   9 GLU CA   C   7.536  -9.617   4.456 1.00 . A A .   6 GLU CA   1 1 
        1    96 1 1   9 GLU CB   C   8.928 -10.165   4.027 1.00 . A A .   6 GLU CB   1 1 
        1    97 1 1   9 GLU CD   C  11.353 -10.694   4.746 1.00 . A A .   6 GLU CD   1 1 
        1    98 1 1   9 GLU CG   C  10.079  -9.879   5.023 1.00 . A A .   6 GLU CG   1 1 
        1    99 1 1   9 GLU H    H   6.850 -10.270   2.558 1.00 . A A .   6 GLU H    1 1 
        1   100 1 1   9 GLU HA   H   7.215 -10.132   5.361 1.00 . A A .   6 GLU HA   1 1 
        1   101 1 1   9 GLU HB2  H   8.847 -11.239   3.906 1.00 . A A .   6 GLU HB2  1 1 
        1   102 1 1   9 GLU HB3  H   9.194  -9.730   3.069 1.00 . A A .   6 GLU HB3  1 1 
        1   103 1 1   9 GLU HG2  H  10.322  -8.823   4.979 1.00 . A A .   6 GLU HG2  1 1 
        1   104 1 1   9 GLU HG3  H   9.732 -10.104   6.029 1.00 . A A .   6 GLU HG3  1 1 
        1   105 1 1   9 GLU N    N   6.535  -9.899   3.402 1.00 . A A .   6 GLU N    1 1 
        1   106 1 1   9 GLU O    O   7.845  -7.703   5.908 1.00 . A A .   6 GLU O    1 1 
        1   107 1 1   9 GLU OE1  O  12.219 -10.230   3.982 1.00 . A A .   6 GLU OE1  1 1 
        1   108 1 1   9 GLU OE2  O  11.498 -11.795   5.312 1.00 . A A .   6 GLU OE2  1 1 
        1   109 1 1  10 MET C    C   6.279  -5.275   4.437 1.00 . A A .   7 MET C    1 1 
        1   110 1 1  10 MET CA   C   7.580  -5.849   3.838 1.00 . A A .   7 MET CA   1 1 
        1   111 1 1  10 MET CB   C   7.916  -5.196   2.474 1.00 . A A .   7 MET CB   1 1 
        1   112 1 1  10 MET CE   C   9.198  -1.877   4.499 1.00 . A A .   7 MET CE   1 1 
        1   113 1 1  10 MET CG   C   8.269  -3.714   2.592 1.00 . A A .   7 MET CG   1 1 
        1   114 1 1  10 MET H    H   7.299  -7.690   2.840 1.00 . A A .   7 MET H    1 1 
        1   115 1 1  10 MET HA   H   8.397  -5.633   4.530 1.00 . A A .   7 MET HA   1 1 
        1   116 1 1  10 MET HB2  H   8.765  -5.711   2.036 1.00 . A A .   7 MET HB2  1 1 
        1   117 1 1  10 MET HB3  H   7.064  -5.298   1.806 1.00 . A A .   7 MET HB3  1 1 
        1   118 1 1  10 MET HE1  H   8.241  -1.973   4.995 1.00 . A A .   7 MET HE1  1 1 
        1   119 1 1  10 MET HE2  H   9.136  -1.111   3.739 1.00 . A A .   7 MET HE2  1 1 
        1   120 1 1  10 MET HE3  H   9.950  -1.605   5.223 1.00 . A A .   7 MET HE3  1 1 
        1   121 1 1  10 MET HG2  H   8.552  -3.341   1.616 1.00 . A A .   7 MET HG2  1 1 
        1   122 1 1  10 MET HG3  H   7.398  -3.174   2.944 1.00 . A A .   7 MET HG3  1 1 
        1   123 1 1  10 MET N    N   7.490  -7.302   3.712 1.00 . A A .   7 MET N    1 1 
        1   124 1 1  10 MET O    O   6.305  -4.228   5.096 1.00 . A A .   7 MET O    1 1 
        1   125 1 1  10 MET SD   S   9.642  -3.442   3.742 1.00 . A A .   7 MET SD   1 1 
        1   126 1 1  11 PHE C    C   3.774  -5.745   6.245 1.00 . A A .   8 PHE C    1 1 
        1   127 1 1  11 PHE CA   C   3.837  -5.553   4.728 1.00 . A A .   8 PHE CA   1 1 
        1   128 1 1  11 PHE CB   C   2.663  -6.312   4.030 1.00 . A A .   8 PHE CB   1 1 
        1   129 1 1  11 PHE CD1  C   0.573  -6.095   5.503 1.00 . A A .   8 PHE CD1  1 1 
        1   130 1 1  11 PHE CD2  C   0.688  -4.771   3.517 1.00 . A A .   8 PHE CD2  1 1 
        1   131 1 1  11 PHE CE1  C  -0.654  -5.531   5.798 1.00 . A A .   8 PHE CE1  1 1 
        1   132 1 1  11 PHE CE2  C  -0.537  -4.207   3.819 1.00 . A A .   8 PHE CE2  1 1 
        1   133 1 1  11 PHE CG   C   1.274  -5.726   4.351 1.00 . A A .   8 PHE CG   1 1 
        1   134 1 1  11 PHE CZ   C  -1.207  -4.586   4.958 1.00 . A A .   8 PHE CZ   1 1 
        1   135 1 1  11 PHE H    H   5.212  -6.846   3.768 1.00 . A A .   8 PHE H    1 1 
        1   136 1 1  11 PHE HA   H   3.742  -4.490   4.503 1.00 . A A .   8 PHE HA   1 1 
        1   137 1 1  11 PHE HB2  H   2.804  -6.265   2.953 1.00 . A A .   8 PHE HB2  1 1 
        1   138 1 1  11 PHE HB3  H   2.673  -7.350   4.332 1.00 . A A .   8 PHE HB3  1 1 
        1   139 1 1  11 PHE HD1  H   0.997  -6.837   6.170 1.00 . A A .   8 PHE HD1  1 1 
        1   140 1 1  11 PHE HD2  H   1.201  -4.467   2.617 1.00 . A A .   8 PHE HD2  1 1 
        1   141 1 1  11 PHE HE1  H  -1.186  -5.829   6.696 1.00 . A A .   8 PHE HE1  1 1 
        1   142 1 1  11 PHE HE2  H  -0.972  -3.468   3.158 1.00 . A A .   8 PHE HE2  1 1 
        1   143 1 1  11 PHE HZ   H  -2.167  -4.145   5.199 1.00 . A A .   8 PHE HZ   1 1 
        1   144 1 1  11 PHE N    N   5.150  -5.991   4.233 1.00 . A A .   8 PHE N    1 1 
        1   145 1 1  11 PHE O    O   3.334  -4.846   6.957 1.00 . A A .   8 PHE O    1 1 
        1   146 1 1  12 VAL C    C   4.997  -6.300   9.009 1.00 . A A .   9 VAL C    1 1 
        1   147 1 1  12 VAL CA   C   4.167  -7.278   8.160 1.00 . A A .   9 VAL CA   1 1 
        1   148 1 1  12 VAL CB   C   4.609  -8.765   8.447 1.00 . A A .   9 VAL CB   1 1 
        1   149 1 1  12 VAL CG1  C   3.667  -9.755   7.744 1.00 . A A .   9 VAL CG1  1 1 
        1   150 1 1  12 VAL CG2  C   6.078  -9.038   8.062 1.00 . A A .   9 VAL CG2  1 1 
        1   151 1 1  12 VAL H    H   4.606  -7.579   6.095 1.00 . A A .   9 VAL H    1 1 
        1   152 1 1  12 VAL HA   H   3.124  -7.181   8.464 1.00 . A A .   9 VAL HA   1 1 
        1   153 1 1  12 VAL HB   H   4.514  -8.935   9.512 1.00 . A A .   9 VAL HB   1 1 
        1   154 1 1  12 VAL HG11 H   3.705  -9.597   6.671 1.00 . A A .   9 VAL HG11 1 1 
        1   155 1 1  12 VAL HG12 H   2.651  -9.604   8.086 1.00 . A A .   9 VAL HG12 1 1 
        1   156 1 1  12 VAL HG13 H   3.965 -10.774   7.963 1.00 . A A .   9 VAL HG13 1 1 
        1   157 1 1  12 VAL HG21 H   6.343 -10.057   8.313 1.00 . A A .   9 VAL HG21 1 1 
        1   158 1 1  12 VAL HG22 H   6.728  -8.362   8.602 1.00 . A A .   9 VAL HG22 1 1 
        1   159 1 1  12 VAL HG23 H   6.212  -8.886   6.998 1.00 . A A .   9 VAL HG23 1 1 
        1   160 1 1  12 VAL N    N   4.226  -6.928   6.725 1.00 . A A .   9 VAL N    1 1 
        1   161 1 1  12 VAL O    O   4.526  -5.824  10.041 1.00 . A A .   9 VAL O    1 1 
        1   162 1 1  13 SER C    C   6.523  -3.626   9.241 1.00 . A A .  10 SER C    1 1 
        1   163 1 1  13 SER CA   C   7.126  -5.044   9.199 1.00 . A A .  10 SER CA   1 1 
        1   164 1 1  13 SER CB   C   8.497  -5.051   8.485 1.00 . A A .  10 SER CB   1 1 
        1   165 1 1  13 SER H    H   6.492  -6.374   7.671 1.00 . A A .  10 SER H    1 1 
        1   166 1 1  13 SER HA   H   7.260  -5.397  10.218 1.00 . A A .  10 SER HA   1 1 
        1   167 1 1  13 SER HB2  H   9.153  -4.320   8.941 1.00 . A A .  10 SER HB2  1 1 
        1   168 1 1  13 SER HB3  H   8.945  -6.034   8.574 1.00 . A A .  10 SER HB3  1 1 
        1   169 1 1  13 SER HG   H   8.248  -3.789   6.998 1.00 . A A .  10 SER HG   1 1 
        1   170 1 1  13 SER N    N   6.209  -5.971   8.523 1.00 . A A .  10 SER N    1 1 
        1   171 1 1  13 SER O    O   6.532  -2.973  10.287 1.00 . A A .  10 SER O    1 1 
        1   172 1 1  13 SER OG   O   8.365  -4.741   7.104 1.00 . A A .  10 SER OG   1 1 
        1   173 1 1  14 ALA C    C   4.055  -1.740   8.837 1.00 . A A .  11 ALA C    1 1 
        1   174 1 1  14 ALA CA   C   5.325  -1.860   7.961 1.00 . A A .  11 ALA CA   1 1 
        1   175 1 1  14 ALA CB   C   4.993  -1.582   6.486 1.00 . A A .  11 ALA CB   1 1 
        1   176 1 1  14 ALA H    H   5.967  -3.788   7.320 1.00 . A A .  11 ALA H    1 1 
        1   177 1 1  14 ALA HA   H   6.047  -1.115   8.288 1.00 . A A .  11 ALA HA   1 1 
        1   178 1 1  14 ALA HB1  H   4.265  -2.303   6.132 1.00 . A A .  11 ALA HB1  1 1 
        1   179 1 1  14 ALA HB2  H   5.891  -1.664   5.889 1.00 . A A .  11 ALA HB2  1 1 
        1   180 1 1  14 ALA HB3  H   4.589  -0.581   6.382 1.00 . A A .  11 ALA HB3  1 1 
        1   181 1 1  14 ALA N    N   5.959  -3.191   8.099 1.00 . A A .  11 ALA N    1 1 
        1   182 1 1  14 ALA O    O   3.778  -0.670   9.393 1.00 . A A .  11 ALA O    1 1 
        1   183 1 1  15 LEU C    C   2.360  -2.660  11.238 1.00 . A A .  12 LEU C    1 1 
        1   184 1 1  15 LEU CA   C   2.066  -2.960   9.761 1.00 . A A .  12 LEU CA   1 1 
        1   185 1 1  15 LEU CB   C   1.446  -4.383   9.582 1.00 . A A .  12 LEU CB   1 1 
        1   186 1 1  15 LEU CD1  C  -0.552  -5.970   9.391 1.00 . A A .  12 LEU CD1  1 1 
        1   187 1 1  15 LEU CD2  C  -0.568  -4.249  11.244 1.00 . A A .  12 LEU CD2  1 1 
        1   188 1 1  15 LEU CG   C  -0.103  -4.555   9.799 1.00 . A A .  12 LEU CG   1 1 
        1   189 1 1  15 LEU H    H   3.643  -3.673   8.529 1.00 . A A .  12 LEU H    1 1 
        1   190 1 1  15 LEU HA   H   1.382  -2.223   9.382 1.00 . A A .  12 LEU HA   1 1 
        1   191 1 1  15 LEU HB2  H   1.664  -4.705   8.569 1.00 . A A .  12 LEU HB2  1 1 
        1   192 1 1  15 LEU HB3  H   1.958  -5.062  10.257 1.00 . A A .  12 LEU HB3  1 1 
        1   193 1 1  15 LEU HD11 H  -0.273  -6.155   8.362 1.00 . A A .  12 LEU HD11 1 1 
        1   194 1 1  15 LEU HD12 H  -1.627  -6.052   9.481 1.00 . A A .  12 LEU HD12 1 1 
        1   195 1 1  15 LEU HD13 H  -0.080  -6.710  10.028 1.00 . A A .  12 LEU HD13 1 1 
        1   196 1 1  15 LEU HD21 H  -1.640  -4.365  11.315 1.00 . A A .  12 LEU HD21 1 1 
        1   197 1 1  15 LEU HD22 H  -0.309  -3.228  11.496 1.00 . A A .  12 LEU HD22 1 1 
        1   198 1 1  15 LEU HD23 H  -0.081  -4.921  11.940 1.00 . A A .  12 LEU HD23 1 1 
        1   199 1 1  15 LEU HG   H  -0.614  -3.863   9.141 1.00 . A A .  12 LEU HG   1 1 
        1   200 1 1  15 LEU N    N   3.322  -2.866   8.973 1.00 . A A .  12 LEU N    1 1 
        1   201 1 1  15 LEU O    O   1.603  -1.959  11.920 1.00 . A A .  12 LEU O    1 1 
        1   202 1 1  16 ILE C    C   4.244  -1.520  13.357 1.00 . A A .  13 ILE C    1 1 
        1   203 1 1  16 ILE CA   C   3.988  -3.017  13.059 1.00 . A A .  13 ILE CA   1 1 
        1   204 1 1  16 ILE CB   C   5.277  -3.899  13.244 1.00 . A A .  13 ILE CB   1 1 
        1   205 1 1  16 ILE CD1  C   6.034  -6.376  12.988 1.00 . A A .  13 ILE CD1  1 1 
        1   206 1 1  16 ILE CG1  C   4.886  -5.412  13.105 1.00 . A A .  13 ILE CG1  1 1 
        1   207 1 1  16 ILE CG2  C   6.007  -3.620  14.575 1.00 . A A .  13 ILE CG2  1 1 
        1   208 1 1  16 ILE H    H   4.011  -3.761  11.080 1.00 . A A .  13 ILE H    1 1 
        1   209 1 1  16 ILE HA   H   3.222  -3.384  13.742 1.00 . A A .  13 ILE HA   1 1 
        1   210 1 1  16 ILE HB   H   5.963  -3.647  12.441 1.00 . A A .  13 ILE HB   1 1 
        1   211 1 1  16 ILE HD11 H   6.664  -6.308  13.861 1.00 . A A .  13 ILE HD11 1 1 
        1   212 1 1  16 ILE HD12 H   6.606  -6.145  12.101 1.00 . A A .  13 ILE HD12 1 1 
        1   213 1 1  16 ILE HD13 H   5.636  -7.380  12.906 1.00 . A A .  13 ILE HD13 1 1 
        1   214 1 1  16 ILE HG12 H   4.312  -5.715  13.966 1.00 . A A .  13 ILE HG12 1 1 
        1   215 1 1  16 ILE HG13 H   4.270  -5.542  12.221 1.00 . A A .  13 ILE HG13 1 1 
        1   216 1 1  16 ILE HG21 H   6.883  -4.250  14.651 1.00 . A A .  13 ILE HG21 1 1 
        1   217 1 1  16 ILE HG22 H   5.348  -3.825  15.410 1.00 . A A .  13 ILE HG22 1 1 
        1   218 1 1  16 ILE HG23 H   6.315  -2.580  14.615 1.00 . A A .  13 ILE HG23 1 1 
        1   219 1 1  16 ILE N    N   3.487  -3.200  11.695 1.00 . A A .  13 ILE N    1 1 
        1   220 1 1  16 ILE O    O   3.875  -1.022  14.416 1.00 . A A .  13 ILE O    1 1 
        1   221 1 1  17 ARG C    C   3.724   1.457  12.511 1.00 . A A .  14 ARG C    1 1 
        1   222 1 1  17 ARG CA   C   5.052   0.667  12.507 1.00 . A A .  14 ARG CA   1 1 
        1   223 1 1  17 ARG CB   C   6.007   1.190  11.388 1.00 . A A .  14 ARG CB   1 1 
        1   224 1 1  17 ARG CD   C   7.860  -0.577  11.671 1.00 . A A .  14 ARG CD   1 1 
        1   225 1 1  17 ARG CG   C   7.515   0.914  11.632 1.00 . A A .  14 ARG CG   1 1 
        1   226 1 1  17 ARG CZ   C   9.826  -2.060  12.070 1.00 . A A .  14 ARG CZ   1 1 
        1   227 1 1  17 ARG H    H   5.048  -1.241  11.541 1.00 . A A .  14 ARG H    1 1 
        1   228 1 1  17 ARG HA   H   5.531   0.827  13.470 1.00 . A A .  14 ARG HA   1 1 
        1   229 1 1  17 ARG HB2  H   5.725   0.728  10.450 1.00 . A A .  14 ARG HB2  1 1 
        1   230 1 1  17 ARG HB3  H   5.883   2.265  11.288 1.00 . A A .  14 ARG HB3  1 1 
        1   231 1 1  17 ARG HD2  H   7.224  -1.066  12.401 1.00 . A A .  14 ARG HD2  1 1 
        1   232 1 1  17 ARG HD3  H   7.660  -1.001  10.691 1.00 . A A .  14 ARG HD3  1 1 
        1   233 1 1  17 ARG HE   H   9.817  -0.061  12.251 1.00 . A A .  14 ARG HE   1 1 
        1   234 1 1  17 ARG HG2  H   8.088   1.379  10.838 1.00 . A A .  14 ARG HG2  1 1 
        1   235 1 1  17 ARG HG3  H   7.802   1.364  12.578 1.00 . A A .  14 ARG HG3  1 1 
        1   236 1 1  17 ARG HH11 H   8.177  -3.064  11.447 1.00 . A A .  14 ARG HH11 1 1 
        1   237 1 1  17 ARG HH12 H   9.558  -4.049  11.782 1.00 . A A .  14 ARG HH12 1 1 
        1   238 1 1  17 ARG HH21 H  11.622  -1.369  12.674 1.00 . A A .  14 ARG HH21 1 1 
        1   239 1 1  17 ARG HH22 H  11.522  -3.087  12.481 1.00 . A A .  14 ARG HH22 1 1 
        1   240 1 1  17 ARG N    N   4.805  -0.793  12.377 1.00 . A A .  14 ARG N    1 1 
        1   241 1 1  17 ARG NE   N   9.266  -0.840  12.022 1.00 . A A .  14 ARG NE   1 1 
        1   242 1 1  17 ARG NH1  N   9.132  -3.147  11.738 1.00 . A A .  14 ARG NH1  1 1 
        1   243 1 1  17 ARG NH2  N  11.090  -2.182  12.436 1.00 . A A .  14 ARG NH2  1 1 
        1   244 1 1  17 ARG O    O   3.651   2.541  13.104 1.00 . A A .  14 ARG O    1 1 
        1   245 1 1  18 ARG C    C   0.682   1.481  13.219 1.00 . A A .  15 ARG C    1 1 
        1   246 1 1  18 ARG CA   C   1.341   1.523  11.826 1.00 . A A .  15 ARG CA   1 1 
        1   247 1 1  18 ARG CB   C   0.397   0.827  10.806 1.00 . A A .  15 ARG CB   1 1 
        1   248 1 1  18 ARG CD   C  -0.187   0.244   8.374 1.00 . A A .  15 ARG CD   1 1 
        1   249 1 1  18 ARG CG   C   0.891   0.773   9.350 1.00 . A A .  15 ARG CG   1 1 
        1   250 1 1  18 ARG CZ   C  -1.991   1.422   7.083 1.00 . A A .  15 ARG CZ   1 1 
        1   251 1 1  18 ARG H    H   2.816   0.047  11.396 1.00 . A A .  15 ARG H    1 1 
        1   252 1 1  18 ARG HA   H   1.468   2.563  11.528 1.00 . A A .  15 ARG HA   1 1 
        1   253 1 1  18 ARG HB2  H   0.228  -0.194  11.133 1.00 . A A .  15 ARG HB2  1 1 
        1   254 1 1  18 ARG HB3  H  -0.559   1.350  10.815 1.00 . A A .  15 ARG HB3  1 1 
        1   255 1 1  18 ARG HD2  H   0.271   0.064   7.409 1.00 . A A .  15 ARG HD2  1 1 
        1   256 1 1  18 ARG HD3  H  -0.591  -0.698   8.752 1.00 . A A .  15 ARG HD3  1 1 
        1   257 1 1  18 ARG HE   H  -1.555   1.715   9.017 1.00 . A A .  15 ARG HE   1 1 
        1   258 1 1  18 ARG HG2  H   1.185   1.769   9.039 1.00 . A A .  15 ARG HG2  1 1 
        1   259 1 1  18 ARG HG3  H   1.756   0.120   9.302 1.00 . A A .  15 ARG HG3  1 1 
        1   260 1 1  18 ARG HH11 H  -0.976   0.059   5.971 1.00 . A A .  15 ARG HH11 1 1 
        1   261 1 1  18 ARG HH12 H  -2.211   0.933   5.124 1.00 . A A .  15 ARG HH12 1 1 
        1   262 1 1  18 ARG HH21 H  -3.184   2.837   7.900 1.00 . A A .  15 ARG HH21 1 1 
        1   263 1 1  18 ARG HH22 H  -3.468   2.508   6.223 1.00 . A A .  15 ARG HH22 1 1 
        1   264 1 1  18 ARG N    N   2.679   0.898  11.862 1.00 . A A .  15 ARG N    1 1 
        1   265 1 1  18 ARG NE   N  -1.303   1.204   8.218 1.00 . A A .  15 ARG NE   1 1 
        1   266 1 1  18 ARG NH1  N  -1.702   0.749   5.971 1.00 . A A .  15 ARG NH1  1 1 
        1   267 1 1  18 ARG NH2  N  -2.956   2.328   7.067 1.00 . A A .  15 ARG NH2  1 1 
        1   268 1 1  18 ARG O    O   0.074   2.468  13.653 1.00 . A A .  15 ARG O    1 1 
        1   269 1 1  19 VAL C    C   0.843   0.934  16.316 1.00 . A A .  16 VAL C    1 1 
        1   270 1 1  19 VAL CA   C   0.141   0.116  15.214 1.00 . A A .  16 VAL CA   1 1 
        1   271 1 1  19 VAL CB   C   0.054  -1.403  15.633 1.00 . A A .  16 VAL CB   1 1 
        1   272 1 1  19 VAL CG1  C  -0.524  -2.268  14.499 1.00 . A A .  16 VAL CG1  1 1 
        1   273 1 1  19 VAL CG2  C   1.406  -1.952  16.103 1.00 . A A .  16 VAL CG2  1 1 
        1   274 1 1  19 VAL H    H   1.335  -0.405  13.522 1.00 . A A .  16 VAL H    1 1 
        1   275 1 1  19 VAL HA   H  -0.880   0.488  15.120 1.00 . A A .  16 VAL HA   1 1 
        1   276 1 1  19 VAL HB   H  -0.640  -1.472  16.473 1.00 . A A .  16 VAL HB   1 1 
        1   277 1 1  19 VAL HG11 H  -0.622  -3.296  14.830 1.00 . A A .  16 VAL HG11 1 1 
        1   278 1 1  19 VAL HG12 H   0.131  -2.233  13.636 1.00 . A A .  16 VAL HG12 1 1 
        1   279 1 1  19 VAL HG13 H  -1.494  -1.892  14.218 1.00 . A A .  16 VAL HG13 1 1 
        1   280 1 1  19 VAL HG21 H   1.278  -2.964  16.469 1.00 . A A .  16 VAL HG21 1 1 
        1   281 1 1  19 VAL HG22 H   1.799  -1.338  16.903 1.00 . A A .  16 VAL HG22 1 1 
        1   282 1 1  19 VAL HG23 H   2.107  -1.957  15.279 1.00 . A A .  16 VAL HG23 1 1 
        1   283 1 1  19 VAL N    N   0.796   0.322  13.905 1.00 . A A .  16 VAL N    1 1 
        1   284 1 1  19 VAL O    O   0.183   1.476  17.199 1.00 . A A .  16 VAL O    1 1 
        1   285 1 1  20 PHE C    C   2.758   3.329  16.943 1.00 . A A .  17 PHE C    1 1 
        1   286 1 1  20 PHE CA   C   3.005   1.823  17.171 1.00 . A A .  17 PHE CA   1 1 
        1   287 1 1  20 PHE CB   C   4.515   1.451  17.054 1.00 . A A .  17 PHE CB   1 1 
        1   288 1 1  20 PHE CD1  C   4.997   0.160  19.189 1.00 . A A .  17 PHE CD1  1 1 
        1   289 1 1  20 PHE CD2  C   5.185  -1.020  17.127 1.00 . A A .  17 PHE CD2  1 1 
        1   290 1 1  20 PHE CE1  C   5.346  -0.988  19.875 1.00 . A A .  17 PHE CE1  1 1 
        1   291 1 1  20 PHE CE2  C   5.531  -2.169  17.816 1.00 . A A .  17 PHE CE2  1 1 
        1   292 1 1  20 PHE CG   C   4.910   0.168  17.799 1.00 . A A .  17 PHE CG   1 1 
        1   293 1 1  20 PHE CZ   C   5.612  -2.151  19.186 1.00 . A A .  17 PHE CZ   1 1 
        1   294 1 1  20 PHE H    H   2.646   0.526  15.531 1.00 . A A .  17 PHE H    1 1 
        1   295 1 1  20 PHE HA   H   2.668   1.582  18.180 1.00 . A A .  17 PHE HA   1 1 
        1   296 1 1  20 PHE HB2  H   4.768   1.324  16.008 1.00 . A A .  17 PHE HB2  1 1 
        1   297 1 1  20 PHE HB3  H   5.116   2.261  17.457 1.00 . A A .  17 PHE HB3  1 1 
        1   298 1 1  20 PHE HD1  H   4.788   1.069  19.741 1.00 . A A .  17 PHE HD1  1 1 
        1   299 1 1  20 PHE HD2  H   5.131  -1.042  16.048 1.00 . A A .  17 PHE HD2  1 1 
        1   300 1 1  20 PHE HE1  H   5.409  -0.975  20.955 1.00 . A A .  17 PHE HE1  1 1 
        1   301 1 1  20 PHE HE2  H   5.739  -3.088  17.275 1.00 . A A .  17 PHE HE2  1 1 
        1   302 1 1  20 PHE HZ   H   5.881  -3.055  19.726 1.00 . A A .  17 PHE HZ   1 1 
        1   303 1 1  20 PHE N    N   2.189   1.021  16.239 1.00 . A A .  17 PHE N    1 1 
        1   304 1 1  20 PHE O    O   2.855   4.129  17.882 1.00 . A A .  17 PHE O    1 1 
        1   305 1 1  21 ALA C    C   0.580   5.389  15.966 1.00 . A A .  18 ALA C    1 1 
        1   306 1 1  21 ALA CA   C   1.965   5.071  15.345 1.00 . A A .  18 ALA CA   1 1 
        1   307 1 1  21 ALA CB   C   1.930   5.260  13.819 1.00 . A A .  18 ALA CB   1 1 
        1   308 1 1  21 ALA H    H   2.451   3.026  14.978 1.00 . A A .  18 ALA H    1 1 
        1   309 1 1  21 ALA HA   H   2.697   5.766  15.752 1.00 . A A .  18 ALA HA   1 1 
        1   310 1 1  21 ALA HB1  H   1.663   6.283  13.576 1.00 . A A .  18 ALA HB1  1 1 
        1   311 1 1  21 ALA HB2  H   1.201   4.588  13.383 1.00 . A A .  18 ALA HB2  1 1 
        1   312 1 1  21 ALA HB3  H   2.905   5.041  13.405 1.00 . A A .  18 ALA HB3  1 1 
        1   313 1 1  21 ALA N    N   2.408   3.699  15.691 1.00 . A A .  18 ALA N    1 1 
        1   314 1 1  21 ALA O    O   0.233   6.556  16.167 1.00 . A A .  18 ALA O    1 1 
        1   315 1 1  22 ALA C    C  -1.353   4.194  18.477 1.00 . A A .  19 ALA C    1 1 
        1   316 1 1  22 ALA CA   C  -1.512   4.438  16.955 1.00 . A A .  19 ALA CA   1 1 
        1   317 1 1  22 ALA CB   C  -2.523   3.442  16.353 1.00 . A A .  19 ALA CB   1 1 
        1   318 1 1  22 ALA H    H   0.083   3.443  15.949 1.00 . A A .  19 ALA H    1 1 
        1   319 1 1  22 ALA HA   H  -1.904   5.444  16.808 1.00 . A A .  19 ALA HA   1 1 
        1   320 1 1  22 ALA HB1  H  -2.630   3.626  15.292 1.00 . A A .  19 ALA HB1  1 1 
        1   321 1 1  22 ALA HB2  H  -3.487   3.560  16.833 1.00 . A A .  19 ALA HB2  1 1 
        1   322 1 1  22 ALA HB3  H  -2.171   2.428  16.504 1.00 . A A .  19 ALA HB3  1 1 
        1   323 1 1  22 ALA N    N  -0.211   4.331  16.244 1.00 . A A .  19 ALA N    1 1 
        1   324 1 1  22 ALA O    O  -2.343   4.238  19.223 1.00 . A A .  19 ALA O    1 1 
        1   325 1 1  23 GLY C    C   0.165   2.242  20.777 1.00 . A A .  20 GLY C    1 1 
        1   326 1 1  23 GLY CA   C   0.208   3.709  20.345 1.00 . A A .  20 GLY CA   1 1 
        1   327 1 1  23 GLY H    H   0.613   3.845  18.265 1.00 . A A .  20 GLY H    1 1 
        1   328 1 1  23 GLY HA2  H   1.206   4.084  20.526 1.00 . A A .  20 GLY HA2  1 1 
        1   329 1 1  23 GLY HA3  H  -0.485   4.275  20.958 1.00 . A A .  20 GLY HA3  1 1 
        1   330 1 1  23 GLY N    N  -0.108   3.917  18.921 1.00 . A A .  20 GLY N    1 1 
        1   331 1 1  23 GLY O    O   0.620   1.908  21.880 1.00 . A A .  20 GLY O    1 1 
        1   332 1 1  24 GLY C    C   0.862  -0.807  19.987 1.00 . A A .  21 GLY C    1 1 
        1   333 1 1  24 GLY CA   C  -0.472  -0.065  20.161 1.00 . A A .  21 GLY CA   1 1 
        1   334 1 1  24 GLY H    H  -0.715   1.718  19.051 1.00 . A A .  21 GLY H    1 1 
        1   335 1 1  24 GLY HA2  H  -0.828  -0.220  21.173 1.00 . A A .  21 GLY HA2  1 1 
        1   336 1 1  24 GLY HA3  H  -1.197  -0.488  19.478 1.00 . A A .  21 GLY HA3  1 1 
        1   337 1 1  24 GLY N    N  -0.378   1.372  19.900 1.00 . A A .  21 GLY N    1 1 
        1   338 1 1  24 GLY O    O   1.924  -0.186  19.873 1.00 . A A .  21 GLY O    1 1 
        1   339 1 1  25 PHE C    C   1.833  -4.050  18.759 1.00 . A A .  22 PHE C    1 1 
        1   340 1 1  25 PHE CA   C   1.963  -3.055  19.925 1.00 . A A .  22 PHE CA   1 1 
        1   341 1 1  25 PHE CB   C   2.044  -3.810  21.286 1.00 . A A .  22 PHE CB   1 1 
        1   342 1 1  25 PHE CD1  C   4.469  -4.549  21.517 1.00 . A A .  22 PHE CD1  1 1 
        1   343 1 1  25 PHE CD2  C   2.805  -6.251  21.247 1.00 . A A .  22 PHE CD2  1 1 
        1   344 1 1  25 PHE CE1  C   5.450  -5.521  21.560 1.00 . A A .  22 PHE CE1  1 1 
        1   345 1 1  25 PHE CE2  C   3.788  -7.221  21.293 1.00 . A A .  22 PHE CE2  1 1 
        1   346 1 1  25 PHE CG   C   3.129  -4.892  21.359 1.00 . A A .  22 PHE CG   1 1 
        1   347 1 1  25 PHE CZ   C   5.110  -6.854  21.450 1.00 . A A .  22 PHE CZ   1 1 
        1   348 1 1  25 PHE H    H  -0.102  -2.552  19.876 1.00 . A A .  22 PHE H    1 1 
        1   349 1 1  25 PHE HA   H   2.868  -2.465  19.785 1.00 . A A .  22 PHE HA   1 1 
        1   350 1 1  25 PHE HB2  H   2.246  -3.092  22.070 1.00 . A A .  22 PHE HB2  1 1 
        1   351 1 1  25 PHE HB3  H   1.086  -4.278  21.485 1.00 . A A .  22 PHE HB3  1 1 
        1   352 1 1  25 PHE HD1  H   4.746  -3.508  21.605 1.00 . A A .  22 PHE HD1  1 1 
        1   353 1 1  25 PHE HD2  H   1.769  -6.541  21.124 1.00 . A A .  22 PHE HD2  1 1 
        1   354 1 1  25 PHE HE1  H   6.490  -5.238  21.681 1.00 . A A .  22 PHE HE1  1 1 
        1   355 1 1  25 PHE HE2  H   3.522  -8.270  21.205 1.00 . A A .  22 PHE HE2  1 1 
        1   356 1 1  25 PHE HZ   H   5.883  -7.613  21.484 1.00 . A A .  22 PHE HZ   1 1 
        1   357 1 1  25 PHE N    N   0.788  -2.146  19.936 1.00 . A A .  22 PHE N    1 1 
        1   358 1 1  25 PHE O    O   0.729  -4.275  18.276 1.00 . A A .  22 PHE O    1 1 
        1   359 1 1  26 ALA C    C   4.294  -6.465  17.269 1.00 . A A .  23 ALA C    1 1 
        1   360 1 1  26 ALA CA   C   2.975  -5.687  17.268 1.00 . A A .  23 ALA CA   1 1 
        1   361 1 1  26 ALA CB   C   2.690  -5.146  15.870 1.00 . A A .  23 ALA CB   1 1 
        1   362 1 1  26 ALA H    H   3.829  -4.310  18.648 1.00 . A A .  23 ALA H    1 1 
        1   363 1 1  26 ALA HA   H   2.177  -6.379  17.526 1.00 . A A .  23 ALA HA   1 1 
        1   364 1 1  26 ALA HB1  H   3.439  -4.409  15.601 1.00 . A A .  23 ALA HB1  1 1 
        1   365 1 1  26 ALA HB2  H   1.714  -4.681  15.848 1.00 . A A .  23 ALA HB2  1 1 
        1   366 1 1  26 ALA HB3  H   2.708  -5.955  15.149 1.00 . A A .  23 ALA HB3  1 1 
        1   367 1 1  26 ALA N    N   2.969  -4.613  18.287 1.00 . A A .  23 ALA N    1 1 
        1   368 1 1  26 ALA O    O   5.324  -5.966  17.750 1.00 . A A .  23 ALA O    1 1 
        1   369 1 1  27 ALA C    C   5.056  -9.772  15.656 1.00 . A A .  24 ALA C    1 1 
        1   370 1 1  27 ALA CA   C   5.373  -8.616  16.626 1.00 . A A .  24 ALA CA   1 1 
        1   371 1 1  27 ALA CB   C   5.679  -9.153  18.033 1.00 . A A .  24 ALA CB   1 1 
        1   372 1 1  27 ALA H    H   3.379  -7.979  16.301 1.00 . A A .  24 ALA H    1 1 
        1   373 1 1  27 ALA HA   H   6.242  -8.069  16.265 1.00 . A A .  24 ALA HA   1 1 
        1   374 1 1  27 ALA HB1  H   4.818  -9.690  18.417 1.00 . A A .  24 ALA HB1  1 1 
        1   375 1 1  27 ALA HB2  H   5.903  -8.324  18.697 1.00 . A A .  24 ALA HB2  1 1 
        1   376 1 1  27 ALA HB3  H   6.531  -9.816  17.992 1.00 . A A .  24 ALA HB3  1 1 
        1   377 1 1  27 ALA N    N   4.238  -7.687  16.690 1.00 . A A .  24 ALA N    1 1 
        1   378 1 1  27 ALA O    O   3.957 -10.341  15.715 1.00 . A A .  24 ALA O    1 1 
        1   379 1 1  28 VAL C    C   6.110 -12.568  14.509 1.00 . A A .  25 VAL C    1 1 
        1   380 1 1  28 VAL CA   C   5.867 -11.219  13.797 1.00 . A A .  25 VAL CA   1 1 
        1   381 1 1  28 VAL CB   C   6.838 -11.090  12.555 1.00 . A A .  25 VAL CB   1 1 
        1   382 1 1  28 VAL CG1  C   6.642 -12.261  11.548 1.00 . A A .  25 VAL CG1  1 1 
        1   383 1 1  28 VAL CG2  C   6.662  -9.725  11.849 1.00 . A A .  25 VAL CG2  1 1 
        1   384 1 1  28 VAL H    H   6.849  -9.592  14.760 1.00 . A A .  25 VAL H    1 1 
        1   385 1 1  28 VAL HA   H   4.842 -11.191  13.423 1.00 . A A .  25 VAL HA   1 1 
        1   386 1 1  28 VAL HB   H   7.861 -11.141  12.926 1.00 . A A .  25 VAL HB   1 1 
        1   387 1 1  28 VAL HG11 H   5.628 -12.252  11.166 1.00 . A A .  25 VAL HG11 1 1 
        1   388 1 1  28 VAL HG12 H   6.825 -13.208  12.043 1.00 . A A .  25 VAL HG12 1 1 
        1   389 1 1  28 VAL HG13 H   7.335 -12.156  10.722 1.00 . A A .  25 VAL HG13 1 1 
        1   390 1 1  28 VAL HG21 H   7.356  -9.647  11.020 1.00 . A A .  25 VAL HG21 1 1 
        1   391 1 1  28 VAL HG22 H   6.856  -8.921  12.549 1.00 . A A .  25 VAL HG22 1 1 
        1   392 1 1  28 VAL HG23 H   5.650  -9.633  11.474 1.00 . A A .  25 VAL HG23 1 1 
        1   393 1 1  28 VAL N    N   6.016 -10.105  14.762 1.00 . A A .  25 VAL N    1 1 
        1   394 1 1  28 VAL O    O   7.238 -12.880  14.919 1.00 . A A .  25 VAL O    1 1 
        1   395 1 1  29 GLU C    C   5.487 -15.731  14.255 1.00 . A A .  26 GLU C    1 1 
        1   396 1 1  29 GLU CA   C   5.060 -14.667  15.286 1.00 . A A .  26 GLU CA   1 1 
        1   397 1 1  29 GLU CB   C   3.670 -14.978  15.897 1.00 . A A .  26 GLU CB   1 1 
        1   398 1 1  29 GLU CD   C   4.185 -13.765  18.101 1.00 . A A .  26 GLU CD   1 1 
        1   399 1 1  29 GLU CG   C   3.202 -13.930  16.926 1.00 . A A .  26 GLU CG   1 1 
        1   400 1 1  29 GLU H    H   4.165 -12.974  14.403 1.00 . A A .  26 GLU H    1 1 
        1   401 1 1  29 GLU HA   H   5.792 -14.652  16.092 1.00 . A A .  26 GLU HA   1 1 
        1   402 1 1  29 GLU HB2  H   2.933 -15.021  15.101 1.00 . A A .  26 GLU HB2  1 1 
        1   403 1 1  29 GLU HB3  H   3.710 -15.946  16.390 1.00 . A A .  26 GLU HB3  1 1 
        1   404 1 1  29 GLU HG2  H   3.084 -12.972  16.420 1.00 . A A .  26 GLU HG2  1 1 
        1   405 1 1  29 GLU HG3  H   2.236 -14.231  17.319 1.00 . A A .  26 GLU HG3  1 1 
        1   406 1 1  29 GLU N    N   5.030 -13.334  14.680 1.00 . A A .  26 GLU N    1 1 
        1   407 1 1  29 GLU O    O   6.559 -16.334  14.380 1.00 . A A .  26 GLU O    1 1 
        1   408 1 1  29 GLU OE1  O   4.196 -14.635  18.998 1.00 . A A .  26 GLU OE1  1 1 
        1   409 1 1  29 GLU OE2  O   4.968 -12.783  18.122 1.00 . A A .  26 GLU OE2  1 1 
        1   410 1 1  30 LYS C    C   5.463 -16.245  10.920 1.00 . A A .  27 LYS C    1 1 
        1   411 1 1  30 LYS CA   C   4.920 -16.942  12.172 1.00 . A A .  27 LYS CA   1 1 
        1   412 1 1  30 LYS CB   C   3.640 -17.747  11.839 1.00 . A A .  27 LYS CB   1 1 
        1   413 1 1  30 LYS CD   C   2.518 -19.619  10.462 1.00 . A A .  27 LYS CD   1 1 
        1   414 1 1  30 LYS CE   C   2.660 -20.598   9.283 1.00 . A A .  27 LYS CE   1 1 
        1   415 1 1  30 LYS CG   C   3.803 -18.805  10.723 1.00 . A A .  27 LYS CG   1 1 
        1   416 1 1  30 LYS H    H   3.826 -15.423  13.170 1.00 . A A .  27 LYS H    1 1 
        1   417 1 1  30 LYS HA   H   5.677 -17.632  12.540 1.00 . A A .  27 LYS HA   1 1 
        1   418 1 1  30 LYS HB2  H   3.307 -18.253  12.740 1.00 . A A .  27 LYS HB2  1 1 
        1   419 1 1  30 LYS HB3  H   2.865 -17.050  11.534 1.00 . A A .  27 LYS HB3  1 1 
        1   420 1 1  30 LYS HD2  H   2.280 -20.187  11.352 1.00 . A A .  27 LYS HD2  1 1 
        1   421 1 1  30 LYS HD3  H   1.703 -18.932  10.250 1.00 . A A .  27 LYS HD3  1 1 
        1   422 1 1  30 LYS HE2  H   1.738 -21.153   9.180 1.00 . A A .  27 LYS HE2  1 1 
        1   423 1 1  30 LYS HE3  H   2.832 -20.035   8.374 1.00 . A A .  27 LYS HE3  1 1 
        1   424 1 1  30 LYS HG2  H   4.086 -18.297   9.806 1.00 . A A .  27 LYS HG2  1 1 
        1   425 1 1  30 LYS HG3  H   4.598 -19.483  11.009 1.00 . A A .  27 LYS HG3  1 1 
        1   426 1 1  30 LYS HZ1  H   4.676 -21.072   9.520 1.00 . A A .  27 LYS HZ1  1 1 
        1   427 1 1  30 LYS HZ2  H   3.800 -22.226   8.652 1.00 . A A .  27 LYS HZ2  1 1 
        1   428 1 1  30 LYS HZ3  H   3.625 -22.115  10.330 1.00 . A A .  27 LYS HZ3  1 1 
        1   429 1 1  30 LYS N    N   4.646 -15.953  13.230 1.00 . A A .  27 LYS N    1 1 
        1   430 1 1  30 LYS NZ   N   3.767 -21.568   9.457 1.00 . A A .  27 LYS NZ   1 1 
        1   431 1 1  30 LYS O    O   5.082 -15.110  10.615 1.00 . A A .  27 LYS O    1 1 
        1   432 1 1  31 LYS C    C   6.700 -17.524   7.841 1.00 . A A .  28 LYS C    1 1 
        1   433 1 1  31 LYS CA   C   6.952 -16.480   8.950 1.00 . A A .  28 LYS CA   1 1 
        1   434 1 1  31 LYS CB   C   8.473 -16.234   9.162 1.00 . A A .  28 LYS CB   1 1 
        1   435 1 1  31 LYS CD   C  10.687 -15.302   8.203 1.00 . A A .  28 LYS CD   1 1 
        1   436 1 1  31 LYS CE   C  11.385 -14.704   6.965 1.00 . A A .  28 LYS CE   1 1 
        1   437 1 1  31 LYS CG   C   9.221 -15.713   7.917 1.00 . A A .  28 LYS CG   1 1 
        1   438 1 1  31 LYS H    H   6.622 -17.823  10.538 1.00 . A A .  28 LYS H    1 1 
        1   439 1 1  31 LYS HA   H   6.478 -15.540   8.664 1.00 . A A .  28 LYS HA   1 1 
        1   440 1 1  31 LYS HB2  H   8.594 -15.508   9.960 1.00 . A A .  28 LYS HB2  1 1 
        1   441 1 1  31 LYS HB3  H   8.938 -17.164   9.475 1.00 . A A .  28 LYS HB3  1 1 
        1   442 1 1  31 LYS HD2  H  10.696 -14.560   8.995 1.00 . A A .  28 LYS HD2  1 1 
        1   443 1 1  31 LYS HD3  H  11.241 -16.177   8.531 1.00 . A A .  28 LYS HD3  1 1 
        1   444 1 1  31 LYS HE2  H  11.409 -15.446   6.178 1.00 . A A .  28 LYS HE2  1 1 
        1   445 1 1  31 LYS HE3  H  10.824 -13.841   6.622 1.00 . A A .  28 LYS HE3  1 1 
        1   446 1 1  31 LYS HG2  H   9.219 -16.490   7.161 1.00 . A A .  28 LYS HG2  1 1 
        1   447 1 1  31 LYS HG3  H   8.685 -14.851   7.532 1.00 . A A .  28 LYS HG3  1 1 
        1   448 1 1  31 LYS HZ1  H  13.364 -15.100   7.499 1.00 . A A .  28 LYS HZ1  1 1 
        1   449 1 1  31 LYS HZ2  H  12.795 -13.606   8.041 1.00 . A A .  28 LYS HZ2  1 1 
        1   450 1 1  31 LYS HZ3  H  13.193 -13.815   6.410 1.00 . A A .  28 LYS HZ3  1 1 
        1   451 1 1  31 LYS N    N   6.354 -16.945  10.204 1.00 . A A .  28 LYS N    1 1 
        1   452 1 1  31 LYS NZ   N  12.781 -14.277   7.248 1.00 . A A .  28 LYS NZ   1 1 
        1   453 1 1  31 LYS O    O   6.865 -18.726   8.074 1.00 . A A .  28 LYS O    1 1 
        1   454 1 1  32 GLY C    C   6.834 -17.388   4.260 1.00 . A A .  29 GLY C    1 1 
        1   455 1 1  32 GLY CA   C   6.067 -17.906   5.474 1.00 . A A .  29 GLY CA   1 1 
        1   456 1 1  32 GLY H    H   6.124 -16.092   6.571 1.00 . A A .  29 GLY H    1 1 
        1   457 1 1  32 GLY HA2  H   6.383 -18.925   5.682 1.00 . A A .  29 GLY HA2  1 1 
        1   458 1 1  32 GLY HA3  H   5.012 -17.913   5.249 1.00 . A A .  29 GLY HA3  1 1 
        1   459 1 1  32 GLY N    N   6.287 -17.053   6.652 1.00 . A A .  29 GLY N    1 1 
        1   460 1 1  32 GLY O    O   8.037 -17.140   4.362 1.00 . A A .  29 GLY O    1 1 
        1   461 1 1  33 ALA C    C   6.841 -15.186   1.832 1.00 . A A .  30 ALA C    1 1 
        1   462 1 1  33 ALA CA   C   6.759 -16.725   1.854 1.00 . A A .  30 ALA CA   1 1 
        1   463 1 1  33 ALA CB   C   5.973 -17.252   0.638 1.00 . A A .  30 ALA CB   1 1 
        1   464 1 1  33 ALA H    H   5.176 -17.379   3.112 1.00 . A A .  30 ALA H    1 1 
        1   465 1 1  33 ALA HA   H   7.769 -17.134   1.803 1.00 . A A .  30 ALA HA   1 1 
        1   466 1 1  33 ALA HB1  H   6.454 -16.937  -0.279 1.00 . A A .  30 ALA HB1  1 1 
        1   467 1 1  33 ALA HB2  H   4.958 -16.869   0.656 1.00 . A A .  30 ALA HB2  1 1 
        1   468 1 1  33 ALA HB3  H   5.939 -18.333   0.666 1.00 . A A .  30 ALA HB3  1 1 
        1   469 1 1  33 ALA N    N   6.138 -17.201   3.112 1.00 . A A .  30 ALA N    1 1 
        1   470 1 1  33 ALA O    O   5.850 -14.508   2.105 1.00 . A A .  30 ALA O    1 1 
        1   471 1 1  34 GLU C    C   7.541 -12.373   0.526 1.00 . A A .  31 GLU C    1 1 
        1   472 1 1  34 GLU CA   C   8.324 -13.200   1.561 1.00 . A A .  31 GLU CA   1 1 
        1   473 1 1  34 GLU CB   C   9.834 -12.947   1.360 1.00 . A A .  31 GLU CB   1 1 
        1   474 1 1  34 GLU CD   C  12.242 -13.467   2.119 1.00 . A A .  31 GLU CD   1 1 
        1   475 1 1  34 GLU CG   C  10.738 -13.606   2.416 1.00 . A A .  31 GLU CG   1 1 
        1   476 1 1  34 GLU H    H   8.738 -15.254   1.180 1.00 . A A .  31 GLU H    1 1 
        1   477 1 1  34 GLU HA   H   8.051 -12.862   2.557 1.00 . A A .  31 GLU HA   1 1 
        1   478 1 1  34 GLU HB2  H  10.124 -13.316   0.382 1.00 . A A .  31 GLU HB2  1 1 
        1   479 1 1  34 GLU HB3  H  10.017 -11.875   1.389 1.00 . A A .  31 GLU HB3  1 1 
        1   480 1 1  34 GLU HG2  H  10.539 -13.147   3.378 1.00 . A A .  31 GLU HG2  1 1 
        1   481 1 1  34 GLU HG3  H  10.484 -14.660   2.475 1.00 . A A .  31 GLU HG3  1 1 
        1   482 1 1  34 GLU N    N   8.028 -14.650   1.488 1.00 . A A .  31 GLU N    1 1 
        1   483 1 1  34 GLU O    O   7.021 -11.317   0.852 1.00 . A A .  31 GLU O    1 1 
        1   484 1 1  34 GLU OE1  O  12.659 -12.435   1.552 1.00 . A A .  31 GLU OE1  1 1 
        1   485 1 1  34 GLU OE2  O  13.016 -14.393   2.448 1.00 . A A .  31 GLU OE2  1 1 
        1   486 1 1  35 ALA C    C   5.399 -12.384  -1.981 1.00 . A A .  32 ALA C    1 1 
        1   487 1 1  35 ALA CA   C   6.906 -12.093  -1.848 1.00 . A A .  32 ALA CA   1 1 
        1   488 1 1  35 ALA CB   C   7.652 -12.407  -3.157 1.00 . A A .  32 ALA CB   1 1 
        1   489 1 1  35 ALA H    H   7.920 -13.700  -0.904 1.00 . A A .  32 ALA H    1 1 
        1   490 1 1  35 ALA HA   H   7.032 -11.036  -1.653 1.00 . A A .  32 ALA HA   1 1 
        1   491 1 1  35 ALA HB1  H   8.705 -12.171  -3.042 1.00 . A A .  32 ALA HB1  1 1 
        1   492 1 1  35 ALA HB2  H   7.242 -11.816  -3.970 1.00 . A A .  32 ALA HB2  1 1 
        1   493 1 1  35 ALA HB3  H   7.546 -13.456  -3.393 1.00 . A A .  32 ALA HB3  1 1 
        1   494 1 1  35 ALA N    N   7.514 -12.837  -0.726 1.00 . A A .  32 ALA N    1 1 
        1   495 1 1  35 ALA O    O   4.567 -11.474  -1.866 1.00 . A A .  32 ALA O    1 1 
        1   496 1 1  36 ALA C    C   2.897 -14.683  -1.414 1.00 . A A .  33 ALA C    1 1 
        1   497 1 1  36 ALA CA   C   3.716 -14.113  -2.585 1.00 . A A .  33 ALA CA   1 1 
        1   498 1 1  36 ALA CB   C   3.862 -15.163  -3.704 1.00 . A A .  33 ALA CB   1 1 
        1   499 1 1  36 ALA H    H   5.752 -14.348  -2.031 1.00 . A A .  33 ALA H    1 1 
        1   500 1 1  36 ALA HA   H   3.181 -13.262  -2.999 1.00 . A A .  33 ALA HA   1 1 
        1   501 1 1  36 ALA HB1  H   4.389 -16.033  -3.324 1.00 . A A .  33 ALA HB1  1 1 
        1   502 1 1  36 ALA HB2  H   4.426 -14.741  -4.526 1.00 . A A .  33 ALA HB2  1 1 
        1   503 1 1  36 ALA HB3  H   2.885 -15.464  -4.064 1.00 . A A .  33 ALA HB3  1 1 
        1   504 1 1  36 ALA N    N   5.067 -13.666  -2.174 1.00 . A A .  33 ALA N    1 1 
        1   505 1 1  36 ALA O    O   1.770 -15.158  -1.627 1.00 . A A .  33 ALA O    1 1 
        1   506 1 1  37 GLY C    C   1.524 -14.677   1.434 1.00 . A A .  34 GLY C    1 1 
        1   507 1 1  37 GLY CA   C   2.854 -15.265   0.983 1.00 . A A .  34 GLY CA   1 1 
        1   508 1 1  37 GLY H    H   4.261 -14.071  -0.067 1.00 . A A .  34 GLY H    1 1 
        1   509 1 1  37 GLY HA2  H   2.717 -16.318   0.757 1.00 . A A .  34 GLY HA2  1 1 
        1   510 1 1  37 GLY HA3  H   3.556 -15.187   1.803 1.00 . A A .  34 GLY HA3  1 1 
        1   511 1 1  37 GLY N    N   3.446 -14.605  -0.187 1.00 . A A .  34 GLY N    1 1 
        1   512 1 1  37 GLY O    O   1.185 -13.534   1.094 1.00 . A A .  34 GLY O    1 1 
        1   513 1 1  38 ALA C    C  -0.049 -14.355   4.193 1.00 . A A .  35 ALA C    1 1 
        1   514 1 1  38 ALA CA   C  -0.458 -15.022   2.869 1.00 . A A .  35 ALA CA   1 1 
        1   515 1 1  38 ALA CB   C  -1.413 -16.208   3.100 1.00 . A A .  35 ALA CB   1 1 
        1   516 1 1  38 ALA H    H   1.030 -16.415   2.300 1.00 . A A .  35 ALA H    1 1 
        1   517 1 1  38 ALA HA   H  -0.964 -14.292   2.235 1.00 . A A .  35 ALA HA   1 1 
        1   518 1 1  38 ALA HB1  H  -2.305 -15.868   3.612 1.00 . A A .  35 ALA HB1  1 1 
        1   519 1 1  38 ALA HB2  H  -0.923 -16.964   3.699 1.00 . A A .  35 ALA HB2  1 1 
        1   520 1 1  38 ALA HB3  H  -1.695 -16.640   2.148 1.00 . A A .  35 ALA HB3  1 1 
        1   521 1 1  38 ALA N    N   0.757 -15.480   2.184 1.00 . A A .  35 ALA N    1 1 
        1   522 1 1  38 ALA O    O   1.052 -14.597   4.692 1.00 . A A .  35 ALA O    1 1 
        1   523 1 1  39 ILE C    C  -1.913 -12.814   6.865 1.00 . A A .  36 ILE C    1 1 
        1   524 1 1  39 ILE CA   C  -0.652 -12.765   5.999 1.00 . A A .  36 ILE CA   1 1 
        1   525 1 1  39 ILE CB   C  -0.278 -11.249   5.756 1.00 . A A .  36 ILE CB   1 1 
        1   526 1 1  39 ILE CD1  C   2.207 -11.643   5.170 1.00 . A A .  36 ILE CD1  1 1 
        1   527 1 1  39 ILE CG1  C   0.887 -11.054   4.736 1.00 . A A .  36 ILE CG1  1 1 
        1   528 1 1  39 ILE CG2  C   0.052 -10.540   7.100 1.00 . A A .  36 ILE CG2  1 1 
        1   529 1 1  39 ILE H    H  -1.806 -13.420   4.347 1.00 . A A .  36 ILE H    1 1 
        1   530 1 1  39 ILE HA   H   0.171 -13.245   6.528 1.00 . A A .  36 ILE HA   1 1 
        1   531 1 1  39 ILE HB   H  -1.161 -10.765   5.349 1.00 . A A .  36 ILE HB   1 1 
        1   532 1 1  39 ILE HD11 H   2.987 -11.271   4.534 1.00 . A A .  36 ILE HD11 1 1 
        1   533 1 1  39 ILE HD12 H   2.168 -12.720   5.095 1.00 . A A .  36 ILE HD12 1 1 
        1   534 1 1  39 ILE HD13 H   2.420 -11.366   6.192 1.00 . A A .  36 ILE HD13 1 1 
        1   535 1 1  39 ILE HG12 H   0.618 -11.523   3.799 1.00 . A A .  36 ILE HG12 1 1 
        1   536 1 1  39 ILE HG13 H   1.040  -9.993   4.562 1.00 . A A .  36 ILE HG13 1 1 
        1   537 1 1  39 ILE HG21 H  -0.806 -10.594   7.759 1.00 . A A .  36 ILE HG21 1 1 
        1   538 1 1  39 ILE HG22 H   0.296  -9.500   6.923 1.00 . A A .  36 ILE HG22 1 1 
        1   539 1 1  39 ILE HG23 H   0.895 -11.030   7.572 1.00 . A A .  36 ILE HG23 1 1 
        1   540 1 1  39 ILE N    N  -0.924 -13.513   4.755 1.00 . A A .  36 ILE N    1 1 
        1   541 1 1  39 ILE O    O  -2.967 -12.324   6.452 1.00 . A A .  36 ILE O    1 1 
        1   542 1 1  40 PHE C    C  -2.513 -12.854  10.317 1.00 . A A .  37 PHE C    1 1 
        1   543 1 1  40 PHE CA   C  -2.907 -13.534   9.009 1.00 . A A .  37 PHE CA   1 1 
        1   544 1 1  40 PHE CB   C  -3.276 -15.022   9.238 1.00 . A A .  37 PHE CB   1 1 
        1   545 1 1  40 PHE CD1  C  -3.407 -15.938   6.864 1.00 . A A .  37 PHE CD1  1 1 
        1   546 1 1  40 PHE CD2  C  -5.403 -15.927   8.173 1.00 . A A .  37 PHE CD2  1 1 
        1   547 1 1  40 PHE CE1  C  -4.101 -16.484   5.807 1.00 . A A .  37 PHE CE1  1 1 
        1   548 1 1  40 PHE CE2  C  -6.092 -16.473   7.115 1.00 . A A .  37 PHE CE2  1 1 
        1   549 1 1  40 PHE CG   C  -4.042 -15.647   8.070 1.00 . A A .  37 PHE CG   1 1 
        1   550 1 1  40 PHE CZ   C  -5.444 -16.751   5.932 1.00 . A A .  37 PHE CZ   1 1 
        1   551 1 1  40 PHE H    H  -0.940 -13.780   8.304 1.00 . A A .  37 PHE H    1 1 
        1   552 1 1  40 PHE HA   H  -3.777 -13.019   8.598 1.00 . A A .  37 PHE HA   1 1 
        1   553 1 1  40 PHE HB2  H  -2.366 -15.589   9.397 1.00 . A A .  37 PHE HB2  1 1 
        1   554 1 1  40 PHE HB3  H  -3.893 -15.109  10.126 1.00 . A A .  37 PHE HB3  1 1 
        1   555 1 1  40 PHE HD1  H  -2.348 -15.730   6.760 1.00 . A A .  37 PHE HD1  1 1 
        1   556 1 1  40 PHE HD2  H  -5.924 -15.714   9.100 1.00 . A A .  37 PHE HD2  1 1 
        1   557 1 1  40 PHE HE1  H  -3.590 -16.703   4.876 1.00 . A A .  37 PHE HE1  1 1 
        1   558 1 1  40 PHE HE2  H  -7.150 -16.685   7.210 1.00 . A A .  37 PHE HE2  1 1 
        1   559 1 1  40 PHE HZ   H  -5.993 -17.182   5.100 1.00 . A A .  37 PHE HZ   1 1 
        1   560 1 1  40 PHE N    N  -1.803 -13.415   8.052 1.00 . A A .  37 PHE N    1 1 
        1   561 1 1  40 PHE O    O  -1.641 -13.318  11.036 1.00 . A A .  37 PHE O    1 1 
        1   562 1 1  41 VAL C    C  -3.984 -11.048  12.823 1.00 . A A .  38 VAL C    1 1 
        1   563 1 1  41 VAL CA   C  -2.879 -10.896  11.774 1.00 . A A .  38 VAL CA   1 1 
        1   564 1 1  41 VAL CB   C  -2.745  -9.396  11.310 1.00 . A A .  38 VAL CB   1 1 
        1   565 1 1  41 VAL CG1  C  -2.466  -8.444  12.492 1.00 . A A .  38 VAL CG1  1 1 
        1   566 1 1  41 VAL CG2  C  -1.642  -9.263  10.236 1.00 . A A .  38 VAL CG2  1 1 
        1   567 1 1  41 VAL H    H  -3.946 -11.498  10.055 1.00 . A A .  38 VAL H    1 1 
        1   568 1 1  41 VAL HA   H  -1.927 -11.209  12.206 1.00 . A A .  38 VAL HA   1 1 
        1   569 1 1  41 VAL HB   H  -3.687  -9.095  10.858 1.00 . A A .  38 VAL HB   1 1 
        1   570 1 1  41 VAL HG11 H  -3.268  -8.511  13.219 1.00 . A A .  38 VAL HG11 1 1 
        1   571 1 1  41 VAL HG12 H  -2.400  -7.420  12.137 1.00 . A A .  38 VAL HG12 1 1 
        1   572 1 1  41 VAL HG13 H  -1.531  -8.714  12.967 1.00 . A A .  38 VAL HG13 1 1 
        1   573 1 1  41 VAL HG21 H  -0.681  -9.525  10.666 1.00 . A A .  38 VAL HG21 1 1 
        1   574 1 1  41 VAL HG22 H  -1.601  -8.244   9.877 1.00 . A A .  38 VAL HG22 1 1 
        1   575 1 1  41 VAL HG23 H  -1.852  -9.923   9.404 1.00 . A A .  38 VAL HG23 1 1 
        1   576 1 1  41 VAL N    N  -3.190 -11.751  10.623 1.00 . A A .  38 VAL N    1 1 
        1   577 1 1  41 VAL O    O  -5.161 -11.035  12.481 1.00 . A A .  38 VAL O    1 1 
        1   578 1 1  42 ARG C    C  -4.520  -9.951  15.986 1.00 . A A .  39 ARG C    1 1 
        1   579 1 1  42 ARG CA   C  -4.560 -11.277  15.212 1.00 . A A .  39 ARG CA   1 1 
        1   580 1 1  42 ARG CB   C  -4.264 -12.493  16.164 1.00 . A A .  39 ARG CB   1 1 
        1   581 1 1  42 ARG CD   C  -2.809 -13.273  18.171 1.00 . A A .  39 ARG CD   1 1 
        1   582 1 1  42 ARG CG   C  -2.859 -12.506  16.827 1.00 . A A .  39 ARG CG   1 1 
        1   583 1 1  42 ARG CZ   C  -3.373 -15.569  18.996 1.00 . A A .  39 ARG CZ   1 1 
        1   584 1 1  42 ARG H    H  -2.647 -11.256  14.299 1.00 . A A .  39 ARG H    1 1 
        1   585 1 1  42 ARG HA   H  -5.561 -11.403  14.792 1.00 . A A .  39 ARG HA   1 1 
        1   586 1 1  42 ARG HB2  H  -5.012 -12.504  16.949 1.00 . A A .  39 ARG HB2  1 1 
        1   587 1 1  42 ARG HB3  H  -4.372 -13.411  15.592 1.00 . A A .  39 ARG HB3  1 1 
        1   588 1 1  42 ARG HD2  H  -1.859 -13.066  18.649 1.00 . A A .  39 ARG HD2  1 1 
        1   589 1 1  42 ARG HD3  H  -3.608 -12.904  18.812 1.00 . A A .  39 ARG HD3  1 1 
        1   590 1 1  42 ARG HE   H  -2.645 -15.129  17.181 1.00 . A A .  39 ARG HE   1 1 
        1   591 1 1  42 ARG HG2  H  -2.153 -12.961  16.144 1.00 . A A .  39 ARG HG2  1 1 
        1   592 1 1  42 ARG HG3  H  -2.551 -11.483  17.008 1.00 . A A .  39 ARG HG3  1 1 
        1   593 1 1  42 ARG HH11 H  -3.999 -14.106  20.263 1.00 . A A .  39 ARG HH11 1 1 
        1   594 1 1  42 ARG HH12 H  -4.218 -15.730  20.827 1.00 . A A .  39 ARG HH12 1 1 
        1   595 1 1  42 ARG HH21 H  -2.950 -17.254  17.952 1.00 . A A .  39 ARG HH21 1 1 
        1   596 1 1  42 ARG HH22 H  -3.625 -17.501  19.532 1.00 . A A .  39 ARG HH22 1 1 
        1   597 1 1  42 ARG N    N  -3.602 -11.200  14.099 1.00 . A A .  39 ARG N    1 1 
        1   598 1 1  42 ARG NE   N  -2.948 -14.737  18.030 1.00 . A A .  39 ARG NE   1 1 
        1   599 1 1  42 ARG NH1  N  -3.904 -15.099  20.117 1.00 . A A .  39 ARG NH1  1 1 
        1   600 1 1  42 ARG NH2  N  -3.314 -16.880  18.808 1.00 . A A .  39 ARG NH2  1 1 
        1   601 1 1  42 ARG O    O  -3.453  -9.527  16.440 1.00 . A A .  39 ARG O    1 1 
        1   602 1 1  43 GLN C    C  -6.219  -8.471  18.312 1.00 . A A .  40 GLN C    1 1 
        1   603 1 1  43 GLN CA   C  -5.800  -8.055  16.910 1.00 . A A .  40 GLN CA   1 1 
        1   604 1 1  43 GLN CB   C  -6.803  -7.019  16.343 1.00 . A A .  40 GLN CB   1 1 
        1   605 1 1  43 GLN CD   C  -7.914  -4.714  16.718 1.00 . A A .  40 GLN CD   1 1 
        1   606 1 1  43 GLN CG   C  -7.089  -5.847  17.306 1.00 . A A .  40 GLN CG   1 1 
        1   607 1 1  43 GLN H    H  -6.443  -9.564  15.561 1.00 . A A .  40 GLN H    1 1 
        1   608 1 1  43 GLN HA   H  -4.817  -7.582  16.966 1.00 . A A .  40 GLN HA   1 1 
        1   609 1 1  43 GLN HB2  H  -6.400  -6.618  15.420 1.00 . A A .  40 GLN HB2  1 1 
        1   610 1 1  43 GLN HB3  H  -7.740  -7.520  16.122 1.00 . A A .  40 GLN HB3  1 1 
        1   611 1 1  43 GLN HE21 H  -7.164  -3.502  18.072 1.00 . A A .  40 GLN HE21 1 1 
        1   612 1 1  43 GLN HE22 H  -8.299  -2.800  16.978 1.00 . A A .  40 GLN HE22 1 1 
        1   613 1 1  43 GLN HG2  H  -7.618  -6.232  18.167 1.00 . A A .  40 GLN HG2  1 1 
        1   614 1 1  43 GLN HG3  H  -6.137  -5.443  17.635 1.00 . A A .  40 GLN HG3  1 1 
        1   615 1 1  43 GLN N    N  -5.668  -9.253  16.067 1.00 . A A .  40 GLN N    1 1 
        1   616 1 1  43 GLN NE2  N  -7.779  -3.554  17.310 1.00 . A A .  40 GLN NE2  1 1 
        1   617 1 1  43 GLN O    O  -7.210  -9.163  18.487 1.00 . A A .  40 GLN O    1 1 
        1   618 1 1  43 GLN OE1  O  -8.697  -4.893  15.801 1.00 . A A .  40 GLN OE1  1 1 
        1   619 1 1  44 ARG C    C  -6.286  -7.132  21.392 1.00 . A A .  41 ARG C    1 1 
        1   620 1 1  44 ARG CA   C  -5.682  -8.342  20.692 1.00 . A A .  41 ARG CA   1 1 
        1   621 1 1  44 ARG CB   C  -4.346  -8.752  21.335 1.00 . A A .  41 ARG CB   1 1 
        1   622 1 1  44 ARG CD   C  -3.163 -10.018  23.222 1.00 . A A .  41 ARG CD   1 1 
        1   623 1 1  44 ARG CG   C  -4.487  -9.400  22.730 1.00 . A A .  41 ARG CG   1 1 
        1   624 1 1  44 ARG CZ   C  -3.550 -12.152  24.477 1.00 . A A .  41 ARG CZ   1 1 
        1   625 1 1  44 ARG H    H  -4.747  -7.405  19.080 1.00 . A A .  41 ARG H    1 1 
        1   626 1 1  44 ARG HA   H  -6.375  -9.182  20.752 1.00 . A A .  41 ARG HA   1 1 
        1   627 1 1  44 ARG HB2  H  -3.847  -9.459  20.677 1.00 . A A .  41 ARG HB2  1 1 
        1   628 1 1  44 ARG HB3  H  -3.724  -7.866  21.422 1.00 . A A .  41 ARG HB3  1 1 
        1   629 1 1  44 ARG HD2  H  -2.750 -10.645  22.438 1.00 . A A .  41 ARG HD2  1 1 
        1   630 1 1  44 ARG HD3  H  -2.463  -9.221  23.442 1.00 . A A .  41 ARG HD3  1 1 
        1   631 1 1  44 ARG HE   H  -3.353 -10.335  25.294 1.00 . A A .  41 ARG HE   1 1 
        1   632 1 1  44 ARG HG2  H  -4.815  -8.645  23.442 1.00 . A A .  41 ARG HG2  1 1 
        1   633 1 1  44 ARG HG3  H  -5.241 -10.181  22.678 1.00 . A A .  41 ARG HG3  1 1 
        1   634 1 1  44 ARG HH11 H  -3.481 -12.436  22.458 1.00 . A A .  41 ARG HH11 1 1 
        1   635 1 1  44 ARG HH12 H  -3.750 -13.861  23.404 1.00 . A A .  41 ARG HH12 1 1 
        1   636 1 1  44 ARG HH21 H  -3.681 -12.215  26.493 1.00 . A A .  41 ARG HH21 1 1 
        1   637 1 1  44 ARG HH22 H  -3.876 -13.736  25.686 1.00 . A A .  41 ARG HH22 1 1 
        1   638 1 1  44 ARG N    N  -5.469  -8.009  19.299 1.00 . A A .  41 ARG N    1 1 
        1   639 1 1  44 ARG NE   N  -3.360 -10.821  24.442 1.00 . A A .  41 ARG NE   1 1 
        1   640 1 1  44 ARG NH1  N  -3.593 -12.876  23.357 1.00 . A A .  41 ARG NH1  1 1 
        1   641 1 1  44 ARG NH2  N  -3.709 -12.750  25.644 1.00 . A A .  41 ARG NH2  1 1 
        1   642 1 1  44 ARG O    O  -5.603  -6.120  21.599 1.00 . A A .  41 ARG O    1 1 
        1   643 1 1  45 LEU C    C  -8.035  -6.441  23.927 1.00 . A A .  42 LEU C    1 1 
        1   644 1 1  45 LEU CA   C  -8.314  -6.213  22.436 1.00 . A A .  42 LEU CA   1 1 
        1   645 1 1  45 LEU CB   C  -9.854  -6.282  22.150 1.00 . A A .  42 LEU CB   1 1 
        1   646 1 1  45 LEU CD1  C  -9.815  -4.594  20.218 1.00 . A A .  42 LEU CD1  1 1 
        1   647 1 1  45 LEU CD2  C -10.009  -7.095  19.707 1.00 . A A .  42 LEU CD2  1 1 
        1   648 1 1  45 LEU CG   C -10.342  -5.958  20.696 1.00 . A A .  42 LEU CG   1 1 
        1   649 1 1  45 LEU H    H  -8.061  -8.039  21.413 1.00 . A A .  42 LEU H    1 1 
        1   650 1 1  45 LEU HA   H  -7.940  -5.230  22.142 1.00 . A A .  42 LEU HA   1 1 
        1   651 1 1  45 LEU HB2  H -10.193  -7.280  22.396 1.00 . A A .  42 LEU HB2  1 1 
        1   652 1 1  45 LEU HB3  H -10.352  -5.591  22.824 1.00 . A A .  42 LEU HB3  1 1 
        1   653 1 1  45 LEU HD11 H -10.140  -3.823  20.904 1.00 . A A .  42 LEU HD11 1 1 
        1   654 1 1  45 LEU HD12 H -10.204  -4.375  19.233 1.00 . A A .  42 LEU HD12 1 1 
        1   655 1 1  45 LEU HD13 H  -8.732  -4.606  20.181 1.00 . A A .  42 LEU HD13 1 1 
        1   656 1 1  45 LEU HD21 H -10.382  -6.845  18.722 1.00 . A A .  42 LEU HD21 1 1 
        1   657 1 1  45 LEU HD22 H -10.482  -8.010  20.044 1.00 . A A .  42 LEU HD22 1 1 
        1   658 1 1  45 LEU HD23 H  -8.938  -7.242  19.662 1.00 . A A .  42 LEU HD23 1 1 
        1   659 1 1  45 LEU HG   H -11.423  -5.870  20.717 1.00 . A A .  42 LEU HG   1 1 
        1   660 1 1  45 LEU N    N  -7.583  -7.229  21.686 1.00 . A A .  42 LEU N    1 1 
        1   661 1 1  45 LEU O    O  -8.230  -7.551  24.437 1.00 . A A .  42 LEU O    1 1 
        1   662 1 1  46 ARG C    C  -8.655  -5.586  26.884 1.00 . A A .  43 ARG C    1 1 
        1   663 1 1  46 ARG CA   C  -7.349  -5.409  26.080 1.00 . A A .  43 ARG CA   1 1 
        1   664 1 1  46 ARG CB   C  -6.572  -4.136  26.523 1.00 . A A .  43 ARG CB   1 1 
        1   665 1 1  46 ARG CD   C  -8.414  -2.282  26.469 1.00 . A A .  43 ARG CD   1 1 
        1   666 1 1  46 ARG CG   C  -7.057  -2.778  25.938 1.00 . A A .  43 ARG CG   1 1 
        1   667 1 1  46 ARG CZ   C  -9.353  -0.581  24.890 1.00 . A A .  43 ARG CZ   1 1 
        1   668 1 1  46 ARG H    H  -7.339  -4.583  24.117 1.00 . A A .  43 ARG H    1 1 
        1   669 1 1  46 ARG HA   H  -6.723  -6.272  26.286 1.00 . A A .  43 ARG HA   1 1 
        1   670 1 1  46 ARG HB2  H  -6.603  -4.066  27.605 1.00 . A A .  43 ARG HB2  1 1 
        1   671 1 1  46 ARG HB3  H  -5.533  -4.264  26.232 1.00 . A A .  43 ARG HB3  1 1 
        1   672 1 1  46 ARG HD2  H  -9.198  -2.954  26.129 1.00 . A A .  43 ARG HD2  1 1 
        1   673 1 1  46 ARG HD3  H  -8.390  -2.286  27.550 1.00 . A A .  43 ARG HD3  1 1 
        1   674 1 1  46 ARG HE   H  -8.352  -0.182  26.571 1.00 . A A .  43 ARG HE   1 1 
        1   675 1 1  46 ARG HG2  H  -6.313  -2.027  26.169 1.00 . A A .  43 ARG HG2  1 1 
        1   676 1 1  46 ARG HG3  H  -7.122  -2.876  24.859 1.00 . A A .  43 ARG HG3  1 1 
        1   677 1 1  46 ARG HH11 H  -9.869  -2.473  24.353 1.00 . A A .  43 ARG HH11 1 1 
        1   678 1 1  46 ARG HH12 H -10.396  -1.219  23.279 1.00 . A A .  43 ARG HH12 1 1 
        1   679 1 1  46 ARG HH21 H  -9.063   1.407  25.138 1.00 . A A .  43 ARG HH21 1 1 
        1   680 1 1  46 ARG HH22 H  -9.948   0.942  23.715 1.00 . A A .  43 ARG HH22 1 1 
        1   681 1 1  46 ARG N    N  -7.572  -5.391  24.615 1.00 . A A .  43 ARG N    1 1 
        1   682 1 1  46 ARG NE   N  -8.700  -0.911  26.012 1.00 . A A .  43 ARG NE   1 1 
        1   683 1 1  46 ARG NH1  N  -9.915  -1.500  24.112 1.00 . A A .  43 ARG NH1  1 1 
        1   684 1 1  46 ARG NH2  N  -9.465   0.688  24.556 1.00 . A A .  43 ARG NH2  1 1 
        1   685 1 1  46 ARG O    O  -8.621  -5.723  28.109 1.00 . A A .  43 ARG O    1 1 
        1   686 1 1  47 ASP C    C -11.213  -7.330  27.152 1.00 . A A .  44 ASP C    1 1 
        1   687 1 1  47 ASP CA   C -11.123  -5.843  26.732 1.00 . A A .  44 ASP CA   1 1 
        1   688 1 1  47 ASP CB   C -12.211  -5.516  25.673 1.00 . A A .  44 ASP CB   1 1 
        1   689 1 1  47 ASP CG   C -12.061  -4.095  25.088 1.00 . A A .  44 ASP CG   1 1 
        1   690 1 1  47 ASP H    H  -9.740  -5.299  25.227 1.00 . A A .  44 ASP H    1 1 
        1   691 1 1  47 ASP HA   H -11.271  -5.215  27.606 1.00 . A A .  44 ASP HA   1 1 
        1   692 1 1  47 ASP HB2  H -12.143  -6.233  24.859 1.00 . A A .  44 ASP HB2  1 1 
        1   693 1 1  47 ASP HB3  H -13.192  -5.605  26.133 1.00 . A A .  44 ASP HB3  1 1 
        1   694 1 1  47 ASP N    N  -9.794  -5.547  26.175 1.00 . A A .  44 ASP N    1 1 
        1   695 1 1  47 ASP O    O -11.995  -7.699  28.039 1.00 . A A .  44 ASP O    1 1 
        1   696 1 1  47 ASP OD1  O -12.648  -3.141  25.643 1.00 . A A .  44 ASP OD1  1 1 
        1   697 1 1  47 ASP OD2  O -11.322  -3.928  24.091 1.00 . A A .  44 ASP OD2  1 1 
        1   698 1 1  48 GLY C    C -10.653 -10.426  25.495 1.00 . A A .  45 GLY C    1 1 
        1   699 1 1  48 GLY CA   C -10.307  -9.605  26.730 1.00 . A A .  45 GLY CA   1 1 
        1   700 1 1  48 GLY H    H  -9.796  -7.776  25.809 1.00 . A A .  45 GLY H    1 1 
        1   701 1 1  48 GLY HA2  H  -9.293  -9.844  27.029 1.00 . A A .  45 GLY HA2  1 1 
        1   702 1 1  48 GLY HA3  H -10.977  -9.884  27.536 1.00 . A A .  45 GLY HA3  1 1 
        1   703 1 1  48 GLY N    N -10.385  -8.163  26.487 1.00 . A A .  45 GLY N    1 1 
        1   704 1 1  48 GLY O    O -10.743 -11.653  25.568 1.00 . A A .  45 GLY O    1 1 
        1   705 1 1  49 ARG C    C -10.137 -10.275  22.059 1.00 . A A .  46 ARG C    1 1 
        1   706 1 1  49 ARG CA   C -11.263 -10.378  23.084 1.00 . A A .  46 ARG CA   1 1 
        1   707 1 1  49 ARG CB   C -12.560  -9.704  22.526 1.00 . A A .  46 ARG CB   1 1 
        1   708 1 1  49 ARG CD   C -14.113 -10.904  24.212 1.00 . A A .  46 ARG CD   1 1 
        1   709 1 1  49 ARG CG   C -13.727  -9.567  23.538 1.00 . A A .  46 ARG CG   1 1 
        1   710 1 1  49 ARG CZ   C -14.583 -13.237  23.427 1.00 . A A .  46 ARG CZ   1 1 
        1   711 1 1  49 ARG H    H -10.591  -8.797  24.331 1.00 . A A .  46 ARG H    1 1 
        1   712 1 1  49 ARG HA   H -11.465 -11.431  23.272 1.00 . A A .  46 ARG HA   1 1 
        1   713 1 1  49 ARG HB2  H -12.316  -8.712  22.165 1.00 . A A .  46 ARG HB2  1 1 
        1   714 1 1  49 ARG HB3  H -12.914 -10.295  21.681 1.00 . A A .  46 ARG HB3  1 1 
        1   715 1 1  49 ARG HD2  H -13.230 -11.317  24.688 1.00 . A A .  46 ARG HD2  1 1 
        1   716 1 1  49 ARG HD3  H -14.858 -10.704  24.977 1.00 . A A .  46 ARG HD3  1 1 
        1   717 1 1  49 ARG HE   H -15.169 -11.554  22.498 1.00 . A A .  46 ARG HE   1 1 
        1   718 1 1  49 ARG HG2  H -13.432  -8.862  24.311 1.00 . A A .  46 ARG HG2  1 1 
        1   719 1 1  49 ARG HG3  H -14.595  -9.171  23.017 1.00 . A A .  46 ARG HG3  1 1 
        1   720 1 1  49 ARG HH11 H -13.307 -13.196  25.012 1.00 . A A .  46 ARG HH11 1 1 
        1   721 1 1  49 ARG HH12 H -13.796 -14.775  24.491 1.00 . A A .  46 ARG HH12 1 1 
        1   722 1 1  49 ARG HH21 H -15.791 -13.646  21.859 1.00 . A A .  46 ARG HH21 1 1 
        1   723 1 1  49 ARG HH22 H -15.183 -15.028  22.709 1.00 . A A .  46 ARG HH22 1 1 
        1   724 1 1  49 ARG N    N -10.826  -9.747  24.347 1.00 . A A .  46 ARG N    1 1 
        1   725 1 1  49 ARG NE   N -14.662 -11.902  23.269 1.00 . A A .  46 ARG NE   1 1 
        1   726 1 1  49 ARG NH1  N -13.832 -13.780  24.386 1.00 . A A .  46 ARG NH1  1 1 
        1   727 1 1  49 ARG NH2  N -15.236 -14.033  22.599 1.00 . A A .  46 ARG NH2  1 1 
        1   728 1 1  49 ARG O    O  -9.172  -9.532  22.266 1.00 . A A .  46 ARG O    1 1 
        1   729 1 1  50 GLU C    C -10.008 -11.174  18.513 1.00 . A A .  47 GLU C    1 1 
        1   730 1 1  50 GLU CA   C  -9.294 -11.037  19.858 1.00 . A A .  47 GLU CA   1 1 
        1   731 1 1  50 GLU CB   C  -8.214 -12.154  20.039 1.00 . A A .  47 GLU CB   1 1 
        1   732 1 1  50 GLU CD   C  -6.000 -12.804  21.212 1.00 . A A .  47 GLU CD   1 1 
        1   733 1 1  50 GLU CG   C  -7.261 -11.926  21.234 1.00 . A A .  47 GLU CG   1 1 
        1   734 1 1  50 GLU H    H -11.090 -11.543  20.849 1.00 . A A .  47 GLU H    1 1 
        1   735 1 1  50 GLU HA   H  -8.791 -10.074  19.857 1.00 . A A .  47 GLU HA   1 1 
        1   736 1 1  50 GLU HB2  H  -8.711 -13.110  20.177 1.00 . A A .  47 GLU HB2  1 1 
        1   737 1 1  50 GLU HB3  H  -7.614 -12.205  19.135 1.00 . A A .  47 GLU HB3  1 1 
        1   738 1 1  50 GLU HG2  H  -6.956 -10.883  21.232 1.00 . A A .  47 GLU HG2  1 1 
        1   739 1 1  50 GLU HG3  H  -7.810 -12.117  22.154 1.00 . A A .  47 GLU HG3  1 1 
        1   740 1 1  50 GLU N    N -10.276 -11.013  20.951 1.00 . A A .  47 GLU N    1 1 
        1   741 1 1  50 GLU O    O -11.153 -11.604  18.436 1.00 . A A .  47 GLU O    1 1 
        1   742 1 1  50 GLU OE1  O  -4.978 -12.386  20.613 1.00 . A A .  47 GLU OE1  1 1 
        1   743 1 1  50 GLU OE2  O  -6.010 -13.901  21.801 1.00 . A A .  47 GLU OE2  1 1 
        1   744 1 1  51 ASN C    C  -8.735 -11.462  15.225 1.00 . A A .  48 ASN C    1 1 
        1   745 1 1  51 ASN CA   C  -9.790 -10.738  16.069 1.00 . A A .  48 ASN CA   1 1 
        1   746 1 1  51 ASN CB   C  -9.988  -9.288  15.515 1.00 . A A .  48 ASN CB   1 1 
        1   747 1 1  51 ASN CG   C -11.218  -8.512  16.021 1.00 . A A .  48 ASN CG   1 1 
        1   748 1 1  51 ASN H    H  -8.439 -10.355  17.632 1.00 . A A .  48 ASN H    1 1 
        1   749 1 1  51 ASN HA   H -10.728 -11.286  16.015 1.00 . A A .  48 ASN HA   1 1 
        1   750 1 1  51 ASN HB2  H  -9.121  -8.700  15.774 1.00 . A A .  48 ASN HB2  1 1 
        1   751 1 1  51 ASN HB3  H -10.050  -9.334  14.429 1.00 . A A .  48 ASN HB3  1 1 
        1   752 1 1  51 ASN HD21 H -11.048  -9.220  17.853 1.00 . A A .  48 ASN HD21 1 1 
        1   753 1 1  51 ASN HD22 H -12.360  -8.144  17.596 1.00 . A A .  48 ASN HD22 1 1 
        1   754 1 1  51 ASN N    N  -9.326 -10.716  17.465 1.00 . A A .  48 ASN N    1 1 
        1   755 1 1  51 ASN ND2  N -11.577  -8.644  17.284 1.00 . A A .  48 ASN ND2  1 1 
        1   756 1 1  51 ASN O    O  -7.602 -11.642  15.667 1.00 . A A .  48 ASN O    1 1 
        1   757 1 1  51 ASN OD1  O -11.822  -7.748  15.269 1.00 . A A .  48 ASN OD1  1 1 
        1   758 1 1  52 LEU C    C  -8.462 -11.817  11.691 1.00 . A A .  49 LEU C    1 1 
        1   759 1 1  52 LEU CA   C  -8.195 -12.478  13.039 1.00 . A A .  49 LEU CA   1 1 
        1   760 1 1  52 LEU CB   C  -8.399 -14.027  12.965 1.00 . A A .  49 LEU CB   1 1 
        1   761 1 1  52 LEU CD1  C  -7.447 -16.402  12.864 1.00 . A A .  49 LEU CD1  1 1 
        1   762 1 1  52 LEU CD2  C  -6.225 -14.531  11.660 1.00 . A A .  49 LEU CD2  1 1 
        1   763 1 1  52 LEU CG   C  -7.107 -14.903  12.871 1.00 . A A .  49 LEU CG   1 1 
        1   764 1 1  52 LEU H    H -10.028 -11.711  13.735 1.00 . A A .  49 LEU H    1 1 
        1   765 1 1  52 LEU HA   H  -7.172 -12.259  13.338 1.00 . A A .  49 LEU HA   1 1 
        1   766 1 1  52 LEU HB2  H  -8.940 -14.331  13.851 1.00 . A A .  49 LEU HB2  1 1 
        1   767 1 1  52 LEU HB3  H  -9.026 -14.261  12.111 1.00 . A A .  49 LEU HB3  1 1 
        1   768 1 1  52 LEU HD11 H  -7.977 -16.655  13.770 1.00 . A A .  49 LEU HD11 1 1 
        1   769 1 1  52 LEU HD12 H  -6.537 -16.991  12.813 1.00 . A A .  49 LEU HD12 1 1 
        1   770 1 1  52 LEU HD13 H  -8.070 -16.635  12.009 1.00 . A A .  49 LEU HD13 1 1 
        1   771 1 1  52 LEU HD21 H  -5.358 -15.179  11.621 1.00 . A A .  49 LEU HD21 1 1 
        1   772 1 1  52 LEU HD22 H  -5.893 -13.507  11.759 1.00 . A A .  49 LEU HD22 1 1 
        1   773 1 1  52 LEU HD23 H  -6.793 -14.635  10.742 1.00 . A A .  49 LEU HD23 1 1 
        1   774 1 1  52 LEU HG   H  -6.523 -14.723  13.762 1.00 . A A .  49 LEU HG   1 1 
        1   775 1 1  52 LEU N    N  -9.107 -11.858  14.009 1.00 . A A .  49 LEU N    1 1 
        1   776 1 1  52 LEU O    O  -9.604 -11.477  11.378 1.00 . A A .  49 LEU O    1 1 
        1   777 1 1  53 TYR C    C  -6.676 -11.837   8.619 1.00 . A A .  50 TYR C    1 1 
        1   778 1 1  53 TYR CA   C  -7.446 -10.967   9.607 1.00 . A A .  50 TYR CA   1 1 
        1   779 1 1  53 TYR CB   C  -6.850  -9.537   9.690 1.00 . A A .  50 TYR CB   1 1 
        1   780 1 1  53 TYR CD1  C  -8.849  -8.269  10.598 1.00 . A A .  50 TYR CD1  1 1 
        1   781 1 1  53 TYR CD2  C  -6.905  -8.384  11.969 1.00 . A A .  50 TYR CD2  1 1 
        1   782 1 1  53 TYR CE1  C  -9.507  -7.565  11.579 1.00 . A A .  50 TYR CE1  1 1 
        1   783 1 1  53 TYR CE2  C  -7.561  -7.672  12.948 1.00 . A A .  50 TYR CE2  1 1 
        1   784 1 1  53 TYR CG   C  -7.537  -8.695  10.766 1.00 . A A .  50 TYR CG   1 1 
        1   785 1 1  53 TYR CZ   C  -8.864  -7.265  12.747 1.00 . A A .  50 TYR CZ   1 1 
        1   786 1 1  53 TYR H    H  -6.528 -11.875  11.264 1.00 . A A .  50 TYR H    1 1 
        1   787 1 1  53 TYR HA   H  -8.485 -10.907   9.286 1.00 . A A .  50 TYR HA   1 1 
        1   788 1 1  53 TYR HB2  H  -5.787  -9.594   9.918 1.00 . A A .  50 TYR HB2  1 1 
        1   789 1 1  53 TYR HB3  H  -6.978  -9.033   8.740 1.00 . A A .  50 TYR HB3  1 1 
        1   790 1 1  53 TYR HD1  H  -9.362  -8.495   9.670 1.00 . A A .  50 TYR HD1  1 1 
        1   791 1 1  53 TYR HD2  H  -5.882  -8.698  12.128 1.00 . A A .  50 TYR HD2  1 1 
        1   792 1 1  53 TYR HE1  H -10.531  -7.247  11.417 1.00 . A A .  50 TYR HE1  1 1 
        1   793 1 1  53 TYR HE2  H  -7.053  -7.431  13.871 1.00 . A A .  50 TYR HE2  1 1 
        1   794 1 1  53 TYR HH   H -10.435  -6.861  13.785 1.00 . A A .  50 TYR HH   1 1 
        1   795 1 1  53 TYR N    N  -7.400 -11.598  10.926 1.00 . A A .  50 TYR N    1 1 
        1   796 1 1  53 TYR O    O  -5.812 -12.602   9.028 1.00 . A A .  50 TYR O    1 1 
        1   797 1 1  53 TYR OH   O  -9.527  -6.555  13.723 1.00 . A A .  50 TYR OH   1 1 
        1   798 1 1  54 GLY C    C  -6.335 -11.730   4.964 1.00 . A A .  51 GLY C    1 1 
        1   799 1 1  54 GLY CA   C  -6.341 -12.492   6.276 1.00 . A A .  51 GLY CA   1 1 
        1   800 1 1  54 GLY H    H  -7.728 -11.109   7.086 1.00 . A A .  51 GLY H    1 1 
        1   801 1 1  54 GLY HA2  H  -5.314 -12.704   6.567 1.00 . A A .  51 GLY HA2  1 1 
        1   802 1 1  54 GLY HA3  H  -6.864 -13.426   6.135 1.00 . A A .  51 GLY HA3  1 1 
        1   803 1 1  54 GLY N    N  -7.010 -11.730   7.333 1.00 . A A .  51 GLY N    1 1 
        1   804 1 1  54 GLY O    O  -6.967 -10.673   4.878 1.00 . A A .  51 GLY O    1 1 
        1   805 1 1  55 PRO C    C  -7.037 -11.735   1.909 1.00 . A A .  52 PRO C    1 1 
        1   806 1 1  55 PRO CA   C  -5.647 -11.583   2.576 1.00 . A A .  52 PRO CA   1 1 
        1   807 1 1  55 PRO CB   C  -4.525 -12.324   1.802 1.00 . A A .  52 PRO CB   1 1 
        1   808 1 1  55 PRO CD   C  -4.759 -13.439   3.923 1.00 . A A .  52 PRO CD   1 1 
        1   809 1 1  55 PRO CG   C  -4.433 -13.670   2.461 1.00 . A A .  52 PRO CG   1 1 
        1   810 1 1  55 PRO HA   H  -5.401 -10.522   2.653 1.00 . A A .  52 PRO HA   1 1 
        1   811 1 1  55 PRO HB2  H  -4.778 -12.409   0.751 1.00 . A A .  52 PRO HB2  1 1 
        1   812 1 1  55 PRO HB3  H  -3.594 -11.774   1.901 1.00 . A A .  52 PRO HB3  1 1 
        1   813 1 1  55 PRO HD2  H  -5.292 -14.291   4.335 1.00 . A A .  52 PRO HD2  1 1 
        1   814 1 1  55 PRO HD3  H  -3.856 -13.255   4.496 1.00 . A A .  52 PRO HD3  1 1 
        1   815 1 1  55 PRO HG2  H  -5.152 -14.352   2.013 1.00 . A A .  52 PRO HG2  1 1 
        1   816 1 1  55 PRO HG3  H  -3.430 -14.073   2.354 1.00 . A A .  52 PRO HG3  1 1 
        1   817 1 1  55 PRO N    N  -5.626 -12.228   3.906 1.00 . A A .  52 PRO N    1 1 
        1   818 1 1  55 PRO O    O  -7.561 -12.849   1.792 1.00 . A A .  52 PRO O    1 1 
        1   819 1 1  56 ALA C    C  -8.944 -11.153  -0.537 1.00 . A A .  53 ALA C    1 1 
        1   820 1 1  56 ALA CA   C  -8.967 -10.542   0.884 1.00 . A A .  53 ALA CA   1 1 
        1   821 1 1  56 ALA CB   C  -9.464  -9.083   0.839 1.00 . A A .  53 ALA CB   1 1 
        1   822 1 1  56 ALA H    H  -7.150  -9.750   1.647 1.00 . A A .  53 ALA H    1 1 
        1   823 1 1  56 ALA HA   H  -9.653 -11.115   1.506 1.00 . A A .  53 ALA HA   1 1 
        1   824 1 1  56 ALA HB1  H  -9.496  -8.680   1.844 1.00 . A A .  53 ALA HB1  1 1 
        1   825 1 1  56 ALA HB2  H -10.460  -9.044   0.413 1.00 . A A .  53 ALA HB2  1 1 
        1   826 1 1  56 ALA HB3  H  -8.793  -8.481   0.239 1.00 . A A .  53 ALA HB3  1 1 
        1   827 1 1  56 ALA N    N  -7.632 -10.593   1.517 1.00 . A A .  53 ALA N    1 1 
        1   828 1 1  56 ALA O    O  -7.860 -11.275  -1.135 1.00 . A A .  53 ALA O    1 1 
        1   829 1 1  57 PRO C    C  -9.940 -10.808  -3.459 1.00 . A A .  54 PRO C    1 1 
        1   830 1 1  57 PRO CA   C -10.245 -11.985  -2.516 1.00 . A A .  54 PRO CA   1 1 
        1   831 1 1  57 PRO CB   C -11.715 -12.499  -2.659 1.00 . A A .  54 PRO CB   1 1 
        1   832 1 1  57 PRO CD   C -11.450 -11.688  -0.417 1.00 . A A .  54 PRO CD   1 1 
        1   833 1 1  57 PRO CG   C -12.184 -12.711  -1.251 1.00 . A A .  54 PRO CG   1 1 
        1   834 1 1  57 PRO HA   H  -9.550 -12.800  -2.730 1.00 . A A .  54 PRO HA   1 1 
        1   835 1 1  57 PRO HB2  H -12.326 -11.760  -3.172 1.00 . A A .  54 PRO HB2  1 1 
        1   836 1 1  57 PRO HB3  H -11.728 -13.425  -3.224 1.00 . A A .  54 PRO HB3  1 1 
        1   837 1 1  57 PRO HD2  H -11.974 -10.736  -0.420 1.00 . A A .  54 PRO HD2  1 1 
        1   838 1 1  57 PRO HD3  H -11.328 -12.041   0.599 1.00 . A A .  54 PRO HD3  1 1 
        1   839 1 1  57 PRO HG2  H -13.257 -12.556  -1.187 1.00 . A A .  54 PRO HG2  1 1 
        1   840 1 1  57 PRO HG3  H -11.936 -13.716  -0.921 1.00 . A A .  54 PRO HG3  1 1 
        1   841 1 1  57 PRO N    N -10.137 -11.567  -1.104 1.00 . A A .  54 PRO N    1 1 
        1   842 1 1  57 PRO O    O -10.826 -10.021  -3.810 1.00 . A A .  54 PRO O    1 1 
        1   843 1 1  58 GLN C    C  -8.547  -9.954  -6.134 1.00 . A A .  55 GLN C    1 1 
        1   844 1 1  58 GLN CA   C  -8.142  -9.620  -4.685 1.00 . A A .  55 GLN CA   1 1 
        1   845 1 1  58 GLN CB   C  -6.591  -9.514  -4.530 1.00 . A A .  55 GLN CB   1 1 
        1   846 1 1  58 GLN CD   C  -6.361  -7.066  -5.333 1.00 . A A .  55 GLN CD   1 1 
        1   847 1 1  58 GLN CG   C  -5.892  -8.521  -5.478 1.00 . A A .  55 GLN CG   1 1 
        1   848 1 1  58 GLN H    H  -8.002 -11.278  -3.377 1.00 . A A .  55 GLN H    1 1 
        1   849 1 1  58 GLN HA   H  -8.590  -8.673  -4.399 1.00 . A A .  55 GLN HA   1 1 
        1   850 1 1  58 GLN HB2  H  -6.363  -9.215  -3.510 1.00 . A A .  55 GLN HB2  1 1 
        1   851 1 1  58 GLN HB3  H  -6.161 -10.497  -4.695 1.00 . A A .  55 GLN HB3  1 1 
        1   852 1 1  58 GLN HE21 H  -6.062  -6.739  -7.273 1.00 . A A .  55 GLN HE21 1 1 
        1   853 1 1  58 GLN HE22 H  -6.652  -5.397  -6.369 1.00 . A A .  55 GLN HE22 1 1 
        1   854 1 1  58 GLN HG2  H  -4.824  -8.549  -5.282 1.00 . A A .  55 GLN HG2  1 1 
        1   855 1 1  58 GLN HG3  H  -6.065  -8.843  -6.500 1.00 . A A .  55 GLN HG3  1 1 
        1   856 1 1  58 GLN N    N  -8.647 -10.656  -3.777 1.00 . A A .  55 GLN N    1 1 
        1   857 1 1  58 GLN NE2  N  -6.361  -6.327  -6.435 1.00 . A A .  55 GLN NE2  1 1 
        1   858 1 1  58 GLN O    O  -8.623 -11.131  -6.504 1.00 . A A .  55 GLN O    1 1 
        1   859 1 1  58 GLN OE1  O  -6.727  -6.616  -4.248 1.00 . A A .  55 GLN OE1  1 1 
        1   860 1 1  59 SER C    C  -7.813  -9.246  -9.164 1.00 . A A .  56 SER C    1 1 
        1   861 1 1  59 SER CA   C  -9.130  -9.075  -8.370 1.00 . A A .  56 SER CA   1 1 
        1   862 1 1  59 SER CB   C  -9.950  -7.847  -8.855 1.00 . A A .  56 SER CB   1 1 
        1   863 1 1  59 SER H    H  -8.856  -8.021  -6.554 1.00 . A A .  56 SER H    1 1 
        1   864 1 1  59 SER HA   H  -9.735  -9.974  -8.498 1.00 . A A .  56 SER HA   1 1 
        1   865 1 1  59 SER HB2  H -10.088  -7.895  -9.928 1.00 . A A .  56 SER HB2  1 1 
        1   866 1 1  59 SER HB3  H -10.917  -7.851  -8.374 1.00 . A A .  56 SER HB3  1 1 
        1   867 1 1  59 SER HG   H  -8.468  -6.569  -9.028 1.00 . A A .  56 SER HG   1 1 
        1   868 1 1  59 SER N    N  -8.834  -8.922  -6.937 1.00 . A A .  56 SER N    1 1 
        1   869 1 1  59 SER O    O  -7.471  -8.421 -10.023 1.00 . A A .  56 SER O    1 1 
        1   870 1 1  59 SER OG   O  -9.295  -6.624  -8.538 1.00 . A A .  56 SER OG   1 1 
        1   871 1 1  60 PHE C    C  -5.913 -11.191 -10.865 1.00 . A A .  57 PHE C    1 1 
        1   872 1 1  60 PHE CA   C  -5.759 -10.592  -9.458 1.00 . A A .  57 PHE CA   1 1 
        1   873 1 1  60 PHE CB   C  -4.842 -11.437  -8.517 1.00 . A A .  57 PHE CB   1 1 
        1   874 1 1  60 PHE CD1  C  -5.489 -13.915  -8.594 1.00 . A A .  57 PHE CD1  1 1 
        1   875 1 1  60 PHE CD2  C  -5.897 -12.708  -6.575 1.00 . A A .  57 PHE CD2  1 1 
        1   876 1 1  60 PHE CE1  C  -5.982 -15.064  -8.003 1.00 . A A .  57 PHE CE1  1 1 
        1   877 1 1  60 PHE CE2  C  -6.393 -13.855  -5.986 1.00 . A A .  57 PHE CE2  1 1 
        1   878 1 1  60 PHE CG   C  -5.437 -12.710  -7.894 1.00 . A A .  57 PHE CG   1 1 
        1   879 1 1  60 PHE CZ   C  -6.433 -15.035  -6.700 1.00 . A A .  57 PHE CZ   1 1 
        1   880 1 1  60 PHE H    H  -7.430 -10.983  -8.218 1.00 . A A .  57 PHE H    1 1 
        1   881 1 1  60 PHE HA   H  -5.280  -9.617  -9.578 1.00 . A A .  57 PHE HA   1 1 
        1   882 1 1  60 PHE HB2  H  -3.956 -11.734  -9.066 1.00 . A A .  57 PHE HB2  1 1 
        1   883 1 1  60 PHE HB3  H  -4.520 -10.797  -7.699 1.00 . A A .  57 PHE HB3  1 1 
        1   884 1 1  60 PHE HD1  H  -5.139 -13.950  -9.620 1.00 . A A .  57 PHE HD1  1 1 
        1   885 1 1  60 PHE HD2  H  -5.872 -11.785  -6.006 1.00 . A A .  57 PHE HD2  1 1 
        1   886 1 1  60 PHE HE1  H  -6.016 -15.991  -8.564 1.00 . A A .  57 PHE HE1  1 1 
        1   887 1 1  60 PHE HE2  H  -6.741 -13.830  -4.961 1.00 . A A .  57 PHE HE2  1 1 
        1   888 1 1  60 PHE HZ   H  -6.819 -15.936  -6.236 1.00 . A A .  57 PHE HZ   1 1 
        1   889 1 1  60 PHE N    N  -7.069 -10.333  -8.855 1.00 . A A .  57 PHE N    1 1 
        1   890 1 1  60 PHE O    O  -6.334 -12.337 -11.025 1.00 . A A .  57 PHE O    1 1 
        1   891 1 1  61 ALA C    C  -4.553 -11.763 -13.622 1.00 . A A .  58 ALA C    1 1 
        1   892 1 1  61 ALA CA   C  -5.674 -10.760 -13.295 1.00 . A A .  58 ALA CA   1 1 
        1   893 1 1  61 ALA CB   C  -5.604  -9.511 -14.196 1.00 . A A .  58 ALA CB   1 1 
        1   894 1 1  61 ALA H    H  -5.290  -9.459 -11.665 1.00 . A A .  58 ALA H    1 1 
        1   895 1 1  61 ALA HA   H  -6.635 -11.239 -13.461 1.00 . A A .  58 ALA HA   1 1 
        1   896 1 1  61 ALA HB1  H  -5.703  -9.797 -15.236 1.00 . A A .  58 ALA HB1  1 1 
        1   897 1 1  61 ALA HB2  H  -4.655  -9.007 -14.050 1.00 . A A .  58 ALA HB2  1 1 
        1   898 1 1  61 ALA HB3  H  -6.407  -8.833 -13.938 1.00 . A A .  58 ALA HB3  1 1 
        1   899 1 1  61 ALA N    N  -5.596 -10.368 -11.881 1.00 . A A .  58 ALA N    1 1 
        1   900 1 1  61 ALA O    O  -3.462 -11.362 -14.008 1.00 . A A .  58 ALA O    1 1 
        1   901 1 1  62 ASP C    C  -2.668 -13.958 -12.545 1.00 . A A .  59 ASP C    1 1 
        1   902 1 1  62 ASP CA   C  -3.847 -14.164 -13.544 1.00 . A A .  59 ASP CA   1 1 
        1   903 1 1  62 ASP CB   C  -3.368 -14.301 -15.031 1.00 . A A .  59 ASP CB   1 1 
        1   904 1 1  62 ASP CG   C  -2.583 -15.600 -15.323 1.00 . A A .  59 ASP CG   1 1 
        1   905 1 1  62 ASP H    H  -5.752 -13.297 -13.138 1.00 . A A .  59 ASP H    1 1 
        1   906 1 1  62 ASP HA   H  -4.364 -15.076 -13.260 1.00 . A A .  59 ASP HA   1 1 
        1   907 1 1  62 ASP HB2  H  -4.235 -14.277 -15.683 1.00 . A A .  59 ASP HB2  1 1 
        1   908 1 1  62 ASP HB3  H  -2.739 -13.447 -15.265 1.00 . A A .  59 ASP HB3  1 1 
        1   909 1 1  62 ASP N    N  -4.834 -13.064 -13.403 1.00 . A A .  59 ASP N    1 1 
        1   910 1 1  62 ASP O    O  -1.490 -14.120 -12.885 1.00 . A A .  59 ASP O    1 1 
        1   911 1 1  62 ASP OD1  O  -3.143 -16.698 -15.100 1.00 . A A .  59 ASP OD1  1 1 
        1   912 1 1  62 ASP OD2  O  -1.419 -15.534 -15.785 1.00 . A A .  59 ASP OD2  1 1 
        1   913 1 1  63 ASP C    C  -1.131 -12.193 -10.317 1.00 . A A .  60 ASP C    1 1 
        1   914 1 1  63 ASP CA   C  -2.117 -13.369 -10.152 1.00 . A A .  60 ASP CA   1 1 
        1   915 1 1  63 ASP CB   C  -1.380 -14.693  -9.798 1.00 . A A .  60 ASP CB   1 1 
        1   916 1 1  63 ASP CG   C  -2.303 -15.718  -9.124 1.00 . A A .  60 ASP CG   1 1 
        1   917 1 1  63 ASP H    H  -3.993 -13.391 -11.154 1.00 . A A .  60 ASP H    1 1 
        1   918 1 1  63 ASP HA   H  -2.748 -13.110  -9.311 1.00 . A A .  60 ASP HA   1 1 
        1   919 1 1  63 ASP HB2  H  -0.981 -15.130 -10.707 1.00 . A A .  60 ASP HB2  1 1 
        1   920 1 1  63 ASP HB3  H  -0.549 -14.483  -9.130 1.00 . A A .  60 ASP HB3  1 1 
        1   921 1 1  63 ASP N    N  -3.041 -13.557 -11.305 1.00 . A A .  60 ASP N    1 1 
        1   922 1 1  63 ASP O    O  -0.093 -12.154  -9.644 1.00 . A A .  60 ASP O    1 1 
        1   923 1 1  63 ASP OD1  O  -3.007 -16.464  -9.835 1.00 . A A .  60 ASP OD1  1 1 
        1   924 1 1  63 ASP OD2  O  -2.329 -15.777  -7.873 1.00 . A A .  60 ASP OD2  1 1 
        1   925 1 1  64 GLU C    C  -0.785  -9.139  -9.968 1.00 . A A .  61 GLU C    1 1 
        1   926 1 1  64 GLU CA   C  -0.725  -9.945 -11.281 1.00 . A A .  61 GLU CA   1 1 
        1   927 1 1  64 GLU CB   C  -1.277  -9.089 -12.454 1.00 . A A .  61 GLU CB   1 1 
        1   928 1 1  64 GLU CD   C   0.530  -9.648 -14.194 1.00 . A A .  61 GLU CD   1 1 
        1   929 1 1  64 GLU CG   C  -0.968  -9.648 -13.852 1.00 . A A .  61 GLU CG   1 1 
        1   930 1 1  64 GLU H    H  -2.287 -11.332 -11.712 1.00 . A A .  61 GLU H    1 1 
        1   931 1 1  64 GLU HA   H   0.312 -10.200 -11.491 1.00 . A A .  61 GLU HA   1 1 
        1   932 1 1  64 GLU HB2  H  -2.358  -9.017 -12.353 1.00 . A A .  61 GLU HB2  1 1 
        1   933 1 1  64 GLU HB3  H  -0.860  -8.087 -12.391 1.00 . A A .  61 GLU HB3  1 1 
        1   934 1 1  64 GLU HG2  H  -1.345 -10.666 -13.908 1.00 . A A .  61 GLU HG2  1 1 
        1   935 1 1  64 GLU HG3  H  -1.492  -9.046 -14.586 1.00 . A A .  61 GLU HG3  1 1 
        1   936 1 1  64 GLU N    N  -1.491 -11.207 -11.154 1.00 . A A .  61 GLU N    1 1 
        1   937 1 1  64 GLU O    O   0.242  -8.840  -9.351 1.00 . A A .  61 GLU O    1 1 
        1   938 1 1  64 GLU OE1  O   1.067  -8.574 -14.558 1.00 . A A .  61 GLU OE1  1 1 
        1   939 1 1  64 GLU OE2  O   1.183 -10.713 -14.099 1.00 . A A .  61 GLU OE2  1 1 
        1   940 1 1  65 ASP C    C  -1.750  -8.360  -7.041 1.00 . A A .  62 ASP C    1 1 
        1   941 1 1  65 ASP CA   C  -2.319  -7.923  -8.416 1.00 . A A .  62 ASP CA   1 1 
        1   942 1 1  65 ASP CB   C  -3.848  -7.729  -8.302 1.00 . A A .  62 ASP CB   1 1 
        1   943 1 1  65 ASP CG   C  -4.506  -7.105  -9.550 1.00 . A A .  62 ASP CG   1 1 
        1   944 1 1  65 ASP H    H  -2.773  -9.306  -9.963 1.00 . A A .  62 ASP H    1 1 
        1   945 1 1  65 ASP HA   H  -1.876  -6.966  -8.675 1.00 . A A .  62 ASP HA   1 1 
        1   946 1 1  65 ASP HB2  H  -4.312  -8.692  -8.127 1.00 . A A .  62 ASP HB2  1 1 
        1   947 1 1  65 ASP HB3  H  -4.053  -7.090  -7.441 1.00 . A A .  62 ASP HB3  1 1 
        1   948 1 1  65 ASP N    N  -2.017  -8.864  -9.522 1.00 . A A .  62 ASP N    1 1 
        1   949 1 1  65 ASP O    O  -1.834  -7.600  -6.074 1.00 . A A .  62 ASP O    1 1 
        1   950 1 1  65 ASP OD1  O  -4.378  -7.684 -10.658 1.00 . A A .  62 ASP OD1  1 1 
        1   951 1 1  65 ASP OD2  O  -5.170  -6.047  -9.426 1.00 . A A .  62 ASP OD2  1 1 
        1   952 1 1  66 ILE C    C   0.665  -9.281  -5.344 1.00 . A A .  63 ILE C    1 1 
        1   953 1 1  66 ILE CA   C  -0.580 -10.123  -5.730 1.00 . A A .  63 ILE CA   1 1 
        1   954 1 1  66 ILE CB   C  -0.171 -11.642  -5.923 1.00 . A A .  63 ILE CB   1 1 
        1   955 1 1  66 ILE CD1  C  -2.569 -12.483  -5.442 1.00 . A A .  63 ILE CD1  1 1 
        1   956 1 1  66 ILE CG1  C  -1.396 -12.491  -6.398 1.00 . A A .  63 ILE CG1  1 1 
        1   957 1 1  66 ILE CG2  C   0.448 -12.248  -4.631 1.00 . A A .  63 ILE CG2  1 1 
        1   958 1 1  66 ILE H    H  -1.237 -10.156  -7.751 1.00 . A A .  63 ILE H    1 1 
        1   959 1 1  66 ILE HA   H  -1.311 -10.061  -4.924 1.00 . A A .  63 ILE HA   1 1 
        1   960 1 1  66 ILE HB   H   0.593 -11.682  -6.696 1.00 . A A .  63 ILE HB   1 1 
        1   961 1 1  66 ILE HD11 H  -3.349 -13.118  -5.836 1.00 . A A .  63 ILE HD11 1 1 
        1   962 1 1  66 ILE HD12 H  -2.946 -11.476  -5.339 1.00 . A A .  63 ILE HD12 1 1 
        1   963 1 1  66 ILE HD13 H  -2.255 -12.857  -4.480 1.00 . A A .  63 ILE HD13 1 1 
        1   964 1 1  66 ILE HG12 H  -1.750 -12.108  -7.345 1.00 . A A .  63 ILE HG12 1 1 
        1   965 1 1  66 ILE HG13 H  -1.092 -13.525  -6.536 1.00 . A A .  63 ILE HG13 1 1 
        1   966 1 1  66 ILE HG21 H   0.730 -13.282  -4.808 1.00 . A A .  63 ILE HG21 1 1 
        1   967 1 1  66 ILE HG22 H  -0.274 -12.212  -3.824 1.00 . A A .  63 ILE HG22 1 1 
        1   968 1 1  66 ILE HG23 H   1.328 -11.685  -4.347 1.00 . A A .  63 ILE HG23 1 1 
        1   969 1 1  66 ILE N    N  -1.213  -9.588  -6.958 1.00 . A A .  63 ILE N    1 1 
        1   970 1 1  66 ILE O    O   0.915  -9.010  -4.166 1.00 . A A .  63 ILE O    1 1 
        1   971 1 1  67 MET C    C   2.772  -6.903  -7.176 1.00 . A A .  64 MET C    1 1 
        1   972 1 1  67 MET CA   C   2.682  -8.100  -6.195 1.00 . A A .  64 MET CA   1 1 
        1   973 1 1  67 MET CB   C   3.898  -9.082  -6.331 1.00 . A A .  64 MET CB   1 1 
        1   974 1 1  67 MET CE   C   2.949 -10.983  -9.958 1.00 . A A .  64 MET CE   1 1 
        1   975 1 1  67 MET CG   C   3.736 -10.177  -7.404 1.00 . A A .  64 MET CG   1 1 
        1   976 1 1  67 MET H    H   1.121  -9.051  -7.276 1.00 . A A .  64 MET H    1 1 
        1   977 1 1  67 MET HA   H   2.690  -7.684  -5.190 1.00 . A A .  64 MET HA   1 1 
        1   978 1 1  67 MET HB2  H   4.794  -8.516  -6.563 1.00 . A A .  64 MET HB2  1 1 
        1   979 1 1  67 MET HB3  H   4.049  -9.574  -5.374 1.00 . A A .  64 MET HB3  1 1 
        1   980 1 1  67 MET HE1  H   2.055 -11.383  -9.491 1.00 . A A .  64 MET HE1  1 1 
        1   981 1 1  67 MET HE2  H   3.730 -11.729  -9.938 1.00 . A A .  64 MET HE2  1 1 
        1   982 1 1  67 MET HE3  H   2.730 -10.720 -10.983 1.00 . A A .  64 MET HE3  1 1 
        1   983 1 1  67 MET HG2  H   4.627 -10.793  -7.413 1.00 . A A .  64 MET HG2  1 1 
        1   984 1 1  67 MET HG3  H   2.883 -10.796  -7.143 1.00 . A A .  64 MET HG3  1 1 
        1   985 1 1  67 MET N    N   1.419  -8.852  -6.367 1.00 . A A .  64 MET N    1 1 
        1   986 1 1  67 MET O    O   3.813  -6.239  -7.251 1.00 . A A .  64 MET O    1 1 
        1   987 1 1  67 MET SD   S   3.485  -9.521  -9.067 1.00 . A A .  64 MET SD   1 1 
        1   988 1 1  68 ARG C    C   0.490  -4.467  -8.339 1.00 . A A .  65 ARG C    1 1 
        1   989 1 1  68 ARG CA   C   1.573  -5.450  -8.820 1.00 . A A .  65 ARG CA   1 1 
        1   990 1 1  68 ARG CB   C   1.268  -5.899 -10.277 1.00 . A A .  65 ARG CB   1 1 
        1   991 1 1  68 ARG CD   C   3.747  -6.302 -10.909 1.00 . A A .  65 ARG CD   1 1 
        1   992 1 1  68 ARG CG   C   2.306  -6.860 -10.897 1.00 . A A .  65 ARG CG   1 1 
        1   993 1 1  68 ARG CZ   C   3.933  -4.869 -12.967 1.00 . A A .  65 ARG CZ   1 1 
        1   994 1 1  68 ARG H    H   0.892  -7.196  -7.820 1.00 . A A .  65 ARG H    1 1 
        1   995 1 1  68 ARG HA   H   2.527  -4.926  -8.812 1.00 . A A .  65 ARG HA   1 1 
        1   996 1 1  68 ARG HB2  H   0.302  -6.401 -10.294 1.00 . A A .  65 ARG HB2  1 1 
        1   997 1 1  68 ARG HB3  H   1.205  -5.017 -10.911 1.00 . A A .  65 ARG HB3  1 1 
        1   998 1 1  68 ARG HD2  H   4.076  -6.151  -9.883 1.00 . A A .  65 ARG HD2  1 1 
        1   999 1 1  68 ARG HD3  H   4.401  -7.029 -11.379 1.00 . A A .  65 ARG HD3  1 1 
        1  1000 1 1  68 ARG HE   H   3.887  -4.212 -11.073 1.00 . A A .  65 ARG HE   1 1 
        1  1001 1 1  68 ARG HG2  H   2.301  -7.786 -10.331 1.00 . A A .  65 ARG HG2  1 1 
        1  1002 1 1  68 ARG HG3  H   2.009  -7.076 -11.920 1.00 . A A .  65 ARG HG3  1 1 
        1  1003 1 1  68 ARG HH11 H   3.701  -6.839 -13.412 1.00 . A A .  65 ARG HH11 1 1 
        1  1004 1 1  68 ARG HH12 H   3.893  -5.789 -14.779 1.00 . A A .  65 ARG HH12 1 1 
        1  1005 1 1  68 ARG HH21 H   4.149  -2.863 -12.867 1.00 . A A .  65 ARG HH21 1 1 
        1  1006 1 1  68 ARG HH22 H   4.150  -3.531 -14.466 1.00 . A A .  65 ARG HH22 1 1 
        1  1007 1 1  68 ARG N    N   1.669  -6.616  -7.906 1.00 . A A .  65 ARG N    1 1 
        1  1008 1 1  68 ARG NE   N   3.852  -5.019 -11.630 1.00 . A A .  65 ARG NE   1 1 
        1  1009 1 1  68 ARG NH1  N   3.836  -5.917 -13.786 1.00 . A A .  65 ARG NH1  1 1 
        1  1010 1 1  68 ARG NH2  N   4.089  -3.659 -13.474 1.00 . A A .  65 ARG NH2  1 1 
        1  1011 1 1  68 ARG O    O   0.376  -3.359  -8.877 1.00 . A A .  65 ARG O    1 1 
        1  1012 1 1  69 ALA C    C  -1.387  -4.265  -5.207 1.00 . A A .  66 ALA C    1 1 
        1  1013 1 1  69 ALA CA   C  -1.363  -4.055  -6.726 1.00 . A A .  66 ALA CA   1 1 
        1  1014 1 1  69 ALA CB   C  -2.735  -4.374  -7.351 1.00 . A A .  66 ALA CB   1 1 
        1  1015 1 1  69 ALA H    H  -0.156  -5.783  -6.960 1.00 . A A .  66 ALA H    1 1 
        1  1016 1 1  69 ALA HA   H  -1.135  -3.006  -6.924 1.00 . A A .  66 ALA HA   1 1 
        1  1017 1 1  69 ALA HB1  H  -2.685  -4.244  -8.425 1.00 . A A .  66 ALA HB1  1 1 
        1  1018 1 1  69 ALA HB2  H  -3.487  -3.707  -6.950 1.00 . A A .  66 ALA HB2  1 1 
        1  1019 1 1  69 ALA HB3  H  -3.015  -5.398  -7.131 1.00 . A A .  66 ALA HB3  1 1 
        1  1020 1 1  69 ALA N    N  -0.300  -4.883  -7.328 1.00 . A A .  66 ALA N    1 1 
        1  1021 1 1  69 ALA O    O  -0.928  -5.304  -4.707 1.00 . A A .  66 ALA O    1 1 
        1  1022 1 1  70 GLU C    C  -3.302  -4.258  -2.754 1.00 . A A .  67 GLU C    1 1 
        1  1023 1 1  70 GLU CA   C  -2.086  -3.346  -3.028 1.00 . A A .  67 GLU CA   1 1 
        1  1024 1 1  70 GLU CB   C  -2.303  -1.947  -2.397 1.00 . A A .  67 GLU CB   1 1 
        1  1025 1 1  70 GLU CD   C  -2.925  -0.638  -0.278 1.00 . A A .  67 GLU CD   1 1 
        1  1026 1 1  70 GLU CG   C  -2.447  -1.972  -0.859 1.00 . A A .  67 GLU CG   1 1 
        1  1027 1 1  70 GLU H    H  -2.087  -2.404  -4.916 1.00 . A A .  67 GLU H    1 1 
        1  1028 1 1  70 GLU HA   H  -1.192  -3.794  -2.586 1.00 . A A .  67 GLU HA   1 1 
        1  1029 1 1  70 GLU HB2  H  -1.459  -1.310  -2.647 1.00 . A A .  67 GLU HB2  1 1 
        1  1030 1 1  70 GLU HB3  H  -3.202  -1.511  -2.820 1.00 . A A .  67 GLU HB3  1 1 
        1  1031 1 1  70 GLU HG2  H  -3.157  -2.748  -0.587 1.00 . A A .  67 GLU HG2  1 1 
        1  1032 1 1  70 GLU HG3  H  -1.484  -2.223  -0.424 1.00 . A A .  67 GLU HG3  1 1 
        1  1033 1 1  70 GLU N    N  -1.873  -3.248  -4.471 1.00 . A A .  67 GLU N    1 1 
        1  1034 1 1  70 GLU O    O  -4.466  -3.829  -2.871 1.00 . A A .  67 GLU O    1 1 
        1  1035 1 1  70 GLU OE1  O  -4.147  -0.389  -0.273 1.00 . A A .  67 GLU OE1  1 1 
        1  1036 1 1  70 GLU OE2  O  -2.091   0.168   0.174 1.00 . A A .  67 GLU OE2  1 1 
        1  1037 1 1  71 ARG C    C  -4.439  -6.150  -0.586 1.00 . A A .  68 ARG C    1 1 
        1  1038 1 1  71 ARG CA   C  -3.983  -6.520  -2.019 1.00 . A A .  68 ARG CA   1 1 
        1  1039 1 1  71 ARG CB   C  -3.367  -7.957  -2.089 1.00 . A A .  68 ARG CB   1 1 
        1  1040 1 1  71 ARG CD   C  -1.319  -9.470  -1.691 1.00 . A A .  68 ARG CD   1 1 
        1  1041 1 1  71 ARG CG   C  -1.948  -8.083  -1.482 1.00 . A A .  68 ARG CG   1 1 
        1  1042 1 1  71 ARG CZ   C   0.857 -10.545  -1.089 1.00 . A A .  68 ARG CZ   1 1 
        1  1043 1 1  71 ARG H    H  -2.080  -5.827  -2.640 1.00 . A A .  68 ARG H    1 1 
        1  1044 1 1  71 ARG HA   H  -4.843  -6.477  -2.686 1.00 . A A .  68 ARG HA   1 1 
        1  1045 1 1  71 ARG HB2  H  -4.018  -8.650  -1.568 1.00 . A A .  68 ARG HB2  1 1 
        1  1046 1 1  71 ARG HB3  H  -3.313  -8.260  -3.132 1.00 . A A .  68 ARG HB3  1 1 
        1  1047 1 1  71 ARG HD2  H  -1.830 -10.189  -1.057 1.00 . A A .  68 ARG HD2  1 1 
        1  1048 1 1  71 ARG HD3  H  -1.438  -9.765  -2.730 1.00 . A A .  68 ARG HD3  1 1 
        1  1049 1 1  71 ARG HE   H   0.569  -8.595  -1.400 1.00 . A A .  68 ARG HE   1 1 
        1  1050 1 1  71 ARG HG2  H  -1.306  -7.338  -1.940 1.00 . A A .  68 ARG HG2  1 1 
        1  1051 1 1  71 ARG HG3  H  -2.007  -7.882  -0.416 1.00 . A A .  68 ARG HG3  1 1 
        1  1052 1 1  71 ARG HH11 H  -0.687 -11.869  -1.120 1.00 . A A .  68 ARG HH11 1 1 
        1  1053 1 1  71 ARG HH12 H   0.866 -12.551  -0.758 1.00 . A A .  68 ARG HH12 1 1 
        1  1054 1 1  71 ARG HH21 H   2.577  -9.493  -0.979 1.00 . A A .  68 ARG HH21 1 1 
        1  1055 1 1  71 ARG HH22 H   2.732 -11.198  -0.716 1.00 . A A .  68 ARG HH22 1 1 
        1  1056 1 1  71 ARG N    N  -3.005  -5.534  -2.493 1.00 . A A .  68 ARG N    1 1 
        1  1057 1 1  71 ARG NE   N   0.119  -9.466  -1.368 1.00 . A A .  68 ARG NE   1 1 
        1  1058 1 1  71 ARG NH1  N   0.302 -11.753  -0.986 1.00 . A A .  68 ARG NH1  1 1 
        1  1059 1 1  71 ARG NH2  N   2.157 -10.400  -0.910 1.00 . A A .  68 ARG NH2  1 1 
        1  1060 1 1  71 ARG O    O  -3.638  -6.171   0.361 1.00 . A A .  68 ARG O    1 1 
        1  1061 1 1  72 ARG C    C  -6.622  -6.638   1.645 1.00 . A A .  69 ARG C    1 1 
        1  1062 1 1  72 ARG CA   C  -6.327  -5.373   0.818 1.00 . A A .  69 ARG CA   1 1 
        1  1063 1 1  72 ARG CB   C  -7.614  -4.545   0.531 1.00 . A A .  69 ARG CB   1 1 
        1  1064 1 1  72 ARG CD   C  -9.412  -2.921   1.375 1.00 . A A .  69 ARG CD   1 1 
        1  1065 1 1  72 ARG CG   C  -8.294  -3.904   1.761 1.00 . A A .  69 ARG CG   1 1 
        1  1066 1 1  72 ARG CZ   C  -9.472  -1.273  -0.513 1.00 . A A .  69 ARG CZ   1 1 
        1  1067 1 1  72 ARG H    H  -6.280  -5.710  -1.254 1.00 . A A .  69 ARG H    1 1 
        1  1068 1 1  72 ARG HA   H  -5.620  -4.752   1.363 1.00 . A A .  69 ARG HA   1 1 
        1  1069 1 1  72 ARG HB2  H  -7.354  -3.747  -0.159 1.00 . A A .  69 ARG HB2  1 1 
        1  1070 1 1  72 ARG HB3  H  -8.336  -5.192   0.040 1.00 . A A .  69 ARG HB3  1 1 
        1  1071 1 1  72 ARG HD2  H -10.182  -3.450   0.818 1.00 . A A .  69 ARG HD2  1 1 
        1  1072 1 1  72 ARG HD3  H  -9.848  -2.516   2.280 1.00 . A A .  69 ARG HD3  1 1 
        1  1073 1 1  72 ARG HE   H  -8.021  -1.433   0.854 1.00 . A A .  69 ARG HE   1 1 
        1  1074 1 1  72 ARG HG2  H  -8.715  -4.691   2.378 1.00 . A A .  69 ARG HG2  1 1 
        1  1075 1 1  72 ARG HG3  H  -7.542  -3.370   2.335 1.00 . A A .  69 ARG HG3  1 1 
        1  1076 1 1  72 ARG HH11 H -11.122  -2.446  -0.438 1.00 . A A .  69 ARG HH11 1 1 
        1  1077 1 1  72 ARG HH12 H -11.081  -1.299  -1.733 1.00 . A A .  69 ARG HH12 1 1 
        1  1078 1 1  72 ARG HH21 H  -7.985   0.052  -0.850 1.00 . A A .  69 ARG HH21 1 1 
        1  1079 1 1  72 ARG HH22 H  -9.300   0.111  -1.972 1.00 . A A .  69 ARG HH22 1 1 
        1  1080 1 1  72 ARG N    N  -5.719  -5.752  -0.457 1.00 . A A .  69 ARG N    1 1 
        1  1081 1 1  72 ARG NE   N  -8.885  -1.805   0.568 1.00 . A A .  69 ARG NE   1 1 
        1  1082 1 1  72 ARG NH1  N -10.651  -1.708  -0.930 1.00 . A A .  69 ARG NH1  1 1 
        1  1083 1 1  72 ARG NH2  N  -8.872  -0.292  -1.164 1.00 . A A .  69 ARG NH2  1 1 
        1  1084 1 1  72 ARG O    O  -6.593  -7.760   1.125 1.00 . A A .  69 ARG O    1 1 
        1  1085 1 1  73 PHE C    C  -8.623  -7.640   4.169 1.00 . A A .  70 PHE C    1 1 
        1  1086 1 1  73 PHE CA   C  -7.133  -7.536   3.886 1.00 . A A .  70 PHE CA   1 1 
        1  1087 1 1  73 PHE CB   C  -6.308  -7.316   5.183 1.00 . A A .  70 PHE CB   1 1 
        1  1088 1 1  73 PHE CD1  C  -4.067  -7.264   3.995 1.00 . A A .  70 PHE CD1  1 1 
        1  1089 1 1  73 PHE CD2  C  -4.269  -8.592   5.973 1.00 . A A .  70 PHE CD2  1 1 
        1  1090 1 1  73 PHE CE1  C  -2.759  -7.660   3.856 1.00 . A A .  70 PHE CE1  1 1 
        1  1091 1 1  73 PHE CE2  C  -2.962  -8.978   5.838 1.00 . A A .  70 PHE CE2  1 1 
        1  1092 1 1  73 PHE CG   C  -4.850  -7.725   5.054 1.00 . A A .  70 PHE CG   1 1 
        1  1093 1 1  73 PHE CZ   C  -2.207  -8.515   4.778 1.00 . A A .  70 PHE CZ   1 1 
        1  1094 1 1  73 PHE H    H  -6.869  -5.531   3.285 1.00 . A A .  70 PHE H    1 1 
        1  1095 1 1  73 PHE HA   H  -6.819  -8.475   3.427 1.00 . A A .  70 PHE HA   1 1 
        1  1096 1 1  73 PHE HB2  H  -6.334  -6.266   5.453 1.00 . A A .  70 PHE HB2  1 1 
        1  1097 1 1  73 PHE HB3  H  -6.751  -7.892   5.991 1.00 . A A .  70 PHE HB3  1 1 
        1  1098 1 1  73 PHE HD1  H  -4.501  -6.584   3.271 1.00 . A A .  70 PHE HD1  1 1 
        1  1099 1 1  73 PHE HD2  H  -4.855  -8.957   6.807 1.00 . A A .  70 PHE HD2  1 1 
        1  1100 1 1  73 PHE HE1  H  -2.162  -7.297   3.026 1.00 . A A .  70 PHE HE1  1 1 
        1  1101 1 1  73 PHE HE2  H  -2.519  -9.654   6.561 1.00 . A A .  70 PHE HE2  1 1 
        1  1102 1 1  73 PHE HZ   H  -1.174  -8.831   4.671 1.00 . A A .  70 PHE HZ   1 1 
        1  1103 1 1  73 PHE N    N  -6.865  -6.449   2.941 1.00 . A A .  70 PHE N    1 1 
        1  1104 1 1  73 PHE O    O  -9.416  -6.889   3.619 1.00 . A A .  70 PHE O    1 1 
        1  1105 1 1  74 GLU C    C -10.328  -9.372   6.871 1.00 . A A .  71 GLU C    1 1 
        1  1106 1 1  74 GLU CA   C -10.355  -8.900   5.415 1.00 . A A .  71 GLU CA   1 1 
        1  1107 1 1  74 GLU CB   C -11.010  -9.982   4.534 1.00 . A A .  71 GLU CB   1 1 
        1  1108 1 1  74 GLU CD   C -11.226 -12.476   4.033 1.00 . A A .  71 GLU CD   1 1 
        1  1109 1 1  74 GLU CG   C -10.341 -11.374   4.615 1.00 . A A .  71 GLU CG   1 1 
        1  1110 1 1  74 GLU H    H  -8.283  -9.227   5.305 1.00 . A A .  71 GLU H    1 1 
        1  1111 1 1  74 GLU HA   H -10.932  -7.979   5.354 1.00 . A A .  71 GLU HA   1 1 
        1  1112 1 1  74 GLU HB2  H -12.052 -10.082   4.826 1.00 . A A .  71 GLU HB2  1 1 
        1  1113 1 1  74 GLU HB3  H -10.981  -9.652   3.500 1.00 . A A .  71 GLU HB3  1 1 
        1  1114 1 1  74 GLU HG2  H  -9.403 -11.347   4.062 1.00 . A A .  71 GLU HG2  1 1 
        1  1115 1 1  74 GLU HG3  H -10.121 -11.605   5.652 1.00 . A A .  71 GLU HG3  1 1 
        1  1116 1 1  74 GLU N    N  -8.982  -8.635   4.975 1.00 . A A .  71 GLU N    1 1 
        1  1117 1 1  74 GLU O    O  -9.262  -9.676   7.404 1.00 . A A .  71 GLU O    1 1 
        1  1118 1 1  74 GLU OE1  O -11.301 -12.584   2.805 1.00 . A A .  71 GLU OE1  1 1 
        1  1119 1 1  74 GLU OE2  O -11.874 -13.216   4.812 1.00 . A A .  71 GLU OE2  1 1 
        1  1120 1 1  75 THR C    C -12.040 -11.408   8.872 1.00 . A A .  72 THR C    1 1 
        1  1121 1 1  75 THR CA   C -11.637  -9.916   8.879 1.00 . A A .  72 THR CA   1 1 
        1  1122 1 1  75 THR CB   C -12.702  -9.057   9.639 1.00 . A A .  72 THR CB   1 1 
        1  1123 1 1  75 THR CG2  C -12.696  -9.314  11.151 1.00 . A A .  72 THR CG2  1 1 
        1  1124 1 1  75 THR H    H -12.312  -9.203   7.013 1.00 . A A .  72 THR H    1 1 
        1  1125 1 1  75 THR HA   H -10.677  -9.793   9.384 1.00 . A A .  72 THR HA   1 1 
        1  1126 1 1  75 THR HB   H -13.689  -9.298   9.252 1.00 . A A .  72 THR HB   1 1 
        1  1127 1 1  75 THR HG1  H -13.305  -7.190   9.378 1.00 . A A .  72 THR HG1  1 1 
        1  1128 1 1  75 THR HG21 H -13.460  -8.714  11.628 1.00 . A A .  72 THR HG21 1 1 
        1  1129 1 1  75 THR HG22 H -11.729  -9.048  11.562 1.00 . A A .  72 THR HG22 1 1 
        1  1130 1 1  75 THR HG23 H -12.890 -10.361  11.347 1.00 . A A .  72 THR HG23 1 1 
        1  1131 1 1  75 THR N    N -11.503  -9.449   7.498 1.00 . A A .  72 THR N    1 1 
        1  1132 1 1  75 THR O    O -13.160 -11.737   8.475 1.00 . A A .  72 THR O    1 1 
        1  1133 1 1  75 THR OG1  O -12.461  -7.657   9.403 1.00 . A A .  72 THR OG1  1 1 
        1  1134 1 1  76 ARG C    C -12.335 -13.962  10.622 1.00 . A A .  73 ARG C    1 1 
        1  1135 1 1  76 ARG CA   C -11.400 -13.747   9.414 1.00 . A A .  73 ARG CA   1 1 
        1  1136 1 1  76 ARG CB   C -10.082 -14.570   9.583 1.00 . A A .  73 ARG CB   1 1 
        1  1137 1 1  76 ARG CD   C -10.098 -15.648   7.247 1.00 . A A .  73 ARG CD   1 1 
        1  1138 1 1  76 ARG CG   C  -9.287 -14.837   8.282 1.00 . A A .  73 ARG CG   1 1 
        1  1139 1 1  76 ARG CZ   C  -9.332 -16.343   4.956 1.00 . A A .  73 ARG CZ   1 1 
        1  1140 1 1  76 ARG H    H -10.198 -11.993   9.453 1.00 . A A .  73 ARG H    1 1 
        1  1141 1 1  76 ARG HA   H -11.910 -14.083   8.516 1.00 . A A .  73 ARG HA   1 1 
        1  1142 1 1  76 ARG HB2  H  -9.429 -14.035  10.265 1.00 . A A .  73 ARG HB2  1 1 
        1  1143 1 1  76 ARG HB3  H -10.321 -15.531  10.032 1.00 . A A .  73 ARG HB3  1 1 
        1  1144 1 1  76 ARG HD2  H -10.702 -16.384   7.770 1.00 . A A .  73 ARG HD2  1 1 
        1  1145 1 1  76 ARG HD3  H -10.757 -14.971   6.705 1.00 . A A .  73 ARG HD3  1 1 
        1  1146 1 1  76 ARG HE   H  -8.559 -16.968   6.684 1.00 . A A .  73 ARG HE   1 1 
        1  1147 1 1  76 ARG HG2  H  -9.005 -13.887   7.840 1.00 . A A .  73 ARG HG2  1 1 
        1  1148 1 1  76 ARG HG3  H  -8.386 -15.389   8.534 1.00 . A A .  73 ARG HG3  1 1 
        1  1149 1 1  76 ARG HH11 H -10.809 -14.949   4.866 1.00 . A A .  73 ARG HH11 1 1 
        1  1150 1 1  76 ARG HH12 H -10.245 -15.546   3.340 1.00 . A A .  73 ARG HH12 1 1 
        1  1151 1 1  76 ARG HH21 H  -7.889 -17.740   4.691 1.00 . A A .  73 ARG HH21 1 1 
        1  1152 1 1  76 ARG HH22 H  -8.612 -17.114   3.243 1.00 . A A .  73 ARG HH22 1 1 
        1  1153 1 1  76 ARG N    N -11.106 -12.309   9.255 1.00 . A A .  73 ARG N    1 1 
        1  1154 1 1  76 ARG NE   N  -9.235 -16.373   6.292 1.00 . A A .  73 ARG NE   1 1 
        1  1155 1 1  76 ARG NH1  N -10.197 -15.549   4.338 1.00 . A A .  73 ARG NH1  1 1 
        1  1156 1 1  76 ARG NH2  N  -8.549 -17.124   4.240 1.00 . A A .  73 ARG NH2  1 1 
        1  1157 1 1  76 ARG O    O -13.426 -14.519  10.484 1.00 . A A .  73 ARG O    1 1 
        1  1158 1 1  77 LEU C    C -12.755 -12.233  13.731 1.00 . A A .  74 LEU C    1 1 
        1  1159 1 1  77 LEU CA   C -12.643 -13.619  13.072 1.00 . A A .  74 LEU CA   1 1 
        1  1160 1 1  77 LEU CB   C -11.925 -14.606  14.029 1.00 . A A .  74 LEU CB   1 1 
        1  1161 1 1  77 LEU CD1  C -10.816 -16.872  14.447 1.00 . A A .  74 LEU CD1  1 1 
        1  1162 1 1  77 LEU CD2  C -13.072 -16.784  13.284 1.00 . A A .  74 LEU CD2  1 1 
        1  1163 1 1  77 LEU CG   C -11.721 -16.065  13.501 1.00 . A A .  74 LEU CG   1 1 
        1  1164 1 1  77 LEU H    H -10.996 -13.084  11.839 1.00 . A A .  74 LEU H    1 1 
        1  1165 1 1  77 LEU HA   H -13.644 -13.990  12.857 1.00 . A A .  74 LEU HA   1 1 
        1  1166 1 1  77 LEU HB2  H -10.946 -14.192  14.258 1.00 . A A .  74 LEU HB2  1 1 
        1  1167 1 1  77 LEU HB3  H -12.490 -14.658  14.957 1.00 . A A .  74 LEU HB3  1 1 
        1  1168 1 1  77 LEU HD11 H -10.675 -17.872  14.056 1.00 . A A .  74 LEU HD11 1 1 
        1  1169 1 1  77 LEU HD12 H -11.263 -16.934  15.433 1.00 . A A .  74 LEU HD12 1 1 
        1  1170 1 1  77 LEU HD13 H  -9.851 -16.386  14.524 1.00 . A A .  74 LEU HD13 1 1 
        1  1171 1 1  77 LEU HD21 H -13.663 -16.234  12.565 1.00 . A A .  74 LEU HD21 1 1 
        1  1172 1 1  77 LEU HD22 H -13.614 -16.847  14.220 1.00 . A A .  74 LEU HD22 1 1 
        1  1173 1 1  77 LEU HD23 H -12.898 -17.786  12.907 1.00 . A A .  74 LEU HD23 1 1 
        1  1174 1 1  77 LEU HG   H -11.216 -16.016  12.540 1.00 . A A .  74 LEU HG   1 1 
        1  1175 1 1  77 LEU N    N -11.881 -13.512  11.808 1.00 . A A .  74 LEU N    1 1 
        1  1176 1 1  77 LEU O    O -11.934 -11.357  13.466 1.00 . A A .  74 LEU O    1 1 
        1  1177 1 1  78 ALA C    C -14.688 -11.036  16.679 1.00 . A A .  75 ALA C    1 1 
        1  1178 1 1  78 ALA CA   C -13.954 -10.792  15.352 1.00 . A A .  75 ALA CA   1 1 
        1  1179 1 1  78 ALA CB   C -14.715  -9.766  14.498 1.00 . A A .  75 ALA CB   1 1 
        1  1180 1 1  78 ALA H    H -14.393 -12.782  14.761 1.00 . A A .  75 ALA H    1 1 
        1  1181 1 1  78 ALA HA   H -12.971 -10.383  15.572 1.00 . A A .  75 ALA HA   1 1 
        1  1182 1 1  78 ALA HB1  H -14.804  -8.831  15.039 1.00 . A A .  75 ALA HB1  1 1 
        1  1183 1 1  78 ALA HB2  H -15.703 -10.141  14.268 1.00 . A A .  75 ALA HB2  1 1 
        1  1184 1 1  78 ALA HB3  H -14.178  -9.591  13.574 1.00 . A A .  75 ALA HB3  1 1 
        1  1185 1 1  78 ALA N    N -13.757 -12.052  14.612 1.00 . A A .  75 ALA N    1 1 
        1  1186 1 1  78 ALA O    O -15.724 -11.715  16.702 1.00 . A A .  75 ALA O    1 1 
        1  1187 1 1  79 GLY C    C -14.723 -12.016  19.638 1.00 . A A .  76 GLY C    1 1 
        1  1188 1 1  79 GLY CA   C -14.711 -10.582  19.123 1.00 . A A .  76 GLY CA   1 1 
        1  1189 1 1  79 GLY H    H -13.308  -9.958  17.659 1.00 . A A .  76 GLY H    1 1 
        1  1190 1 1  79 GLY HA2  H -14.119  -9.979  19.800 1.00 . A A .  76 GLY HA2  1 1 
        1  1191 1 1  79 GLY HA3  H -15.717 -10.195  19.115 1.00 . A A .  76 GLY HA3  1 1 
        1  1192 1 1  79 GLY N    N -14.134 -10.466  17.774 1.00 . A A .  76 GLY N    1 1 
        1  1193 1 1  79 GLY O    O -15.651 -12.436  20.337 1.00 . A A .  76 GLY O    1 1 
        1  1194 1 1  80 VAL C    C -12.327 -14.279  20.680 1.00 . A A .  77 VAL C    1 1 
        1  1195 1 1  80 VAL CA   C -13.471 -14.168  19.644 1.00 . A A .  77 VAL CA   1 1 
        1  1196 1 1  80 VAL CB   C -13.174 -15.038  18.362 1.00 . A A .  77 VAL CB   1 1 
        1  1197 1 1  80 VAL CG1  C -14.344 -14.959  17.348 1.00 . A A .  77 VAL CG1  1 1 
        1  1198 1 1  80 VAL CG2  C -11.832 -14.642  17.698 1.00 . A A .  77 VAL CG2  1 1 
        1  1199 1 1  80 VAL H    H -12.981 -12.332  18.732 1.00 . A A .  77 VAL H    1 1 
        1  1200 1 1  80 VAL HA   H -14.387 -14.538  20.104 1.00 . A A .  77 VAL HA   1 1 
        1  1201 1 1  80 VAL HB   H -13.092 -16.075  18.685 1.00 . A A .  77 VAL HB   1 1 
        1  1202 1 1  80 VAL HG11 H -15.253 -15.325  17.809 1.00 . A A .  77 VAL HG11 1 1 
        1  1203 1 1  80 VAL HG12 H -14.120 -15.562  16.477 1.00 . A A .  77 VAL HG12 1 1 
        1  1204 1 1  80 VAL HG13 H -14.491 -13.929  17.040 1.00 . A A .  77 VAL HG13 1 1 
        1  1205 1 1  80 VAL HG21 H -11.864 -13.601  17.400 1.00 . A A .  77 VAL HG21 1 1 
        1  1206 1 1  80 VAL HG22 H -11.653 -15.258  16.822 1.00 . A A .  77 VAL HG22 1 1 
        1  1207 1 1  80 VAL HG23 H -11.020 -14.786  18.400 1.00 . A A .  77 VAL HG23 1 1 
        1  1208 1 1  80 VAL N    N -13.669 -12.758  19.275 1.00 . A A .  77 VAL N    1 1 
        1  1209 1 1  80 VAL O    O -11.935 -13.272  21.267 1.00 . A A .  77 VAL O    1 1 
        1  1210 1 1  81 GLU C    C  -9.470 -16.288  21.107 1.00 . A A .  78 GLU C    1 1 
        1  1211 1 1  81 GLU CA   C -10.688 -15.727  21.868 1.00 . A A .  78 GLU CA   1 1 
        1  1212 1 1  81 GLU CB   C -11.105 -16.684  23.018 1.00 . A A .  78 GLU CB   1 1 
        1  1213 1 1  81 GLU CD   C -11.890 -19.002  23.746 1.00 . A A .  78 GLU CD   1 1 
        1  1214 1 1  81 GLU CG   C -11.452 -18.115  22.574 1.00 . A A .  78 GLU CG   1 1 
        1  1215 1 1  81 GLU H    H -12.226 -16.280  20.502 1.00 . A A .  78 GLU H    1 1 
        1  1216 1 1  81 GLU HA   H -10.404 -14.769  22.299 1.00 . A A .  78 GLU HA   1 1 
        1  1217 1 1  81 GLU HB2  H -10.292 -16.743  23.737 1.00 . A A .  78 GLU HB2  1 1 
        1  1218 1 1  81 GLU HB3  H -11.974 -16.265  23.521 1.00 . A A .  78 GLU HB3  1 1 
        1  1219 1 1  81 GLU HG2  H -12.256 -18.067  21.844 1.00 . A A .  78 GLU HG2  1 1 
        1  1220 1 1  81 GLU HG3  H -10.578 -18.556  22.098 1.00 . A A .  78 GLU HG3  1 1 
        1  1221 1 1  81 GLU N    N -11.826 -15.504  20.943 1.00 . A A .  78 GLU N    1 1 
        1  1222 1 1  81 GLU O    O  -9.570 -16.622  19.918 1.00 . A A .  78 GLU O    1 1 
        1  1223 1 1  81 GLU OE1  O -13.064 -18.914  24.154 1.00 . A A .  78 GLU OE1  1 1 
        1  1224 1 1  81 GLU OE2  O -11.058 -19.750  24.297 1.00 . A A .  78 GLU OE2  1 1 
        1  1225 1 1  82 GLY C    C  -7.113 -18.345  20.778 1.00 . A A .  79 GLY C    1 1 
        1  1226 1 1  82 GLY CA   C  -7.071 -16.904  21.269 1.00 . A A .  79 GLY CA   1 1 
        1  1227 1 1  82 GLY H    H  -8.358 -16.140  22.765 1.00 . A A .  79 GLY H    1 1 
        1  1228 1 1  82 GLY HA2  H  -6.779 -16.263  20.447 1.00 . A A .  79 GLY HA2  1 1 
        1  1229 1 1  82 GLY HA3  H  -6.313 -16.830  22.040 1.00 . A A .  79 GLY HA3  1 1 
        1  1230 1 1  82 GLY N    N  -8.337 -16.410  21.826 1.00 . A A .  79 GLY N    1 1 
        1  1231 1 1  82 GLY O    O  -6.346 -18.717  19.876 1.00 . A A .  79 GLY O    1 1 
        1  1232 1 1  83 GLU C    C  -8.811 -20.564  19.532 1.00 . A A .  80 GLU C    1 1 
        1  1233 1 1  83 GLU CA   C  -8.226 -20.554  20.950 1.00 . A A .  80 GLU CA   1 1 
        1  1234 1 1  83 GLU CB   C  -9.181 -21.308  21.913 1.00 . A A .  80 GLU CB   1 1 
        1  1235 1 1  83 GLU CD   C -10.460 -23.501  22.410 1.00 . A A .  80 GLU CD   1 1 
        1  1236 1 1  83 GLU CG   C  -9.390 -22.800  21.558 1.00 . A A .  80 GLU CG   1 1 
        1  1237 1 1  83 GLU H    H  -8.513 -18.814  22.143 1.00 . A A .  80 GLU H    1 1 
        1  1238 1 1  83 GLU HA   H  -7.261 -21.057  20.942 1.00 . A A .  80 GLU HA   1 1 
        1  1239 1 1  83 GLU HB2  H  -8.772 -21.253  22.916 1.00 . A A .  80 GLU HB2  1 1 
        1  1240 1 1  83 GLU HB3  H -10.147 -20.814  21.907 1.00 . A A .  80 GLU HB3  1 1 
        1  1241 1 1  83 GLU HG2  H  -9.675 -22.870  20.510 1.00 . A A .  80 GLU HG2  1 1 
        1  1242 1 1  83 GLU HG3  H  -8.447 -23.322  21.689 1.00 . A A .  80 GLU HG3  1 1 
        1  1243 1 1  83 GLU N    N  -8.001 -19.161  21.383 1.00 . A A .  80 GLU N    1 1 
        1  1244 1 1  83 GLU O    O  -8.349 -21.314  18.676 1.00 . A A .  80 GLU O    1 1 
        1  1245 1 1  83 GLU OE1  O -10.179 -23.846  23.577 1.00 . A A .  80 GLU OE1  1 1 
        1  1246 1 1  83 GLU OE2  O -11.580 -23.731  21.906 1.00 . A A .  80 GLU OE2  1 1 
        1  1247 1 1  84 GLU C    C  -9.464 -19.086  16.925 1.00 . A A .  81 GLU C    1 1 
        1  1248 1 1  84 GLU CA   C -10.478 -19.533  17.994 1.00 . A A .  81 GLU CA   1 1 
        1  1249 1 1  84 GLU CB   C -11.637 -18.506  18.083 1.00 . A A .  81 GLU CB   1 1 
        1  1250 1 1  84 GLU CD   C -13.554 -20.161  18.572 1.00 . A A .  81 GLU CD   1 1 
        1  1251 1 1  84 GLU CG   C -12.791 -18.904  19.025 1.00 . A A .  81 GLU CG   1 1 
        1  1252 1 1  84 GLU H    H -10.137 -19.143  20.057 1.00 . A A .  81 GLU H    1 1 
        1  1253 1 1  84 GLU HA   H -10.886 -20.494  17.707 1.00 . A A .  81 GLU HA   1 1 
        1  1254 1 1  84 GLU HB2  H -11.237 -17.556  18.433 1.00 . A A .  81 GLU HB2  1 1 
        1  1255 1 1  84 GLU HB3  H -12.050 -18.355  17.085 1.00 . A A .  81 GLU HB3  1 1 
        1  1256 1 1  84 GLU HG2  H -12.384 -19.071  20.019 1.00 . A A .  81 GLU HG2  1 1 
        1  1257 1 1  84 GLU HG3  H -13.492 -18.077  19.076 1.00 . A A .  81 GLU HG3  1 1 
        1  1258 1 1  84 GLU N    N  -9.825 -19.696  19.310 1.00 . A A .  81 GLU N    1 1 
        1  1259 1 1  84 GLU O    O  -9.495 -19.573  15.781 1.00 . A A .  81 GLU O    1 1 
        1  1260 1 1  84 GLU OE1  O -14.267 -20.095  17.549 1.00 . A A .  81 GLU OE1  1 1 
        1  1261 1 1  84 GLU OE2  O -13.445 -21.217  19.227 1.00 . A A .  81 GLU OE2  1 1 
        1  1262 1 1  85 ILE C    C  -6.606 -18.782  15.952 1.00 . A A .  82 ILE C    1 1 
        1  1263 1 1  85 ILE CA   C  -7.513 -17.633  16.431 1.00 . A A .  82 ILE CA   1 1 
        1  1264 1 1  85 ILE CB   C  -6.631 -16.532  17.139 1.00 . A A .  82 ILE CB   1 1 
        1  1265 1 1  85 ILE CD1  C  -8.374 -14.653  16.722 1.00 . A A .  82 ILE CD1  1 1 
        1  1266 1 1  85 ILE CG1  C  -7.498 -15.371  17.726 1.00 . A A .  82 ILE CG1  1 1 
        1  1267 1 1  85 ILE CG2  C  -5.557 -15.976  16.173 1.00 . A A .  82 ILE CG2  1 1 
        1  1268 1 1  85 ILE H    H  -8.605 -17.831  18.239 1.00 . A A .  82 ILE H    1 1 
        1  1269 1 1  85 ILE HA   H  -8.002 -17.182  15.568 1.00 . A A .  82 ILE HA   1 1 
        1  1270 1 1  85 ILE HB   H  -6.106 -17.016  17.961 1.00 . A A .  82 ILE HB   1 1 
        1  1271 1 1  85 ILE HD11 H  -9.092 -15.343  16.297 1.00 . A A .  82 ILE HD11 1 1 
        1  1272 1 1  85 ILE HD12 H  -7.762 -14.239  15.934 1.00 . A A .  82 ILE HD12 1 1 
        1  1273 1 1  85 ILE HD13 H  -8.903 -13.850  17.218 1.00 . A A .  82 ILE HD13 1 1 
        1  1274 1 1  85 ILE HG12 H  -8.150 -15.767  18.491 1.00 . A A .  82 ILE HG12 1 1 
        1  1275 1 1  85 ILE HG13 H  -6.848 -14.630  18.180 1.00 . A A .  82 ILE HG13 1 1 
        1  1276 1 1  85 ILE HG21 H  -6.034 -15.503  15.325 1.00 . A A .  82 ILE HG21 1 1 
        1  1277 1 1  85 ILE HG22 H  -4.927 -16.783  15.822 1.00 . A A .  82 ILE HG22 1 1 
        1  1278 1 1  85 ILE HG23 H  -4.943 -15.248  16.688 1.00 . A A .  82 ILE HG23 1 1 
        1  1279 1 1  85 ILE N    N  -8.561 -18.161  17.319 1.00 . A A .  82 ILE N    1 1 
        1  1280 1 1  85 ILE O    O  -6.502 -19.047  14.752 1.00 . A A .  82 ILE O    1 1 
        1  1281 1 1  86 ALA C    C  -5.766 -21.778  15.966 1.00 . A A .  83 ALA C    1 1 
        1  1282 1 1  86 ALA CA   C  -5.076 -20.597  16.677 1.00 . A A .  83 ALA CA   1 1 
        1  1283 1 1  86 ALA CB   C  -4.438 -21.044  18.003 1.00 . A A .  83 ALA CB   1 1 
        1  1284 1 1  86 ALA H    H  -6.253 -19.284  17.852 1.00 . A A .  83 ALA H    1 1 
        1  1285 1 1  86 ALA HA   H  -4.284 -20.215  16.034 1.00 . A A .  83 ALA HA   1 1 
        1  1286 1 1  86 ALA HB1  H  -3.705 -21.821  17.819 1.00 . A A .  83 ALA HB1  1 1 
        1  1287 1 1  86 ALA HB2  H  -5.205 -21.425  18.667 1.00 . A A .  83 ALA HB2  1 1 
        1  1288 1 1  86 ALA HB3  H  -3.950 -20.200  18.474 1.00 . A A .  83 ALA HB3  1 1 
        1  1289 1 1  86 ALA N    N  -6.022 -19.496  16.926 1.00 . A A .  83 ALA N    1 1 
        1  1290 1 1  86 ALA O    O  -5.125 -22.508  15.207 1.00 . A A .  83 ALA O    1 1 
        1  1291 1 1  87 ALA C    C  -8.055 -22.791  14.088 1.00 . A A .  84 ALA C    1 1 
        1  1292 1 1  87 ALA CA   C  -7.907 -22.996  15.602 1.00 . A A .  84 ALA CA   1 1 
        1  1293 1 1  87 ALA CB   C  -9.289 -23.067  16.265 1.00 . A A .  84 ALA CB   1 1 
        1  1294 1 1  87 ALA H    H  -7.520 -21.297  16.816 1.00 . A A .  84 ALA H    1 1 
        1  1295 1 1  87 ALA HA   H  -7.403 -23.942  15.779 1.00 . A A .  84 ALA HA   1 1 
        1  1296 1 1  87 ALA HB1  H  -9.170 -23.237  17.326 1.00 . A A .  84 ALA HB1  1 1 
        1  1297 1 1  87 ALA HB2  H  -9.862 -23.880  15.836 1.00 . A A .  84 ALA HB2  1 1 
        1  1298 1 1  87 ALA HB3  H  -9.820 -22.134  16.111 1.00 . A A .  84 ALA HB3  1 1 
        1  1299 1 1  87 ALA N    N  -7.085 -21.931  16.209 1.00 . A A .  84 ALA N    1 1 
        1  1300 1 1  87 ALA O    O  -8.100 -23.766  13.335 1.00 . A A .  84 ALA O    1 1 
        1  1301 1 1  88 LEU C    C  -6.803 -21.197  11.589 1.00 . A A .  85 LEU C    1 1 
        1  1302 1 1  88 LEU CA   C  -8.207 -21.198  12.209 1.00 . A A .  85 LEU CA   1 1 
        1  1303 1 1  88 LEU CB   C  -8.888 -19.846  11.915 1.00 . A A .  85 LEU CB   1 1 
        1  1304 1 1  88 LEU CD1  C -10.580 -19.490  10.007 1.00 . A A .  85 LEU CD1  1 1 
        1  1305 1 1  88 LEU CD2  C  -8.278 -18.361   9.870 1.00 . A A .  85 LEU CD2  1 1 
        1  1306 1 1  88 LEU CG   C  -9.099 -19.570  10.373 1.00 . A A .  85 LEU CG   1 1 
        1  1307 1 1  88 LEU H    H  -8.173 -20.789  14.295 1.00 . A A .  85 LEU H    1 1 
        1  1308 1 1  88 LEU HA   H  -8.796 -21.981  11.727 1.00 . A A .  85 LEU HA   1 1 
        1  1309 1 1  88 LEU HB2  H  -9.852 -19.834  12.422 1.00 . A A .  85 LEU HB2  1 1 
        1  1310 1 1  88 LEU HB3  H  -8.284 -19.055  12.337 1.00 . A A .  85 LEU HB3  1 1 
        1  1311 1 1  88 LEU HD11 H -10.681 -19.319   8.946 1.00 . A A .  85 LEU HD11 1 1 
        1  1312 1 1  88 LEU HD12 H -11.055 -18.690  10.556 1.00 . A A .  85 LEU HD12 1 1 
        1  1313 1 1  88 LEU HD13 H -11.047 -20.435  10.261 1.00 . A A .  85 LEU HD13 1 1 
        1  1314 1 1  88 LEU HD21 H  -8.478 -18.194   8.821 1.00 . A A .  85 LEU HD21 1 1 
        1  1315 1 1  88 LEU HD22 H  -7.218 -18.586   9.992 1.00 . A A .  85 LEU HD22 1 1 
        1  1316 1 1  88 LEU HD23 H  -8.529 -17.478  10.439 1.00 . A A .  85 LEU HD23 1 1 
        1  1317 1 1  88 LEU HG   H  -8.723 -20.432   9.824 1.00 . A A .  85 LEU HG   1 1 
        1  1318 1 1  88 LEU N    N  -8.148 -21.518  13.644 1.00 . A A .  85 LEU N    1 1 
        1  1319 1 1  88 LEU O    O  -6.626 -21.649  10.460 1.00 . A A .  85 LEU O    1 1 
        1  1320 1 1  89 LEU C    C  -3.909 -22.115  11.660 1.00 . A A .  86 LEU C    1 1 
        1  1321 1 1  89 LEU CA   C  -4.388 -20.672  11.908 1.00 . A A .  86 LEU CA   1 1 
        1  1322 1 1  89 LEU CB   C  -3.484 -19.971  12.961 1.00 . A A .  86 LEU CB   1 1 
        1  1323 1 1  89 LEU CD1  C  -2.839 -17.876  14.293 1.00 . A A .  86 LEU CD1  1 1 
        1  1324 1 1  89 LEU CD2  C  -3.680 -17.647  11.886 1.00 . A A .  86 LEU CD2  1 1 
        1  1325 1 1  89 LEU CG   C  -3.768 -18.453  13.202 1.00 . A A .  86 LEU CG   1 1 
        1  1326 1 1  89 LEU H    H  -6.041 -20.263  13.194 1.00 . A A .  86 LEU H    1 1 
        1  1327 1 1  89 LEU HA   H  -4.331 -20.119  10.976 1.00 . A A .  86 LEU HA   1 1 
        1  1328 1 1  89 LEU HB2  H  -3.599 -20.494  13.906 1.00 . A A .  86 LEU HB2  1 1 
        1  1329 1 1  89 LEU HB3  H  -2.447 -20.072  12.644 1.00 . A A .  86 LEU HB3  1 1 
        1  1330 1 1  89 LEU HD11 H  -3.064 -16.829  14.449 1.00 . A A .  86 LEU HD11 1 1 
        1  1331 1 1  89 LEU HD12 H  -1.803 -17.979  13.993 1.00 . A A .  86 LEU HD12 1 1 
        1  1332 1 1  89 LEU HD13 H  -2.996 -18.413  15.221 1.00 . A A .  86 LEU HD13 1 1 
        1  1333 1 1  89 LEU HD21 H  -2.690 -17.742  11.458 1.00 . A A .  86 LEU HD21 1 1 
        1  1334 1 1  89 LEU HD22 H  -3.888 -16.603  12.082 1.00 . A A .  86 LEU HD22 1 1 
        1  1335 1 1  89 LEU HD23 H  -4.412 -18.023  11.182 1.00 . A A .  86 LEU HD23 1 1 
        1  1336 1 1  89 LEU HG   H  -4.783 -18.351  13.572 1.00 . A A .  86 LEU HG   1 1 
        1  1337 1 1  89 LEU N    N  -5.810 -20.668  12.335 1.00 . A A .  86 LEU N    1 1 
        1  1338 1 1  89 LEU O    O  -3.041 -22.353  10.836 1.00 . A A .  86 LEU O    1 1 
        1  1339 1 1  90 GLU C    C  -4.889 -24.986  10.877 1.00 . A A .  87 GLU C    1 1 
        1  1340 1 1  90 GLU CA   C  -4.368 -24.493  12.249 1.00 . A A .  87 GLU CA   1 1 
        1  1341 1 1  90 GLU CB   C  -5.142 -25.160  13.416 1.00 . A A .  87 GLU CB   1 1 
        1  1342 1 1  90 GLU CD   C  -3.991 -27.449  13.387 1.00 . A A .  87 GLU CD   1 1 
        1  1343 1 1  90 GLU CG   C  -5.315 -26.668  13.319 1.00 . A A .  87 GLU CG   1 1 
        1  1344 1 1  90 GLU H    H  -5.184 -22.751  13.056 1.00 . A A .  87 GLU H    1 1 
        1  1345 1 1  90 GLU HA   H  -3.311 -24.728  12.343 1.00 . A A .  87 GLU HA   1 1 
        1  1346 1 1  90 GLU HB2  H  -4.626 -24.940  14.347 1.00 . A A .  87 GLU HB2  1 1 
        1  1347 1 1  90 GLU HB3  H  -6.131 -24.717  13.472 1.00 . A A .  87 GLU HB3  1 1 
        1  1348 1 1  90 GLU HG2  H  -5.960 -26.990  14.120 1.00 . A A .  87 GLU HG2  1 1 
        1  1349 1 1  90 GLU HG3  H  -5.808 -26.872  12.373 1.00 . A A .  87 GLU HG3  1 1 
        1  1350 1 1  90 GLU N    N  -4.540 -23.051  12.387 1.00 . A A .  87 GLU N    1 1 
        1  1351 1 1  90 GLU O    O  -4.241 -25.805  10.208 1.00 . A A .  87 GLU O    1 1 
        1  1352 1 1  90 GLU OE1  O  -3.229 -27.275  14.364 1.00 . A A .  87 GLU OE1  1 1 
        1  1353 1 1  90 GLU OE2  O  -3.701 -28.238  12.467 1.00 . A A .  87 GLU OE2  1 1 
        1  1354 1 1  91 ARG C    C  -5.932 -24.308   8.006 1.00 . A A .  88 ARG C    1 1 
        1  1355 1 1  91 ARG CA   C  -6.716 -24.873   9.210 1.00 . A A .  88 ARG CA   1 1 
        1  1356 1 1  91 ARG CB   C  -8.181 -24.360   9.206 1.00 . A A .  88 ARG CB   1 1 
        1  1357 1 1  91 ARG CD   C -10.350 -24.091  10.568 1.00 . A A .  88 ARG CD   1 1 
        1  1358 1 1  91 ARG CG   C  -9.010 -24.836  10.423 1.00 . A A .  88 ARG CG   1 1 
        1  1359 1 1  91 ARG CZ   C -12.376 -23.684   9.156 1.00 . A A .  88 ARG CZ   1 1 
        1  1360 1 1  91 ARG H    H  -6.498 -23.799  11.031 1.00 . A A .  88 ARG H    1 1 
        1  1361 1 1  91 ARG HA   H  -6.718 -25.967   9.166 1.00 . A A .  88 ARG HA   1 1 
        1  1362 1 1  91 ARG HB2  H  -8.166 -23.275   9.205 1.00 . A A .  88 ARG HB2  1 1 
        1  1363 1 1  91 ARG HB3  H  -8.678 -24.704   8.300 1.00 . A A .  88 ARG HB3  1 1 
        1  1364 1 1  91 ARG HD2  H -10.795 -24.361  11.518 1.00 . A A .  88 ARG HD2  1 1 
        1  1365 1 1  91 ARG HD3  H -10.158 -23.021  10.560 1.00 . A A .  88 ARG HD3  1 1 
        1  1366 1 1  91 ARG HE   H -11.149 -25.264   9.013 1.00 . A A .  88 ARG HE   1 1 
        1  1367 1 1  91 ARG HG2  H  -9.212 -25.896  10.321 1.00 . A A .  88 ARG HG2  1 1 
        1  1368 1 1  91 ARG HG3  H  -8.424 -24.677  11.325 1.00 . A A .  88 ARG HG3  1 1 
        1  1369 1 1  91 ARG HH11 H -11.964 -22.152  10.423 1.00 . A A .  88 ARG HH11 1 1 
        1  1370 1 1  91 ARG HH12 H -13.400 -21.956   9.477 1.00 . A A .  88 ARG HH12 1 1 
        1  1371 1 1  91 ARG HH21 H -13.015 -24.996   7.759 1.00 . A A .  88 ARG HH21 1 1 
        1  1372 1 1  91 ARG HH22 H -13.995 -23.575   7.945 1.00 . A A .  88 ARG HH22 1 1 
        1  1373 1 1  91 ARG N    N  -6.060 -24.475  10.469 1.00 . A A .  88 ARG N    1 1 
        1  1374 1 1  91 ARG NE   N -11.304 -24.420   9.494 1.00 . A A .  88 ARG NE   1 1 
        1  1375 1 1  91 ARG NH1  N -12.597 -22.502   9.734 1.00 . A A .  88 ARG NH1  1 1 
        1  1376 1 1  91 ARG NH2  N -13.195 -24.121   8.215 1.00 . A A .  88 ARG NH2  1 1 
        1  1377 1 1  91 ARG O    O  -5.594 -25.039   7.077 1.00 . A A .  88 ARG O    1 1 
        1  1378 1 1  92 GLU C    C  -3.481 -22.736   6.815 1.00 . A A .  89 GLU C    1 1 
        1  1379 1 1  92 GLU CA   C  -4.925 -22.259   7.016 1.00 . A A .  89 GLU CA   1 1 
        1  1380 1 1  92 GLU CB   C  -4.975 -20.737   7.311 1.00 . A A .  89 GLU CB   1 1 
        1  1381 1 1  92 GLU CD   C  -7.232 -20.333   6.112 1.00 . A A .  89 GLU CD   1 1 
        1  1382 1 1  92 GLU CG   C  -6.404 -20.168   7.405 1.00 . A A .  89 GLU CG   1 1 
        1  1383 1 1  92 GLU H    H  -5.817 -22.539   8.910 1.00 . A A .  89 GLU H    1 1 
        1  1384 1 1  92 GLU HA   H  -5.477 -22.447   6.097 1.00 . A A .  89 GLU HA   1 1 
        1  1385 1 1  92 GLU HB2  H  -4.477 -20.544   8.259 1.00 . A A .  89 GLU HB2  1 1 
        1  1386 1 1  92 GLU HB3  H  -4.446 -20.202   6.526 1.00 . A A .  89 GLU HB3  1 1 
        1  1387 1 1  92 GLU HG2  H  -6.923 -20.673   8.217 1.00 . A A .  89 GLU HG2  1 1 
        1  1388 1 1  92 GLU HG3  H  -6.340 -19.112   7.648 1.00 . A A .  89 GLU HG3  1 1 
        1  1389 1 1  92 GLU N    N  -5.601 -23.011   8.091 1.00 . A A .  89 GLU N    1 1 
        1  1390 1 1  92 GLU O    O  -3.015 -22.812   5.682 1.00 . A A .  89 GLU O    1 1 
        1  1391 1 1  92 GLU OE1  O  -7.168 -19.450   5.239 1.00 . A A .  89 GLU OE1  1 1 
        1  1392 1 1  92 GLU OE2  O  -7.939 -21.358   5.957 1.00 . A A .  89 GLU OE2  1 1 
        1  1393 1 1  93 ARG C    C  -1.381 -24.981   7.142 1.00 . A A .  90 ARG C    1 1 
        1  1394 1 1  93 ARG CA   C  -1.401 -23.616   7.853 1.00 . A A .  90 ARG CA   1 1 
        1  1395 1 1  93 ARG CB   C  -0.722 -23.754   9.255 1.00 . A A .  90 ARG CB   1 1 
        1  1396 1 1  93 ARG CD   C  -0.478 -25.134  11.428 1.00 . A A .  90 ARG CD   1 1 
        1  1397 1 1  93 ARG CG   C  -1.215 -24.954  10.099 1.00 . A A .  90 ARG CG   1 1 
        1  1398 1 1  93 ARG CZ   C  -0.197 -27.440  12.398 1.00 . A A .  90 ARG CZ   1 1 
        1  1399 1 1  93 ARG H    H  -3.207 -22.913   8.802 1.00 . A A .  90 ARG H    1 1 
        1  1400 1 1  93 ARG HA   H  -0.815 -22.918   7.259 1.00 . A A .  90 ARG HA   1 1 
        1  1401 1 1  93 ARG HB2  H   0.351 -23.857   9.114 1.00 . A A .  90 ARG HB2  1 1 
        1  1402 1 1  93 ARG HB3  H  -0.905 -22.844   9.818 1.00 . A A .  90 ARG HB3  1 1 
        1  1403 1 1  93 ARG HD2  H   0.589 -25.203  11.234 1.00 . A A .  90 ARG HD2  1 1 
        1  1404 1 1  93 ARG HD3  H  -0.668 -24.273  12.056 1.00 . A A .  90 ARG HD3  1 1 
        1  1405 1 1  93 ARG HE   H  -1.887 -26.367  12.410 1.00 . A A .  90 ARG HE   1 1 
        1  1406 1 1  93 ARG HG2  H  -2.267 -24.812  10.308 1.00 . A A .  90 ARG HG2  1 1 
        1  1407 1 1  93 ARG HG3  H  -1.097 -25.859   9.513 1.00 . A A .  90 ARG HG3  1 1 
        1  1408 1 1  93 ARG HH11 H   1.530 -26.701  11.626 1.00 . A A .  90 ARG HH11 1 1 
        1  1409 1 1  93 ARG HH12 H   1.631 -28.307  12.268 1.00 . A A .  90 ARG HH12 1 1 
        1  1410 1 1  93 ARG HH21 H  -1.724 -28.465  13.252 1.00 . A A .  90 ARG HH21 1 1 
        1  1411 1 1  93 ARG HH22 H  -0.201 -29.304  13.186 1.00 . A A .  90 ARG HH22 1 1 
        1  1412 1 1  93 ARG N    N  -2.786 -23.065   7.924 1.00 . A A .  90 ARG N    1 1 
        1  1413 1 1  93 ARG NE   N  -0.944 -26.353  12.134 1.00 . A A .  90 ARG NE   1 1 
        1  1414 1 1  93 ARG NH1  N   1.093 -27.485  12.073 1.00 . A A .  90 ARG NH1  1 1 
        1  1415 1 1  93 ARG NH2  N  -0.750 -28.486  12.995 1.00 . A A .  90 ARG NH2  1 1 
        1  1416 1 1  93 ARG O    O  -0.433 -25.297   6.419 1.00 . A A .  90 ARG O    1 1 
        1  1417 1 1  94 ARG C    C  -2.526 -27.149   5.312 1.00 . A A .  91 ARG C    1 1 
        1  1418 1 1  94 ARG CA   C  -2.556 -27.154   6.848 1.00 . A A .  91 ARG CA   1 1 
        1  1419 1 1  94 ARG CB   C  -3.865 -27.816   7.350 1.00 . A A .  91 ARG CB   1 1 
        1  1420 1 1  94 ARG CD   C  -5.479 -29.816   7.158 1.00 . A A .  91 ARG CD   1 1 
        1  1421 1 1  94 ARG CG   C  -4.070 -29.273   6.870 1.00 . A A .  91 ARG CG   1 1 
        1  1422 1 1  94 ARG CZ   C  -6.722 -31.381   5.642 1.00 . A A .  91 ARG CZ   1 1 
        1  1423 1 1  94 ARG H    H  -3.192 -25.418   7.894 1.00 . A A .  91 ARG H    1 1 
        1  1424 1 1  94 ARG HA   H  -1.703 -27.714   7.222 1.00 . A A .  91 ARG HA   1 1 
        1  1425 1 1  94 ARG HB2  H  -3.868 -27.810   8.437 1.00 . A A .  91 ARG HB2  1 1 
        1  1426 1 1  94 ARG HB3  H  -4.702 -27.221   7.002 1.00 . A A .  91 ARG HB3  1 1 
        1  1427 1 1  94 ARG HD2  H  -5.593 -29.959   8.229 1.00 . A A .  91 ARG HD2  1 1 
        1  1428 1 1  94 ARG HD3  H  -6.215 -29.094   6.814 1.00 . A A .  91 ARG HD3  1 1 
        1  1429 1 1  94 ARG HE   H  -5.030 -31.812   6.630 1.00 . A A .  91 ARG HE   1 1 
        1  1430 1 1  94 ARG HG2  H  -3.901 -29.315   5.801 1.00 . A A .  91 ARG HG2  1 1 
        1  1431 1 1  94 ARG HG3  H  -3.340 -29.907   7.365 1.00 . A A .  91 ARG HG3  1 1 
        1  1432 1 1  94 ARG HH11 H  -7.679 -29.620   5.928 1.00 . A A .  91 ARG HH11 1 1 
        1  1433 1 1  94 ARG HH12 H  -8.439 -30.707   4.820 1.00 . A A .  91 ARG HH12 1 1 
        1  1434 1 1  94 ARG HH21 H  -6.058 -33.231   5.163 1.00 . A A .  91 ARG HH21 1 1 
        1  1435 1 1  94 ARG HH22 H  -7.531 -32.739   4.388 1.00 . A A .  91 ARG HH22 1 1 
        1  1436 1 1  94 ARG N    N  -2.448 -25.777   7.365 1.00 . A A .  91 ARG N    1 1 
        1  1437 1 1  94 ARG NE   N  -5.704 -31.112   6.477 1.00 . A A .  91 ARG NE   1 1 
        1  1438 1 1  94 ARG NH1  N  -7.690 -30.500   5.449 1.00 . A A .  91 ARG NH1  1 1 
        1  1439 1 1  94 ARG NH2  N  -6.776 -32.545   5.017 1.00 . A A .  91 ARG NH2  1 1 
        1  1440 1 1  94 ARG O    O  -1.761 -27.895   4.689 1.00 . A A .  91 ARG O    1 1 
        1  1441 1 1  95 PHE C    C  -2.262 -25.331   2.730 1.00 . A A .  92 PHE C    1 1 
        1  1442 1 1  95 PHE CA   C  -3.469 -26.113   3.279 1.00 . A A .  92 PHE CA   1 1 
        1  1443 1 1  95 PHE CB   C  -4.804 -25.401   2.938 1.00 . A A .  92 PHE CB   1 1 
        1  1444 1 1  95 PHE CD1  C  -6.448 -27.292   2.496 1.00 . A A .  92 PHE CD1  1 1 
        1  1445 1 1  95 PHE CD2  C  -6.804 -25.926   4.426 1.00 . A A .  92 PHE CD2  1 1 
        1  1446 1 1  95 PHE CE1  C  -7.564 -28.041   2.823 1.00 . A A .  92 PHE CE1  1 1 
        1  1447 1 1  95 PHE CE2  C  -7.920 -26.674   4.751 1.00 . A A .  92 PHE CE2  1 1 
        1  1448 1 1  95 PHE CG   C  -6.047 -26.219   3.294 1.00 . A A .  92 PHE CG   1 1 
        1  1449 1 1  95 PHE CZ   C  -8.300 -27.732   3.951 1.00 . A A .  92 PHE CZ   1 1 
        1  1450 1 1  95 PHE H    H  -3.916 -25.705   5.300 1.00 . A A .  92 PHE H    1 1 
        1  1451 1 1  95 PHE HA   H  -3.477 -27.106   2.828 1.00 . A A .  92 PHE HA   1 1 
        1  1452 1 1  95 PHE HB2  H  -4.853 -24.458   3.474 1.00 . A A .  92 PHE HB2  1 1 
        1  1453 1 1  95 PHE HB3  H  -4.838 -25.190   1.881 1.00 . A A .  92 PHE HB3  1 1 
        1  1454 1 1  95 PHE HD1  H  -5.875 -27.539   1.610 1.00 . A A .  92 PHE HD1  1 1 
        1  1455 1 1  95 PHE HD2  H  -6.515 -25.096   5.058 1.00 . A A .  92 PHE HD2  1 1 
        1  1456 1 1  95 PHE HE1  H  -7.861 -28.873   2.193 1.00 . A A .  92 PHE HE1  1 1 
        1  1457 1 1  95 PHE HE2  H  -8.495 -26.432   5.636 1.00 . A A .  92 PHE HE2  1 1 
        1  1458 1 1  95 PHE HZ   H  -9.171 -28.322   4.206 1.00 . A A .  92 PHE HZ   1 1 
        1  1459 1 1  95 PHE N    N  -3.359 -26.275   4.730 1.00 . A A .  92 PHE N    1 1 
        1  1460 1 1  95 PHE O    O  -1.639 -25.739   1.738 1.00 . A A .  92 PHE O    1 1 
        1  1461 1 1  96 ASP C    C  -0.150 -22.646   4.152 1.00 . A A .  93 ASP C    1 1 
        1  1462 1 1  96 ASP CA   C  -0.897 -23.261   2.950 1.00 . A A .  93 ASP CA   1 1 
        1  1463 1 1  96 ASP CB   C  -1.552 -22.141   2.085 1.00 . A A .  93 ASP CB   1 1 
        1  1464 1 1  96 ASP CG   C  -1.962 -22.595   0.671 1.00 . A A .  93 ASP CG   1 1 
        1  1465 1 1  96 ASP H    H  -2.358 -24.049   4.267 1.00 . A A .  93 ASP H    1 1 
        1  1466 1 1  96 ASP HA   H  -0.174 -23.798   2.336 1.00 . A A .  93 ASP HA   1 1 
        1  1467 1 1  96 ASP HB2  H  -2.427 -21.773   2.606 1.00 . A A .  93 ASP HB2  1 1 
        1  1468 1 1  96 ASP HB3  H  -0.853 -21.318   1.981 1.00 . A A .  93 ASP HB3  1 1 
        1  1469 1 1  96 ASP N    N  -1.919 -24.223   3.411 1.00 . A A .  93 ASP N    1 1 
        1  1470 1 1  96 ASP O    O  -0.588 -21.645   4.715 1.00 . A A .  93 ASP O    1 1 
        1  1471 1 1  96 ASP OD1  O  -1.070 -22.980  -0.117 1.00 . A A .  93 ASP OD1  1 1 
        1  1472 1 1  96 ASP OD2  O  -3.167 -22.553   0.334 1.00 . A A .  93 ASP OD2  1 1 
        1  1473 1 1  97 SER C    C   2.657 -21.546   5.308 1.00 . A A .  94 SER C    1 1 
        1  1474 1 1  97 SER CA   C   1.836 -22.822   5.656 1.00 . A A .  94 SER CA   1 1 
        1  1475 1 1  97 SER CB   C   2.771 -23.983   6.090 1.00 . A A .  94 SER CB   1 1 
        1  1476 1 1  97 SER H    H   1.263 -24.054   4.022 1.00 . A A .  94 SER H    1 1 
        1  1477 1 1  97 SER HA   H   1.174 -22.590   6.496 1.00 . A A .  94 SER HA   1 1 
        1  1478 1 1  97 SER HB2  H   2.181 -24.873   6.274 1.00 . A A .  94 SER HB2  1 1 
        1  1479 1 1  97 SER HB3  H   3.484 -24.189   5.302 1.00 . A A .  94 SER HB3  1 1 
        1  1480 1 1  97 SER HG   H   4.154 -24.346   7.442 1.00 . A A .  94 SER HG   1 1 
        1  1481 1 1  97 SER N    N   0.986 -23.261   4.525 1.00 . A A .  94 SER N    1 1 
        1  1482 1 1  97 SER O    O   3.396 -21.029   6.157 1.00 . A A .  94 SER O    1 1 
        1  1483 1 1  97 SER OG   O   3.486 -23.670   7.284 1.00 . A A .  94 SER OG   1 1 
        1  1484 1 1  98 ASP C    C   2.609 -18.525   4.240 1.00 . A A .  95 ASP C    1 1 
        1  1485 1 1  98 ASP CA   C   3.210 -19.796   3.606 1.00 . A A .  95 ASP CA   1 1 
        1  1486 1 1  98 ASP CB   C   3.189 -19.676   2.053 1.00 . A A .  95 ASP CB   1 1 
        1  1487 1 1  98 ASP CG   C   1.787 -19.416   1.474 1.00 . A A .  95 ASP CG   1 1 
        1  1488 1 1  98 ASP H    H   1.935 -21.495   3.424 1.00 . A A .  95 ASP H    1 1 
        1  1489 1 1  98 ASP HA   H   4.250 -19.861   3.927 1.00 . A A .  95 ASP HA   1 1 
        1  1490 1 1  98 ASP HB2  H   3.845 -18.864   1.751 1.00 . A A .  95 ASP HB2  1 1 
        1  1491 1 1  98 ASP HB3  H   3.576 -20.596   1.623 1.00 . A A .  95 ASP HB3  1 1 
        1  1492 1 1  98 ASP N    N   2.522 -21.033   4.058 1.00 . A A .  95 ASP N    1 1 
        1  1493 1 1  98 ASP O    O   3.098 -17.414   3.970 1.00 . A A .  95 ASP O    1 1 
        1  1494 1 1  98 ASP OD1  O   1.043 -20.378   1.270 1.00 . A A .  95 ASP OD1  1 1 
        1  1495 1 1  98 ASP OD2  O   1.427 -18.249   1.227 1.00 . A A .  95 ASP OD2  1 1 
        1  1496 1 1  99 LEU C    C   1.973 -17.090   6.907 1.00 . A A .  96 LEU C    1 1 
        1  1497 1 1  99 LEU CA   C   0.988 -17.551   5.819 1.00 . A A .  96 LEU CA   1 1 
        1  1498 1 1  99 LEU CB   C  -0.403 -17.842   6.465 1.00 . A A .  96 LEU CB   1 1 
        1  1499 1 1  99 LEU CD1  C  -1.721 -18.502   8.573 1.00 . A A .  96 LEU CD1  1 1 
        1  1500 1 1  99 LEU CD2  C  -0.292 -20.220   7.418 1.00 . A A .  96 LEU CD2  1 1 
        1  1501 1 1  99 LEU CG   C  -0.438 -18.735   7.754 1.00 . A A .  96 LEU CG   1 1 
        1  1502 1 1  99 LEU H    H   1.132 -19.565   5.145 1.00 . A A .  96 LEU H    1 1 
        1  1503 1 1  99 LEU HA   H   0.866 -16.734   5.106 1.00 . A A .  96 LEU HA   1 1 
        1  1504 1 1  99 LEU HB2  H  -0.852 -16.882   6.715 1.00 . A A .  96 LEU HB2  1 1 
        1  1505 1 1  99 LEU HB3  H  -1.034 -18.306   5.711 1.00 . A A .  96 LEU HB3  1 1 
        1  1506 1 1  99 LEU HD11 H  -1.783 -17.455   8.845 1.00 . A A .  96 LEU HD11 1 1 
        1  1507 1 1  99 LEU HD12 H  -1.695 -19.099   9.473 1.00 . A A .  96 LEU HD12 1 1 
        1  1508 1 1  99 LEU HD13 H  -2.592 -18.769   7.985 1.00 . A A .  96 LEU HD13 1 1 
        1  1509 1 1  99 LEU HD21 H  -0.282 -20.797   8.333 1.00 . A A .  96 LEU HD21 1 1 
        1  1510 1 1  99 LEU HD22 H   0.638 -20.381   6.890 1.00 . A A .  96 LEU HD22 1 1 
        1  1511 1 1  99 LEU HD23 H  -1.119 -20.544   6.797 1.00 . A A .  96 LEU HD23 1 1 
        1  1512 1 1  99 LEU HG   H   0.396 -18.463   8.389 1.00 . A A .  96 LEU HG   1 1 
        1  1513 1 1  99 LEU N    N   1.545 -18.680   5.064 1.00 . A A .  96 LEU N    1 1 
        1  1514 1 1  99 LEU O    O   2.771 -17.881   7.431 1.00 . A A .  96 LEU O    1 1 
        1  1515 1 1 100 TRP C    C   1.561 -14.967   9.427 1.00 . A A .  97 TRP C    1 1 
        1  1516 1 1 100 TRP CA   C   2.605 -15.193   8.338 1.00 . A A .  97 TRP CA   1 1 
        1  1517 1 1 100 TRP CB   C   3.263 -13.845   7.928 1.00 . A A .  97 TRP CB   1 1 
        1  1518 1 1 100 TRP CD1  C   4.211 -14.593   5.647 1.00 . A A .  97 TRP CD1  1 1 
        1  1519 1 1 100 TRP CD2  C   5.650 -13.422   6.892 1.00 . A A .  97 TRP CD2  1 1 
        1  1520 1 1 100 TRP CE2  C   6.281 -13.793   5.691 1.00 . A A .  97 TRP CE2  1 1 
        1  1521 1 1 100 TRP CE3  C   6.365 -12.671   7.823 1.00 . A A .  97 TRP CE3  1 1 
        1  1522 1 1 100 TRP CG   C   4.330 -13.970   6.858 1.00 . A A .  97 TRP CG   1 1 
        1  1523 1 1 100 TRP CH2  C   8.262 -12.700   6.330 1.00 . A A .  97 TRP CH2  1 1 
        1  1524 1 1 100 TRP CZ2  C   7.584 -13.434   5.397 1.00 . A A .  97 TRP CZ2  1 1 
        1  1525 1 1 100 TRP CZ3  C   7.663 -12.315   7.532 1.00 . A A .  97 TRP CZ3  1 1 
        1  1526 1 1 100 TRP H    H   1.389 -15.216   6.624 1.00 . A A .  97 TRP H    1 1 
        1  1527 1 1 100 TRP HA   H   3.368 -15.877   8.710 1.00 . A A .  97 TRP HA   1 1 
        1  1528 1 1 100 TRP HB2  H   2.501 -13.177   7.547 1.00 . A A .  97 TRP HB2  1 1 
        1  1529 1 1 100 TRP HB3  H   3.717 -13.393   8.803 1.00 . A A .  97 TRP HB3  1 1 
        1  1530 1 1 100 TRP HD1  H   3.318 -15.107   5.314 1.00 . A A .  97 TRP HD1  1 1 
        1  1531 1 1 100 TRP HE1  H   5.544 -14.904   4.076 1.00 . A A .  97 TRP HE1  1 1 
        1  1532 1 1 100 TRP HE3  H   5.915 -12.357   8.757 1.00 . A A .  97 TRP HE3  1 1 
        1  1533 1 1 100 TRP HH2  H   9.285 -12.399   6.144 1.00 . A A .  97 TRP HH2  1 1 
        1  1534 1 1 100 TRP HZ2  H   8.066 -13.729   4.469 1.00 . A A .  97 TRP HZ2  1 1 
        1  1535 1 1 100 TRP HZ3  H   8.234 -11.730   8.246 1.00 . A A .  97 TRP HZ3  1 1 
        1  1536 1 1 100 TRP N    N   1.921 -15.798   7.201 1.00 . A A .  97 TRP N    1 1 
        1  1537 1 1 100 TRP NE1  N   5.382 -14.513   4.958 1.00 . A A .  97 TRP NE1  1 1 
        1  1538 1 1 100 TRP O    O   0.361 -14.950   9.140 1.00 . A A .  97 TRP O    1 1 
        1  1539 1 1 101 VAL C    C   1.807 -13.283  12.524 1.00 . A A .  98 VAL C    1 1 
        1  1540 1 1 101 VAL CA   C   1.129 -14.422  11.780 1.00 . A A .  98 VAL CA   1 1 
        1  1541 1 1 101 VAL CB   C   0.764 -15.597  12.765 1.00 . A A .  98 VAL CB   1 1 
        1  1542 1 1 101 VAL CG1  C  -0.115 -15.092  13.944 1.00 . A A .  98 VAL CG1  1 1 
        1  1543 1 1 101 VAL CG2  C   0.060 -16.762  12.014 1.00 . A A .  98 VAL CG2  1 1 
        1  1544 1 1 101 VAL H    H   2.949 -14.986  10.854 1.00 . A A .  98 VAL H    1 1 
        1  1545 1 1 101 VAL HA   H   0.203 -14.047  11.353 1.00 . A A .  98 VAL HA   1 1 
        1  1546 1 1 101 VAL HB   H   1.691 -15.982  13.182 1.00 . A A .  98 VAL HB   1 1 
        1  1547 1 1 101 VAL HG11 H  -0.347 -15.916  14.609 1.00 . A A .  98 VAL HG11 1 1 
        1  1548 1 1 101 VAL HG12 H  -1.038 -14.674  13.563 1.00 . A A .  98 VAL HG12 1 1 
        1  1549 1 1 101 VAL HG13 H   0.418 -14.327  14.499 1.00 . A A .  98 VAL HG13 1 1 
        1  1550 1 1 101 VAL HG21 H   0.717 -17.150  11.242 1.00 . A A .  98 VAL HG21 1 1 
        1  1551 1 1 101 VAL HG22 H  -0.853 -16.404  11.555 1.00 . A A .  98 VAL HG22 1 1 
        1  1552 1 1 101 VAL HG23 H  -0.179 -17.556  12.710 1.00 . A A .  98 VAL HG23 1 1 
        1  1553 1 1 101 VAL N    N   2.002 -14.828  10.672 1.00 . A A .  98 VAL N    1 1 
        1  1554 1 1 101 VAL O    O   2.970 -13.392  12.883 1.00 . A A .  98 VAL O    1 1 
        1  1555 1 1 102 VAL C    C   0.521 -10.742  14.575 1.00 . A A .  99 VAL C    1 1 
        1  1556 1 1 102 VAL CA   C   1.535 -10.999  13.459 1.00 . A A .  99 VAL CA   1 1 
        1  1557 1 1 102 VAL CB   C   1.686  -9.698  12.567 1.00 . A A .  99 VAL CB   1 1 
        1  1558 1 1 102 VAL CG1  C   2.204  -8.478  13.383 1.00 . A A .  99 VAL CG1  1 1 
        1  1559 1 1 102 VAL CG2  C   2.594  -9.979  11.347 1.00 . A A .  99 VAL CG2  1 1 
        1  1560 1 1 102 VAL H    H   0.188 -12.140  12.256 1.00 . A A .  99 VAL H    1 1 
        1  1561 1 1 102 VAL HA   H   2.504 -11.228  13.903 1.00 . A A .  99 VAL HA   1 1 
        1  1562 1 1 102 VAL HB   H   0.703  -9.437  12.196 1.00 . A A .  99 VAL HB   1 1 
        1  1563 1 1 102 VAL HG11 H   2.276  -7.606  12.740 1.00 . A A .  99 VAL HG11 1 1 
        1  1564 1 1 102 VAL HG12 H   3.179  -8.699  13.795 1.00 . A A .  99 VAL HG12 1 1 
        1  1565 1 1 102 VAL HG13 H   1.516  -8.265  14.194 1.00 . A A .  99 VAL HG13 1 1 
        1  1566 1 1 102 VAL HG21 H   2.669  -9.092  10.728 1.00 . A A .  99 VAL HG21 1 1 
        1  1567 1 1 102 VAL HG22 H   2.174 -10.787  10.758 1.00 . A A .  99 VAL HG22 1 1 
        1  1568 1 1 102 VAL HG23 H   3.581 -10.265  11.686 1.00 . A A .  99 VAL HG23 1 1 
        1  1569 1 1 102 VAL N    N   1.081 -12.169  12.679 1.00 . A A .  99 VAL N    1 1 
        1  1570 1 1 102 VAL O    O  -0.673 -10.602  14.295 1.00 . A A .  99 VAL O    1 1 
        1  1571 1 1 103 GLU C    C   0.222  -8.798  17.123 1.00 . A A . 100 GLU C    1 1 
        1  1572 1 1 103 GLU CA   C   0.134 -10.321  16.964 1.00 . A A . 100 GLU CA   1 1 
        1  1573 1 1 103 GLU CB   C   0.529 -11.056  18.285 1.00 . A A . 100 GLU CB   1 1 
        1  1574 1 1 103 GLU CD   C   2.279 -11.420  20.159 1.00 . A A . 100 GLU CD   1 1 
        1  1575 1 1 103 GLU CG   C   1.988 -10.849  18.760 1.00 . A A . 100 GLU CG   1 1 
        1  1576 1 1 103 GLU H    H   1.915 -10.963  16.006 1.00 . A A . 100 GLU H    1 1 
        1  1577 1 1 103 GLU HA   H  -0.896 -10.588  16.720 1.00 . A A . 100 GLU HA   1 1 
        1  1578 1 1 103 GLU HB2  H  -0.129 -10.718  19.078 1.00 . A A . 100 GLU HB2  1 1 
        1  1579 1 1 103 GLU HB3  H   0.371 -12.126  18.148 1.00 . A A . 100 GLU HB3  1 1 
        1  1580 1 1 103 GLU HG2  H   2.656 -11.328  18.053 1.00 . A A . 100 GLU HG2  1 1 
        1  1581 1 1 103 GLU HG3  H   2.191  -9.781  18.764 1.00 . A A . 100 GLU HG3  1 1 
        1  1582 1 1 103 GLU N    N   0.981 -10.721  15.835 1.00 . A A . 100 GLU N    1 1 
        1  1583 1 1 103 GLU O    O   1.287  -8.260  17.404 1.00 . A A . 100 GLU O    1 1 
        1  1584 1 1 103 GLU OE1  O   1.841 -12.554  20.449 1.00 . A A . 100 GLU OE1  1 1 
        1  1585 1 1 103 GLU OE2  O   2.963 -10.749  20.968 1.00 . A A . 100 GLU OE2  1 1 
        1  1586 1 1 104 ILE C    C  -1.927  -6.481  18.327 1.00 . A A . 101 ILE C    1 1 
        1  1587 1 1 104 ILE CA   C  -1.014  -6.662  17.101 1.00 . A A . 101 ILE CA   1 1 
        1  1588 1 1 104 ILE CB   C  -1.556  -5.872  15.839 1.00 . A A . 101 ILE CB   1 1 
        1  1589 1 1 104 ILE CD1  C  -3.635  -5.495  14.337 1.00 . A A . 101 ILE CD1  1 1 
        1  1590 1 1 104 ILE CG1  C  -2.998  -6.312  15.441 1.00 . A A . 101 ILE CG1  1 1 
        1  1591 1 1 104 ILE CG2  C  -0.592  -6.047  14.635 1.00 . A A . 101 ILE CG2  1 1 
        1  1592 1 1 104 ILE H    H  -1.645  -8.575  16.452 1.00 . A A . 101 ILE H    1 1 
        1  1593 1 1 104 ILE HA   H  -0.029  -6.263  17.346 1.00 . A A . 101 ILE HA   1 1 
        1  1594 1 1 104 ILE HB   H  -1.571  -4.812  16.091 1.00 . A A . 101 ILE HB   1 1 
        1  1595 1 1 104 ILE HD11 H  -3.685  -4.458  14.639 1.00 . A A . 101 ILE HD11 1 1 
        1  1596 1 1 104 ILE HD12 H  -4.633  -5.863  14.152 1.00 . A A . 101 ILE HD12 1 1 
        1  1597 1 1 104 ILE HD13 H  -3.046  -5.582  13.435 1.00 . A A . 101 ILE HD13 1 1 
        1  1598 1 1 104 ILE HG12 H  -2.979  -7.342  15.111 1.00 . A A . 101 ILE HG12 1 1 
        1  1599 1 1 104 ILE HG13 H  -3.643  -6.243  16.306 1.00 . A A . 101 ILE HG13 1 1 
        1  1600 1 1 104 ILE HG21 H   0.392  -5.690  14.898 1.00 . A A . 101 ILE HG21 1 1 
        1  1601 1 1 104 ILE HG22 H  -0.953  -5.483  13.783 1.00 . A A . 101 ILE HG22 1 1 
        1  1602 1 1 104 ILE HG23 H  -0.528  -7.096  14.363 1.00 . A A . 101 ILE HG23 1 1 
        1  1603 1 1 104 ILE N    N  -0.884  -8.102  16.841 1.00 . A A . 101 ILE N    1 1 
        1  1604 1 1 104 ILE O    O  -2.986  -7.092  18.402 1.00 . A A . 101 ILE O    1 1 
        1  1605 1 1 105 GLU C    C  -2.686  -3.976  20.506 1.00 . A A . 102 GLU C    1 1 
        1  1606 1 1 105 GLU CA   C  -2.252  -5.445  20.549 1.00 . A A . 102 GLU CA   1 1 
        1  1607 1 1 105 GLU CB   C  -1.393  -5.789  21.805 1.00 . A A . 102 GLU CB   1 1 
        1  1608 1 1 105 GLU CD   C  -2.745  -4.625  23.718 1.00 . A A . 102 GLU CD   1 1 
        1  1609 1 1 105 GLU CG   C  -2.172  -5.940  23.141 1.00 . A A . 102 GLU CG   1 1 
        1  1610 1 1 105 GLU H    H  -0.611  -5.280  19.226 1.00 . A A . 102 GLU H    1 1 
        1  1611 1 1 105 GLU HA   H  -3.141  -6.079  20.543 1.00 . A A . 102 GLU HA   1 1 
        1  1612 1 1 105 GLU HB2  H  -0.890  -6.729  21.618 1.00 . A A . 102 GLU HB2  1 1 
        1  1613 1 1 105 GLU HB3  H  -0.633  -5.019  21.935 1.00 . A A . 102 GLU HB3  1 1 
        1  1614 1 1 105 GLU HG2  H  -2.989  -6.637  22.979 1.00 . A A . 102 GLU HG2  1 1 
        1  1615 1 1 105 GLU HG3  H  -1.500  -6.374  23.878 1.00 . A A . 102 GLU HG3  1 1 
        1  1616 1 1 105 GLU N    N  -1.481  -5.705  19.323 1.00 . A A . 102 GLU N    1 1 
        1  1617 1 1 105 GLU O    O  -1.881  -3.074  20.752 1.00 . A A . 102 GLU O    1 1 
        1  1618 1 1 105 GLU OE1  O  -1.940  -3.745  24.101 1.00 . A A . 102 GLU OE1  1 1 
        1  1619 1 1 105 GLU OE2  O  -3.990  -4.457  23.784 1.00 . A A . 102 GLU OE2  1 1 
        1  1620 1 1 106 THR C    C  -6.043  -2.429  20.091 1.00 . A A . 103 THR C    1 1 
        1  1621 1 1 106 THR CA   C  -4.514  -2.413  19.930 1.00 . A A . 103 THR CA   1 1 
        1  1622 1 1 106 THR CB   C  -4.108  -1.877  18.497 1.00 . A A . 103 THR CB   1 1 
        1  1623 1 1 106 THR CG2  C  -4.448  -2.886  17.387 1.00 . A A . 103 THR CG2  1 1 
        1  1624 1 1 106 THR H    H  -4.573  -4.526  20.133 1.00 . A A . 103 THR H    1 1 
        1  1625 1 1 106 THR HA   H  -4.102  -1.739  20.676 1.00 . A A . 103 THR HA   1 1 
        1  1626 1 1 106 THR HB   H  -3.032  -1.716  18.482 1.00 . A A . 103 THR HB   1 1 
        1  1627 1 1 106 THR HG1  H  -5.098  -0.622  17.318 1.00 . A A . 103 THR HG1  1 1 
        1  1628 1 1 106 THR HG21 H  -3.947  -3.824  17.580 1.00 . A A . 103 THR HG21 1 1 
        1  1629 1 1 106 THR HG22 H  -4.126  -2.498  16.429 1.00 . A A . 103 THR HG22 1 1 
        1  1630 1 1 106 THR HG23 H  -5.520  -3.049  17.361 1.00 . A A . 103 THR HG23 1 1 
        1  1631 1 1 106 THR N    N  -3.964  -3.754  20.181 1.00 . A A . 103 THR N    1 1 
        1  1632 1 1 106 THR O    O  -6.671  -3.493  20.086 1.00 . A A . 103 THR O    1 1 
        1  1633 1 1 106 THR OG1  O  -4.747  -0.612  18.216 1.00 . A A . 103 THR OG1  1 1 
        1  1634 1 1 107 ASP C    C  -8.683  -0.927  18.921 1.00 . A A . 104 ASP C    1 1 
        1  1635 1 1 107 ASP CA   C  -8.083  -1.015  20.336 1.00 . A A . 104 ASP CA   1 1 
        1  1636 1 1 107 ASP CB   C  -8.376   0.290  21.134 1.00 . A A . 104 ASP CB   1 1 
        1  1637 1 1 107 ASP CG   C  -9.860   0.726  21.089 1.00 . A A . 104 ASP CG   1 1 
        1  1638 1 1 107 ASP H    H  -6.041  -0.443  20.307 1.00 . A A . 104 ASP H    1 1 
        1  1639 1 1 107 ASP HA   H  -8.528  -1.857  20.861 1.00 . A A . 104 ASP HA   1 1 
        1  1640 1 1 107 ASP HB2  H  -8.093   0.141  22.174 1.00 . A A . 104 ASP HB2  1 1 
        1  1641 1 1 107 ASP HB3  H  -7.764   1.094  20.729 1.00 . A A . 104 ASP HB3  1 1 
        1  1642 1 1 107 ASP N    N  -6.622  -1.228  20.252 1.00 . A A . 104 ASP N    1 1 
        1  1643 1 1 107 ASP O    O  -9.697  -1.565  18.606 1.00 . A A . 104 ASP O    1 1 
        1  1644 1 1 107 ASP OD1  O -10.678   0.182  21.863 1.00 . A A . 104 ASP OD1  1 1 
        1  1645 1 1 107 ASP OD2  O -10.208   1.625  20.287 1.00 . A A . 104 ASP OD2  1 1 
        1  1646 1 1 108 GLU C    C  -7.721  -0.592  15.663 1.00 . A A . 105 GLU C    1 1 
        1  1647 1 1 108 GLU CA   C  -8.482   0.211  16.723 1.00 . A A . 105 GLU CA   1 1 
        1  1648 1 1 108 GLU CB   C  -8.306   1.733  16.516 1.00 . A A . 105 GLU CB   1 1 
        1  1649 1 1 108 GLU CD   C  -6.804   3.774  16.919 1.00 . A A . 105 GLU CD   1 1 
        1  1650 1 1 108 GLU CG   C  -6.866   2.253  16.725 1.00 . A A . 105 GLU CG   1 1 
        1  1651 1 1 108 GLU H    H  -7.133   0.191  18.356 1.00 . A A . 105 GLU H    1 1 
        1  1652 1 1 108 GLU HA   H  -9.541  -0.033  16.651 1.00 . A A . 105 GLU HA   1 1 
        1  1653 1 1 108 GLU HB2  H  -8.617   1.993  15.507 1.00 . A A . 105 GLU HB2  1 1 
        1  1654 1 1 108 GLU HB3  H  -8.960   2.246  17.213 1.00 . A A . 105 GLU HB3  1 1 
        1  1655 1 1 108 GLU HG2  H  -6.444   1.766  17.600 1.00 . A A . 105 GLU HG2  1 1 
        1  1656 1 1 108 GLU HG3  H  -6.265   1.988  15.860 1.00 . A A . 105 GLU HG3  1 1 
        1  1657 1 1 108 GLU N    N  -8.010  -0.143  18.073 1.00 . A A . 105 GLU N    1 1 
        1  1658 1 1 108 GLU O    O  -6.602  -1.044  15.911 1.00 . A A . 105 GLU O    1 1 
        1  1659 1 1 108 GLU OE1  O  -6.966   4.522  15.933 1.00 . A A . 105 GLU OE1  1 1 
        1  1660 1 1 108 GLU OE2  O  -6.638   4.225  18.074 1.00 . A A . 105 GLU OE2  1 1 
        1  1661 1 1 109 ILE C    C  -7.633  -0.761  12.084 1.00 . A A . 106 ILE C    1 1 
        1  1662 1 1 109 ILE CA   C  -7.765  -1.583  13.387 1.00 . A A . 106 ILE CA   1 1 
        1  1663 1 1 109 ILE CB   C  -8.617  -2.893  13.130 1.00 . A A . 106 ILE CB   1 1 
        1  1664 1 1 109 ILE CD1  C  -6.587  -4.385  12.514 1.00 . A A . 106 ILE CD1  1 1 
        1  1665 1 1 109 ILE CG1  C  -7.929  -3.825  12.078 1.00 . A A . 106 ILE CG1  1 1 
        1  1666 1 1 109 ILE CG2  C -10.083  -2.574  12.730 1.00 . A A . 106 ILE CG2  1 1 
        1  1667 1 1 109 ILE H    H  -9.208  -0.347  14.339 1.00 . A A . 106 ILE H    1 1 
        1  1668 1 1 109 ILE HA   H  -6.762  -1.897  13.693 1.00 . A A . 106 ILE HA   1 1 
        1  1669 1 1 109 ILE HB   H  -8.663  -3.434  14.072 1.00 . A A . 106 ILE HB   1 1 
        1  1670 1 1 109 ILE HD11 H  -6.698  -4.927  13.445 1.00 . A A . 106 ILE HD11 1 1 
        1  1671 1 1 109 ILE HD12 H  -5.879  -3.582  12.645 1.00 . A A . 106 ILE HD12 1 1 
        1  1672 1 1 109 ILE HD13 H  -6.221  -5.059  11.753 1.00 . A A . 106 ILE HD13 1 1 
        1  1673 1 1 109 ILE HG12 H  -8.570  -4.671  11.875 1.00 . A A . 106 ILE HG12 1 1 
        1  1674 1 1 109 ILE HG13 H  -7.771  -3.277  11.156 1.00 . A A . 106 ILE HG13 1 1 
        1  1675 1 1 109 ILE HG21 H -10.558  -1.993  13.513 1.00 . A A . 106 ILE HG21 1 1 
        1  1676 1 1 109 ILE HG22 H -10.639  -3.494  12.586 1.00 . A A . 106 ILE HG22 1 1 
        1  1677 1 1 109 ILE HG23 H -10.095  -2.004  11.810 1.00 . A A . 106 ILE HG23 1 1 
        1  1678 1 1 109 ILE N    N  -8.338  -0.772  14.481 1.00 . A A . 106 ILE N    1 1 
        1  1679 1 1 109 ILE O    O  -6.625  -0.875  11.389 1.00 . A A . 106 ILE O    1 1 
        1  1680 1 1 110 GLY C    C  -7.597   1.642  10.083 1.00 . A A . 107 GLY C    1 1 
        1  1681 1 1 110 GLY CA   C  -8.778   0.762  10.495 1.00 . A A . 107 GLY CA   1 1 
        1  1682 1 1 110 GLY H    H  -9.246   0.354  12.531 1.00 . A A . 107 GLY H    1 1 
        1  1683 1 1 110 GLY HA2  H  -8.918  -0.009   9.747 1.00 . A A . 107 GLY HA2  1 1 
        1  1684 1 1 110 GLY HA3  H  -9.668   1.373  10.525 1.00 . A A . 107 GLY HA3  1 1 
        1  1685 1 1 110 GLY N    N  -8.620   0.120  11.814 1.00 . A A . 107 GLY N    1 1 
        1  1686 1 1 110 GLY O    O  -7.238   1.704   8.901 1.00 . A A . 107 GLY O    1 1 
        1  1687 1 1 111 THR C    C  -4.543   2.399  10.555 1.00 . A A . 108 THR C    1 1 
        1  1688 1 1 111 THR CA   C  -5.828   3.193  10.876 1.00 . A A . 108 THR CA   1 1 
        1  1689 1 1 111 THR CB   C  -5.594   4.098  12.138 1.00 . A A . 108 THR CB   1 1 
        1  1690 1 1 111 THR CG2  C  -5.231   3.284  13.397 1.00 . A A . 108 THR CG2  1 1 
        1  1691 1 1 111 THR H    H  -7.328   2.187  11.992 1.00 . A A . 108 THR H    1 1 
        1  1692 1 1 111 THR HA   H  -6.056   3.845  10.037 1.00 . A A . 108 THR HA   1 1 
        1  1693 1 1 111 THR HB   H  -6.516   4.637  12.334 1.00 . A A . 108 THR HB   1 1 
        1  1694 1 1 111 THR HG1  H  -4.069   5.237  12.692 1.00 . A A . 108 THR HG1  1 1 
        1  1695 1 1 111 THR HG21 H  -6.017   2.570  13.610 1.00 . A A . 108 THR HG21 1 1 
        1  1696 1 1 111 THR HG22 H  -5.118   3.948  14.243 1.00 . A A . 108 THR HG22 1 1 
        1  1697 1 1 111 THR HG23 H  -4.300   2.753  13.235 1.00 . A A . 108 THR HG23 1 1 
        1  1698 1 1 111 THR N    N  -6.984   2.301  11.081 1.00 . A A . 108 THR N    1 1 
        1  1699 1 1 111 THR O    O  -3.698   2.849   9.775 1.00 . A A . 108 THR O    1 1 
        1  1700 1 1 111 THR OG1  O  -4.554   5.058  11.879 1.00 . A A . 108 THR OG1  1 1 
        1  1701 1 1 112 LEU C    C  -3.271  -0.861  10.281 1.00 . A A . 109 LEU C    1 1 
        1  1702 1 1 112 LEU CA   C  -3.178   0.411  11.146 1.00 . A A . 109 LEU CA   1 1 
        1  1703 1 1 112 LEU CB   C  -2.765   0.127  12.628 1.00 . A A . 109 LEU CB   1 1 
        1  1704 1 1 112 LEU CD1  C  -4.060  -1.919  13.536 1.00 . A A . 109 LEU CD1  1 1 
        1  1705 1 1 112 LEU CD2  C  -3.639   0.078  15.056 1.00 . A A . 109 LEU CD2  1 1 
        1  1706 1 1 112 LEU CG   C  -3.887  -0.390  13.602 1.00 . A A . 109 LEU CG   1 1 
        1  1707 1 1 112 LEU H    H  -5.219   0.807  11.570 1.00 . A A . 109 LEU H    1 1 
        1  1708 1 1 112 LEU HA   H  -2.400   1.032  10.700 1.00 . A A . 109 LEU HA   1 1 
        1  1709 1 1 112 LEU HB2  H  -1.955  -0.599  12.623 1.00 . A A . 109 LEU HB2  1 1 
        1  1710 1 1 112 LEU HB3  H  -2.359   1.050  13.037 1.00 . A A . 109 LEU HB3  1 1 
        1  1711 1 1 112 LEU HD11 H  -4.261  -2.223  12.516 1.00 . A A . 109 LEU HD11 1 1 
        1  1712 1 1 112 LEU HD12 H  -4.892  -2.213  14.160 1.00 . A A . 109 LEU HD12 1 1 
        1  1713 1 1 112 LEU HD13 H  -3.160  -2.409  13.888 1.00 . A A . 109 LEU HD13 1 1 
        1  1714 1 1 112 LEU HD21 H  -2.706  -0.331  15.423 1.00 . A A . 109 LEU HD21 1 1 
        1  1715 1 1 112 LEU HD22 H  -4.450  -0.255  15.693 1.00 . A A . 109 LEU HD22 1 1 
        1  1716 1 1 112 LEU HD23 H  -3.592   1.157  15.085 1.00 . A A . 109 LEU HD23 1 1 
        1  1717 1 1 112 LEU HG   H  -4.832   0.040  13.289 1.00 . A A . 109 LEU HG   1 1 
        1  1718 1 1 112 LEU N    N  -4.427   1.193  11.140 1.00 . A A . 109 LEU N    1 1 
        1  1719 1 1 112 LEU O    O  -2.283  -1.593  10.151 1.00 . A A . 109 LEU O    1 1 
        1  1720 1 1 113 LEU C    C  -6.097  -2.015   8.108 1.00 . A A . 110 LEU C    1 1 
        1  1721 1 1 113 LEU CA   C  -4.711  -2.204   8.755 1.00 . A A . 110 LEU CA   1 1 
        1  1722 1 1 113 LEU CB   C  -4.642  -3.574   9.496 1.00 . A A . 110 LEU CB   1 1 
        1  1723 1 1 113 LEU CD1  C  -3.787  -4.949   7.513 1.00 . A A . 110 LEU CD1  1 1 
        1  1724 1 1 113 LEU CD2  C  -4.928  -6.128   9.476 1.00 . A A . 110 LEU CD2  1 1 
        1  1725 1 1 113 LEU CG   C  -4.855  -4.840   8.613 1.00 . A A . 110 LEU CG   1 1 
        1  1726 1 1 113 LEU H    H  -5.189  -0.471   9.869 1.00 . A A . 110 LEU H    1 1 
        1  1727 1 1 113 LEU HA   H  -3.950  -2.178   7.975 1.00 . A A . 110 LEU HA   1 1 
        1  1728 1 1 113 LEU HB2  H  -3.672  -3.651   9.977 1.00 . A A . 110 LEU HB2  1 1 
        1  1729 1 1 113 LEU HB3  H  -5.399  -3.569  10.272 1.00 . A A . 110 LEU HB3  1 1 
        1  1730 1 1 113 LEU HD11 H  -2.802  -5.025   7.957 1.00 . A A . 110 LEU HD11 1 1 
        1  1731 1 1 113 LEU HD12 H  -3.825  -4.072   6.879 1.00 . A A . 110 LEU HD12 1 1 
        1  1732 1 1 113 LEU HD13 H  -3.974  -5.825   6.909 1.00 . A A . 110 LEU HD13 1 1 
        1  1733 1 1 113 LEU HD21 H  -5.132  -6.979   8.842 1.00 . A A . 110 LEU HD21 1 1 
        1  1734 1 1 113 LEU HD22 H  -5.725  -6.033  10.207 1.00 . A A . 110 LEU HD22 1 1 
        1  1735 1 1 113 LEU HD23 H  -3.988  -6.282   9.993 1.00 . A A . 110 LEU HD23 1 1 
        1  1736 1 1 113 LEU HG   H  -5.800  -4.736   8.107 1.00 . A A . 110 LEU HG   1 1 
        1  1737 1 1 113 LEU N    N  -4.449  -1.084   9.676 1.00 . A A . 110 LEU N    1 1 
        1  1738 1 1 113 LEU O    O  -7.121  -2.004   8.806 1.00 . A A . 110 LEU O    1 1 
        1  1739 1 1 114 THR C    C  -7.952  -2.998   5.557 1.00 . A A . 111 THR C    1 1 
        1  1740 1 1 114 THR CA   C  -7.350  -1.645   6.005 1.00 . A A . 111 THR CA   1 1 
        1  1741 1 1 114 THR CB   C  -7.083  -0.714   4.780 1.00 . A A . 111 THR CB   1 1 
        1  1742 1 1 114 THR CG2  C  -8.350  -0.500   3.929 1.00 . A A . 111 THR CG2  1 1 
        1  1743 1 1 114 THR H    H  -5.270  -1.891   6.295 1.00 . A A . 111 THR H    1 1 
        1  1744 1 1 114 THR HA   H  -8.067  -1.143   6.651 1.00 . A A . 111 THR HA   1 1 
        1  1745 1 1 114 THR HB   H  -6.318  -1.173   4.154 1.00 . A A . 111 THR HB   1 1 
        1  1746 1 1 114 THR HG1  H  -6.907   0.699   6.147 1.00 . A A . 111 THR HG1  1 1 
        1  1747 1 1 114 THR HG21 H  -8.143   0.207   3.137 1.00 . A A . 111 THR HG21 1 1 
        1  1748 1 1 114 THR HG22 H  -9.151  -0.126   4.551 1.00 . A A . 111 THR HG22 1 1 
        1  1749 1 1 114 THR HG23 H  -8.655  -1.446   3.488 1.00 . A A . 111 THR HG23 1 1 
        1  1750 1 1 114 THR N    N  -6.117  -1.856   6.777 1.00 . A A . 111 THR N    1 1 
        1  1751 1 1 114 THR O    O  -7.229  -3.905   5.118 1.00 . A A . 111 THR O    1 1 
        1  1752 1 1 114 THR OG1  O  -6.593   0.558   5.247 1.00 . A A . 111 THR OG1  1 1 
        1  1753 1 1 115 LEU C    C -11.247  -4.091   4.497 1.00 . A A . 112 LEU C    1 1 
        1  1754 1 1 115 LEU CA   C -10.063  -4.344   5.458 1.00 . A A . 112 LEU CA   1 1 
        1  1755 1 1 115 LEU CB   C -10.595  -4.850   6.826 1.00 . A A . 112 LEU CB   1 1 
        1  1756 1 1 115 LEU CD1  C -10.155  -5.049   9.339 1.00 . A A . 112 LEU CD1  1 1 
        1  1757 1 1 115 LEU CD2  C  -8.597  -6.204   7.716 1.00 . A A . 112 LEU CD2  1 1 
        1  1758 1 1 115 LEU CG   C  -9.519  -4.993   7.954 1.00 . A A . 112 LEU CG   1 1 
        1  1759 1 1 115 LEU H    H  -9.791  -2.292   5.899 1.00 . A A . 112 LEU H    1 1 
        1  1760 1 1 115 LEU HA   H  -9.404  -5.095   5.030 1.00 . A A . 112 LEU HA   1 1 
        1  1761 1 1 115 LEU HB2  H -11.361  -4.154   7.167 1.00 . A A . 112 LEU HB2  1 1 
        1  1762 1 1 115 LEU HB3  H -11.067  -5.819   6.675 1.00 . A A . 112 LEU HB3  1 1 
        1  1763 1 1 115 LEU HD11 H -10.834  -5.892   9.404 1.00 . A A . 112 LEU HD11 1 1 
        1  1764 1 1 115 LEU HD12 H -10.700  -4.133   9.521 1.00 . A A . 112 LEU HD12 1 1 
        1  1765 1 1 115 LEU HD13 H  -9.382  -5.155  10.088 1.00 . A A . 112 LEU HD13 1 1 
        1  1766 1 1 115 LEU HD21 H  -7.834  -6.237   8.482 1.00 . A A . 112 LEU HD21 1 1 
        1  1767 1 1 115 LEU HD22 H  -8.121  -6.116   6.748 1.00 . A A . 112 LEU HD22 1 1 
        1  1768 1 1 115 LEU HD23 H  -9.173  -7.121   7.748 1.00 . A A . 112 LEU HD23 1 1 
        1  1769 1 1 115 LEU HG   H  -8.895  -4.116   7.944 1.00 . A A . 112 LEU HG   1 1 
        1  1770 1 1 115 LEU N    N  -9.293  -3.101   5.670 1.00 . A A . 112 LEU N    1 1 
        1  1771 1 1 115 LEU O    O -11.796  -2.986   4.467 1.00 . A A . 112 LEU O    1 1 
        1  1772 1 1 116 VAL C    C -14.080  -5.398   3.659 1.00 . A A . 113 VAL C    1 1 
        1  1773 1 1 116 VAL CA   C -12.805  -5.110   2.833 1.00 . A A . 113 VAL CA   1 1 
        1  1774 1 1 116 VAL CB   C -12.680  -6.166   1.653 1.00 . A A . 113 VAL CB   1 1 
        1  1775 1 1 116 VAL CG1  C -11.523  -5.810   0.685 1.00 . A A . 113 VAL CG1  1 1 
        1  1776 1 1 116 VAL CG2  C -12.506  -7.605   2.196 1.00 . A A . 113 VAL CG2  1 1 
        1  1777 1 1 116 VAL H    H -11.080  -5.927   3.743 1.00 . A A . 113 VAL H    1 1 
        1  1778 1 1 116 VAL HA   H -12.892  -4.117   2.397 1.00 . A A . 113 VAL HA   1 1 
        1  1779 1 1 116 VAL HB   H -13.605  -6.133   1.077 1.00 . A A . 113 VAL HB   1 1 
        1  1780 1 1 116 VAL HG11 H -10.579  -5.827   1.219 1.00 . A A . 113 VAL HG11 1 1 
        1  1781 1 1 116 VAL HG12 H -11.676  -4.818   0.274 1.00 . A A . 113 VAL HG12 1 1 
        1  1782 1 1 116 VAL HG13 H -11.487  -6.526  -0.127 1.00 . A A . 113 VAL HG13 1 1 
        1  1783 1 1 116 VAL HG21 H -12.449  -8.306   1.371 1.00 . A A . 113 VAL HG21 1 1 
        1  1784 1 1 116 VAL HG22 H -13.346  -7.866   2.826 1.00 . A A . 113 VAL HG22 1 1 
        1  1785 1 1 116 VAL HG23 H -11.591  -7.664   2.777 1.00 . A A . 113 VAL HG23 1 1 
        1  1786 1 1 116 VAL N    N -11.619  -5.123   3.717 1.00 . A A . 113 VAL N    1 1 
        1  1787 1 1 116 VAL O    O -15.170  -4.926   3.325 1.00 . A A . 113 VAL O    1 1 
        1  1788 1 1 117 ASP C    C -15.429  -5.339   6.484 1.00 . A A . 114 ASP C    1 1 
        1  1789 1 1 117 ASP CA   C -14.986  -6.563   5.666 1.00 . A A . 114 ASP CA   1 1 
        1  1790 1 1 117 ASP CB   C -14.491  -7.693   6.604 1.00 . A A . 114 ASP CB   1 1 
        1  1791 1 1 117 ASP CG   C -15.543  -8.145   7.639 1.00 . A A . 114 ASP CG   1 1 
        1  1792 1 1 117 ASP H    H -13.007  -6.525   4.918 1.00 . A A . 114 ASP H    1 1 
        1  1793 1 1 117 ASP HA   H -15.827  -6.929   5.078 1.00 . A A . 114 ASP HA   1 1 
        1  1794 1 1 117 ASP HB2  H -14.202  -8.553   6.000 1.00 . A A . 114 ASP HB2  1 1 
        1  1795 1 1 117 ASP HB3  H -13.607  -7.350   7.136 1.00 . A A . 114 ASP HB3  1 1 
        1  1796 1 1 117 ASP N    N -13.907  -6.186   4.739 1.00 . A A . 114 ASP N    1 1 
        1  1797 1 1 117 ASP O    O -16.605  -4.956   6.472 1.00 . A A . 114 ASP O    1 1 
        1  1798 1 1 117 ASP OD1  O -15.610  -7.550   8.747 1.00 . A A . 114 ASP OD1  1 1 
        1  1799 1 1 117 ASP OD2  O -16.300  -9.099   7.360 1.00 . A A . 114 ASP OD2  1 1 
        1  1800 1 1 118 GLN C    C -14.883  -2.291   7.177 1.00 . A A . 115 GLN C    1 1 
        1  1801 1 1 118 GLN CA   C -14.690  -3.563   8.037 1.00 . A A . 115 GLN CA   1 1 
        1  1802 1 1 118 GLN CB   C -13.528  -3.381   9.057 1.00 . A A . 115 GLN CB   1 1 
        1  1803 1 1 118 GLN CD   C -14.798  -4.346  11.050 1.00 . A A . 115 GLN CD   1 1 
        1  1804 1 1 118 GLN CG   C -13.532  -4.418  10.198 1.00 . A A . 115 GLN CG   1 1 
        1  1805 1 1 118 GLN H    H -13.553  -5.114   7.153 1.00 . A A . 115 GLN H    1 1 
        1  1806 1 1 118 GLN HA   H -15.609  -3.739   8.590 1.00 . A A . 115 GLN HA   1 1 
        1  1807 1 1 118 GLN HB2  H -12.583  -3.462   8.529 1.00 . A A . 115 GLN HB2  1 1 
        1  1808 1 1 118 GLN HB3  H -13.592  -2.392   9.500 1.00 . A A . 115 GLN HB3  1 1 
        1  1809 1 1 118 GLN HE21 H -13.982  -2.960  12.220 1.00 . A A . 115 GLN HE21 1 1 
        1  1810 1 1 118 GLN HE22 H -15.587  -3.446  12.631 1.00 . A A . 115 GLN HE22 1 1 
        1  1811 1 1 118 GLN HG2  H -13.452  -5.412   9.767 1.00 . A A . 115 GLN HG2  1 1 
        1  1812 1 1 118 GLN HG3  H -12.671  -4.245  10.833 1.00 . A A . 115 GLN HG3  1 1 
        1  1813 1 1 118 GLN N    N -14.458  -4.746   7.198 1.00 . A A . 115 GLN N    1 1 
        1  1814 1 1 118 GLN NE2  N -14.789  -3.499  12.070 1.00 . A A . 115 GLN NE2  1 1 
        1  1815 1 1 118 GLN O    O -14.245  -2.156   6.126 1.00 . A A . 115 GLN O    1 1 
        1  1816 1 1 118 GLN OE1  O -15.783  -5.030  10.783 1.00 . A A . 115 GLN OE1  1 1 
        1  1817 1 1 119 PRO C    C -14.890   0.862   6.731 1.00 . A A . 116 PRO C    1 1 
        1  1818 1 1 119 PRO CA   C -16.091  -0.105   6.857 1.00 . A A . 116 PRO CA   1 1 
        1  1819 1 1 119 PRO CB   C -17.248   0.529   7.678 1.00 . A A . 116 PRO CB   1 1 
        1  1820 1 1 119 PRO CD   C -16.523  -1.383   8.913 1.00 . A A . 116 PRO CD   1 1 
        1  1821 1 1 119 PRO CG   C -17.037   0.026   9.069 1.00 . A A . 116 PRO CG   1 1 
        1  1822 1 1 119 PRO HA   H -16.448  -0.348   5.860 1.00 . A A . 116 PRO HA   1 1 
        1  1823 1 1 119 PRO HB2  H -17.203   1.614   7.634 1.00 . A A . 116 PRO HB2  1 1 
        1  1824 1 1 119 PRO HB3  H -18.206   0.200   7.279 1.00 . A A . 116 PRO HB3  1 1 
        1  1825 1 1 119 PRO HD2  H -15.868  -1.642   9.739 1.00 . A A . 116 PRO HD2  1 1 
        1  1826 1 1 119 PRO HD3  H -17.343  -2.093   8.854 1.00 . A A . 116 PRO HD3  1 1 
        1  1827 1 1 119 PRO HG2  H -16.305   0.646   9.584 1.00 . A A . 116 PRO HG2  1 1 
        1  1828 1 1 119 PRO HG3  H -17.973   0.033   9.621 1.00 . A A . 116 PRO HG3  1 1 
        1  1829 1 1 119 PRO N    N -15.769  -1.338   7.623 1.00 . A A . 116 PRO N    1 1 
        1  1830 1 1 119 PRO O    O -13.892   0.753   7.463 1.00 . A A . 116 PRO O    1 1 
        1  1831 1 1 120 GLN C    C -14.092   3.970   6.485 1.00 . A A . 117 GLN C    1 1 
        1  1832 1 1 120 GLN CA   C -14.004   2.814   5.471 1.00 . A A . 117 GLN CA   1 1 
        1  1833 1 1 120 GLN CB   C -14.243   3.348   4.032 1.00 . A A . 117 GLN CB   1 1 
        1  1834 1 1 120 GLN CD   C -14.962   2.763   1.624 1.00 . A A . 117 GLN CD   1 1 
        1  1835 1 1 120 GLN CG   C -14.443   2.239   2.965 1.00 . A A . 117 GLN CG   1 1 
        1  1836 1 1 120 GLN H    H -15.865   1.834   5.289 1.00 . A A . 117 GLN H    1 1 
        1  1837 1 1 120 GLN HA   H -13.021   2.349   5.527 1.00 . A A . 117 GLN HA   1 1 
        1  1838 1 1 120 GLN HB2  H -15.126   3.975   4.040 1.00 . A A . 117 GLN HB2  1 1 
        1  1839 1 1 120 GLN HB3  H -13.391   3.955   3.737 1.00 . A A . 117 GLN HB3  1 1 
        1  1840 1 1 120 GLN HE21 H -15.939   1.069   1.306 1.00 . A A . 117 GLN HE21 1 1 
        1  1841 1 1 120 GLN HE22 H -16.097   2.271   0.079 1.00 . A A . 117 GLN HE22 1 1 
        1  1842 1 1 120 GLN HG2  H -13.494   1.745   2.792 1.00 . A A . 117 GLN HG2  1 1 
        1  1843 1 1 120 GLN HG3  H -15.151   1.512   3.346 1.00 . A A . 117 GLN HG3  1 1 
        1  1844 1 1 120 GLN N    N -15.025   1.804   5.787 1.00 . A A . 117 GLN N    1 1 
        1  1845 1 1 120 GLN NE2  N -15.740   1.953   0.931 1.00 . A A . 117 GLN NE2  1 1 
        1  1846 1 1 120 GLN O    O -15.181   4.265   7.003 1.00 . A A . 117 GLN O    1 1 
        1  1847 1 1 120 GLN OE1  O -14.680   3.889   1.225 1.00 . A A . 117 GLN OE1  1 1 
        1  1848 1 1 121 ALA C    C -13.423   7.028   7.105 1.00 . A A . 118 ALA C    1 1 
        1  1849 1 1 121 ALA CA   C -12.851   5.717   7.712 1.00 . A A . 118 ALA CA   1 1 
        1  1850 1 1 121 ALA CB   C -11.383   5.871   8.157 1.00 . A A . 118 ALA CB   1 1 
        1  1851 1 1 121 ALA H    H -12.140   4.344   6.261 1.00 . A A . 118 ALA H    1 1 
        1  1852 1 1 121 ALA HA   H -13.435   5.445   8.596 1.00 . A A . 118 ALA HA   1 1 
        1  1853 1 1 121 ALA HB1  H -11.309   6.644   8.911 1.00 . A A . 118 ALA HB1  1 1 
        1  1854 1 1 121 ALA HB2  H -10.775   6.143   7.305 1.00 . A A . 118 ALA HB2  1 1 
        1  1855 1 1 121 ALA HB3  H -11.023   4.935   8.568 1.00 . A A . 118 ALA HB3  1 1 
        1  1856 1 1 121 ALA N    N -12.950   4.616   6.745 1.00 . A A . 118 ALA N    1 1 
        1  1857 1 1 121 ALA O    O -14.607   7.345   7.349 1.00 . A A . 118 ALA O    1 1 
        1  1858 1 1 121 ALA OXT  O -12.703   7.717   6.359 1.00 . A A . 118 ALA OXT  1 1 
        2  1859 1 1   4 MET C    C   1.752  -2.097  -1.136 1.00 . A A .   1 MET C    1 1 
        2  1860 1 1   4 MET CA   C   1.325  -0.747  -0.531 1.00 . A A .   1 MET CA   1 1 
        2  1861 1 1   4 MET CB   C   2.294  -0.321   0.607 1.00 . A A .   1 MET CB   1 1 
        2  1862 1 1   4 MET CE   C   6.411   0.523   0.684 1.00 . A A .   1 MET CE   1 1 
        2  1863 1 1   4 MET CG   C   3.750  -0.105   0.165 1.00 . A A .   1 MET CG   1 1 
        2  1864 1 1   4 MET H    H  -0.351   0.049   0.426 1.00 . A A .   1 MET H    1 1 
        2  1865 1 1   4 MET HA   H   1.335   0.016  -1.308 1.00 . A A .   1 MET HA   1 1 
        2  1866 1 1   4 MET HB2  H   1.939   0.606   1.041 1.00 . A A .   1 MET HB2  1 1 
        2  1867 1 1   4 MET HB3  H   2.286  -1.085   1.377 1.00 . A A .   1 MET HB3  1 1 
        2  1868 1 1   4 MET HE1  H   6.345   1.236  -0.125 1.00 . A A .   1 MET HE1  1 1 
        2  1869 1 1   4 MET HE2  H   6.680  -0.446   0.290 1.00 . A A .   1 MET HE2  1 1 
        2  1870 1 1   4 MET HE3  H   7.166   0.847   1.386 1.00 . A A .   1 MET HE3  1 1 
        2  1871 1 1   4 MET HG2  H   4.133  -1.034  -0.237 1.00 . A A .   1 MET HG2  1 1 
        2  1872 1 1   4 MET HG3  H   3.776   0.656  -0.607 1.00 . A A .   1 MET HG3  1 1 
        2  1873 1 1   4 MET N    N  -0.064  -0.844  -0.024 1.00 . A A .   1 MET N    1 1 
        2  1874 1 1   4 MET O    O   1.605  -3.140  -0.493 1.00 . A A .   1 MET O    1 1 
        2  1875 1 1   4 MET SD   S   4.827   0.415   1.520 1.00 . A A .   1 MET SD   1 1 
        2  1876 1 1   5 ARG C    C   4.127  -3.631  -2.701 1.00 . A A .   2 ARG C    1 1 
        2  1877 1 1   5 ARG CA   C   2.708  -3.233  -3.147 1.00 . A A .   2 ARG CA   1 1 
        2  1878 1 1   5 ARG CB   C   2.682  -2.886  -4.662 1.00 . A A .   2 ARG CB   1 1 
        2  1879 1 1   5 ARG CD   C   1.451  -1.599  -6.513 1.00 . A A .   2 ARG CD   1 1 
        2  1880 1 1   5 ARG CG   C   1.374  -2.204  -5.107 1.00 . A A .   2 ARG CG   1 1 
        2  1881 1 1   5 ARG CZ   C   0.461   0.577  -7.260 1.00 . A A .   2 ARG CZ   1 1 
        2  1882 1 1   5 ARG H    H   2.294  -1.177  -2.824 1.00 . A A .   2 ARG H    1 1 
        2  1883 1 1   5 ARG HA   H   2.017  -4.059  -2.961 1.00 . A A .   2 ARG HA   1 1 
        2  1884 1 1   5 ARG HB2  H   3.507  -2.215  -4.884 1.00 . A A .   2 ARG HB2  1 1 
        2  1885 1 1   5 ARG HB3  H   2.807  -3.797  -5.238 1.00 . A A .   2 ARG HB3  1 1 
        2  1886 1 1   5 ARG HD2  H   2.399  -1.082  -6.627 1.00 . A A .   2 ARG HD2  1 1 
        2  1887 1 1   5 ARG HD3  H   1.386  -2.393  -7.250 1.00 . A A .   2 ARG HD3  1 1 
        2  1888 1 1   5 ARG HE   H  -0.546  -0.943  -6.444 1.00 . A A .   2 ARG HE   1 1 
        2  1889 1 1   5 ARG HG2  H   0.572  -2.933  -5.083 1.00 . A A .   2 ARG HG2  1 1 
        2  1890 1 1   5 ARG HG3  H   1.143  -1.411  -4.402 1.00 . A A .   2 ARG HG3  1 1 
        2  1891 1 1   5 ARG HH11 H   2.439   0.432  -7.704 1.00 . A A .   2 ARG HH11 1 1 
        2  1892 1 1   5 ARG HH12 H   1.687   1.937  -8.135 1.00 . A A .   2 ARG HH12 1 1 
        2  1893 1 1   5 ARG HH21 H  -1.483   1.027  -6.965 1.00 . A A .   2 ARG HH21 1 1 
        2  1894 1 1   5 ARG HH22 H  -0.533   2.271  -7.711 1.00 . A A .   2 ARG HH22 1 1 
        2  1895 1 1   5 ARG N    N   2.250  -2.052  -2.383 1.00 . A A .   2 ARG N    1 1 
        2  1896 1 1   5 ARG NE   N   0.344  -0.652  -6.737 1.00 . A A .   2 ARG NE   1 1 
        2  1897 1 1   5 ARG NH1  N   1.623   1.020  -7.736 1.00 . A A .   2 ARG NH1  1 1 
        2  1898 1 1   5 ARG NH2  N  -0.601   1.353  -7.316 1.00 . A A .   2 ARG NH2  1 1 
        2  1899 1 1   5 ARG O    O   5.104  -2.937  -3.022 1.00 . A A .   2 ARG O    1 1 
        2  1900 1 1   6 LEU C    C   5.435  -6.751  -1.120 1.00 . A A .   3 LEU C    1 1 
        2  1901 1 1   6 LEU CA   C   5.493  -5.222  -1.355 1.00 . A A .   3 LEU CA   1 1 
        2  1902 1 1   6 LEU CB   C   5.842  -4.427  -0.038 1.00 . A A .   3 LEU CB   1 1 
        2  1903 1 1   6 LEU CD1  C   3.711  -5.071   1.283 1.00 . A A .   3 LEU CD1  1 1 
        2  1904 1 1   6 LEU CD2  C   5.151  -3.140   2.096 1.00 . A A .   3 LEU CD2  1 1 
        2  1905 1 1   6 LEU CG   C   4.645  -3.928   0.858 1.00 . A A .   3 LEU CG   1 1 
        2  1906 1 1   6 LEU H    H   3.406  -5.213  -1.704 1.00 . A A .   3 LEU H    1 1 
        2  1907 1 1   6 LEU HA   H   6.274  -5.042  -2.086 1.00 . A A .   3 LEU HA   1 1 
        2  1908 1 1   6 LEU HB2  H   6.482  -5.052   0.577 1.00 . A A .   3 LEU HB2  1 1 
        2  1909 1 1   6 LEU HB3  H   6.422  -3.555  -0.330 1.00 . A A .   3 LEU HB3  1 1 
        2  1910 1 1   6 LEU HD11 H   3.281  -5.538   0.406 1.00 . A A .   3 LEU HD11 1 1 
        2  1911 1 1   6 LEU HD12 H   2.913  -4.680   1.900 1.00 . A A .   3 LEU HD12 1 1 
        2  1912 1 1   6 LEU HD13 H   4.268  -5.811   1.845 1.00 . A A .   3 LEU HD13 1 1 
        2  1913 1 1   6 LEU HD21 H   5.752  -3.788   2.727 1.00 . A A .   3 LEU HD21 1 1 
        2  1914 1 1   6 LEU HD22 H   4.309  -2.770   2.666 1.00 . A A .   3 LEU HD22 1 1 
        2  1915 1 1   6 LEU HD23 H   5.753  -2.301   1.774 1.00 . A A .   3 LEU HD23 1 1 
        2  1916 1 1   6 LEU HG   H   4.043  -3.242   0.270 1.00 . A A .   3 LEU HG   1 1 
        2  1917 1 1   6 LEU N    N   4.224  -4.723  -1.923 1.00 . A A .   3 LEU N    1 1 
        2  1918 1 1   6 LEU O    O   4.417  -7.401  -1.421 1.00 . A A .   3 LEU O    1 1 
        2  1919 1 1   7 LYS C    C   5.664  -9.001   1.023 1.00 . A A .   4 LYS C    1 1 
        2  1920 1 1   7 LYS CA   C   6.593  -8.740  -0.179 1.00 . A A .   4 LYS CA   1 1 
        2  1921 1 1   7 LYS CB   C   8.032  -9.176   0.209 1.00 . A A .   4 LYS CB   1 1 
        2  1922 1 1   7 LYS CD   C  10.459  -9.661  -0.437 1.00 . A A .   4 LYS CD   1 1 
        2  1923 1 1   7 LYS CE   C  11.037  -8.953   0.805 1.00 . A A .   4 LYS CE   1 1 
        2  1924 1 1   7 LYS CG   C   9.098  -9.065  -0.896 1.00 . A A .   4 LYS CG   1 1 
        2  1925 1 1   7 LYS H    H   7.349  -6.773  -0.484 1.00 . A A .   4 LYS H    1 1 
        2  1926 1 1   7 LYS HA   H   6.256  -9.345  -1.020 1.00 . A A .   4 LYS HA   1 1 
        2  1927 1 1   7 LYS HB2  H   8.362  -8.580   1.051 1.00 . A A .   4 LYS HB2  1 1 
        2  1928 1 1   7 LYS HB3  H   7.997 -10.220   0.522 1.00 . A A .   4 LYS HB3  1 1 
        2  1929 1 1   7 LYS HD2  H  10.316 -10.710  -0.200 1.00 . A A .   4 LYS HD2  1 1 
        2  1930 1 1   7 LYS HD3  H  11.169  -9.580  -1.253 1.00 . A A .   4 LYS HD3  1 1 
        2  1931 1 1   7 LYS HE2  H  11.267  -7.926   0.553 1.00 . A A .   4 LYS HE2  1 1 
        2  1932 1 1   7 LYS HE3  H  10.299  -8.965   1.598 1.00 . A A .   4 LYS HE3  1 1 
        2  1933 1 1   7 LYS HG2  H   8.755  -9.612  -1.770 1.00 . A A .   4 LYS HG2  1 1 
        2  1934 1 1   7 LYS HG3  H   9.235  -8.021  -1.159 1.00 . A A .   4 LYS HG3  1 1 
        2  1935 1 1   7 LYS HZ1  H  13.016  -9.591   0.581 1.00 . A A .   4 LYS HZ1  1 1 
        2  1936 1 1   7 LYS HZ2  H  12.086 -10.589   1.582 1.00 . A A .   4 LYS HZ2  1 1 
        2  1937 1 1   7 LYS HZ3  H  12.627  -9.093   2.149 1.00 . A A .   4 LYS HZ3  1 1 
        2  1938 1 1   7 LYS N    N   6.542  -7.321  -0.589 1.00 . A A .   4 LYS N    1 1 
        2  1939 1 1   7 LYS NZ   N  12.277  -9.602   1.311 1.00 . A A .   4 LYS NZ   1 1 
        2  1940 1 1   7 LYS O    O   5.250  -8.072   1.708 1.00 . A A .   4 LYS O    1 1 
        2  1941 1 1   8 SER C    C   5.409 -10.471   3.735 1.00 . A A .   5 SER C    1 1 
        2  1942 1 1   8 SER CA   C   4.617 -10.759   2.431 1.00 . A A .   5 SER CA   1 1 
        2  1943 1 1   8 SER CB   C   4.380 -12.277   2.272 1.00 . A A .   5 SER CB   1 1 
        2  1944 1 1   8 SER H    H   5.671 -10.952   0.612 1.00 . A A .   5 SER H    1 1 
        2  1945 1 1   8 SER HA   H   3.660 -10.243   2.459 1.00 . A A .   5 SER HA   1 1 
        2  1946 1 1   8 SER HB2  H   5.291 -12.819   2.495 1.00 . A A .   5 SER HB2  1 1 
        2  1947 1 1   8 SER HB3  H   3.600 -12.598   2.952 1.00 . A A .   5 SER HB3  1 1 
        2  1948 1 1   8 SER HG   H   3.054 -12.836   0.939 1.00 . A A .   5 SER HG   1 1 
        2  1949 1 1   8 SER N    N   5.372 -10.282   1.261 1.00 . A A .   5 SER N    1 1 
        2  1950 1 1   8 SER O    O   4.842 -10.051   4.742 1.00 . A A .   5 SER O    1 1 
        2  1951 1 1   8 SER OG   O   3.989 -12.600   0.948 1.00 . A A .   5 SER OG   1 1 
        2  1952 1 1   9 GLU C    C   7.689  -8.892   5.073 1.00 . A A .   6 GLU C    1 1 
        2  1953 1 1   9 GLU CA   C   7.692 -10.393   4.754 1.00 . A A .   6 GLU CA   1 1 
        2  1954 1 1   9 GLU CB   C   9.110 -10.878   4.324 1.00 . A A .   6 GLU CB   1 1 
        2  1955 1 1   9 GLU CD   C  10.940  -9.210   5.149 1.00 . A A .   6 GLU CD   1 1 
        2  1956 1 1   9 GLU CG   C  10.282 -10.597   5.305 1.00 . A A .   6 GLU CG   1 1 
        2  1957 1 1   9 GLU H    H   7.086 -11.088   2.845 1.00 . A A .   6 GLU H    1 1 
        2  1958 1 1   9 GLU HA   H   7.380 -10.946   5.635 1.00 . A A .   6 GLU HA   1 1 
        2  1959 1 1   9 GLU HB2  H   9.061 -11.951   4.178 1.00 . A A .   6 GLU HB2  1 1 
        2  1960 1 1   9 GLU HB3  H   9.350 -10.425   3.365 1.00 . A A .   6 GLU HB3  1 1 
        2  1961 1 1   9 GLU HG2  H   9.909 -10.699   6.318 1.00 . A A .   6 GLU HG2  1 1 
        2  1962 1 1   9 GLU HG3  H  11.048 -11.353   5.149 1.00 . A A .   6 GLU HG3  1 1 
        2  1963 1 1   9 GLU N    N   6.736 -10.693   3.666 1.00 . A A .   6 GLU N    1 1 
        2  1964 1 1   9 GLU O    O   7.557  -8.485   6.234 1.00 . A A .   6 GLU O    1 1 
        2  1965 1 1   9 GLU OE1  O  11.556  -8.958   4.097 1.00 . A A .   6 GLU OE1  1 1 
        2  1966 1 1   9 GLU OE2  O  10.836  -8.371   6.063 1.00 . A A .   6 GLU OE2  1 1 
        2  1967 1 1  10 MET C    C   6.487  -6.072   4.518 1.00 . A A .   7 MET C    1 1 
        2  1968 1 1  10 MET CA   C   7.868  -6.619   4.095 1.00 . A A .   7 MET CA   1 1 
        2  1969 1 1  10 MET CB   C   8.314  -6.017   2.735 1.00 . A A .   7 MET CB   1 1 
        2  1970 1 1  10 MET CE   C   9.004  -3.094   5.135 1.00 . A A .   7 MET CE   1 1 
        2  1971 1 1  10 MET CG   C   8.542  -4.488   2.717 1.00 . A A .   7 MET CG   1 1 
        2  1972 1 1  10 MET H    H   7.922  -8.507   3.129 1.00 . A A .   7 MET H    1 1 
        2  1973 1 1  10 MET HA   H   8.604  -6.350   4.855 1.00 . A A .   7 MET HA   1 1 
        2  1974 1 1  10 MET HB2  H   9.243  -6.489   2.435 1.00 . A A .   7 MET HB2  1 1 
        2  1975 1 1  10 MET HB3  H   7.559  -6.253   1.991 1.00 . A A .   7 MET HB3  1 1 
        2  1976 1 1  10 MET HE1  H   8.369  -3.804   5.650 1.00 . A A .   7 MET HE1  1 1 
        2  1977 1 1  10 MET HE2  H   8.398  -2.300   4.728 1.00 . A A .   7 MET HE2  1 1 
        2  1978 1 1  10 MET HE3  H   9.719  -2.682   5.832 1.00 . A A .   7 MET HE3  1 1 
        2  1979 1 1  10 MET HG2  H   8.786  -4.186   1.708 1.00 . A A .   7 MET HG2  1 1 
        2  1980 1 1  10 MET HG3  H   7.620  -3.998   3.011 1.00 . A A .   7 MET HG3  1 1 
        2  1981 1 1  10 MET N    N   7.834  -8.090   4.008 1.00 . A A .   7 MET N    1 1 
        2  1982 1 1  10 MET O    O   6.401  -5.006   5.122 1.00 . A A .   7 MET O    1 1 
        2  1983 1 1  10 MET SD   S   9.878  -3.930   3.807 1.00 . A A .   7 MET SD   1 1 
        2  1984 1 1  11 PHE C    C   3.913  -6.568   6.144 1.00 . A A .   8 PHE C    1 1 
        2  1985 1 1  11 PHE CA   C   4.032  -6.495   4.616 1.00 . A A .   8 PHE CA   1 1 
        2  1986 1 1  11 PHE CB   C   3.014  -7.458   3.935 1.00 . A A .   8 PHE CB   1 1 
        2  1987 1 1  11 PHE CD1  C   0.830  -7.559   5.253 1.00 . A A .   8 PHE CD1  1 1 
        2  1988 1 1  11 PHE CD2  C   0.869  -6.281   3.230 1.00 . A A .   8 PHE CD2  1 1 
        2  1989 1 1  11 PHE CE1  C  -0.494  -7.214   5.437 1.00 . A A .   8 PHE CE1  1 1 
        2  1990 1 1  11 PHE CE2  C  -0.454  -5.941   3.421 1.00 . A A .   8 PHE CE2  1 1 
        2  1991 1 1  11 PHE CG   C   1.542  -7.097   4.143 1.00 . A A .   8 PHE CG   1 1 
        2  1992 1 1  11 PHE CZ   C  -1.132  -6.403   4.522 1.00 . A A .   8 PHE CZ   1 1 
        2  1993 1 1  11 PHE H    H   5.558  -7.648   3.689 1.00 . A A .   8 PHE H    1 1 
        2  1994 1 1  11 PHE HA   H   3.829  -5.476   4.289 1.00 . A A .   8 PHE HA   1 1 
        2  1995 1 1  11 PHE HB2  H   3.201  -7.462   2.862 1.00 . A A .   8 PHE HB2  1 1 
        2  1996 1 1  11 PHE HB3  H   3.171  -8.462   4.310 1.00 . A A .   8 PHE HB3  1 1 
        2  1997 1 1  11 PHE HD1  H   1.323  -8.197   5.974 1.00 . A A .   8 PHE HD1  1 1 
        2  1998 1 1  11 PHE HD2  H   1.392  -5.911   2.360 1.00 . A A .   8 PHE HD2  1 1 
        2  1999 1 1  11 PHE HE1  H  -1.034  -7.576   6.308 1.00 . A A .   8 PHE HE1  1 1 
        2  2000 1 1  11 PHE HE2  H  -0.958  -5.306   2.703 1.00 . A A .   8 PHE HE2  1 1 
        2  2001 1 1  11 PHE HZ   H  -2.171  -6.133   4.670 1.00 . A A .   8 PHE HZ   1 1 
        2  2002 1 1  11 PHE N    N   5.414  -6.832   4.208 1.00 . A A .   8 PHE N    1 1 
        2  2003 1 1  11 PHE O    O   3.388  -5.650   6.775 1.00 . A A .   8 PHE O    1 1 
        2  2004 1 1  12 VAL C    C   5.272  -6.829   8.880 1.00 . A A .   9 VAL C    1 1 
        2  2005 1 1  12 VAL CA   C   4.462  -7.912   8.166 1.00 . A A .   9 VAL CA   1 1 
        2  2006 1 1  12 VAL CB   C   5.081  -9.320   8.491 1.00 . A A .   9 VAL CB   1 1 
        2  2007 1 1  12 VAL CG1  C   5.329  -9.514  10.001 1.00 . A A .   9 VAL CG1  1 1 
        2  2008 1 1  12 VAL CG2  C   4.196 -10.440   7.938 1.00 . A A .   9 VAL CG2  1 1 
        2  2009 1 1  12 VAL H    H   4.801  -8.364   6.116 1.00 . A A .   9 VAL H    1 1 
        2  2010 1 1  12 VAL HA   H   3.439  -7.895   8.534 1.00 . A A .   9 VAL HA   1 1 
        2  2011 1 1  12 VAL HB   H   6.044  -9.382   7.994 1.00 . A A .   9 VAL HB   1 1 
        2  2012 1 1  12 VAL HG11 H   5.710 -10.512  10.186 1.00 . A A .   9 VAL HG11 1 1 
        2  2013 1 1  12 VAL HG12 H   4.405  -9.380  10.545 1.00 . A A .   9 VAL HG12 1 1 
        2  2014 1 1  12 VAL HG13 H   6.053  -8.788  10.350 1.00 . A A .   9 VAL HG13 1 1 
        2  2015 1 1  12 VAL HG21 H   4.079 -10.321   6.867 1.00 . A A .   9 VAL HG21 1 1 
        2  2016 1 1  12 VAL HG22 H   3.220 -10.403   8.407 1.00 . A A .   9 VAL HG22 1 1 
        2  2017 1 1  12 VAL HG23 H   4.651 -11.402   8.138 1.00 . A A .   9 VAL HG23 1 1 
        2  2018 1 1  12 VAL N    N   4.427  -7.674   6.709 1.00 . A A .   9 VAL N    1 1 
        2  2019 1 1  12 VAL O    O   4.780  -6.183   9.810 1.00 . A A .   9 VAL O    1 1 
        2  2020 1 1  13 SER C    C   6.915  -4.273   8.992 1.00 . A A .  10 SER C    1 1 
        2  2021 1 1  13 SER CA   C   7.474  -5.705   8.990 1.00 . A A .  10 SER CA   1 1 
        2  2022 1 1  13 SER CB   C   8.801  -5.774   8.217 1.00 . A A .  10 SER CB   1 1 
        2  2023 1 1  13 SER H    H   6.787  -7.154   7.618 1.00 . A A .  10 SER H    1 1 
        2  2024 1 1  13 SER HA   H   7.647  -6.017  10.018 1.00 . A A .  10 SER HA   1 1 
        2  2025 1 1  13 SER HB2  H   8.646  -5.456   7.194 1.00 . A A .  10 SER HB2  1 1 
        2  2026 1 1  13 SER HB3  H   9.534  -5.128   8.686 1.00 . A A .  10 SER HB3  1 1 
        2  2027 1 1  13 SER HG   H   9.381  -7.406   7.289 1.00 . A A .  10 SER HG   1 1 
        2  2028 1 1  13 SER N    N   6.511  -6.641   8.403 1.00 . A A .  10 SER N    1 1 
        2  2029 1 1  13 SER O    O   7.027  -3.567   9.992 1.00 . A A .  10 SER O    1 1 
        2  2030 1 1  13 SER OG   O   9.309  -7.098   8.205 1.00 . A A .  10 SER OG   1 1 
        2  2031 1 1  14 ALA C    C   4.397  -2.463   8.691 1.00 . A A .  11 ALA C    1 1 
        2  2032 1 1  14 ALA CA   C   5.612  -2.574   7.752 1.00 . A A .  11 ALA CA   1 1 
        2  2033 1 1  14 ALA CB   C   5.198  -2.317   6.293 1.00 . A A .  11 ALA CB   1 1 
        2  2034 1 1  14 ALA H    H   6.204  -4.516   7.131 1.00 . A A .  11 ALA H    1 1 
        2  2035 1 1  14 ALA HA   H   6.343  -1.817   8.031 1.00 . A A .  11 ALA HA   1 1 
        2  2036 1 1  14 ALA HB1  H   6.065  -2.398   5.649 1.00 . A A .  11 ALA HB1  1 1 
        2  2037 1 1  14 ALA HB2  H   4.775  -1.323   6.197 1.00 . A A .  11 ALA HB2  1 1 
        2  2038 1 1  14 ALA HB3  H   4.462  -3.050   5.986 1.00 . A A .  11 ALA HB3  1 1 
        2  2039 1 1  14 ALA N    N   6.259  -3.889   7.882 1.00 . A A .  11 ALA N    1 1 
        2  2040 1 1  14 ALA O    O   4.221  -1.439   9.346 1.00 . A A .  11 ALA O    1 1 
        2  2041 1 1  15 LEU C    C   2.603  -3.346  11.035 1.00 . A A .  12 LEU C    1 1 
        2  2042 1 1  15 LEU CA   C   2.335  -3.617   9.549 1.00 . A A .  12 LEU CA   1 1 
        2  2043 1 1  15 LEU CB   C   1.658  -5.010   9.348 1.00 . A A .  12 LEU CB   1 1 
        2  2044 1 1  15 LEU CD1  C  -0.395  -6.492   9.060 1.00 . A A .  12 LEU CD1  1 1 
        2  2045 1 1  15 LEU CD2  C  -0.391  -4.801  10.946 1.00 . A A .  12 LEU CD2  1 1 
        2  2046 1 1  15 LEU CG   C   0.100  -5.108   9.510 1.00 . A A .  12 LEU CG   1 1 
        2  2047 1 1  15 LEU H    H   3.887  -4.365   8.293 1.00 . A A .  12 LEU H    1 1 
        2  2048 1 1  15 LEU HA   H   1.686  -2.852   9.170 1.00 . A A .  12 LEU HA   1 1 
        2  2049 1 1  15 LEU HB2  H   1.898  -5.342   8.343 1.00 . A A .  12 LEU HB2  1 1 
        2  2050 1 1  15 LEU HB3  H   2.116  -5.714  10.038 1.00 . A A .  12 LEU HB3  1 1 
        2  2051 1 1  15 LEU HD11 H   0.034  -7.263   9.689 1.00 . A A .  12 LEU HD11 1 1 
        2  2052 1 1  15 LEU HD12 H  -0.098  -6.666   8.033 1.00 . A A .  12 LEU HD12 1 1 
        2  2053 1 1  15 LEU HD13 H  -1.474  -6.534   9.125 1.00 . A A .  12 LEU HD13 1 1 
        2  2054 1 1  15 LEU HD21 H   0.039  -5.506  11.645 1.00 . A A .  12 LEU HD21 1 1 
        2  2055 1 1  15 LEU HD22 H  -1.471  -4.867  10.985 1.00 . A A .  12 LEU HD22 1 1 
        2  2056 1 1  15 LEU HD23 H  -0.090  -3.798  11.222 1.00 . A A .  12 LEU HD23 1 1 
        2  2057 1 1  15 LEU HG   H  -0.356  -4.384   8.849 1.00 . A A .  12 LEU HG   1 1 
        2  2058 1 1  15 LEU N    N   3.604  -3.557   8.774 1.00 . A A .  12 LEU N    1 1 
        2  2059 1 1  15 LEU O    O   1.873  -2.595  11.692 1.00 . A A .  12 LEU O    1 1 
        2  2060 1 1  16 ILE C    C   4.445  -2.312  13.200 1.00 . A A .  13 ILE C    1 1 
        2  2061 1 1  16 ILE CA   C   4.138  -3.799  12.910 1.00 . A A .  13 ILE CA   1 1 
        2  2062 1 1  16 ILE CB   C   5.388  -4.731  13.141 1.00 . A A .  13 ILE CB   1 1 
        2  2063 1 1  16 ILE CD1  C   6.073  -7.231  12.877 1.00 . A A .  13 ILE CD1  1 1 
        2  2064 1 1  16 ILE CG1  C   4.946  -6.230  13.019 1.00 . A A .  13 ILE CG1  1 1 
        2  2065 1 1  16 ILE CG2  C   6.104  -4.454  14.484 1.00 . A A .  13 ILE CG2  1 1 
        2  2066 1 1  16 ILE H    H   4.185  -4.546  10.936 1.00 . A A .  13 ILE H    1 1 
        2  2067 1 1  16 ILE HA   H   3.335  -4.129  13.566 1.00 . A A .  13 ILE HA   1 1 
        2  2068 1 1  16 ILE HB   H   6.100  -4.521  12.351 1.00 . A A .  13 ILE HB   1 1 
        2  2069 1 1  16 ILE HD11 H   6.646  -7.003  11.988 1.00 . A A .  13 ILE HD11 1 1 
        2  2070 1 1  16 ILE HD12 H   5.650  -8.224  12.781 1.00 . A A .  13 ILE HD12 1 1 
        2  2071 1 1  16 ILE HD13 H   6.713  -7.195  13.744 1.00 . A A .  13 ILE HD13 1 1 
        2  2072 1 1  16 ILE HG12 H   4.383  -6.509  13.899 1.00 . A A .  13 ILE HG12 1 1 
        2  2073 1 1  16 ILE HG13 H   4.306  -6.345  12.151 1.00 . A A .  13 ILE HG13 1 1 
        2  2074 1 1  16 ILE HG21 H   5.418  -4.612  15.309 1.00 . A A .  13 ILE HG21 1 1 
        2  2075 1 1  16 ILE HG22 H   6.456  -3.429  14.511 1.00 . A A .  13 ILE HG22 1 1 
        2  2076 1 1  16 ILE HG23 H   6.949  -5.120  14.592 1.00 . A A .  13 ILE HG23 1 1 
        2  2077 1 1  16 ILE N    N   3.676  -3.959  11.530 1.00 . A A .  13 ILE N    1 1 
        2  2078 1 1  16 ILE O    O   3.976  -1.758  14.189 1.00 . A A .  13 ILE O    1 1 
        2  2079 1 1  17 ARG C    C   4.279   0.692  12.190 1.00 . A A .  14 ARG C    1 1 
        2  2080 1 1  17 ARG CA   C   5.509  -0.221  12.405 1.00 . A A .  14 ARG CA   1 1 
        2  2081 1 1  17 ARG CB   C   6.701   0.159  11.469 1.00 . A A .  14 ARG CB   1 1 
        2  2082 1 1  17 ARG CD   C   8.290  -1.795  12.053 1.00 . A A .  14 ARG CD   1 1 
        2  2083 1 1  17 ARG CG   C   8.097  -0.271  12.008 1.00 . A A .  14 ARG CG   1 1 
        2  2084 1 1  17 ARG CZ   C   9.589  -3.509  13.311 1.00 . A A .  14 ARG CZ   1 1 
        2  2085 1 1  17 ARG H    H   5.428  -2.136  11.466 1.00 . A A .  14 ARG H    1 1 
        2  2086 1 1  17 ARG HA   H   5.833  -0.073  13.434 1.00 . A A .  14 ARG HA   1 1 
        2  2087 1 1  17 ARG HB2  H   6.550  -0.304  10.501 1.00 . A A .  14 ARG HB2  1 1 
        2  2088 1 1  17 ARG HB3  H   6.717   1.237  11.332 1.00 . A A .  14 ARG HB3  1 1 
        2  2089 1 1  17 ARG HD2  H   7.338  -2.267  12.279 1.00 . A A .  14 ARG HD2  1 1 
        2  2090 1 1  17 ARG HD3  H   8.619  -2.134  11.074 1.00 . A A .  14 ARG HD3  1 1 
        2  2091 1 1  17 ARG HE   H   9.671  -1.527  13.612 1.00 . A A .  14 ARG HE   1 1 
        2  2092 1 1  17 ARG HG2  H   8.865   0.157  11.370 1.00 . A A .  14 ARG HG2  1 1 
        2  2093 1 1  17 ARG HG3  H   8.218   0.128  13.009 1.00 . A A .  14 ARG HG3  1 1 
        2  2094 1 1  17 ARG HH11 H   8.526  -4.301  11.771 1.00 . A A .  14 ARG HH11 1 1 
        2  2095 1 1  17 ARG HH12 H   9.378  -5.453  12.747 1.00 . A A .  14 ARG HH12 1 1 
        2  2096 1 1  17 ARG HH21 H  10.737  -3.041  14.907 1.00 . A A .  14 ARG HH21 1 1 
        2  2097 1 1  17 ARG HH22 H  10.638  -4.731  14.533 1.00 . A A .  14 ARG HH22 1 1 
        2  2098 1 1  17 ARG N    N   5.153  -1.654  12.274 1.00 . A A .  14 ARG N    1 1 
        2  2099 1 1  17 ARG NE   N   9.267  -2.231  13.056 1.00 . A A .  14 ARG NE   1 1 
        2  2100 1 1  17 ARG NH1  N   9.124  -4.502  12.547 1.00 . A A .  14 ARG NH1  1 1 
        2  2101 1 1  17 ARG NH2  N  10.384  -3.784  14.330 1.00 . A A .  14 ARG NH2  1 1 
        2  2102 1 1  17 ARG O    O   4.262   1.822  12.682 1.00 . A A .  14 ARG O    1 1 
        2  2103 1 1  18 ARG C    C   1.230   1.079  12.594 1.00 . A A .  15 ARG C    1 1 
        2  2104 1 1  18 ARG CA   C   1.982   0.916  11.260 1.00 . A A .  15 ARG CA   1 1 
        2  2105 1 1  18 ARG CB   C   1.040   0.193  10.254 1.00 . A A .  15 ARG CB   1 1 
        2  2106 1 1  18 ARG CD   C   0.403  -0.285   7.815 1.00 . A A .  15 ARG CD   1 1 
        2  2107 1 1  18 ARG CG   C   1.537   0.095   8.795 1.00 . A A .  15 ARG CG   1 1 
        2  2108 1 1  18 ARG CZ   C  -1.633   0.872   6.899 1.00 . A A .  15 ARG CZ   1 1 
        2  2109 1 1  18 ARG H    H   3.353  -0.702  11.071 1.00 . A A .  15 ARG H    1 1 
        2  2110 1 1  18 ARG HA   H   2.223   1.904  10.868 1.00 . A A .  15 ARG HA   1 1 
        2  2111 1 1  18 ARG HB2  H   0.871  -0.816  10.611 1.00 . A A .  15 ARG HB2  1 1 
        2  2112 1 1  18 ARG HB3  H   0.082   0.714  10.245 1.00 . A A .  15 ARG HB3  1 1 
        2  2113 1 1  18 ARG HD2  H   0.818  -0.417   6.823 1.00 . A A .  15 ARG HD2  1 1 
        2  2114 1 1  18 ARG HD3  H  -0.059  -1.219   8.139 1.00 . A A .  15 ARG HD3  1 1 
        2  2115 1 1  18 ARG HE   H  -0.554   1.470   8.465 1.00 . A A .  15 ARG HE   1 1 
        2  2116 1 1  18 ARG HG2  H   1.950   1.053   8.496 1.00 . A A .  15 ARG HG2  1 1 
        2  2117 1 1  18 ARG HG3  H   2.316  -0.657   8.739 1.00 . A A .  15 ARG HG3  1 1 
        2  2118 1 1  18 ARG HH11 H  -1.242  -0.855   5.907 1.00 . A A .  15 ARG HH11 1 1 
        2  2119 1 1  18 ARG HH12 H  -2.598   0.051   5.317 1.00 . A A .  15 ARG HH12 1 1 
        2  2120 1 1  18 ARG HH21 H  -2.317   2.598   7.697 1.00 . A A .  15 ARG HH21 1 1 
        2  2121 1 1  18 ARG HH22 H  -3.201   2.003   6.335 1.00 . A A .  15 ARG HH22 1 1 
        2  2122 1 1  18 ARG N    N   3.254   0.188  11.464 1.00 . A A .  15 ARG N    1 1 
        2  2123 1 1  18 ARG NE   N  -0.628   0.772   7.779 1.00 . A A .  15 ARG NE   1 1 
        2  2124 1 1  18 ARG NH1  N  -1.840  -0.052   5.966 1.00 . A A .  15 ARG NH1  1 1 
        2  2125 1 1  18 ARG NH2  N  -2.448   1.905   6.982 1.00 . A A .  15 ARG NH2  1 1 
        2  2126 1 1  18 ARG O    O   0.704   2.160  12.895 1.00 . A A .  15 ARG O    1 1 
        2  2127 1 1  19 VAL C    C   1.183   0.779  15.724 1.00 . A A .  16 VAL C    1 1 
        2  2128 1 1  19 VAL CA   C   0.426  -0.032  14.651 1.00 . A A .  16 VAL CA   1 1 
        2  2129 1 1  19 VAL CB   C   0.110  -1.489  15.178 1.00 . A A .  16 VAL CB   1 1 
        2  2130 1 1  19 VAL CG1  C  -0.459  -2.391  14.062 1.00 . A A .  16 VAL CG1  1 1 
        2  2131 1 1  19 VAL CG2  C   1.327  -2.147  15.836 1.00 . A A .  16 VAL CG2  1 1 
        2  2132 1 1  19 VAL H    H   1.633  -0.832  13.089 1.00 . A A .  16 VAL H    1 1 
        2  2133 1 1  19 VAL HA   H  -0.528   0.465  14.467 1.00 . A A .  16 VAL HA   1 1 
        2  2134 1 1  19 VAL HB   H  -0.666  -1.397  15.939 1.00 . A A .  16 VAL HB   1 1 
        2  2135 1 1  19 VAL HG11 H   0.274  -2.509  13.275 1.00 . A A .  16 VAL HG11 1 1 
        2  2136 1 1  19 VAL HG12 H  -1.349  -1.940  13.648 1.00 . A A .  16 VAL HG12 1 1 
        2  2137 1 1  19 VAL HG13 H  -0.712  -3.364  14.467 1.00 . A A .  16 VAL HG13 1 1 
        2  2138 1 1  19 VAL HG21 H   1.701  -1.519  16.636 1.00 . A A .  16 VAL HG21 1 1 
        2  2139 1 1  19 VAL HG22 H   2.107  -2.288  15.103 1.00 . A A .  16 VAL HG22 1 1 
        2  2140 1 1  19 VAL HG23 H   1.042  -3.110  16.246 1.00 . A A .  16 VAL HG23 1 1 
        2  2141 1 1  19 VAL N    N   1.167  -0.018  13.378 1.00 . A A .  16 VAL N    1 1 
        2  2142 1 1  19 VAL O    O   0.561   1.431  16.552 1.00 . A A .  16 VAL O    1 1 
        2  2143 1 1  20 PHE C    C   3.332   3.019  16.257 1.00 . A A .  17 PHE C    1 1 
        2  2144 1 1  20 PHE CA   C   3.391   1.517  16.609 1.00 . A A .  17 PHE CA   1 1 
        2  2145 1 1  20 PHE CB   C   4.853   0.975  16.627 1.00 . A A .  17 PHE CB   1 1 
        2  2146 1 1  20 PHE CD1  C   4.973  -0.229  18.859 1.00 . A A .  17 PHE CD1  1 1 
        2  2147 1 1  20 PHE CD2  C   5.235  -1.544  16.887 1.00 . A A .  17 PHE CD2  1 1 
        2  2148 1 1  20 PHE CE1  C   5.115  -1.364  19.635 1.00 . A A .  17 PHE CE1  1 1 
        2  2149 1 1  20 PHE CE2  C   5.371  -2.681  17.665 1.00 . A A .  17 PHE CE2  1 1 
        2  2150 1 1  20 PHE CG   C   5.031  -0.295  17.468 1.00 . A A .  17 PHE CG   1 1 
        2  2151 1 1  20 PHE CZ   C   5.312  -2.588  19.037 1.00 . A A .  17 PHE CZ   1 1 
        2  2152 1 1  20 PHE H    H   2.967   0.159  15.025 1.00 . A A .  17 PHE H    1 1 
        2  2153 1 1  20 PHE HA   H   2.971   1.403  17.608 1.00 . A A .  17 PHE HA   1 1 
        2  2154 1 1  20 PHE HB2  H   5.165   0.755  15.613 1.00 . A A .  17 PHE HB2  1 1 
        2  2155 1 1  20 PHE HB3  H   5.515   1.734  17.034 1.00 . A A .  17 PHE HB3  1 1 
        2  2156 1 1  20 PHE HD1  H   4.817   0.729  19.339 1.00 . A A .  17 PHE HD1  1 1 
        2  2157 1 1  20 PHE HD2  H   5.290  -1.627  15.811 1.00 . A A .  17 PHE HD2  1 1 
        2  2158 1 1  20 PHE HE1  H   5.067  -1.291  20.714 1.00 . A A .  17 PHE HE1  1 1 
        2  2159 1 1  20 PHE HE2  H   5.526  -3.650  17.195 1.00 . A A .  17 PHE HE2  1 1 
        2  2160 1 1  20 PHE HZ   H   5.417  -3.479  19.646 1.00 . A A .  17 PHE HZ   1 1 
        2  2161 1 1  20 PHE N    N   2.535   0.734  15.690 1.00 . A A .  17 PHE N    1 1 
        2  2162 1 1  20 PHE O    O   3.485   3.874  17.140 1.00 . A A .  17 PHE O    1 1 
        2  2163 1 1  21 ALA C    C   1.456   5.197  15.086 1.00 . A A .  18 ALA C    1 1 
        2  2164 1 1  21 ALA CA   C   2.803   4.706  14.507 1.00 . A A .  18 ALA CA   1 1 
        2  2165 1 1  21 ALA CB   C   2.778   4.768  12.972 1.00 . A A .  18 ALA CB   1 1 
        2  2166 1 1  21 ALA H    H   3.117   2.609  14.299 1.00 . A A .  18 ALA H    1 1 
        2  2167 1 1  21 ALA HA   H   3.602   5.355  14.862 1.00 . A A .  18 ALA HA   1 1 
        2  2168 1 1  21 ALA HB1  H   2.602   5.786  12.644 1.00 . A A .  18 ALA HB1  1 1 
        2  2169 1 1  21 ALA HB2  H   1.989   4.129  12.593 1.00 . A A .  18 ALA HB2  1 1 
        2  2170 1 1  21 ALA HB3  H   3.728   4.428  12.578 1.00 . A A .  18 ALA HB3  1 1 
        2  2171 1 1  21 ALA N    N   3.095   3.328  14.965 1.00 . A A .  18 ALA N    1 1 
        2  2172 1 1  21 ALA O    O   1.299   6.378  15.420 1.00 . A A .  18 ALA O    1 1 
        2  2173 1 1  22 ALA C    C  -0.739   4.612  17.345 1.00 . A A .  19 ALA C    1 1 
        2  2174 1 1  22 ALA CA   C  -0.839   4.518  15.805 1.00 . A A .  19 ALA CA   1 1 
        2  2175 1 1  22 ALA CB   C  -1.832   3.413  15.396 1.00 . A A .  19 ALA CB   1 1 
        2  2176 1 1  22 ALA H    H   0.665   3.368  14.829 1.00 . A A .  19 ALA H    1 1 
        2  2177 1 1  22 ALA HA   H  -1.211   5.465  15.416 1.00 . A A .  19 ALA HA   1 1 
        2  2178 1 1  22 ALA HB1  H  -1.901   3.372  14.318 1.00 . A A .  19 ALA HB1  1 1 
        2  2179 1 1  22 ALA HB2  H  -2.813   3.623  15.808 1.00 . A A .  19 ALA HB2  1 1 
        2  2180 1 1  22 ALA HB3  H  -1.487   2.454  15.765 1.00 . A A .  19 ALA HB3  1 1 
        2  2181 1 1  22 ALA N    N   0.486   4.262  15.191 1.00 . A A .  19 ALA N    1 1 
        2  2182 1 1  22 ALA O    O  -1.573   5.261  17.993 1.00 . A A .  19 ALA O    1 1 
        2  2183 1 1  23 GLY C    C   0.293   2.584  20.016 1.00 . A A .  20 GLY C    1 1 
        2  2184 1 1  23 GLY CA   C   0.543   3.946  19.369 1.00 . A A .  20 GLY CA   1 1 
        2  2185 1 1  23 GLY H    H   0.908   3.465  17.330 1.00 . A A .  20 GLY H    1 1 
        2  2186 1 1  23 GLY HA2  H   1.578   4.213  19.532 1.00 . A A .  20 GLY HA2  1 1 
        2  2187 1 1  23 GLY HA3  H  -0.081   4.688  19.859 1.00 . A A .  20 GLY HA3  1 1 
        2  2188 1 1  23 GLY N    N   0.294   3.958  17.915 1.00 . A A .  20 GLY N    1 1 
        2  2189 1 1  23 GLY O    O   0.514   2.423  21.221 1.00 . A A .  20 GLY O    1 1 
        2  2190 1 1  24 GLY C    C   0.794  -0.635  19.820 1.00 . A A .  21 GLY C    1 1 
        2  2191 1 1  24 GLY CA   C  -0.453   0.247  19.663 1.00 . A A .  21 GLY CA   1 1 
        2  2192 1 1  24 GLY H    H  -0.352   1.840  18.272 1.00 . A A .  21 GLY H    1 1 
        2  2193 1 1  24 GLY HA2  H  -0.964   0.289  20.617 1.00 . A A .  21 GLY HA2  1 1 
        2  2194 1 1  24 GLY HA3  H  -1.119  -0.213  18.944 1.00 . A A .  21 GLY HA3  1 1 
        2  2195 1 1  24 GLY N    N  -0.175   1.613  19.207 1.00 . A A .  21 GLY N    1 1 
        2  2196 1 1  24 GLY O    O   1.891  -0.139  20.109 1.00 . A A .  21 GLY O    1 1 
        2  2197 1 1  25 PHE C    C   1.564  -4.054  18.729 1.00 . A A .  22 PHE C    1 1 
        2  2198 1 1  25 PHE CA   C   1.656  -2.983  19.837 1.00 . A A .  22 PHE CA   1 1 
        2  2199 1 1  25 PHE CB   C   1.489  -3.620  21.249 1.00 . A A .  22 PHE CB   1 1 
        2  2200 1 1  25 PHE CD1  C   3.804  -4.545  21.757 1.00 . A A .  22 PHE CD1  1 1 
        2  2201 1 1  25 PHE CD2  C   1.981  -6.095  21.621 1.00 . A A .  22 PHE CD2  1 1 
        2  2202 1 1  25 PHE CE1  C   4.670  -5.590  22.018 1.00 . A A .  22 PHE CE1  1 1 
        2  2203 1 1  25 PHE CE2  C   2.849  -7.138  21.883 1.00 . A A .  22 PHE CE2  1 1 
        2  2204 1 1  25 PHE CG   C   2.443  -4.776  21.553 1.00 . A A .  22 PHE CG   1 1 
        2  2205 1 1  25 PHE CZ   C   4.191  -6.886  22.082 1.00 . A A .  22 PHE CZ   1 1 
        2  2206 1 1  25 PHE H    H  -0.266  -2.258  19.311 1.00 . A A .  22 PHE H    1 1 
        2  2207 1 1  25 PHE HA   H   2.633  -2.503  19.774 1.00 . A A .  22 PHE HA   1 1 
        2  2208 1 1  25 PHE HB2  H   1.659  -2.855  21.996 1.00 . A A .  22 PHE HB2  1 1 
        2  2209 1 1  25 PHE HB3  H   0.472  -3.982  21.353 1.00 . A A .  22 PHE HB3  1 1 
        2  2210 1 1  25 PHE HD1  H   4.187  -3.536  21.708 1.00 . A A .  22 PHE HD1  1 1 
        2  2211 1 1  25 PHE HD2  H   0.929  -6.298  21.464 1.00 . A A .  22 PHE HD2  1 1 
        2  2212 1 1  25 PHE HE1  H   5.725  -5.397  22.175 1.00 . A A .  22 PHE HE1  1 1 
        2  2213 1 1  25 PHE HE2  H   2.475  -8.154  21.934 1.00 . A A .  22 PHE HE2  1 1 
        2  2214 1 1  25 PHE HZ   H   4.871  -7.704  22.291 1.00 . A A .  22 PHE HZ   1 1 
        2  2215 1 1  25 PHE N    N   0.611  -1.955  19.627 1.00 . A A .  22 PHE N    1 1 
        2  2216 1 1  25 PHE O    O   0.509  -4.210  18.119 1.00 . A A .  22 PHE O    1 1 
        2  2217 1 1  26 ALA C    C   3.938  -6.775  17.722 1.00 . A A .  23 ALA C    1 1 
        2  2218 1 1  26 ALA CA   C   2.737  -5.860  17.464 1.00 . A A .  23 ALA CA   1 1 
        2  2219 1 1  26 ALA CB   C   2.815  -5.302  16.042 1.00 . A A .  23 ALA CB   1 1 
        2  2220 1 1  26 ALA H    H   3.495  -4.567  18.973 1.00 . A A .  23 ALA H    1 1 
        2  2221 1 1  26 ALA HA   H   1.824  -6.450  17.553 1.00 . A A .  23 ALA HA   1 1 
        2  2222 1 1  26 ALA HB1  H   2.890  -6.113  15.329 1.00 . A A .  23 ALA HB1  1 1 
        2  2223 1 1  26 ALA HB2  H   3.681  -4.656  15.944 1.00 . A A .  23 ALA HB2  1 1 
        2  2224 1 1  26 ALA HB3  H   1.924  -4.728  15.827 1.00 . A A .  23 ALA HB3  1 1 
        2  2225 1 1  26 ALA N    N   2.679  -4.770  18.466 1.00 . A A .  23 ALA N    1 1 
        2  2226 1 1  26 ALA O    O   4.916  -6.358  18.366 1.00 . A A .  23 ALA O    1 1 
        2  2227 1 1  27 ALA C    C   4.622 -10.190  16.322 1.00 . A A .  24 ALA C    1 1 
        2  2228 1 1  27 ALA CA   C   4.922  -9.015  17.269 1.00 . A A .  24 ALA CA   1 1 
        2  2229 1 1  27 ALA CB   C   5.077  -9.508  18.717 1.00 . A A .  24 ALA CB   1 1 
        2  2230 1 1  27 ALA H    H   3.028  -8.252  16.691 1.00 . A A .  24 ALA H    1 1 
        2  2231 1 1  27 ALA HA   H   5.857  -8.547  16.967 1.00 . A A .  24 ALA HA   1 1 
        2  2232 1 1  27 ALA HB1  H   5.296  -8.667  19.365 1.00 . A A .  24 ALA HB1  1 1 
        2  2233 1 1  27 ALA HB2  H   5.888 -10.223  18.776 1.00 . A A .  24 ALA HB2  1 1 
        2  2234 1 1  27 ALA HB3  H   4.159  -9.980  19.046 1.00 . A A .  24 ALA HB3  1 1 
        2  2235 1 1  27 ALA N    N   3.855  -8.009  17.176 1.00 . A A .  24 ALA N    1 1 
        2  2236 1 1  27 ALA O    O   3.566 -10.823  16.429 1.00 . A A .  24 ALA O    1 1 
        2  2237 1 1  28 VAL C    C   5.941 -12.893  15.080 1.00 . A A .  25 VAL C    1 1 
        2  2238 1 1  28 VAL CA   C   5.439 -11.580  14.434 1.00 . A A .  25 VAL CA   1 1 
        2  2239 1 1  28 VAL CB   C   6.183 -11.283  13.070 1.00 . A A .  25 VAL CB   1 1 
        2  2240 1 1  28 VAL CG1  C   7.629 -10.754  13.269 1.00 . A A .  25 VAL CG1  1 1 
        2  2241 1 1  28 VAL CG2  C   6.145 -12.524  12.133 1.00 . A A .  25 VAL CG2  1 1 
        2  2242 1 1  28 VAL H    H   6.338  -9.877  15.341 1.00 . A A .  25 VAL H    1 1 
        2  2243 1 1  28 VAL HA   H   4.378 -11.697  14.202 1.00 . A A .  25 VAL HA   1 1 
        2  2244 1 1  28 VAL HB   H   5.625 -10.491  12.575 1.00 . A A .  25 VAL HB   1 1 
        2  2245 1 1  28 VAL HG11 H   7.604  -9.832  13.840 1.00 . A A .  25 VAL HG11 1 1 
        2  2246 1 1  28 VAL HG12 H   8.089 -10.558  12.306 1.00 . A A .  25 VAL HG12 1 1 
        2  2247 1 1  28 VAL HG13 H   8.219 -11.487  13.802 1.00 . A A .  25 VAL HG13 1 1 
        2  2248 1 1  28 VAL HG21 H   6.667 -13.352  12.596 1.00 . A A .  25 VAL HG21 1 1 
        2  2249 1 1  28 VAL HG22 H   6.620 -12.288  11.191 1.00 . A A .  25 VAL HG22 1 1 
        2  2250 1 1  28 VAL HG23 H   5.115 -12.812  11.946 1.00 . A A .  25 VAL HG23 1 1 
        2  2251 1 1  28 VAL N    N   5.551 -10.457  15.386 1.00 . A A .  25 VAL N    1 1 
        2  2252 1 1  28 VAL O    O   7.143 -13.073  15.324 1.00 . A A .  25 VAL O    1 1 
        2  2253 1 1  29 GLU C    C   5.707 -16.125  14.988 1.00 . A A .  26 GLU C    1 1 
        2  2254 1 1  29 GLU CA   C   5.246 -15.080  16.020 1.00 . A A .  26 GLU CA   1 1 
        2  2255 1 1  29 GLU CB   C   3.970 -15.555  16.773 1.00 . A A .  26 GLU CB   1 1 
        2  2256 1 1  29 GLU CD   C   4.546 -14.211  18.906 1.00 . A A .  26 GLU CD   1 1 
        2  2257 1 1  29 GLU CG   C   3.472 -14.568  17.853 1.00 . A A .  26 GLU CG   1 1 
        2  2258 1 1  29 GLU H    H   4.061 -13.544  15.190 1.00 . A A .  26 GLU H    1 1 
        2  2259 1 1  29 GLU HA   H   6.040 -14.943  16.750 1.00 . A A .  26 GLU HA   1 1 
        2  2260 1 1  29 GLU HB2  H   3.168 -15.698  16.054 1.00 . A A .  26 GLU HB2  1 1 
        2  2261 1 1  29 GLU HB3  H   4.177 -16.507  17.253 1.00 . A A .  26 GLU HB3  1 1 
        2  2262 1 1  29 GLU HG2  H   3.139 -13.658  17.360 1.00 . A A .  26 GLU HG2  1 1 
        2  2263 1 1  29 GLU HG3  H   2.623 -15.009  18.366 1.00 . A A .  26 GLU HG3  1 1 
        2  2264 1 1  29 GLU N    N   4.988 -13.782  15.387 1.00 . A A .  26 GLU N    1 1 
        2  2265 1 1  29 GLU O    O   6.843 -16.610  15.047 1.00 . A A .  26 GLU O    1 1 
        2  2266 1 1  29 GLU OE1  O   4.955 -15.111  19.680 1.00 . A A .  26 GLU OE1  1 1 
        2  2267 1 1  29 GLU OE2  O   4.996 -13.042  18.956 1.00 . A A .  26 GLU OE2  1 1 
        2  2268 1 1  30 LYS C    C   5.694 -16.805  11.760 1.00 . A A .  27 LYS C    1 1 
        2  2269 1 1  30 LYS CA   C   5.106 -17.480  13.005 1.00 . A A .  27 LYS CA   1 1 
        2  2270 1 1  30 LYS CB   C   3.819 -18.271  12.658 1.00 . A A .  27 LYS CB   1 1 
        2  2271 1 1  30 LYS CD   C   2.785 -20.380  11.594 1.00 . A A .  27 LYS CD   1 1 
        2  2272 1 1  30 LYS CE   C   3.061 -21.672  10.799 1.00 . A A .  27 LYS CE   1 1 
        2  2273 1 1  30 LYS CG   C   4.031 -19.476  11.716 1.00 . A A .  27 LYS CG   1 1 
        2  2274 1 1  30 LYS H    H   3.958 -16.005  14.017 1.00 . A A .  27 LYS H    1 1 
        2  2275 1 1  30 LYS HA   H   5.844 -18.177  13.406 1.00 . A A .  27 LYS HA   1 1 
        2  2276 1 1  30 LYS HB2  H   3.384 -18.637  13.582 1.00 . A A .  27 LYS HB2  1 1 
        2  2277 1 1  30 LYS HB3  H   3.107 -17.594  12.189 1.00 . A A .  27 LYS HB3  1 1 
        2  2278 1 1  30 LYS HD2  H   2.451 -20.654  12.588 1.00 . A A .  27 LYS HD2  1 1 
        2  2279 1 1  30 LYS HD3  H   1.996 -19.823  11.097 1.00 . A A .  27 LYS HD3  1 1 
        2  2280 1 1  30 LYS HE2  H   2.165 -22.282  10.794 1.00 . A A .  27 LYS HE2  1 1 
        2  2281 1 1  30 LYS HE3  H   3.315 -21.412   9.779 1.00 . A A .  27 LYS HE3  1 1 
        2  2282 1 1  30 LYS HG2  H   4.290 -19.106  10.728 1.00 . A A .  27 LYS HG2  1 1 
        2  2283 1 1  30 LYS HG3  H   4.858 -20.066  12.094 1.00 . A A .  27 LYS HG3  1 1 
        2  2284 1 1  30 LYS HZ1  H   4.002 -22.641  12.392 1.00 . A A .  27 LYS HZ1  1 1 
        2  2285 1 1  30 LYS HZ2  H   5.075 -21.961  11.273 1.00 . A A .  27 LYS HZ2  1 1 
        2  2286 1 1  30 LYS HZ3  H   4.248 -23.386  10.896 1.00 . A A .  27 LYS HZ3  1 1 
        2  2287 1 1  30 LYS N    N   4.821 -16.465  14.038 1.00 . A A .  27 LYS N    1 1 
        2  2288 1 1  30 LYS NZ   N   4.173 -22.468  11.380 1.00 . A A .  27 LYS NZ   1 1 
        2  2289 1 1  30 LYS O    O   5.333 -15.671  11.431 1.00 . A A .  27 LYS O    1 1 
        2  2290 1 1  31 LYS C    C   7.351 -18.039   8.787 1.00 . A A .  28 LYS C    1 1 
        2  2291 1 1  31 LYS CA   C   7.349 -17.008   9.929 1.00 . A A .  28 LYS CA   1 1 
        2  2292 1 1  31 LYS CB   C   8.796 -16.690  10.381 1.00 . A A .  28 LYS CB   1 1 
        2  2293 1 1  31 LYS CD   C  11.112 -15.759   9.775 1.00 . A A .  28 LYS CD   1 1 
        2  2294 1 1  31 LYS CE   C  11.963 -15.049   8.709 1.00 . A A .  28 LYS CE   1 1 
        2  2295 1 1  31 LYS CG   C   9.698 -16.117   9.273 1.00 . A A .  28 LYS CG   1 1 
        2  2296 1 1  31 LYS H    H   6.760 -18.445  11.353 1.00 . A A .  28 LYS H    1 1 
        2  2297 1 1  31 LYS HA   H   6.876 -16.092   9.581 1.00 . A A .  28 LYS HA   1 1 
        2  2298 1 1  31 LYS HB2  H   8.753 -15.969  11.192 1.00 . A A .  28 LYS HB2  1 1 
        2  2299 1 1  31 LYS HB3  H   9.253 -17.601  10.758 1.00 . A A .  28 LYS HB3  1 1 
        2  2300 1 1  31 LYS HD2  H  11.025 -15.103  10.634 1.00 . A A .  28 LYS HD2  1 1 
        2  2301 1 1  31 LYS HD3  H  11.619 -16.670  10.078 1.00 . A A .  28 LYS HD3  1 1 
        2  2302 1 1  31 LYS HE2  H  12.052 -15.687   7.837 1.00 . A A .  28 LYS HE2  1 1 
        2  2303 1 1  31 LYS HE3  H  11.479 -14.122   8.422 1.00 . A A .  28 LYS HE3  1 1 
        2  2304 1 1  31 LYS HG2  H   9.785 -16.851   8.480 1.00 . A A .  28 LYS HG2  1 1 
        2  2305 1 1  31 LYS HG3  H   9.227 -15.223   8.876 1.00 . A A .  28 LYS HG3  1 1 
        2  2306 1 1  31 LYS HZ1  H  13.271 -14.206  10.094 1.00 . A A .  28 LYS HZ1  1 1 
        2  2307 1 1  31 LYS HZ2  H  13.848 -14.173   8.507 1.00 . A A .  28 LYS HZ2  1 1 
        2  2308 1 1  31 LYS HZ3  H  13.852 -15.623   9.378 1.00 . A A .  28 LYS HZ3  1 1 
        2  2309 1 1  31 LYS N    N   6.594 -17.523  11.075 1.00 . A A .  28 LYS N    1 1 
        2  2310 1 1  31 LYS NZ   N  13.328 -14.740   9.208 1.00 . A A .  28 LYS NZ   1 1 
        2  2311 1 1  31 LYS O    O   7.647 -19.216   9.015 1.00 . A A .  28 LYS O    1 1 
        2  2312 1 1  32 GLY C    C   7.701 -17.783   5.169 1.00 . A A .  29 GLY C    1 1 
        2  2313 1 1  32 GLY CA   C   7.019 -18.437   6.372 1.00 . A A .  29 GLY CA   1 1 
        2  2314 1 1  32 GLY H    H   6.767 -16.645   7.476 1.00 . A A .  29 GLY H    1 1 
        2  2315 1 1  32 GLY HA2  H   7.527 -19.373   6.585 1.00 . A A .  29 GLY HA2  1 1 
        2  2316 1 1  32 GLY HA3  H   5.992 -18.655   6.120 1.00 . A A .  29 GLY HA3  1 1 
        2  2317 1 1  32 GLY N    N   7.025 -17.583   7.565 1.00 . A A .  29 GLY N    1 1 
        2  2318 1 1  32 GLY O    O   8.821 -17.283   5.293 1.00 . A A .  29 GLY O    1 1 
        2  2319 1 1  33 ALA C    C   7.576 -15.775   2.597 1.00 . A A .  30 ALA C    1 1 
        2  2320 1 1  33 ALA CA   C   7.584 -17.311   2.723 1.00 . A A .  30 ALA CA   1 1 
        2  2321 1 1  33 ALA CB   C   6.836 -17.956   1.543 1.00 . A A .  30 ALA CB   1 1 
        2  2322 1 1  33 ALA H    H   6.063 -18.033   4.029 1.00 . A A .  30 ALA H    1 1 
        2  2323 1 1  33 ALA HA   H   8.615 -17.658   2.689 1.00 . A A .  30 ALA HA   1 1 
        2  2324 1 1  33 ALA HB1  H   7.294 -17.660   0.607 1.00 . A A .  30 ALA HB1  1 1 
        2  2325 1 1  33 ALA HB2  H   5.798 -17.644   1.545 1.00 . A A .  30 ALA HB2  1 1 
        2  2326 1 1  33 ALA HB3  H   6.881 -19.033   1.630 1.00 . A A .  30 ALA HB3  1 1 
        2  2327 1 1  33 ALA N    N   7.004 -17.757   4.011 1.00 . A A .  30 ALA N    1 1 
        2  2328 1 1  33 ALA O    O   6.601 -15.117   2.980 1.00 . A A .  30 ALA O    1 1 
        2  2329 1 1  34 GLU C    C   7.995 -13.104   0.872 1.00 . A A .  31 GLU C    1 1 
        2  2330 1 1  34 GLU CA   C   8.863 -13.764   1.952 1.00 . A A .  31 GLU CA   1 1 
        2  2331 1 1  34 GLU CB   C  10.351 -13.412   1.706 1.00 . A A .  31 GLU CB   1 1 
        2  2332 1 1  34 GLU CD   C  12.652 -13.063   2.778 1.00 . A A .  31 GLU CD   1 1 
        2  2333 1 1  34 GLU CG   C  11.281 -13.749   2.886 1.00 . A A .  31 GLU CG   1 1 
        2  2334 1 1  34 GLU H    H   9.351 -15.806   1.658 1.00 . A A .  31 GLU H    1 1 
        2  2335 1 1  34 GLU HA   H   8.580 -13.348   2.916 1.00 . A A .  31 GLU HA   1 1 
        2  2336 1 1  34 GLU HB2  H  10.696 -13.952   0.830 1.00 . A A .  31 GLU HB2  1 1 
        2  2337 1 1  34 GLU HB3  H  10.428 -12.345   1.505 1.00 . A A .  31 GLU HB3  1 1 
        2  2338 1 1  34 GLU HG2  H  10.806 -13.428   3.810 1.00 . A A .  31 GLU HG2  1 1 
        2  2339 1 1  34 GLU HG3  H  11.421 -14.827   2.925 1.00 . A A .  31 GLU HG3  1 1 
        2  2340 1 1  34 GLU N    N   8.662 -15.218   2.032 1.00 . A A .  31 GLU N    1 1 
        2  2341 1 1  34 GLU O    O   7.301 -12.149   1.153 1.00 . A A .  31 GLU O    1 1 
        2  2342 1 1  34 GLU OE1  O  12.758 -11.869   3.136 1.00 . A A .  31 GLU OE1  1 1 
        2  2343 1 1  34 GLU OE2  O  13.624 -13.699   2.332 1.00 . A A .  31 GLU OE2  1 1 
        2  2344 1 1  35 ALA C    C   6.032 -13.491  -1.821 1.00 . A A .  32 ALA C    1 1 
        2  2345 1 1  35 ALA CA   C   7.435 -12.932  -1.525 1.00 . A A .  32 ALA CA   1 1 
        2  2346 1 1  35 ALA CB   C   8.349 -13.062  -2.747 1.00 . A A .  32 ALA CB   1 1 
        2  2347 1 1  35 ALA H    H   8.558 -14.428  -0.509 1.00 . A A .  32 ALA H    1 1 
        2  2348 1 1  35 ALA HA   H   7.341 -11.869  -1.300 1.00 . A A .  32 ALA HA   1 1 
        2  2349 1 1  35 ALA HB1  H   9.318 -12.631  -2.521 1.00 . A A .  32 ALA HB1  1 1 
        2  2350 1 1  35 ALA HB2  H   7.917 -12.538  -3.591 1.00 . A A .  32 ALA HB2  1 1 
        2  2351 1 1  35 ALA HB3  H   8.476 -14.107  -3.001 1.00 . A A .  32 ALA HB3  1 1 
        2  2352 1 1  35 ALA N    N   8.068 -13.596  -0.364 1.00 . A A .  32 ALA N    1 1 
        2  2353 1 1  35 ALA O    O   5.136 -12.746  -2.220 1.00 . A A .  32 ALA O    1 1 
        2  2354 1 1  36 ALA C    C   3.765 -15.918  -0.777 1.00 . A A .  33 ALA C    1 1 
        2  2355 1 1  36 ALA CA   C   4.604 -15.511  -1.999 1.00 . A A .  33 ALA CA   1 1 
        2  2356 1 1  36 ALA CB   C   4.970 -16.747  -2.842 1.00 . A A .  33 ALA CB   1 1 
        2  2357 1 1  36 ALA H    H   6.574 -15.319  -1.200 1.00 . A A .  33 ALA H    1 1 
        2  2358 1 1  36 ALA HA   H   4.002 -14.849  -2.622 1.00 . A A .  33 ALA HA   1 1 
        2  2359 1 1  36 ALA HB1  H   4.069 -17.235  -3.191 1.00 . A A .  33 ALA HB1  1 1 
        2  2360 1 1  36 ALA HB2  H   5.546 -17.444  -2.244 1.00 . A A .  33 ALA HB2  1 1 
        2  2361 1 1  36 ALA HB3  H   5.560 -16.441  -3.695 1.00 . A A .  33 ALA HB3  1 1 
        2  2362 1 1  36 ALA N    N   5.849 -14.802  -1.617 1.00 . A A .  33 ALA N    1 1 
        2  2363 1 1  36 ALA O    O   2.693 -16.527  -0.935 1.00 . A A .  33 ALA O    1 1 
        2  2364 1 1  37 GLY C    C   2.282 -15.544   2.002 1.00 . A A .  34 GLY C    1 1 
        2  2365 1 1  37 GLY CA   C   3.680 -16.056   1.681 1.00 . A A .  34 GLY CA   1 1 
        2  2366 1 1  37 GLY H    H   4.984 -14.917   0.463 1.00 . A A .  34 GLY H    1 1 
        2  2367 1 1  37 GLY HA2  H   3.663 -17.140   1.649 1.00 . A A .  34 GLY HA2  1 1 
        2  2368 1 1  37 GLY HA3  H   4.343 -15.759   2.486 1.00 . A A .  34 GLY HA3  1 1 
        2  2369 1 1  37 GLY N    N   4.242 -15.555   0.426 1.00 . A A .  34 GLY N    1 1 
        2  2370 1 1  37 GLY O    O   1.919 -14.423   1.630 1.00 . A A .  34 GLY O    1 1 
        2  2371 1 1  38 ALA C    C   0.544 -15.198   4.594 1.00 . A A .  35 ALA C    1 1 
        2  2372 1 1  38 ALA CA   C   0.222 -15.970   3.297 1.00 . A A .  35 ALA CA   1 1 
        2  2373 1 1  38 ALA CB   C  -0.669 -17.195   3.580 1.00 . A A .  35 ALA CB   1 1 
        2  2374 1 1  38 ALA H    H   1.776 -17.321   2.783 1.00 . A A .  35 ALA H    1 1 
        2  2375 1 1  38 ALA HA   H  -0.302 -15.311   2.604 1.00 . A A .  35 ALA HA   1 1 
        2  2376 1 1  38 ALA HB1  H  -0.891 -17.707   2.652 1.00 . A A .  35 ALA HB1  1 1 
        2  2377 1 1  38 ALA HB2  H  -1.596 -16.875   4.037 1.00 . A A .  35 ALA HB2  1 1 
        2  2378 1 1  38 ALA HB3  H  -0.158 -17.875   4.251 1.00 . A A .  35 ALA HB3  1 1 
        2  2379 1 1  38 ALA N    N   1.489 -16.388   2.679 1.00 . A A .  35 ALA N    1 1 
        2  2380 1 1  38 ALA O    O   1.619 -15.376   5.168 1.00 . A A .  35 ALA O    1 1 
        2  2381 1 1  39 ILE C    C  -1.492 -13.525   7.045 1.00 . A A .  36 ILE C    1 1 
        2  2382 1 1  39 ILE CA   C  -0.177 -13.512   6.262 1.00 . A A .  36 ILE CA   1 1 
        2  2383 1 1  39 ILE CB   C   0.209 -12.005   5.959 1.00 . A A .  36 ILE CB   1 1 
        2  2384 1 1  39 ILE CD1  C   2.703 -12.438   5.447 1.00 . A A .  36 ILE CD1  1 1 
        2  2385 1 1  39 ILE CG1  C   1.393 -11.869   4.957 1.00 . A A .  36 ILE CG1  1 1 
        2  2386 1 1  39 ILE CG2  C   0.513 -11.234   7.271 1.00 . A A .  36 ILE CG2  1 1 
        2  2387 1 1  39 ILE H    H  -1.227 -14.275   4.582 1.00 . A A .  36 ILE H    1 1 
        2  2388 1 1  39 ILE HA   H   0.610 -13.959   6.869 1.00 . A A .  36 ILE HA   1 1 
        2  2389 1 1  39 ILE HB   H  -0.658 -11.537   5.513 1.00 . A A .  36 ILE HB   1 1 
        2  2390 1 1  39 ILE HD11 H   2.963 -11.995   6.394 1.00 . A A .  36 ILE HD11 1 1 
        2  2391 1 1  39 ILE HD12 H   3.476 -12.215   4.732 1.00 . A A .  36 ILE HD12 1 1 
        2  2392 1 1  39 ILE HD13 H   2.621 -13.509   5.561 1.00 . A A .  36 ILE HD13 1 1 
        2  2393 1 1  39 ILE HG12 H   1.142 -12.384   4.040 1.00 . A A .  36 ILE HG12 1 1 
        2  2394 1 1  39 ILE HG13 H   1.555 -10.819   4.733 1.00 . A A .  36 ILE HG13 1 1 
        2  2395 1 1  39 ILE HG21 H  -0.353 -11.262   7.920 1.00 . A A .  36 ILE HG21 1 1 
        2  2396 1 1  39 ILE HG22 H   0.754 -10.201   7.048 1.00 . A A .  36 ILE HG22 1 1 
        2  2397 1 1  39 ILE HG23 H   1.354 -11.693   7.780 1.00 . A A .  36 ILE HG23 1 1 
        2  2398 1 1  39 ILE N    N  -0.371 -14.335   5.048 1.00 . A A .  36 ILE N    1 1 
        2  2399 1 1  39 ILE O    O  -2.521 -13.078   6.529 1.00 . A A .  36 ILE O    1 1 
        2  2400 1 1  40 PHE C    C  -2.336 -13.321  10.431 1.00 . A A .  37 PHE C    1 1 
        2  2401 1 1  40 PHE CA   C  -2.638 -14.100   9.149 1.00 . A A .  37 PHE CA   1 1 
        2  2402 1 1  40 PHE CB   C  -3.067 -15.569   9.414 1.00 . A A .  37 PHE CB   1 1 
        2  2403 1 1  40 PHE CD1  C  -3.019 -16.665   7.118 1.00 . A A .  37 PHE CD1  1 1 
        2  2404 1 1  40 PHE CD2  C  -5.146 -16.216   8.107 1.00 . A A .  37 PHE CD2  1 1 
        2  2405 1 1  40 PHE CE1  C  -3.641 -17.161   5.993 1.00 . A A .  37 PHE CE1  1 1 
        2  2406 1 1  40 PHE CE2  C  -5.766 -16.719   6.984 1.00 . A A .  37 PHE CE2  1 1 
        2  2407 1 1  40 PHE CG   C  -3.758 -16.183   8.198 1.00 . A A .  37 PHE CG   1 1 
        2  2408 1 1  40 PHE CZ   C  -5.015 -17.186   5.925 1.00 . A A .  37 PHE CZ   1 1 
        2  2409 1 1  40 PHE H    H  -0.635 -14.459   8.590 1.00 . A A .  37 PHE H    1 1 
        2  2410 1 1  40 PHE HA   H  -3.459 -13.595   8.637 1.00 . A A .  37 PHE HA   1 1 
        2  2411 1 1  40 PHE HB2  H  -2.193 -16.164   9.655 1.00 . A A .  37 PHE HB2  1 1 
        2  2412 1 1  40 PHE HB3  H  -3.757 -15.606  10.248 1.00 . A A .  37 PHE HB3  1 1 
        2  2413 1 1  40 PHE HD1  H  -1.937 -16.651   7.168 1.00 . A A .  37 PHE HD1  1 1 
        2  2414 1 1  40 PHE HD2  H  -5.746 -15.856   8.936 1.00 . A A .  37 PHE HD2  1 1 
        2  2415 1 1  40 PHE HE1  H  -3.051 -17.531   5.163 1.00 . A A .  37 PHE HE1  1 1 
        2  2416 1 1  40 PHE HE2  H  -6.847 -16.740   6.928 1.00 . A A .  37 PHE HE2  1 1 
        2  2417 1 1  40 PHE HZ   H  -5.508 -17.574   5.042 1.00 . A A .  37 PHE HZ   1 1 
        2  2418 1 1  40 PHE N    N  -1.469 -14.067   8.266 1.00 . A A .  37 PHE N    1 1 
        2  2419 1 1  40 PHE O    O  -1.524 -13.731  11.255 1.00 . A A .  37 PHE O    1 1 
        2  2420 1 1  41 VAL C    C  -3.941 -11.263  12.642 1.00 . A A .  38 VAL C    1 1 
        2  2421 1 1  41 VAL CA   C  -2.784 -11.209  11.649 1.00 . A A .  38 VAL CA   1 1 
        2  2422 1 1  41 VAL CB   C  -2.653  -9.761  11.048 1.00 . A A .  38 VAL CB   1 1 
        2  2423 1 1  41 VAL CG1  C  -2.395  -8.696  12.141 1.00 . A A .  38 VAL CG1  1 1 
        2  2424 1 1  41 VAL CG2  C  -1.545  -9.722   9.976 1.00 . A A .  38 VAL CG2  1 1 
        2  2425 1 1  41 VAL H    H  -3.743 -11.996   9.945 1.00 . A A .  38 VAL H    1 1 
        2  2426 1 1  41 VAL HA   H  -1.853 -11.459  12.158 1.00 . A A .  38 VAL HA   1 1 
        2  2427 1 1  41 VAL HB   H  -3.594  -9.513  10.561 1.00 . A A .  38 VAL HB   1 1 
        2  2428 1 1  41 VAL HG11 H  -1.464  -8.914  12.650 1.00 . A A .  38 VAL HG11 1 1 
        2  2429 1 1  41 VAL HG12 H  -3.204  -8.701  12.863 1.00 . A A .  38 VAL HG12 1 1 
        2  2430 1 1  41 VAL HG13 H  -2.332  -7.711  11.690 1.00 . A A .  38 VAL HG13 1 1 
        2  2431 1 1  41 VAL HG21 H  -1.742 -10.469   9.215 1.00 . A A .  38 VAL HG21 1 1 
        2  2432 1 1  41 VAL HG22 H  -0.587  -9.926  10.436 1.00 . A A .  38 VAL HG22 1 1 
        2  2433 1 1  41 VAL HG23 H  -1.518  -8.744   9.518 1.00 . A A .  38 VAL HG23 1 1 
        2  2434 1 1  41 VAL N    N  -3.026 -12.185  10.582 1.00 . A A .  38 VAL N    1 1 
        2  2435 1 1  41 VAL O    O  -5.099 -11.255  12.237 1.00 . A A .  38 VAL O    1 1 
        2  2436 1 1  42 ARG C    C  -4.575 -10.127  15.856 1.00 . A A .  39 ARG C    1 1 
        2  2437 1 1  42 ARG CA   C  -4.625 -11.411  15.001 1.00 . A A .  39 ARG CA   1 1 
        2  2438 1 1  42 ARG CB   C  -4.419 -12.707  15.843 1.00 . A A .  39 ARG CB   1 1 
        2  2439 1 1  42 ARG CD   C  -2.859 -14.204  17.227 1.00 . A A .  39 ARG CD   1 1 
        2  2440 1 1  42 ARG CG   C  -2.991 -12.928  16.379 1.00 . A A .  39 ARG CG   1 1 
        2  2441 1 1  42 ARG CZ   C  -3.523 -14.330  19.649 1.00 . A A .  39 ARG CZ   1 1 
        2  2442 1 1  42 ARG H    H  -2.680 -11.324  14.181 1.00 . A A .  39 ARG H    1 1 
        2  2443 1 1  42 ARG HA   H  -5.612 -11.465  14.537 1.00 . A A .  39 ARG HA   1 1 
        2  2444 1 1  42 ARG HB2  H  -5.096 -12.684  16.691 1.00 . A A .  39 ARG HB2  1 1 
        2  2445 1 1  42 ARG HB3  H  -4.680 -13.560  15.224 1.00 . A A .  39 ARG HB3  1 1 
        2  2446 1 1  42 ARG HD2  H  -3.047 -15.068  16.596 1.00 . A A .  39 ARG HD2  1 1 
        2  2447 1 1  42 ARG HD3  H  -1.848 -14.263  17.619 1.00 . A A .  39 ARG HD3  1 1 
        2  2448 1 1  42 ARG HE   H  -4.774 -14.138  18.097 1.00 . A A .  39 ARG HE   1 1 
        2  2449 1 1  42 ARG HG2  H  -2.308 -12.994  15.541 1.00 . A A .  39 ARG HG2  1 1 
        2  2450 1 1  42 ARG HG3  H  -2.714 -12.073  16.991 1.00 . A A .  39 ARG HG3  1 1 
        2  2451 1 1  42 ARG HH11 H  -1.513 -14.429  19.377 1.00 . A A .  39 ARG HH11 1 1 
        2  2452 1 1  42 ARG HH12 H  -2.039 -14.522  21.026 1.00 . A A .  39 ARG HH12 1 1 
        2  2453 1 1  42 ARG HH21 H  -5.450 -14.255  20.256 1.00 . A A .  39 ARG HH21 1 1 
        2  2454 1 1  42 ARG HH22 H  -4.282 -14.410  21.524 1.00 . A A .  39 ARG HH22 1 1 
        2  2455 1 1  42 ARG N    N  -3.624 -11.336  13.934 1.00 . A A .  39 ARG N    1 1 
        2  2456 1 1  42 ARG NE   N  -3.827 -14.215  18.345 1.00 . A A .  39 ARG NE   1 1 
        2  2457 1 1  42 ARG NH1  N  -2.256 -14.435  20.048 1.00 . A A .  39 ARG NH1  1 1 
        2  2458 1 1  42 ARG NH2  N  -4.497 -14.334  20.546 1.00 . A A .  39 ARG NH2  1 1 
        2  2459 1 1  42 ARG O    O  -3.559  -9.831  16.490 1.00 . A A .  39 ARG O    1 1 
        2  2460 1 1  43 GLN C    C  -6.450  -8.249  17.913 1.00 . A A .  40 GLN C    1 1 
        2  2461 1 1  43 GLN CA   C  -5.767  -8.061  16.556 1.00 . A A .  40 GLN CA   1 1 
        2  2462 1 1  43 GLN CB   C  -6.544  -6.999  15.744 1.00 . A A .  40 GLN CB   1 1 
        2  2463 1 1  43 GLN CD   C  -7.746  -4.720  15.810 1.00 . A A .  40 GLN CD   1 1 
        2  2464 1 1  43 GLN CG   C  -6.805  -5.685  16.520 1.00 . A A .  40 GLN CG   1 1 
        2  2465 1 1  43 GLN H    H  -6.440  -9.633  15.292 1.00 . A A .  40 GLN H    1 1 
        2  2466 1 1  43 GLN HA   H  -4.759  -7.693  16.718 1.00 . A A .  40 GLN HA   1 1 
        2  2467 1 1  43 GLN HB2  H  -5.979  -6.763  14.847 1.00 . A A .  40 GLN HB2  1 1 
        2  2468 1 1  43 GLN HB3  H  -7.500  -7.419  15.449 1.00 . A A .  40 GLN HB3  1 1 
        2  2469 1 1  43 GLN HE21 H  -8.428  -4.049  17.540 1.00 . A A .  40 GLN HE21 1 1 
        2  2470 1 1  43 GLN HE22 H  -9.125  -3.334  16.130 1.00 . A A .  40 GLN HE22 1 1 
        2  2471 1 1  43 GLN HG2  H  -7.231  -5.928  17.484 1.00 . A A .  40 GLN HG2  1 1 
        2  2472 1 1  43 GLN HG3  H  -5.855  -5.185  16.674 1.00 . A A .  40 GLN HG3  1 1 
        2  2473 1 1  43 GLN N    N  -5.671  -9.340  15.824 1.00 . A A .  40 GLN N    1 1 
        2  2474 1 1  43 GLN NE2  N  -8.509  -3.956  16.567 1.00 . A A .  40 GLN NE2  1 1 
        2  2475 1 1  43 GLN O    O  -7.607  -8.631  17.968 1.00 . A A .  40 GLN O    1 1 
        2  2476 1 1  43 GLN OE1  O  -7.786  -4.672  14.605 1.00 . A A .  40 GLN OE1  1 1 
        2  2477 1 1  44 ARG C    C  -6.960  -6.588  20.654 1.00 . A A .  41 ARG C    1 1 
        2  2478 1 1  44 ARG CA   C  -6.288  -7.938  20.346 1.00 . A A .  41 ARG CA   1 1 
        2  2479 1 1  44 ARG CB   C  -5.154  -8.184  21.357 1.00 . A A .  41 ARG CB   1 1 
        2  2480 1 1  44 ARG CD   C  -4.434  -8.547  23.781 1.00 . A A .  41 ARG CD   1 1 
        2  2481 1 1  44 ARG CG   C  -5.617  -8.387  22.814 1.00 . A A .  41 ARG CG   1 1 
        2  2482 1 1  44 ARG CZ   C  -2.176  -9.526  23.278 1.00 . A A .  41 ARG CZ   1 1 
        2  2483 1 1  44 ARG H    H  -4.812  -7.675  18.877 1.00 . A A .  41 ARG H    1 1 
        2  2484 1 1  44 ARG HA   H  -7.015  -8.742  20.423 1.00 . A A .  41 ARG HA   1 1 
        2  2485 1 1  44 ARG HB2  H  -4.597  -9.063  21.051 1.00 . A A .  41 ARG HB2  1 1 
        2  2486 1 1  44 ARG HB3  H  -4.486  -7.330  21.328 1.00 . A A .  41 ARG HB3  1 1 
        2  2487 1 1  44 ARG HD2  H  -3.895  -7.608  23.832 1.00 . A A .  41 ARG HD2  1 1 
        2  2488 1 1  44 ARG HD3  H  -4.814  -8.791  24.767 1.00 . A A .  41 ARG HD3  1 1 
        2  2489 1 1  44 ARG HE   H  -3.935 -10.468  23.085 1.00 . A A .  41 ARG HE   1 1 
        2  2490 1 1  44 ARG HG2  H  -6.202  -7.528  23.120 1.00 . A A .  41 ARG HG2  1 1 
        2  2491 1 1  44 ARG HG3  H  -6.240  -9.278  22.864 1.00 . A A .  41 ARG HG3  1 1 
        2  2492 1 1  44 ARG HH11 H  -2.067  -7.622  23.994 1.00 . A A .  41 ARG HH11 1 1 
        2  2493 1 1  44 ARG HH12 H  -0.546  -8.368  23.617 1.00 . A A .  41 ARG HH12 1 1 
        2  2494 1 1  44 ARG HH21 H  -1.934 -11.397  22.546 1.00 . A A .  41 ARG HH21 1 1 
        2  2495 1 1  44 ARG HH22 H  -0.475 -10.490  22.773 1.00 . A A .  41 ARG HH22 1 1 
        2  2496 1 1  44 ARG N    N  -5.741  -7.929  18.993 1.00 . A A .  41 ARG N    1 1 
        2  2497 1 1  44 ARG NE   N  -3.516  -9.622  23.352 1.00 . A A .  41 ARG NE   1 1 
        2  2498 1 1  44 ARG NH1  N  -1.545  -8.415  23.655 1.00 . A A .  41 ARG NH1  1 1 
        2  2499 1 1  44 ARG NH2  N  -1.473 -10.552  22.830 1.00 . A A .  41 ARG NH2  1 1 
        2  2500 1 1  44 ARG O    O  -6.294  -5.547  20.615 1.00 . A A .  41 ARG O    1 1 
        2  2501 1 1  45 LEU C    C  -8.619  -5.254  22.956 1.00 . A A .  42 LEU C    1 1 
        2  2502 1 1  45 LEU CA   C  -8.995  -5.446  21.472 1.00 . A A .  42 LEU CA   1 1 
        2  2503 1 1  45 LEU CB   C -10.547  -5.617  21.367 1.00 . A A .  42 LEU CB   1 1 
        2  2504 1 1  45 LEU CD1  C -10.671  -4.661  18.985 1.00 . A A .  42 LEU CD1  1 1 
        2  2505 1 1  45 LEU CD2  C -11.042  -7.160  19.368 1.00 . A A .  42 LEU CD2  1 1 
        2  2506 1 1  45 LEU CG   C -11.190  -5.741  19.947 1.00 . A A .  42 LEU CG   1 1 
        2  2507 1 1  45 LEU H    H  -8.771  -7.436  20.767 1.00 . A A .  42 LEU H    1 1 
        2  2508 1 1  45 LEU HA   H  -8.693  -4.561  20.909 1.00 . A A .  42 LEU HA   1 1 
        2  2509 1 1  45 LEU HB2  H -10.823  -6.500  21.929 1.00 . A A .  42 LEU HB2  1 1 
        2  2510 1 1  45 LEU HB3  H -11.007  -4.762  21.857 1.00 . A A .  42 LEU HB3  1 1 
        2  2511 1 1  45 LEU HD11 H  -9.607  -4.788  18.823 1.00 . A A .  42 LEU HD11 1 1 
        2  2512 1 1  45 LEU HD12 H -10.852  -3.683  19.411 1.00 . A A .  42 LEU HD12 1 1 
        2  2513 1 1  45 LEU HD13 H -11.190  -4.736  18.040 1.00 . A A .  42 LEU HD13 1 1 
        2  2514 1 1  45 LEU HD21 H  -9.994  -7.399  19.234 1.00 . A A .  42 LEU HD21 1 1 
        2  2515 1 1  45 LEU HD22 H -11.550  -7.223  18.416 1.00 . A A .  42 LEU HD22 1 1 
        2  2516 1 1  45 LEU HD23 H -11.485  -7.871  20.050 1.00 . A A .  42 LEU HD23 1 1 
        2  2517 1 1  45 LEU HG   H -12.254  -5.560  20.048 1.00 . A A .  42 LEU HG   1 1 
        2  2518 1 1  45 LEU N    N  -8.274  -6.609  20.929 1.00 . A A .  42 LEU N    1 1 
        2  2519 1 1  45 LEU O    O  -8.352  -6.229  23.673 1.00 . A A .  42 LEU O    1 1 
        2  2520 1 1  46 ARG C    C  -9.687  -4.118  25.685 1.00 . A A .  43 ARG C    1 1 
        2  2521 1 1  46 ARG CA   C  -8.479  -3.635  24.840 1.00 . A A .  43 ARG CA   1 1 
        2  2522 1 1  46 ARG CB   C  -8.236  -2.095  24.970 1.00 . A A .  43 ARG CB   1 1 
        2  2523 1 1  46 ARG CD   C -10.582  -0.973  25.005 1.00 . A A .  43 ARG CD   1 1 
        2  2524 1 1  46 ARG CG   C  -9.256  -1.164  24.247 1.00 . A A .  43 ARG CG   1 1 
        2  2525 1 1  46 ARG CZ   C -12.875  -0.107  24.531 1.00 . A A .  43 ARG CZ   1 1 
        2  2526 1 1  46 ARG H    H  -8.771  -3.270  22.767 1.00 . A A .  43 ARG H    1 1 
        2  2527 1 1  46 ARG HA   H  -7.594  -4.154  25.200 1.00 . A A .  43 ARG HA   1 1 
        2  2528 1 1  46 ARG HB2  H  -8.227  -1.833  26.022 1.00 . A A .  43 ARG HB2  1 1 
        2  2529 1 1  46 ARG HB3  H  -7.252  -1.882  24.567 1.00 . A A .  43 ARG HB3  1 1 
        2  2530 1 1  46 ARG HD2  H -10.988  -1.949  25.252 1.00 . A A .  43 ARG HD2  1 1 
        2  2531 1 1  46 ARG HD3  H -10.384  -0.432  25.924 1.00 . A A .  43 ARG HD3  1 1 
        2  2532 1 1  46 ARG HE   H -11.259   0.185  23.384 1.00 . A A .  43 ARG HE   1 1 
        2  2533 1 1  46 ARG HG2  H  -8.800  -0.189  24.120 1.00 . A A .  43 ARG HG2  1 1 
        2  2534 1 1  46 ARG HG3  H  -9.470  -1.577  23.263 1.00 . A A .  43 ARG HG3  1 1 
        2  2535 1 1  46 ARG HH11 H -12.770  -1.098  26.298 1.00 . A A .  43 ARG HH11 1 1 
        2  2536 1 1  46 ARG HH12 H -14.342  -0.512  25.868 1.00 . A A .  43 ARG HH12 1 1 
        2  2537 1 1  46 ARG HH21 H -13.335   0.903  22.845 1.00 . A A .  43 ARG HH21 1 1 
        2  2538 1 1  46 ARG HH22 H -14.656   0.620  23.932 1.00 . A A .  43 ARG HH22 1 1 
        2  2539 1 1  46 ARG N    N  -8.645  -3.992  23.413 1.00 . A A .  43 ARG N    1 1 
        2  2540 1 1  46 ARG NE   N -11.576  -0.229  24.217 1.00 . A A .  43 ARG NE   1 1 
        2  2541 1 1  46 ARG NH1  N -13.366  -0.612  25.658 1.00 . A A .  43 ARG NH1  1 1 
        2  2542 1 1  46 ARG NH2  N -13.686   0.522  23.704 1.00 . A A .  43 ARG NH2  1 1 
        2  2543 1 1  46 ARG O    O  -9.649  -4.096  26.920 1.00 . A A .  43 ARG O    1 1 
        2  2544 1 1  47 ASP C    C -11.706  -6.540  26.105 1.00 . A A .  44 ASP C    1 1 
        2  2545 1 1  47 ASP CA   C -11.975  -5.121  25.558 1.00 . A A .  44 ASP CA   1 1 
        2  2546 1 1  47 ASP CB   C -13.088  -5.181  24.475 1.00 . A A .  44 ASP CB   1 1 
        2  2547 1 1  47 ASP CG   C -13.390  -3.818  23.819 1.00 . A A .  44 ASP CG   1 1 
        2  2548 1 1  47 ASP H    H -10.741  -4.396  24.010 1.00 . A A .  44 ASP H    1 1 
        2  2549 1 1  47 ASP HA   H -12.308  -4.489  26.375 1.00 . A A .  44 ASP HA   1 1 
        2  2550 1 1  47 ASP HB2  H -12.789  -5.871  23.691 1.00 . A A .  44 ASP HB2  1 1 
        2  2551 1 1  47 ASP HB3  H -14.001  -5.557  24.932 1.00 . A A .  44 ASP HB3  1 1 
        2  2552 1 1  47 ASP N    N -10.759  -4.524  24.978 1.00 . A A .  44 ASP N    1 1 
        2  2553 1 1  47 ASP O    O -12.462  -7.043  26.945 1.00 . A A .  44 ASP O    1 1 
        2  2554 1 1  47 ASP OD1  O -12.596  -3.375  22.960 1.00 . A A .  44 ASP OD1  1 1 
        2  2555 1 1  47 ASP OD2  O -14.423  -3.194  24.143 1.00 . A A .  44 ASP OD2  1 1 
        2  2556 1 1  48 GLY C    C -10.691  -9.550  24.968 1.00 . A A .  45 GLY C    1 1 
        2  2557 1 1  48 GLY CA   C -10.258  -8.532  26.005 1.00 . A A .  45 GLY CA   1 1 
        2  2558 1 1  48 GLY H    H -10.050  -6.687  24.988 1.00 . A A .  45 GLY H    1 1 
        2  2559 1 1  48 GLY HA2  H  -9.186  -8.585  26.107 1.00 . A A .  45 GLY HA2  1 1 
        2  2560 1 1  48 GLY HA3  H -10.709  -8.779  26.960 1.00 . A A .  45 GLY HA3  1 1 
        2  2561 1 1  48 GLY N    N -10.621  -7.165  25.620 1.00 . A A .  45 GLY N    1 1 
        2  2562 1 1  48 GLY O    O -10.943 -10.711  25.294 1.00 . A A .  45 GLY O    1 1 
        2  2563 1 1  49 ARG C    C -10.038  -9.920  21.498 1.00 . A A .  46 ARG C    1 1 
        2  2564 1 1  49 ARG CA   C -11.160  -9.925  22.544 1.00 . A A .  46 ARG CA   1 1 
        2  2565 1 1  49 ARG CB   C -12.491  -9.407  21.933 1.00 . A A .  46 ARG CB   1 1 
        2  2566 1 1  49 ARG CD   C -13.982 -10.985  23.281 1.00 . A A .  46 ARG CD   1 1 
        2  2567 1 1  49 ARG CG   C -13.723  -9.530  22.854 1.00 . A A .  46 ARG CG   1 1 
        2  2568 1 1  49 ARG CZ   C -16.047 -12.213  23.987 1.00 . A A .  46 ARG CZ   1 1 
        2  2569 1 1  49 ARG H    H -10.548  -8.158  23.538 1.00 . A A .  46 ARG H    1 1 
        2  2570 1 1  49 ARG HA   H -11.301 -10.950  22.875 1.00 . A A .  46 ARG HA   1 1 
        2  2571 1 1  49 ARG HB2  H -12.373  -8.360  21.670 1.00 . A A .  46 ARG HB2  1 1 
        2  2572 1 1  49 ARG HB3  H -12.696  -9.965  21.019 1.00 . A A .  46 ARG HB3  1 1 
        2  2573 1 1  49 ARG HD2  H -14.006 -11.611  22.395 1.00 . A A .  46 ARG HD2  1 1 
        2  2574 1 1  49 ARG HD3  H -13.165 -11.310  23.923 1.00 . A A .  46 ARG HD3  1 1 
        2  2575 1 1  49 ARG HE   H -15.520 -10.374  24.583 1.00 . A A .  46 ARG HE   1 1 
        2  2576 1 1  49 ARG HG2  H -13.562  -8.922  23.740 1.00 . A A .  46 ARG HG2  1 1 
        2  2577 1 1  49 ARG HG3  H -14.598  -9.157  22.325 1.00 . A A .  46 ARG HG3  1 1 
        2  2578 1 1  49 ARG HH11 H -14.922 -13.265  22.658 1.00 . A A .  46 ARG HH11 1 1 
        2  2579 1 1  49 ARG HH12 H -16.353 -14.066  23.213 1.00 . A A .  46 ARG HH12 1 1 
        2  2580 1 1  49 ARG HH21 H -17.388 -11.439  25.284 1.00 . A A .  46 ARG HH21 1 1 
        2  2581 1 1  49 ARG HH22 H -17.753 -13.031  24.706 1.00 . A A .  46 ARG HH22 1 1 
        2  2582 1 1  49 ARG N    N -10.774  -9.096  23.704 1.00 . A A .  46 ARG N    1 1 
        2  2583 1 1  49 ARG NE   N -15.249 -11.133  24.019 1.00 . A A .  46 ARG NE   1 1 
        2  2584 1 1  49 ARG NH1  N -15.748 -13.266  23.225 1.00 . A A .  46 ARG NH1  1 1 
        2  2585 1 1  49 ARG NH2  N -17.150 -12.228  24.718 1.00 . A A .  46 ARG NH2  1 1 
        2  2586 1 1  49 ARG O    O  -9.043  -9.211  21.652 1.00 . A A .  46 ARG O    1 1 
        2  2587 1 1  50 GLU C    C  -9.975 -10.785  17.981 1.00 . A A .  47 GLU C    1 1 
        2  2588 1 1  50 GLU CA   C  -9.248 -10.865  19.334 1.00 . A A .  47 GLU CA   1 1 
        2  2589 1 1  50 GLU CB   C  -8.430 -12.199  19.395 1.00 . A A .  47 GLU CB   1 1 
        2  2590 1 1  50 GLU CD   C  -7.831 -12.400  21.934 1.00 . A A .  47 GLU CD   1 1 
        2  2591 1 1  50 GLU CG   C  -7.324 -12.295  20.481 1.00 . A A .  47 GLU CG   1 1 
        2  2592 1 1  50 GLU H    H -11.035 -11.252  20.393 1.00 . A A .  47 GLU H    1 1 
        2  2593 1 1  50 GLU HA   H  -8.555 -10.030  19.390 1.00 . A A .  47 GLU HA   1 1 
        2  2594 1 1  50 GLU HB2  H  -9.120 -13.021  19.551 1.00 . A A .  47 GLU HB2  1 1 
        2  2595 1 1  50 GLU HB3  H  -7.948 -12.345  18.429 1.00 . A A .  47 GLU HB3  1 1 
        2  2596 1 1  50 GLU HG2  H  -6.719 -13.173  20.278 1.00 . A A .  47 GLU HG2  1 1 
        2  2597 1 1  50 GLU HG3  H  -6.694 -11.417  20.389 1.00 . A A .  47 GLU HG3  1 1 
        2  2598 1 1  50 GLU N    N -10.212 -10.732  20.443 1.00 . A A .  47 GLU N    1 1 
        2  2599 1 1  50 GLU O    O -11.190 -10.901  17.901 1.00 . A A .  47 GLU O    1 1 
        2  2600 1 1  50 GLU OE1  O  -8.724 -13.235  22.206 1.00 . A A .  47 GLU OE1  1 1 
        2  2601 1 1  50 GLU OE2  O  -7.334 -11.656  22.809 1.00 . A A .  47 GLU OE2  1 1 
        2  2602 1 1  51 ASN C    C  -8.636 -11.514  14.755 1.00 . A A .  48 ASN C    1 1 
        2  2603 1 1  51 ASN CA   C  -9.615 -10.612  15.517 1.00 . A A .  48 ASN CA   1 1 
        2  2604 1 1  51 ASN CB   C  -9.612  -9.203  14.864 1.00 . A A .  48 ASN CB   1 1 
        2  2605 1 1  51 ASN CG   C -10.464  -8.148  15.571 1.00 . A A .  48 ASN CG   1 1 
        2  2606 1 1  51 ASN H    H  -8.240 -10.395  17.104 1.00 . A A .  48 ASN H    1 1 
        2  2607 1 1  51 ASN HA   H -10.610 -11.045  15.461 1.00 . A A .  48 ASN HA   1 1 
        2  2608 1 1  51 ASN HB2  H  -8.593  -8.832  14.829 1.00 . A A .  48 ASN HB2  1 1 
        2  2609 1 1  51 ASN HB3  H  -9.972  -9.292  13.839 1.00 . A A .  48 ASN HB3  1 1 
        2  2610 1 1  51 ASN HD21 H  -8.941  -7.655  16.701 1.00 . A A .  48 ASN HD21 1 1 
        2  2611 1 1  51 ASN HD22 H -10.373  -6.739  16.948 1.00 . A A .  48 ASN HD22 1 1 
        2  2612 1 1  51 ASN N    N  -9.182 -10.576  16.928 1.00 . A A .  48 ASN N    1 1 
        2  2613 1 1  51 ASN ND2  N  -9.869  -7.452  16.509 1.00 . A A .  48 ASN ND2  1 1 
        2  2614 1 1  51 ASN O    O  -7.629 -11.947  15.315 1.00 . A A .  48 ASN O    1 1 
        2  2615 1 1  51 ASN OD1  O -11.638  -7.970  15.290 1.00 . A A .  48 ASN OD1  1 1 
        2  2616 1 1  52 LEU C    C  -8.240 -11.983  11.178 1.00 . A A .  49 LEU C    1 1 
        2  2617 1 1  52 LEU CA   C  -8.043 -12.534  12.590 1.00 . A A .  49 LEU CA   1 1 
        2  2618 1 1  52 LEU CB   C  -8.293 -14.077  12.660 1.00 . A A .  49 LEU CB   1 1 
        2  2619 1 1  52 LEU CD1  C  -7.385 -16.436  13.060 1.00 . A A .  49 LEU CD1  1 1 
        2  2620 1 1  52 LEU CD2  C  -6.033 -14.793  11.661 1.00 . A A .  49 LEU CD2  1 1 
        2  2621 1 1  52 LEU CG   C  -7.019 -14.960  12.842 1.00 . A A .  49 LEU CG   1 1 
        2  2622 1 1  52 LEU H    H  -9.765 -11.449  13.120 1.00 . A A .  49 LEU H    1 1 
        2  2623 1 1  52 LEU HA   H  -7.021 -12.322  12.892 1.00 . A A .  49 LEU HA   1 1 
        2  2624 1 1  52 LEU HB2  H  -8.959 -14.272  13.491 1.00 . A A .  49 LEU HB2  1 1 
        2  2625 1 1  52 LEU HB3  H  -8.800 -14.400  11.755 1.00 . A A .  49 LEU HB3  1 1 
        2  2626 1 1  52 LEU HD11 H  -7.956 -16.803  12.220 1.00 . A A .  49 LEU HD11 1 1 
        2  2627 1 1  52 LEU HD12 H  -7.979 -16.529  13.959 1.00 . A A .  49 LEU HD12 1 1 
        2  2628 1 1  52 LEU HD13 H  -6.486 -17.031  13.170 1.00 . A A .  49 LEU HD13 1 1 
        2  2629 1 1  52 LEU HD21 H  -5.727 -13.755  11.590 1.00 . A A .  49 LEU HD21 1 1 
        2  2630 1 1  52 LEU HD22 H  -6.509 -15.086  10.734 1.00 . A A .  49 LEU HD22 1 1 
        2  2631 1 1  52 LEU HD23 H  -5.158 -15.409  11.823 1.00 . A A .  49 LEU HD23 1 1 
        2  2632 1 1  52 LEU HG   H  -6.512 -14.630  13.736 1.00 . A A .  49 LEU HG   1 1 
        2  2633 1 1  52 LEU N    N  -8.931 -11.788  13.487 1.00 . A A .  49 LEU N    1 1 
        2  2634 1 1  52 LEU O    O  -9.359 -11.636  10.795 1.00 . A A .  49 LEU O    1 1 
        2  2635 1 1  53 TYR C    C  -6.341 -12.244   8.163 1.00 . A A .  50 TYR C    1 1 
        2  2636 1 1  53 TYR CA   C  -7.101 -11.294   9.084 1.00 . A A .  50 TYR CA   1 1 
        2  2637 1 1  53 TYR CB   C  -6.430  -9.889   9.126 1.00 . A A .  50 TYR CB   1 1 
        2  2638 1 1  53 TYR CD1  C  -8.401  -8.490   9.903 1.00 . A A .  50 TYR CD1  1 1 
        2  2639 1 1  53 TYR CD2  C  -6.505  -8.600  11.341 1.00 . A A .  50 TYR CD2  1 1 
        2  2640 1 1  53 TYR CE1  C  -9.056  -7.709  10.825 1.00 . A A .  50 TYR CE1  1 1 
        2  2641 1 1  53 TYR CE2  C  -7.160  -7.809  12.259 1.00 . A A .  50 TYR CE2  1 1 
        2  2642 1 1  53 TYR CG   C  -7.112  -8.955  10.134 1.00 . A A .  50 TYR CG   1 1 
        2  2643 1 1  53 TYR CZ   C  -8.439  -7.371  11.994 1.00 . A A .  50 TYR CZ   1 1 
        2  2644 1 1  53 TYR H    H  -6.297 -12.198  10.811 1.00 . A A .  50 TYR H    1 1 
        2  2645 1 1  53 TYR HA   H  -8.122 -11.193   8.718 1.00 . A A .  50 TYR HA   1 1 
        2  2646 1 1  53 TYR HB2  H  -5.382  -9.991   9.399 1.00 . A A .  50 TYR HB2  1 1 
        2  2647 1 1  53 TYR HB3  H  -6.494  -9.426   8.147 1.00 . A A .  50 TYR HB3  1 1 
        2  2648 1 1  53 TYR HD1  H  -8.897  -8.747   8.973 1.00 . A A .  50 TYR HD1  1 1 
        2  2649 1 1  53 TYR HD2  H  -5.496  -8.944  11.548 1.00 . A A .  50 TYR HD2  1 1 
        2  2650 1 1  53 TYR HE1  H -10.060  -7.361  10.616 1.00 . A A .  50 TYR HE1  1 1 
        2  2651 1 1  53 TYR HE2  H  -6.673  -7.534  13.182 1.00 . A A .  50 TYR HE2  1 1 
        2  2652 1 1  53 TYR HH   H  -8.540  -5.865  13.180 1.00 . A A .  50 TYR HH   1 1 
        2  2653 1 1  53 TYR N    N  -7.138 -11.873  10.434 1.00 . A A .  50 TYR N    1 1 
        2  2654 1 1  53 TYR O    O  -5.500 -13.005   8.634 1.00 . A A .  50 TYR O    1 1 
        2  2655 1 1  53 TYR OH   O  -9.106  -6.590  12.907 1.00 . A A .  50 TYR OH   1 1 
        2  2656 1 1  54 GLY C    C  -5.966 -12.424   4.508 1.00 . A A .  51 GLY C    1 1 
        2  2657 1 1  54 GLY CA   C  -6.016 -13.074   5.880 1.00 . A A .  51 GLY CA   1 1 
        2  2658 1 1  54 GLY H    H  -7.341 -11.571   6.565 1.00 . A A .  51 GLY H    1 1 
        2  2659 1 1  54 GLY HA2  H  -5.002 -13.302   6.198 1.00 . A A .  51 GLY HA2  1 1 
        2  2660 1 1  54 GLY HA3  H  -6.575 -13.995   5.809 1.00 . A A .  51 GLY HA3  1 1 
        2  2661 1 1  54 GLY N    N  -6.658 -12.208   6.867 1.00 . A A .  51 GLY N    1 1 
        2  2662 1 1  54 GLY O    O  -6.701 -11.458   4.273 1.00 . A A .  51 GLY O    1 1 
        2  2663 1 1  55 PRO C    C  -6.329 -12.573   1.418 1.00 . A A .  52 PRO C    1 1 
        2  2664 1 1  55 PRO CA   C  -5.008 -12.372   2.192 1.00 . A A .  52 PRO CA   1 1 
        2  2665 1 1  55 PRO CB   C  -3.833 -13.172   1.552 1.00 . A A .  52 PRO CB   1 1 
        2  2666 1 1  55 PRO CD   C  -4.148 -14.039   3.763 1.00 . A A .  52 PRO CD   1 1 
        2  2667 1 1  55 PRO CG   C  -3.094 -13.764   2.717 1.00 . A A .  52 PRO CG   1 1 
        2  2668 1 1  55 PRO HA   H  -4.763 -11.313   2.214 1.00 . A A .  52 PRO HA   1 1 
        2  2669 1 1  55 PRO HB2  H  -4.216 -13.948   0.894 1.00 . A A .  52 PRO HB2  1 1 
        2  2670 1 1  55 PRO HB3  H  -3.199 -12.504   0.979 1.00 . A A .  52 PRO HB3  1 1 
        2  2671 1 1  55 PRO HD2  H  -4.631 -14.994   3.587 1.00 . A A .  52 PRO HD2  1 1 
        2  2672 1 1  55 PRO HD3  H  -3.713 -14.015   4.757 1.00 . A A .  52 PRO HD3  1 1 
        2  2673 1 1  55 PRO HG2  H  -2.595 -14.681   2.422 1.00 . A A .  52 PRO HG2  1 1 
        2  2674 1 1  55 PRO HG3  H  -2.363 -13.052   3.095 1.00 . A A .  52 PRO HG3  1 1 
        2  2675 1 1  55 PRO N    N  -5.099 -12.918   3.568 1.00 . A A .  52 PRO N    1 1 
        2  2676 1 1  55 PRO O    O  -6.834 -13.703   1.324 1.00 . A A .  52 PRO O    1 1 
        2  2677 1 1  56 ALA C    C  -7.854 -11.547  -1.380 1.00 . A A .  53 ALA C    1 1 
        2  2678 1 1  56 ALA CA   C  -8.154 -11.490   0.132 1.00 . A A .  53 ALA CA   1 1 
        2  2679 1 1  56 ALA CB   C  -9.017 -10.256   0.462 1.00 . A A .  53 ALA CB   1 1 
        2  2680 1 1  56 ALA H    H  -6.445 -10.605   1.027 1.00 . A A .  53 ALA H    1 1 
        2  2681 1 1  56 ALA HA   H  -8.717 -12.379   0.416 1.00 . A A .  53 ALA HA   1 1 
        2  2682 1 1  56 ALA HB1  H  -9.963 -10.318  -0.064 1.00 . A A .  53 ALA HB1  1 1 
        2  2683 1 1  56 ALA HB2  H  -8.501  -9.349   0.165 1.00 . A A .  53 ALA HB2  1 1 
        2  2684 1 1  56 ALA HB3  H  -9.206 -10.222   1.525 1.00 . A A .  53 ALA HB3  1 1 
        2  2685 1 1  56 ALA N    N  -6.897 -11.468   0.904 1.00 . A A .  53 ALA N    1 1 
        2  2686 1 1  56 ALA O    O  -6.789 -11.081  -1.818 1.00 . A A .  53 ALA O    1 1 
        2  2687 1 1  57 PRO C    C  -8.861 -10.621  -4.176 1.00 . A A .  54 PRO C    1 1 
        2  2688 1 1  57 PRO CA   C  -8.676 -12.073  -3.680 1.00 . A A .  54 PRO CA   1 1 
        2  2689 1 1  57 PRO CB   C  -9.809 -13.016  -4.173 1.00 . A A .  54 PRO CB   1 1 
        2  2690 1 1  57 PRO CD   C  -9.976 -12.915  -1.772 1.00 . A A .  54 PRO CD   1 1 
        2  2691 1 1  57 PRO CG   C -10.793 -13.061  -3.040 1.00 . A A .  54 PRO CG   1 1 
        2  2692 1 1  57 PRO HA   H  -7.711 -12.451  -4.020 1.00 . A A .  54 PRO HA   1 1 
        2  2693 1 1  57 PRO HB2  H -10.260 -12.630  -5.080 1.00 . A A .  54 PRO HB2  1 1 
        2  2694 1 1  57 PRO HB3  H  -9.398 -14.002  -4.375 1.00 . A A .  54 PRO HB3  1 1 
        2  2695 1 1  57 PRO HD2  H -10.539 -12.373  -1.020 1.00 . A A .  54 PRO HD2  1 1 
        2  2696 1 1  57 PRO HD3  H  -9.679 -13.883  -1.387 1.00 . A A .  54 PRO HD3  1 1 
        2  2697 1 1  57 PRO HG2  H -11.498 -12.239  -3.133 1.00 . A A .  54 PRO HG2  1 1 
        2  2698 1 1  57 PRO HG3  H -11.327 -14.005  -3.041 1.00 . A A .  54 PRO HG3  1 1 
        2  2699 1 1  57 PRO N    N  -8.781 -12.133  -2.206 1.00 . A A .  54 PRO N    1 1 
        2  2700 1 1  57 PRO O    O  -9.975 -10.087  -4.167 1.00 . A A .  54 PRO O    1 1 
        2  2701 1 1  58 GLN C    C  -8.397  -8.468  -6.402 1.00 . A A .  55 GLN C    1 1 
        2  2702 1 1  58 GLN CA   C  -7.718  -8.577  -5.014 1.00 . A A .  55 GLN CA   1 1 
        2  2703 1 1  58 GLN CB   C  -6.251  -8.057  -5.064 1.00 . A A .  55 GLN CB   1 1 
        2  2704 1 1  58 GLN CD   C  -3.872  -8.449  -5.945 1.00 . A A .  55 GLN CD   1 1 
        2  2705 1 1  58 GLN CG   C  -5.362  -8.735  -6.128 1.00 . A A .  55 GLN CG   1 1 
        2  2706 1 1  58 GLN H    H  -6.885 -10.457  -4.456 1.00 . A A .  55 GLN H    1 1 
        2  2707 1 1  58 GLN HA   H  -8.280  -7.980  -4.304 1.00 . A A .  55 GLN HA   1 1 
        2  2708 1 1  58 GLN HB2  H  -6.265  -6.991  -5.266 1.00 . A A .  55 GLN HB2  1 1 
        2  2709 1 1  58 GLN HB3  H  -5.795  -8.212  -4.088 1.00 . A A .  55 GLN HB3  1 1 
        2  2710 1 1  58 GLN HE21 H  -4.041  -6.727  -6.912 1.00 . A A .  55 GLN HE21 1 1 
        2  2711 1 1  58 GLN HE22 H  -2.459  -7.123  -6.347 1.00 . A A .  55 GLN HE22 1 1 
        2  2712 1 1  58 GLN HG2  H  -5.515  -9.808  -6.076 1.00 . A A .  55 GLN HG2  1 1 
        2  2713 1 1  58 GLN HG3  H  -5.667  -8.388  -7.112 1.00 . A A .  55 GLN HG3  1 1 
        2  2714 1 1  58 GLN N    N  -7.735  -9.975  -4.531 1.00 . A A .  55 GLN N    1 1 
        2  2715 1 1  58 GLN NE2  N  -3.414  -7.320  -6.447 1.00 . A A .  55 GLN NE2  1 1 
        2  2716 1 1  58 GLN O    O  -8.591  -9.481  -7.087 1.00 . A A .  55 GLN O    1 1 
        2  2717 1 1  58 GLN OE1  O  -3.155  -9.220  -5.311 1.00 . A A .  55 GLN OE1  1 1 
        2  2718 1 1  59 SER C    C  -8.215  -6.975  -9.161 1.00 . A A .  56 SER C    1 1 
        2  2719 1 1  59 SER CA   C  -9.350  -6.990  -8.130 1.00 . A A .  56 SER CA   1 1 
        2  2720 1 1  59 SER CB   C -10.106  -5.647  -8.145 1.00 . A A .  56 SER CB   1 1 
        2  2721 1 1  59 SER H    H  -8.701  -6.497  -6.172 1.00 . A A .  56 SER H    1 1 
        2  2722 1 1  59 SER HA   H -10.049  -7.793  -8.367 1.00 . A A .  56 SER HA   1 1 
        2  2723 1 1  59 SER HB2  H  -9.415  -4.837  -7.958 1.00 . A A .  56 SER HB2  1 1 
        2  2724 1 1  59 SER HB3  H -10.572  -5.502  -9.114 1.00 . A A .  56 SER HB3  1 1 
        2  2725 1 1  59 SER HG   H -11.404  -6.518  -6.959 1.00 . A A .  56 SER HG   1 1 
        2  2726 1 1  59 SER N    N  -8.788  -7.246  -6.795 1.00 . A A .  56 SER N    1 1 
        2  2727 1 1  59 SER O    O  -7.245  -6.230  -8.991 1.00 . A A .  56 SER O    1 1 
        2  2728 1 1  59 SER OG   O -11.114  -5.616  -7.148 1.00 . A A .  56 SER OG   1 1 
        2  2729 1 1  60 PHE C    C  -8.061  -8.252 -12.607 1.00 . A A .  57 PHE C    1 1 
        2  2730 1 1  60 PHE CA   C  -7.356  -7.893 -11.298 1.00 . A A .  57 PHE CA   1 1 
        2  2731 1 1  60 PHE CB   C  -6.204  -8.891 -10.990 1.00 . A A .  57 PHE CB   1 1 
        2  2732 1 1  60 PHE CD1  C  -7.042 -10.719  -9.446 1.00 . A A .  57 PHE CD1  1 1 
        2  2733 1 1  60 PHE CD2  C  -6.611 -11.300 -11.722 1.00 . A A .  57 PHE CD2  1 1 
        2  2734 1 1  60 PHE CE1  C  -7.410 -12.020  -9.182 1.00 . A A .  57 PHE CE1  1 1 
        2  2735 1 1  60 PHE CE2  C  -6.978 -12.603 -11.457 1.00 . A A .  57 PHE CE2  1 1 
        2  2736 1 1  60 PHE CG   C  -6.635 -10.330 -10.718 1.00 . A A .  57 PHE CG   1 1 
        2  2737 1 1  60 PHE CZ   C  -7.378 -12.962 -10.187 1.00 . A A .  57 PHE CZ   1 1 
        2  2738 1 1  60 PHE H    H  -9.102  -8.429 -10.219 1.00 . A A .  57 PHE H    1 1 
        2  2739 1 1  60 PHE HA   H  -6.923  -6.901 -11.414 1.00 . A A .  57 PHE HA   1 1 
        2  2740 1 1  60 PHE HB2  H  -5.514  -8.905 -11.825 1.00 . A A .  57 PHE HB2  1 1 
        2  2741 1 1  60 PHE HB3  H  -5.664  -8.539 -10.114 1.00 . A A .  57 PHE HB3  1 1 
        2  2742 1 1  60 PHE HD1  H  -7.073  -9.985  -8.651 1.00 . A A .  57 PHE HD1  1 1 
        2  2743 1 1  60 PHE HD2  H  -6.299 -11.025 -12.719 1.00 . A A .  57 PHE HD2  1 1 
        2  2744 1 1  60 PHE HE1  H  -7.720 -12.303  -8.184 1.00 . A A .  57 PHE HE1  1 1 
        2  2745 1 1  60 PHE HE2  H  -6.954 -13.344 -12.249 1.00 . A A .  57 PHE HE2  1 1 
        2  2746 1 1  60 PHE HZ   H  -7.667 -13.985  -9.981 1.00 . A A .  57 PHE HZ   1 1 
        2  2747 1 1  60 PHE N    N  -8.328  -7.824 -10.194 1.00 . A A .  57 PHE N    1 1 
        2  2748 1 1  60 PHE O    O  -9.034  -9.007 -12.606 1.00 . A A .  57 PHE O    1 1 
        2  2749 1 1  61 ALA C    C  -7.010  -8.630 -15.911 1.00 . A A .  58 ALA C    1 1 
        2  2750 1 1  61 ALA CA   C  -8.097  -7.956 -15.061 1.00 . A A .  58 ALA CA   1 1 
        2  2751 1 1  61 ALA CB   C  -8.584  -6.648 -15.700 1.00 . A A .  58 ALA CB   1 1 
        2  2752 1 1  61 ALA H    H  -6.805  -7.080 -13.632 1.00 . A A .  58 ALA H    1 1 
        2  2753 1 1  61 ALA HA   H  -8.953  -8.631 -14.980 1.00 . A A .  58 ALA HA   1 1 
        2  2754 1 1  61 ALA HB1  H  -9.006  -6.849 -16.678 1.00 . A A .  58 ALA HB1  1 1 
        2  2755 1 1  61 ALA HB2  H  -7.754  -5.957 -15.804 1.00 . A A .  58 ALA HB2  1 1 
        2  2756 1 1  61 ALA HB3  H  -9.341  -6.201 -15.073 1.00 . A A .  58 ALA HB3  1 1 
        2  2757 1 1  61 ALA N    N  -7.565  -7.696 -13.718 1.00 . A A .  58 ALA N    1 1 
        2  2758 1 1  61 ALA O    O  -6.073  -7.966 -16.355 1.00 . A A .  58 ALA O    1 1 
        2  2759 1 1  62 ASP C    C  -4.787 -10.737 -16.087 1.00 . A A .  59 ASP C    1 1 
        2  2760 1 1  62 ASP CA   C  -6.167 -10.821 -16.787 1.00 . A A .  59 ASP CA   1 1 
        2  2761 1 1  62 ASP CB   C  -6.098 -10.474 -18.308 1.00 . A A .  59 ASP CB   1 1 
        2  2762 1 1  62 ASP CG   C  -5.348 -11.526 -19.153 1.00 . A A .  59 ASP CG   1 1 
        2  2763 1 1  62 ASP H    H  -7.962 -10.381 -15.741 1.00 . A A .  59 ASP H    1 1 
        2  2764 1 1  62 ASP HA   H  -6.528 -11.838 -16.679 1.00 . A A .  59 ASP HA   1 1 
        2  2765 1 1  62 ASP HB2  H  -7.110 -10.385 -18.693 1.00 . A A .  59 ASP HB2  1 1 
        2  2766 1 1  62 ASP HB3  H  -5.610  -9.512 -18.425 1.00 . A A .  59 ASP HB3  1 1 
        2  2767 1 1  62 ASP N    N  -7.148  -9.959 -16.090 1.00 . A A .  59 ASP N    1 1 
        2  2768 1 1  62 ASP O    O  -3.777 -10.360 -16.689 1.00 . A A .  59 ASP O    1 1 
        2  2769 1 1  62 ASP OD1  O  -5.959 -12.557 -19.517 1.00 . A A .  59 ASP OD1  1 1 
        2  2770 1 1  62 ASP OD2  O  -4.154 -11.329 -19.477 1.00 . A A .  59 ASP OD2  1 1 
        2  2771 1 1  63 ASP C    C  -2.698  -9.844 -13.888 1.00 . A A .  60 ASP C    1 1 
        2  2772 1 1  63 ASP CA   C  -3.619 -11.094 -13.878 1.00 . A A .  60 ASP CA   1 1 
        2  2773 1 1  63 ASP CB   C  -2.807 -12.382 -14.192 1.00 . A A .  60 ASP CB   1 1 
        2  2774 1 1  63 ASP CG   C  -3.545 -13.668 -13.788 1.00 . A A .  60 ASP CG   1 1 
        2  2775 1 1  63 ASP H    H  -5.690 -11.155 -14.358 1.00 . A A .  60 ASP H    1 1 
        2  2776 1 1  63 ASP HA   H  -4.003 -11.183 -12.869 1.00 . A A .  60 ASP HA   1 1 
        2  2777 1 1  63 ASP HB2  H  -2.599 -12.415 -15.255 1.00 . A A .  60 ASP HB2  1 1 
        2  2778 1 1  63 ASP HB3  H  -1.861 -12.353 -13.659 1.00 . A A .  60 ASP HB3  1 1 
        2  2779 1 1  63 ASP N    N  -4.815 -11.002 -14.763 1.00 . A A .  60 ASP N    1 1 
        2  2780 1 1  63 ASP O    O  -1.547  -9.920 -13.434 1.00 . A A .  60 ASP O    1 1 
        2  2781 1 1  63 ASP OD1  O  -3.579 -13.987 -12.577 1.00 . A A .  60 ASP OD1  1 1 
        2  2782 1 1  63 ASP OD2  O  -4.100 -14.365 -14.666 1.00 . A A .  60 ASP OD2  1 1 
        2  2783 1 1  64 GLU C    C  -2.221  -6.903 -12.959 1.00 . A A .  61 GLU C    1 1 
        2  2784 1 1  64 GLU CA   C  -2.458  -7.434 -14.378 1.00 . A A .  61 GLU CA   1 1 
        2  2785 1 1  64 GLU CB   C  -3.219  -6.374 -15.218 1.00 . A A .  61 GLU CB   1 1 
        2  2786 1 1  64 GLU CD   C  -1.858  -6.682 -17.362 1.00 . A A .  61 GLU CD   1 1 
        2  2787 1 1  64 GLU CG   C  -3.255  -6.661 -16.727 1.00 . A A .  61 GLU CG   1 1 
        2  2788 1 1  64 GLU H    H  -4.140  -8.697 -14.680 1.00 . A A .  61 GLU H    1 1 
        2  2789 1 1  64 GLU HA   H  -1.496  -7.630 -14.848 1.00 . A A .  61 GLU HA   1 1 
        2  2790 1 1  64 GLU HB2  H  -4.244  -6.319 -14.856 1.00 . A A .  61 GLU HB2  1 1 
        2  2791 1 1  64 GLU HB3  H  -2.753  -5.405 -15.068 1.00 . A A .  61 GLU HB3  1 1 
        2  2792 1 1  64 GLU HG2  H  -3.739  -7.623 -16.888 1.00 . A A .  61 GLU HG2  1 1 
        2  2793 1 1  64 GLU HG3  H  -3.849  -5.893 -17.211 1.00 . A A .  61 GLU HG3  1 1 
        2  2794 1 1  64 GLU N    N  -3.220  -8.695 -14.345 1.00 . A A .  61 GLU N    1 1 
        2  2795 1 1  64 GLU O    O  -1.079  -6.818 -12.487 1.00 . A A .  61 GLU O    1 1 
        2  2796 1 1  64 GLU OE1  O  -1.302  -5.596 -17.622 1.00 . A A .  61 GLU OE1  1 1 
        2  2797 1 1  64 GLU OE2  O  -1.306  -7.778 -17.595 1.00 . A A .  61 GLU OE2  1 1 
        2  2798 1 1  65 ASP C    C  -2.770  -6.671  -9.824 1.00 . A A .  62 ASP C    1 1 
        2  2799 1 1  65 ASP CA   C  -3.341  -5.858 -11.000 1.00 . A A .  62 ASP CA   1 1 
        2  2800 1 1  65 ASP CB   C  -4.762  -5.342 -10.691 1.00 . A A .  62 ASP CB   1 1 
        2  2801 1 1  65 ASP CG   C  -5.391  -4.582 -11.877 1.00 . A A .  62 ASP CG   1 1 
        2  2802 1 1  65 ASP H    H  -4.194  -6.906 -12.636 1.00 . A A .  62 ASP H    1 1 
        2  2803 1 1  65 ASP HA   H  -2.694  -4.994 -11.140 1.00 . A A .  62 ASP HA   1 1 
        2  2804 1 1  65 ASP HB2  H  -5.399  -6.183 -10.444 1.00 . A A .  62 ASP HB2  1 1 
        2  2805 1 1  65 ASP HB3  H  -4.720  -4.677  -9.828 1.00 . A A .  62 ASP HB3  1 1 
        2  2806 1 1  65 ASP N    N  -3.333  -6.610 -12.271 1.00 . A A .  62 ASP N    1 1 
        2  2807 1 1  65 ASP O    O  -2.614  -6.134  -8.737 1.00 . A A .  62 ASP O    1 1 
        2  2808 1 1  65 ASP OD1  O  -5.934  -5.234 -12.800 1.00 . A A .  62 ASP OD1  1 1 
        2  2809 1 1  65 ASP OD2  O  -5.337  -3.336 -11.914 1.00 . A A .  62 ASP OD2  1 1 
        2  2810 1 1  66 ILE C    C  -0.327  -8.108  -8.814 1.00 . A A .  63 ILE C    1 1 
        2  2811 1 1  66 ILE CA   C  -1.674  -8.809  -9.134 1.00 . A A .  63 ILE CA   1 1 
        2  2812 1 1  66 ILE CB   C  -1.389 -10.234  -9.772 1.00 . A A .  63 ILE CB   1 1 
        2  2813 1 1  66 ILE CD1  C  -3.600 -11.298  -8.964 1.00 . A A .  63 ILE CD1  1 1 
        2  2814 1 1  66 ILE CG1  C  -2.720 -10.962 -10.147 1.00 . A A .  63 ILE CG1  1 1 
        2  2815 1 1  66 ILE CG2  C  -0.519 -11.130  -8.844 1.00 . A A .  63 ILE CG2  1 1 
        2  2816 1 1  66 ILE H    H  -2.807  -8.369 -10.882 1.00 . A A .  63 ILE H    1 1 
        2  2817 1 1  66 ILE HA   H  -2.239  -8.940  -8.212 1.00 . A A .  63 ILE HA   1 1 
        2  2818 1 1  66 ILE HB   H  -0.823 -10.073 -10.686 1.00 . A A .  63 ILE HB   1 1 
        2  2819 1 1  66 ILE HD11 H  -3.892 -10.388  -8.459 1.00 . A A .  63 ILE HD11 1 1 
        2  2820 1 1  66 ILE HD12 H  -3.062 -11.937  -8.280 1.00 . A A .  63 ILE HD12 1 1 
        2  2821 1 1  66 ILE HD13 H  -4.484 -11.811  -9.314 1.00 . A A .  63 ILE HD13 1 1 
        2  2822 1 1  66 ILE HG12 H  -3.300 -10.333 -10.810 1.00 . A A .  63 ILE HG12 1 1 
        2  2823 1 1  66 ILE HG13 H  -2.495 -11.891 -10.662 1.00 . A A .  63 ILE HG13 1 1 
        2  2824 1 1  66 ILE HG21 H  -1.026 -11.285  -7.900 1.00 . A A .  63 ILE HG21 1 1 
        2  2825 1 1  66 ILE HG22 H   0.434 -10.649  -8.661 1.00 . A A .  63 ILE HG22 1 1 
        2  2826 1 1  66 ILE HG23 H  -0.345 -12.090  -9.316 1.00 . A A .  63 ILE HG23 1 1 
        2  2827 1 1  66 ILE N    N  -2.477  -7.966 -10.058 1.00 . A A .  63 ILE N    1 1 
        2  2828 1 1  66 ILE O    O   0.143  -8.109  -7.675 1.00 . A A .  63 ILE O    1 1 
        2  2829 1 1  67 MET C    C   1.431  -5.286  -9.951 1.00 . A A .  64 MET C    1 1 
        2  2830 1 1  67 MET CA   C   1.568  -6.818  -9.806 1.00 . A A .  64 MET CA   1 1 
        2  2831 1 1  67 MET CB   C   2.439  -7.397 -10.949 1.00 . A A .  64 MET CB   1 1 
        2  2832 1 1  67 MET CE   C   1.798  -9.430 -13.435 1.00 . A A .  64 MET CE   1 1 
        2  2833 1 1  67 MET CG   C   2.682  -8.914 -10.843 1.00 . A A .  64 MET CG   1 1 
        2  2834 1 1  67 MET H    H  -0.230  -7.476 -10.706 1.00 . A A .  64 MET H    1 1 
        2  2835 1 1  67 MET HA   H   2.042  -7.041  -8.853 1.00 . A A .  64 MET HA   1 1 
        2  2836 1 1  67 MET HB2  H   1.944  -7.202 -11.895 1.00 . A A .  64 MET HB2  1 1 
        2  2837 1 1  67 MET HB3  H   3.403  -6.898 -10.953 1.00 . A A .  64 MET HB3  1 1 
        2  2838 1 1  67 MET HE1  H   1.983  -9.867 -14.407 1.00 . A A .  64 MET HE1  1 1 
        2  2839 1 1  67 MET HE2  H   1.586  -8.378 -13.554 1.00 . A A .  64 MET HE2  1 1 
        2  2840 1 1  67 MET HE3  H   0.948  -9.920 -12.976 1.00 . A A .  64 MET HE3  1 1 
        2  2841 1 1  67 MET HG2  H   3.427  -9.101 -10.083 1.00 . A A .  64 MET HG2  1 1 
        2  2842 1 1  67 MET HG3  H   1.753  -9.402 -10.556 1.00 . A A .  64 MET HG3  1 1 
        2  2843 1 1  67 MET N    N   0.252  -7.486  -9.855 1.00 . A A .  64 MET N    1 1 
        2  2844 1 1  67 MET O    O   2.405  -4.553  -9.740 1.00 . A A .  64 MET O    1 1 
        2  2845 1 1  67 MET SD   S   3.252  -9.639 -12.392 1.00 . A A .  64 MET SD   1 1 
        2  2846 1 1  68 ARG C    C  -0.807  -2.788  -9.298 1.00 . A A .  65 ARG C    1 1 
        2  2847 1 1  68 ARG CA   C  -0.054  -3.356 -10.523 1.00 . A A .  65 ARG CA   1 1 
        2  2848 1 1  68 ARG CB   C  -0.869  -3.089 -11.828 1.00 . A A .  65 ARG CB   1 1 
        2  2849 1 1  68 ARG CD   C   1.190  -3.562 -13.326 1.00 . A A .  65 ARG CD   1 1 
        2  2850 1 1  68 ARG CG   C  -0.322  -3.762 -13.116 1.00 . A A .  65 ARG CG   1 1 
        2  2851 1 1  68 ARG CZ   C   2.684  -1.599 -12.921 1.00 . A A .  65 ARG CZ   1 1 
        2  2852 1 1  68 ARG H    H  -0.485  -5.449 -10.541 1.00 . A A .  65 ARG H    1 1 
        2  2853 1 1  68 ARG HA   H   0.897  -2.836 -10.600 1.00 . A A .  65 ARG HA   1 1 
        2  2854 1 1  68 ARG HB2  H  -1.886  -3.438 -11.681 1.00 . A A .  65 ARG HB2  1 1 
        2  2855 1 1  68 ARG HB3  H  -0.902  -2.014 -11.999 1.00 . A A .  65 ARG HB3  1 1 
        2  2856 1 1  68 ARG HD2  H   1.721  -4.019 -12.496 1.00 . A A .  65 ARG HD2  1 1 
        2  2857 1 1  68 ARG HD3  H   1.481  -4.063 -14.243 1.00 . A A .  65 ARG HD3  1 1 
        2  2858 1 1  68 ARG HE   H   0.958  -1.559 -13.934 1.00 . A A .  65 ARG HE   1 1 
        2  2859 1 1  68 ARG HG2  H  -0.520  -4.826 -13.060 1.00 . A A .  65 ARG HG2  1 1 
        2  2860 1 1  68 ARG HG3  H  -0.852  -3.355 -13.970 1.00 . A A .  65 ARG HG3  1 1 
        2  2861 1 1  68 ARG HH11 H   3.290  -3.273 -11.937 1.00 . A A .  65 ARG HH11 1 1 
        2  2862 1 1  68 ARG HH12 H   4.351  -1.914 -11.798 1.00 . A A .  65 ARG HH12 1 1 
        2  2863 1 1  68 ARG HH21 H   2.332   0.219 -13.711 1.00 . A A .  65 ARG HH21 1 1 
        2  2864 1 1  68 ARG HH22 H   3.789   0.080 -12.787 1.00 . A A .  65 ARG HH22 1 1 
        2  2865 1 1  68 ARG N    N   0.230  -4.810 -10.353 1.00 . A A .  65 ARG N    1 1 
        2  2866 1 1  68 ARG NE   N   1.565  -2.139 -13.424 1.00 . A A .  65 ARG NE   1 1 
        2  2867 1 1  68 ARG NH1  N   3.506  -2.320 -12.154 1.00 . A A .  65 ARG NH1  1 1 
        2  2868 1 1  68 ARG NH2  N   2.957  -0.334 -13.159 1.00 . A A .  65 ARG NH2  1 1 
        2  2869 1 1  68 ARG O    O  -1.013  -1.572  -9.193 1.00 . A A .  65 ARG O    1 1 
        2  2870 1 1  69 ALA C    C  -1.483  -4.347  -6.037 1.00 . A A .  66 ALA C    1 1 
        2  2871 1 1  69 ALA CA   C  -1.891  -3.343  -7.121 1.00 . A A .  66 ALA CA   1 1 
        2  2872 1 1  69 ALA CB   C  -3.421  -3.318  -7.298 1.00 . A A .  66 ALA CB   1 1 
        2  2873 1 1  69 ALA H    H  -1.024  -4.635  -8.556 1.00 . A A .  66 ALA H    1 1 
        2  2874 1 1  69 ALA HA   H  -1.562  -2.349  -6.812 1.00 . A A .  66 ALA HA   1 1 
        2  2875 1 1  69 ALA HB1  H  -3.687  -2.594  -8.058 1.00 . A A .  66 ALA HB1  1 1 
        2  2876 1 1  69 ALA HB2  H  -3.891  -3.037  -6.363 1.00 . A A .  66 ALA HB2  1 1 
        2  2877 1 1  69 ALA HB3  H  -3.776  -4.297  -7.596 1.00 . A A .  66 ALA HB3  1 1 
        2  2878 1 1  69 ALA N    N  -1.208  -3.686  -8.383 1.00 . A A .  66 ALA N    1 1 
        2  2879 1 1  69 ALA O    O  -0.989  -5.441  -6.352 1.00 . A A .  66 ALA O    1 1 
        2  2880 1 1  70 GLU C    C  -2.408  -5.872  -3.364 1.00 . A A .  67 GLU C    1 1 
        2  2881 1 1  70 GLU CA   C  -1.311  -4.823  -3.620 1.00 . A A .  67 GLU CA   1 1 
        2  2882 1 1  70 GLU CB   C  -1.044  -4.006  -2.310 1.00 . A A .  67 GLU CB   1 1 
        2  2883 1 1  70 GLU CD   C  -2.727  -2.051  -2.477 1.00 . A A .  67 GLU CD   1 1 
        2  2884 1 1  70 GLU CG   C  -2.259  -3.281  -1.681 1.00 . A A .  67 GLU CG   1 1 
        2  2885 1 1  70 GLU H    H  -2.043  -3.076  -4.591 1.00 . A A .  67 GLU H    1 1 
        2  2886 1 1  70 GLU HA   H  -0.391  -5.341  -3.883 1.00 . A A .  67 GLU HA   1 1 
        2  2887 1 1  70 GLU HB2  H  -0.641  -4.678  -1.556 1.00 . A A .  67 GLU HB2  1 1 
        2  2888 1 1  70 GLU HB3  H  -0.283  -3.260  -2.525 1.00 . A A .  67 GLU HB3  1 1 
        2  2889 1 1  70 GLU HG2  H  -3.078  -3.989  -1.610 1.00 . A A .  67 GLU HG2  1 1 
        2  2890 1 1  70 GLU HG3  H  -1.993  -2.965  -0.675 1.00 . A A .  67 GLU HG3  1 1 
        2  2891 1 1  70 GLU N    N  -1.662  -3.960  -4.763 1.00 . A A .  67 GLU N    1 1 
        2  2892 1 1  70 GLU O    O  -3.600  -5.640  -3.633 1.00 . A A .  67 GLU O    1 1 
        2  2893 1 1  70 GLU OE1  O  -2.080  -0.985  -2.360 1.00 . A A .  67 GLU OE1  1 1 
        2  2894 1 1  70 GLU OE2  O  -3.722  -2.145  -3.231 1.00 . A A .  67 GLU OE2  1 1 
        2  2895 1 1  71 ARG C    C  -3.493  -7.461  -1.004 1.00 . A A .  68 ARG C    1 1 
        2  2896 1 1  71 ARG CA   C  -2.845  -8.051  -2.267 1.00 . A A .  68 ARG CA   1 1 
        2  2897 1 1  71 ARG CB   C  -2.040  -9.351  -1.959 1.00 . A A .  68 ARG CB   1 1 
        2  2898 1 1  71 ARG CD   C   0.180 -10.373  -1.147 1.00 . A A .  68 ARG CD   1 1 
        2  2899 1 1  71 ARG CG   C  -0.679  -9.106  -1.270 1.00 . A A .  68 ARG CG   1 1 
        2  2900 1 1  71 ARG CZ   C   2.611 -10.874  -1.284 1.00 . A A .  68 ARG CZ   1 1 
        2  2901 1 1  71 ARG H    H  -1.015  -7.234  -2.945 1.00 . A A .  68 ARG H    1 1 
        2  2902 1 1  71 ARG HA   H  -3.627  -8.288  -2.987 1.00 . A A .  68 ARG HA   1 1 
        2  2903 1 1  71 ARG HB2  H  -2.635 -10.001  -1.324 1.00 . A A .  68 ARG HB2  1 1 
        2  2904 1 1  71 ARG HB3  H  -1.855  -9.869  -2.896 1.00 . A A .  68 ARG HB3  1 1 
        2  2905 1 1  71 ARG HD2  H  -0.123 -10.930  -0.266 1.00 . A A .  68 ARG HD2  1 1 
        2  2906 1 1  71 ARG HD3  H   0.034 -10.992  -2.027 1.00 . A A .  68 ARG HD3  1 1 
        2  2907 1 1  71 ARG HE   H   1.826  -9.103  -0.831 1.00 . A A .  68 ARG HE   1 1 
        2  2908 1 1  71 ARG HG2  H  -0.130  -8.371  -1.848 1.00 . A A .  68 ARG HG2  1 1 
        2  2909 1 1  71 ARG HG3  H  -0.863  -8.704  -0.277 1.00 . A A .  68 ARG HG3  1 1 
        2  2910 1 1  71 ARG HH11 H   1.470 -12.562  -1.355 1.00 . A A .  68 ARG HH11 1 1 
        2  2911 1 1  71 ARG HH12 H   3.169 -12.797  -1.619 1.00 . A A .  68 ARG HH12 1 1 
        2  2912 1 1  71 ARG HH21 H   4.018  -9.423  -1.218 1.00 . A A .  68 ARG HH21 1 1 
        2  2913 1 1  71 ARG HH22 H   4.603 -11.022  -1.548 1.00 . A A .  68 ARG HH22 1 1 
        2  2914 1 1  71 ARG N    N  -1.968  -7.040  -2.875 1.00 . A A .  68 ARG N    1 1 
        2  2915 1 1  71 ARG NE   N   1.609 -10.037  -1.035 1.00 . A A .  68 ARG NE   1 1 
        2  2916 1 1  71 ARG NH1  N   2.398 -12.184  -1.431 1.00 . A A .  68 ARG NH1  1 1 
        2  2917 1 1  71 ARG NH2  N   3.842 -10.404  -1.351 1.00 . A A .  68 ARG NH2  1 1 
        2  2918 1 1  71 ARG O    O  -2.866  -7.365   0.059 1.00 . A A .  68 ARG O    1 1 
        2  2919 1 1  72 ARG C    C  -6.096  -7.490   0.769 1.00 . A A .  69 ARG C    1 1 
        2  2920 1 1  72 ARG CA   C  -5.496  -6.377  -0.088 1.00 . A A .  69 ARG CA   1 1 
        2  2921 1 1  72 ARG CB   C  -6.575  -5.451  -0.687 1.00 . A A .  69 ARG CB   1 1 
        2  2922 1 1  72 ARG CD   C  -7.886  -3.278  -0.396 1.00 . A A .  69 ARG CD   1 1 
        2  2923 1 1  72 ARG CG   C  -7.176  -4.442   0.310 1.00 . A A .  69 ARG CG   1 1 
        2  2924 1 1  72 ARG CZ   C  -7.245  -1.368  -1.890 1.00 . A A .  69 ARG CZ   1 1 
        2  2925 1 1  72 ARG H    H  -5.145  -7.045  -2.050 1.00 . A A .  69 ARG H    1 1 
        2  2926 1 1  72 ARG HA   H  -4.817  -5.785   0.521 1.00 . A A .  69 ARG HA   1 1 
        2  2927 1 1  72 ARG HB2  H  -6.134  -4.895  -1.510 1.00 . A A .  69 ARG HB2  1 1 
        2  2928 1 1  72 ARG HB3  H  -7.380  -6.066  -1.080 1.00 . A A .  69 ARG HB3  1 1 
        2  2929 1 1  72 ARG HD2  H  -8.702  -3.666  -0.998 1.00 . A A .  69 ARG HD2  1 1 
        2  2930 1 1  72 ARG HD3  H  -8.289  -2.609   0.359 1.00 . A A .  69 ARG HD3  1 1 
        2  2931 1 1  72 ARG HE   H  -6.065  -2.899  -1.393 1.00 . A A .  69 ARG HE   1 1 
        2  2932 1 1  72 ARG HG2  H  -7.887  -4.957   0.946 1.00 . A A .  69 ARG HG2  1 1 
        2  2933 1 1  72 ARG HG3  H  -6.378  -4.040   0.927 1.00 . A A .  69 ARG HG3  1 1 
        2  2934 1 1  72 ARG HH11 H  -9.128  -1.196  -1.145 1.00 . A A .  69 ARG HH11 1 1 
        2  2935 1 1  72 ARG HH12 H  -8.623   0.082  -2.201 1.00 . A A .  69 ARG HH12 1 1 
        2  2936 1 1  72 ARG HH21 H  -5.427  -1.228  -2.778 1.00 . A A .  69 ARG HH21 1 1 
        2  2937 1 1  72 ARG HH22 H  -6.529   0.064  -3.133 1.00 . A A .  69 ARG HH22 1 1 
        2  2938 1 1  72 ARG N    N  -4.729  -6.984  -1.168 1.00 . A A .  69 ARG N    1 1 
        2  2939 1 1  72 ARG NE   N  -6.958  -2.518  -1.264 1.00 . A A .  69 ARG NE   1 1 
        2  2940 1 1  72 ARG NH1  N  -8.429  -0.782  -1.736 1.00 . A A .  69 ARG NH1  1 1 
        2  2941 1 1  72 ARG NH2  N  -6.330  -0.799  -2.664 1.00 . A A .  69 ARG NH2  1 1 
        2  2942 1 1  72 ARG O    O  -6.345  -8.592   0.274 1.00 . A A .  69 ARG O    1 1 
        2  2943 1 1  73 PHE C    C  -8.141  -8.202   3.367 1.00 . A A .  70 PHE C    1 1 
        2  2944 1 1  73 PHE CA   C  -6.654  -8.237   3.042 1.00 . A A .  70 PHE CA   1 1 
        2  2945 1 1  73 PHE CB   C  -5.765  -8.071   4.314 1.00 . A A .  70 PHE CB   1 1 
        2  2946 1 1  73 PHE CD1  C  -3.650  -8.668   3.033 1.00 . A A .  70 PHE CD1  1 1 
        2  2947 1 1  73 PHE CD2  C  -3.912  -9.535   5.245 1.00 . A A .  70 PHE CD2  1 1 
        2  2948 1 1  73 PHE CE1  C  -2.446  -9.326   2.909 1.00 . A A .  70 PHE CE1  1 1 
        2  2949 1 1  73 PHE CE2  C  -2.707 -10.183   5.121 1.00 . A A .  70 PHE CE2  1 1 
        2  2950 1 1  73 PHE CG   C  -4.409  -8.761   4.201 1.00 . A A .  70 PHE CG   1 1 
        2  2951 1 1  73 PHE CZ   C  -1.976 -10.083   3.951 1.00 . A A .  70 PHE CZ   1 1 
        2  2952 1 1  73 PHE H    H  -6.196  -6.286   2.361 1.00 . A A .  70 PHE H    1 1 
        2  2953 1 1  73 PHE HA   H  -6.447  -9.215   2.605 1.00 . A A .  70 PHE HA   1 1 
        2  2954 1 1  73 PHE HB2  H  -5.586  -7.017   4.498 1.00 . A A .  70 PHE HB2  1 1 
        2  2955 1 1  73 PHE HB3  H  -6.282  -8.489   5.171 1.00 . A A .  70 PHE HB3  1 1 
        2  2956 1 1  73 PHE HD1  H  -4.016  -8.067   2.209 1.00 . A A .  70 PHE HD1  1 1 
        2  2957 1 1  73 PHE HD2  H  -4.474  -9.617   6.167 1.00 . A A .  70 PHE HD2  1 1 
        2  2958 1 1  73 PHE HE1  H  -1.871  -9.243   1.994 1.00 . A A .  70 PHE HE1  1 1 
        2  2959 1 1  73 PHE HE2  H  -2.330 -10.786   5.940 1.00 . A A .  70 PHE HE2  1 1 
        2  2960 1 1  73 PHE HZ   H  -1.030 -10.605   3.857 1.00 . A A .  70 PHE HZ   1 1 
        2  2961 1 1  73 PHE N    N  -6.292  -7.213   2.056 1.00 . A A .  70 PHE N    1 1 
        2  2962 1 1  73 PHE O    O  -8.878  -7.350   2.882 1.00 . A A .  70 PHE O    1 1 
        2  2963 1 1  74 GLU C    C  -9.866  -9.791   6.096 1.00 . A A .  71 GLU C    1 1 
        2  2964 1 1  74 GLU CA   C  -9.922  -9.369   4.634 1.00 . A A .  71 GLU CA   1 1 
        2  2965 1 1  74 GLU CB   C -10.672 -10.445   3.814 1.00 . A A .  71 GLU CB   1 1 
        2  2966 1 1  74 GLU CD   C -10.889 -12.913   3.159 1.00 . A A .  71 GLU CD   1 1 
        2  2967 1 1  74 GLU CG   C -10.019 -11.847   3.834 1.00 . A A .  71 GLU CG   1 1 
        2  2968 1 1  74 GLU H    H  -7.895  -9.853   4.425 1.00 . A A .  71 GLU H    1 1 
        2  2969 1 1  74 GLU HA   H -10.450  -8.420   4.560 1.00 . A A .  71 GLU HA   1 1 
        2  2970 1 1  74 GLU HB2  H -11.681 -10.535   4.201 1.00 . A A .  71 GLU HB2  1 1 
        2  2971 1 1  74 GLU HB3  H -10.731 -10.114   2.781 1.00 . A A .  71 GLU HB3  1 1 
        2  2972 1 1  74 GLU HG2  H  -9.063 -11.795   3.316 1.00 . A A .  71 GLU HG2  1 1 
        2  2973 1 1  74 GLU HG3  H  -9.837 -12.138   4.865 1.00 . A A .  71 GLU HG3  1 1 
        2  2974 1 1  74 GLU N    N  -8.555  -9.192   4.148 1.00 . A A .  71 GLU N    1 1 
        2  2975 1 1  74 GLU O    O  -8.799 -10.121   6.620 1.00 . A A .  71 GLU O    1 1 
        2  2976 1 1  74 GLU OE1  O -10.851 -13.033   1.914 1.00 . A A .  71 GLU OE1  1 1 
        2  2977 1 1  74 GLU OE2  O -11.630 -13.631   3.873 1.00 . A A .  71 GLU OE2  1 1 
        2  2978 1 1  75 THR C    C -11.701 -11.611   8.206 1.00 . A A .  72 THR C    1 1 
        2  2979 1 1  75 THR CA   C -11.158 -10.167   8.135 1.00 . A A .  72 THR CA   1 1 
        2  2980 1 1  75 THR CB   C -12.105  -9.165   8.855 1.00 . A A .  72 THR CB   1 1 
        2  2981 1 1  75 THR CG2  C -12.179  -9.395  10.368 1.00 . A A .  72 THR CG2  1 1 
        2  2982 1 1  75 THR H    H -11.822  -9.520   6.256 1.00 . A A .  72 THR H    1 1 
        2  2983 1 1  75 THR HA   H -10.176 -10.110   8.612 1.00 . A A .  72 THR HA   1 1 
        2  2984 1 1  75 THR HB   H -13.100  -9.261   8.435 1.00 . A A .  72 THR HB   1 1 
        2  2985 1 1  75 THR HG1  H -11.264  -7.459   9.399 1.00 . A A .  72 THR HG1  1 1 
        2  2986 1 1  75 THR HG21 H -12.848  -8.671  10.816 1.00 . A A .  72 THR HG21 1 1 
        2  2987 1 1  75 THR HG22 H -11.194  -9.284  10.802 1.00 . A A .  72 THR HG22 1 1 
        2  2988 1 1  75 THR HG23 H -12.546 -10.394  10.572 1.00 . A A .  72 THR HG23 1 1 
        2  2989 1 1  75 THR N    N -11.020  -9.781   6.740 1.00 . A A .  72 THR N    1 1 
        2  2990 1 1  75 THR O    O -12.825 -11.873   7.760 1.00 . A A .  72 THR O    1 1 
        2  2991 1 1  75 THR OG1  O -11.642  -7.831   8.596 1.00 . A A .  72 THR OG1  1 1 
        2  2992 1 1  76 ARG C    C -12.230 -14.019  10.143 1.00 . A A .  73 ARG C    1 1 
        2  2993 1 1  76 ARG CA   C -11.262 -13.947   8.942 1.00 . A A .  73 ARG CA   1 1 
        2  2994 1 1  76 ARG CB   C -10.005 -14.832   9.202 1.00 . A A .  73 ARG CB   1 1 
        2  2995 1 1  76 ARG CD   C  -9.841 -15.936   6.877 1.00 . A A .  73 ARG CD   1 1 
        2  2996 1 1  76 ARG CG   C  -9.113 -15.113   7.966 1.00 . A A .  73 ARG CG   1 1 
        2  2997 1 1  76 ARG CZ   C  -8.832 -16.547   4.648 1.00 . A A .  73 ARG CZ   1 1 
        2  2998 1 1  76 ARG H    H  -9.951 -12.280   8.926 1.00 . A A .  73 ARG H    1 1 
        2  2999 1 1  76 ARG HA   H -11.772 -14.310   8.054 1.00 . A A .  73 ARG HA   1 1 
        2  3000 1 1  76 ARG HB2  H  -9.389 -14.343   9.950 1.00 . A A .  73 ARG HB2  1 1 
        2  3001 1 1  76 ARG HB3  H -10.327 -15.790   9.605 1.00 . A A .  73 ARG HB3  1 1 
        2  3002 1 1  76 ARG HD2  H -10.474 -16.670   7.360 1.00 . A A .  73 ARG HD2  1 1 
        2  3003 1 1  76 ARG HD3  H -10.463 -15.266   6.287 1.00 . A A .  73 ARG HD3  1 1 
        2  3004 1 1  76 ARG HE   H  -8.299 -17.307   6.418 1.00 . A A .  73 ARG HE   1 1 
        2  3005 1 1  76 ARG HG2  H  -8.795 -14.167   7.538 1.00 . A A .  73 ARG HG2  1 1 
        2  3006 1 1  76 ARG HG3  H  -8.235 -15.662   8.292 1.00 . A A .  73 ARG HG3  1 1 
        2  3007 1 1  76 ARG HH11 H -10.263 -15.118   4.478 1.00 . A A .  73 ARG HH11 1 1 
        2  3008 1 1  76 ARG HH12 H  -9.538 -15.635   2.992 1.00 . A A .  73 ARG HH12 1 1 
        2  3009 1 1  76 ARG HH21 H  -7.378 -17.951   4.464 1.00 . A A .  73 ARG HH21 1 1 
        2  3010 1 1  76 ARG HH22 H  -7.921 -17.236   2.977 1.00 . A A .  73 ARG HH22 1 1 
        2  3011 1 1  76 ARG N    N -10.865 -12.546   8.702 1.00 . A A .  73 ARG N    1 1 
        2  3012 1 1  76 ARG NE   N  -8.904 -16.660   5.984 1.00 . A A .  73 ARG NE   1 1 
        2  3013 1 1  76 ARG NH1  N  -9.604 -15.699   3.988 1.00 . A A .  73 ARG NH1  1 1 
        2  3014 1 1  76 ARG NH2  N  -7.973 -17.299   3.975 1.00 . A A .  73 ARG NH2  1 1 
        2  3015 1 1  76 ARG O    O -13.366 -14.485  10.012 1.00 . A A .  73 ARG O    1 1 
        2  3016 1 1  77 LEU C    C -12.516 -12.096  13.161 1.00 . A A .  74 LEU C    1 1 
        2  3017 1 1  77 LEU CA   C -12.540 -13.525  12.578 1.00 . A A .  74 LEU CA   1 1 
        2  3018 1 1  77 LEU CB   C -11.925 -14.531  13.587 1.00 . A A .  74 LEU CB   1 1 
        2  3019 1 1  77 LEU CD1  C -10.992 -16.867  14.067 1.00 . A A .  74 LEU CD1  1 1 
        2  3020 1 1  77 LEU CD2  C -13.253 -16.629  12.926 1.00 . A A .  74 LEU CD2  1 1 
        2  3021 1 1  77 LEU CG   C -11.845 -16.019  13.110 1.00 . A A .  74 LEU CG   1 1 
        2  3022 1 1  77 LEU H    H -10.831 -13.218  11.345 1.00 . A A .  74 LEU H    1 1 
        2  3023 1 1  77 LEU HA   H -13.569 -13.805  12.366 1.00 . A A .  74 LEU HA   1 1 
        2  3024 1 1  77 LEU HB2  H -10.917 -14.196  13.819 1.00 . A A .  74 LEU HB2  1 1 
        2  3025 1 1  77 LEU HB3  H -12.508 -14.499  14.506 1.00 . A A .  74 LEU HB3  1 1 
        2  3026 1 1  77 LEU HD11 H -11.435 -16.875  15.057 1.00 . A A .  74 LEU HD11 1 1 
        2  3027 1 1  77 LEU HD12 H  -9.995 -16.448  14.126 1.00 . A A .  74 LEU HD12 1 1 
        2  3028 1 1  77 LEU HD13 H -10.925 -17.880  13.695 1.00 . A A .  74 LEU HD13 1 1 
        2  3029 1 1  77 LEU HD21 H -13.802 -16.054  12.193 1.00 . A A .  74 LEU HD21 1 1 
        2  3030 1 1  77 LEU HD22 H -13.790 -16.613  13.866 1.00 . A A .  74 LEU HD22 1 1 
        2  3031 1 1  77 LEU HD23 H -13.166 -17.653  12.583 1.00 . A A .  74 LEU HD23 1 1 
        2  3032 1 1  77 LEU HG   H -11.353 -16.042  12.143 1.00 . A A .  74 LEU HG   1 1 
        2  3033 1 1  77 LEU N    N -11.754 -13.556  11.318 1.00 . A A .  74 LEU N    1 1 
        2  3034 1 1  77 LEU O    O -11.646 -11.314  12.800 1.00 . A A .  74 LEU O    1 1 
        2  3035 1 1  78 ALA C    C -14.264 -10.467  16.035 1.00 . A A .  75 ALA C    1 1 
        2  3036 1 1  78 ALA CA   C -13.507 -10.425  14.699 1.00 . A A .  75 ALA CA   1 1 
        2  3037 1 1  78 ALA CB   C -14.120  -9.374  13.757 1.00 . A A .  75 ALA CB   1 1 
        2  3038 1 1  78 ALA H    H -14.154 -12.409  14.289 1.00 . A A .  75 ALA H    1 1 
        2  3039 1 1  78 ALA HA   H -12.479 -10.127  14.901 1.00 . A A .  75 ALA HA   1 1 
        2  3040 1 1  78 ALA HB1  H -14.043  -8.392  14.209 1.00 . A A .  75 ALA HB1  1 1 
        2  3041 1 1  78 ALA HB2  H -15.161  -9.606  13.570 1.00 . A A .  75 ALA HB2  1 1 
        2  3042 1 1  78 ALA HB3  H -13.580  -9.373  12.819 1.00 . A A .  75 ALA HB3  1 1 
        2  3043 1 1  78 ALA N    N -13.466 -11.755  14.053 1.00 . A A .  75 ALA N    1 1 
        2  3044 1 1  78 ALA O    O -15.338 -11.070  16.117 1.00 . A A .  75 ALA O    1 1 
        2  3045 1 1  79 GLY C    C -14.485 -11.099  19.084 1.00 . A A .  76 GLY C    1 1 
        2  3046 1 1  79 GLY CA   C -14.283  -9.740  18.417 1.00 . A A .  76 GLY CA   1 1 
        2  3047 1 1  79 GLY H    H -12.807  -9.396  16.920 1.00 . A A .  76 GLY H    1 1 
        2  3048 1 1  79 GLY HA2  H -13.627  -9.155  19.046 1.00 . A A .  76 GLY HA2  1 1 
        2  3049 1 1  79 GLY HA3  H -15.233  -9.231  18.350 1.00 . A A .  76 GLY HA3  1 1 
        2  3050 1 1  79 GLY N    N -13.682  -9.821  17.072 1.00 . A A .  76 GLY N    1 1 
        2  3051 1 1  79 GLY O    O -15.349 -11.257  19.952 1.00 . A A .  76 GLY O    1 1 
        2  3052 1 1  80 VAL C    C -12.748 -13.735  20.269 1.00 . A A .  77 VAL C    1 1 
        2  3053 1 1  80 VAL CA   C -13.756 -13.465  19.137 1.00 . A A .  77 VAL CA   1 1 
        2  3054 1 1  80 VAL CB   C -13.513 -14.447  17.926 1.00 . A A .  77 VAL CB   1 1 
        2  3055 1 1  80 VAL CG1  C -14.609 -14.284  16.847 1.00 . A A .  77 VAL CG1  1 1 
        2  3056 1 1  80 VAL CG2  C -12.104 -14.252  17.320 1.00 . A A .  77 VAL CG2  1 1 
        2  3057 1 1  80 VAL H    H -12.923 -11.829  18.098 1.00 . A A .  77 VAL H    1 1 
        2  3058 1 1  80 VAL HA   H -14.761 -13.636  19.519 1.00 . A A .  77 VAL HA   1 1 
        2  3059 1 1  80 VAL HB   H -13.578 -15.468  18.307 1.00 . A A .  77 VAL HB   1 1 
        2  3060 1 1  80 VAL HG11 H -14.588 -13.272  16.458 1.00 . A A .  77 VAL HG11 1 1 
        2  3061 1 1  80 VAL HG12 H -15.583 -14.478  17.277 1.00 . A A .  77 VAL HG12 1 1 
        2  3062 1 1  80 VAL HG13 H -14.434 -14.982  16.036 1.00 . A A .  77 VAL HG13 1 1 
        2  3063 1 1  80 VAL HG21 H -11.350 -14.453  18.072 1.00 . A A .  77 VAL HG21 1 1 
        2  3064 1 1  80 VAL HG22 H -11.995 -13.232  16.972 1.00 . A A .  77 VAL HG22 1 1 
        2  3065 1 1  80 VAL HG23 H -11.962 -14.929  16.485 1.00 . A A .  77 VAL HG23 1 1 
        2  3066 1 1  80 VAL N    N -13.656 -12.067  18.694 1.00 . A A .  77 VAL N    1 1 
        2  3067 1 1  80 VAL O    O -12.172 -12.798  20.826 1.00 . A A .  77 VAL O    1 1 
        2  3068 1 1  81 GLU C    C -10.352 -16.065  20.957 1.00 . A A .  78 GLU C    1 1 
        2  3069 1 1  81 GLU CA   C -11.584 -15.441  21.636 1.00 . A A .  78 GLU CA   1 1 
        2  3070 1 1  81 GLU CB   C -12.247 -16.431  22.635 1.00 . A A .  78 GLU CB   1 1 
        2  3071 1 1  81 GLU CD   C -13.566 -18.612  22.978 1.00 . A A .  78 GLU CD   1 1 
        2  3072 1 1  81 GLU CG   C -12.773 -17.732  22.001 1.00 . A A .  78 GLU CG   1 1 
        2  3073 1 1  81 GLU H    H -13.125 -15.694  20.201 1.00 . A A .  78 GLU H    1 1 
        2  3074 1 1  81 GLU HA   H -11.258 -14.565  22.184 1.00 . A A .  78 GLU HA   1 1 
        2  3075 1 1  81 GLU HB2  H -11.522 -16.696  23.398 1.00 . A A .  78 GLU HB2  1 1 
        2  3076 1 1  81 GLU HB3  H -13.080 -15.928  23.119 1.00 . A A .  78 GLU HB3  1 1 
        2  3077 1 1  81 GLU HG2  H -13.412 -17.472  21.162 1.00 . A A .  78 GLU HG2  1 1 
        2  3078 1 1  81 GLU HG3  H -11.928 -18.303  21.624 1.00 . A A .  78 GLU HG3  1 1 
        2  3079 1 1  81 GLU N    N -12.569 -15.012  20.626 1.00 . A A .  78 GLU N    1 1 
        2  3080 1 1  81 GLU O    O -10.418 -16.486  19.794 1.00 . A A .  78 GLU O    1 1 
        2  3081 1 1  81 GLU OE1  O -12.943 -19.319  23.793 1.00 . A A .  78 GLU OE1  1 1 
        2  3082 1 1  81 GLU OE2  O -14.815 -18.584  22.951 1.00 . A A .  78 GLU OE2  1 1 
        2  3083 1 1  82 GLY C    C  -8.064 -18.198  20.870 1.00 . A A .  79 GLY C    1 1 
        2  3084 1 1  82 GLY CA   C  -7.979 -16.714  21.232 1.00 . A A .  79 GLY CA   1 1 
        2  3085 1 1  82 GLY H    H  -9.274 -15.763  22.619 1.00 . A A .  79 GLY H    1 1 
        2  3086 1 1  82 GLY HA2  H  -7.655 -16.153  20.359 1.00 . A A .  79 GLY HA2  1 1 
        2  3087 1 1  82 GLY HA3  H  -7.237 -16.602  22.007 1.00 . A A .  79 GLY HA3  1 1 
        2  3088 1 1  82 GLY N    N  -9.241 -16.138  21.715 1.00 . A A .  79 GLY N    1 1 
        2  3089 1 1  82 GLY O    O  -7.239 -18.705  20.101 1.00 . A A .  79 GLY O    1 1 
        2  3090 1 1  83 GLU C    C  -9.896 -20.415  19.668 1.00 . A A .  80 GLU C    1 1 
        2  3091 1 1  83 GLU CA   C  -9.354 -20.294  21.111 1.00 . A A .  80 GLU CA   1 1 
        2  3092 1 1  83 GLU CB   C -10.366 -20.872  22.129 1.00 . A A .  80 GLU CB   1 1 
        2  3093 1 1  83 GLU CD   C  -9.327 -23.234  22.255 1.00 . A A .  80 GLU CD   1 1 
        2  3094 1 1  83 GLU CG   C -10.600 -22.395  22.044 1.00 . A A .  80 GLU CG   1 1 
        2  3095 1 1  83 GLU H    H  -9.642 -18.434  22.085 1.00 . A A .  80 GLU H    1 1 
        2  3096 1 1  83 GLU HA   H  -8.422 -20.844  21.183 1.00 . A A .  80 GLU HA   1 1 
        2  3097 1 1  83 GLU HB2  H -10.019 -20.639  23.127 1.00 . A A .  80 GLU HB2  1 1 
        2  3098 1 1  83 GLU HB3  H -11.325 -20.376  21.981 1.00 . A A .  80 GLU HB3  1 1 
        2  3099 1 1  83 GLU HG2  H -11.322 -22.676  22.803 1.00 . A A .  80 GLU HG2  1 1 
        2  3100 1 1  83 GLU HG3  H -11.019 -22.624  21.069 1.00 . A A .  80 GLU HG3  1 1 
        2  3101 1 1  83 GLU N    N  -9.067 -18.890  21.436 1.00 . A A .  80 GLU N    1 1 
        2  3102 1 1  83 GLU O    O  -9.550 -21.359  18.947 1.00 . A A .  80 GLU O    1 1 
        2  3103 1 1  83 GLU OE1  O  -8.837 -23.314  23.407 1.00 . A A .  80 GLU OE1  1 1 
        2  3104 1 1  83 GLU OE2  O  -8.805 -23.816  21.276 1.00 . A A .  80 GLU OE2  1 1 
        2  3105 1 1  84 GLU C    C -10.128 -19.019  16.882 1.00 . A A .  81 GLU C    1 1 
        2  3106 1 1  84 GLU CA   C -11.257 -19.355  17.867 1.00 . A A .  81 GLU CA   1 1 
        2  3107 1 1  84 GLU CB   C -12.378 -18.289  17.749 1.00 . A A .  81 GLU CB   1 1 
        2  3108 1 1  84 GLU CD   C -14.284 -19.926  18.315 1.00 . A A .  81 GLU CD   1 1 
        2  3109 1 1  84 GLU CG   C -13.630 -18.564  18.601 1.00 . A A .  81 GLU CG   1 1 
        2  3110 1 1  84 GLU H    H -11.012 -18.752  19.892 1.00 . A A .  81 GLU H    1 1 
        2  3111 1 1  84 GLU HA   H -11.669 -20.324  17.605 1.00 . A A .  81 GLU HA   1 1 
        2  3112 1 1  84 GLU HB2  H -11.974 -17.327  18.054 1.00 . A A .  81 GLU HB2  1 1 
        2  3113 1 1  84 GLU HB3  H -12.687 -18.214  16.707 1.00 . A A .  81 GLU HB3  1 1 
        2  3114 1 1  84 GLU HG2  H -13.350 -18.519  19.646 1.00 . A A .  81 GLU HG2  1 1 
        2  3115 1 1  84 GLU HG3  H -14.358 -17.784  18.409 1.00 . A A .  81 GLU HG3  1 1 
        2  3116 1 1  84 GLU N    N -10.740 -19.440  19.253 1.00 . A A .  81 GLU N    1 1 
        2  3117 1 1  84 GLU O    O -10.117 -19.505  15.741 1.00 . A A .  81 GLU O    1 1 
        2  3118 1 1  84 GLU OE1  O -14.920 -20.080  17.246 1.00 . A A .  81 GLU OE1  1 1 
        2  3119 1 1  84 GLU OE2  O -14.174 -20.847  19.155 1.00 . A A .  81 GLU OE2  1 1 
        2  3120 1 1  85 ILE C    C  -7.170 -18.941  16.130 1.00 . A A .  82 ILE C    1 1 
        2  3121 1 1  85 ILE CA   C  -8.039 -17.739  16.540 1.00 . A A .  82 ILE CA   1 1 
        2  3122 1 1  85 ILE CB   C  -7.177 -16.666  17.305 1.00 . A A .  82 ILE CB   1 1 
        2  3123 1 1  85 ILE CD1  C  -8.663 -14.708  16.485 1.00 . A A .  82 ILE CD1  1 1 
        2  3124 1 1  85 ILE CG1  C  -8.041 -15.420  17.669 1.00 . A A .  82 ILE CG1  1 1 
        2  3125 1 1  85 ILE CG2  C  -5.924 -16.252  16.497 1.00 . A A .  82 ILE CG2  1 1 
        2  3126 1 1  85 ILE H    H  -9.261 -17.860  18.266 1.00 . A A .  82 ILE H    1 1 
        2  3127 1 1  85 ILE HA   H  -8.436 -17.273  15.638 1.00 . A A .  82 ILE HA   1 1 
        2  3128 1 1  85 ILE HB   H  -6.830 -17.125  18.229 1.00 . A A .  82 ILE HB   1 1 
        2  3129 1 1  85 ILE HD11 H  -7.888 -14.399  15.796 1.00 . A A .  82 ILE HD11 1 1 
        2  3130 1 1  85 ILE HD12 H  -9.194 -13.834  16.835 1.00 . A A .  82 ILE HD12 1 1 
        2  3131 1 1  85 ILE HD13 H  -9.354 -15.368  15.980 1.00 . A A .  82 ILE HD13 1 1 
        2  3132 1 1  85 ILE HG12 H  -8.850 -15.724  18.319 1.00 . A A .  82 ILE HG12 1 1 
        2  3133 1 1  85 ILE HG13 H  -7.427 -14.699  18.200 1.00 . A A .  82 ILE HG13 1 1 
        2  3134 1 1  85 ILE HG21 H  -5.302 -17.120  16.321 1.00 . A A .  82 ILE HG21 1 1 
        2  3135 1 1  85 ILE HG22 H  -5.356 -15.518  17.052 1.00 . A A .  82 ILE HG22 1 1 
        2  3136 1 1  85 ILE HG23 H  -6.222 -15.829  15.546 1.00 . A A .  82 ILE HG23 1 1 
        2  3137 1 1  85 ILE N    N  -9.183 -18.183  17.346 1.00 . A A .  82 ILE N    1 1 
        2  3138 1 1  85 ILE O    O  -6.973 -19.185  14.940 1.00 . A A .  82 ILE O    1 1 
        2  3139 1 1  86 ALA C    C  -6.651 -22.002  16.129 1.00 . A A .  83 ALA C    1 1 
        2  3140 1 1  86 ALA CA   C  -5.878 -20.913  16.898 1.00 . A A .  83 ALA CA   1 1 
        2  3141 1 1  86 ALA CB   C  -5.364 -21.460  18.231 1.00 . A A .  83 ALA CB   1 1 
        2  3142 1 1  86 ALA H    H  -6.943 -19.471  18.049 1.00 . A A .  83 ALA H    1 1 
        2  3143 1 1  86 ALA HA   H  -5.019 -20.612  16.306 1.00 . A A .  83 ALA HA   1 1 
        2  3144 1 1  86 ALA HB1  H  -4.818 -20.687  18.756 1.00 . A A .  83 ALA HB1  1 1 
        2  3145 1 1  86 ALA HB2  H  -4.709 -22.304  18.056 1.00 . A A .  83 ALA HB2  1 1 
        2  3146 1 1  86 ALA HB3  H  -6.201 -21.777  18.842 1.00 . A A .  83 ALA HB3  1 1 
        2  3147 1 1  86 ALA N    N  -6.711 -19.712  17.127 1.00 . A A .  83 ALA N    1 1 
        2  3148 1 1  86 ALA O    O  -6.053 -22.790  15.383 1.00 . A A .  83 ALA O    1 1 
        2  3149 1 1  87 ALA C    C  -8.862 -22.743  14.098 1.00 . A A .  84 ALA C    1 1 
        2  3150 1 1  87 ALA CA   C  -8.899 -22.943  15.622 1.00 . A A .  84 ALA CA   1 1 
        2  3151 1 1  87 ALA CB   C -10.334 -22.775  16.130 1.00 . A A .  84 ALA CB   1 1 
        2  3152 1 1  87 ALA H    H  -8.366 -21.382  16.962 1.00 . A A .  84 ALA H    1 1 
        2  3153 1 1  87 ALA HA   H  -8.579 -23.956  15.854 1.00 . A A .  84 ALA HA   1 1 
        2  3154 1 1  87 ALA HB1  H -10.979 -23.508  15.661 1.00 . A A .  84 ALA HB1  1 1 
        2  3155 1 1  87 ALA HB2  H -10.693 -21.780  15.895 1.00 . A A .  84 ALA HB2  1 1 
        2  3156 1 1  87 ALA HB3  H -10.361 -22.915  17.204 1.00 . A A .  84 ALA HB3  1 1 
        2  3157 1 1  87 ALA N    N  -7.986 -22.017  16.320 1.00 . A A .  84 ALA N    1 1 
        2  3158 1 1  87 ALA O    O  -9.001 -23.709  13.345 1.00 . A A .  84 ALA O    1 1 
        2  3159 1 1  88 LEU C    C  -7.081 -21.319  11.788 1.00 . A A .  85 LEU C    1 1 
        2  3160 1 1  88 LEU CA   C  -8.555 -21.168  12.221 1.00 . A A .  85 LEU CA   1 1 
        2  3161 1 1  88 LEU CB   C  -9.028 -19.744  11.855 1.00 . A A .  85 LEU CB   1 1 
        2  3162 1 1  88 LEU CD1  C -10.313 -19.466   9.624 1.00 . A A .  85 LEU CD1  1 1 
        2  3163 1 1  88 LEU CD2  C  -8.139 -18.151  10.015 1.00 . A A .  85 LEU CD2  1 1 
        2  3164 1 1  88 LEU CG   C  -8.943 -19.431  10.312 1.00 . A A .  85 LEU CG   1 1 
        2  3165 1 1  88 LEU H    H  -8.760 -20.742  14.293 1.00 . A A .  85 LEU H    1 1 
        2  3166 1 1  88 LEU HA   H  -9.156 -21.881  11.656 1.00 . A A .  85 LEU HA   1 1 
        2  3167 1 1  88 LEU HB2  H -10.054 -19.624  12.195 1.00 . A A .  85 LEU HB2  1 1 
        2  3168 1 1  88 LEU HB3  H  -8.415 -19.033  12.395 1.00 . A A .  85 LEU HB3  1 1 
        2  3169 1 1  88 LEU HD11 H -10.743 -20.451   9.757 1.00 . A A .  85 LEU HD11 1 1 
        2  3170 1 1  88 LEU HD12 H -10.188 -19.276   8.569 1.00 . A A .  85 LEU HD12 1 1 
        2  3171 1 1  88 LEU HD13 H -10.969 -18.722  10.055 1.00 . A A .  85 LEU HD13 1 1 
        2  3172 1 1  88 LEU HD21 H  -8.572 -17.305  10.528 1.00 . A A .  85 LEU HD21 1 1 
        2  3173 1 1  88 LEU HD22 H  -8.128 -17.966   8.949 1.00 . A A .  85 LEU HD22 1 1 
        2  3174 1 1  88 LEU HD23 H  -7.115 -18.302  10.354 1.00 . A A .  85 LEU HD23 1 1 
        2  3175 1 1  88 LEU HG   H  -8.386 -20.237   9.843 1.00 . A A .  85 LEU HG   1 1 
        2  3176 1 1  88 LEU N    N  -8.731 -21.477  13.649 1.00 . A A .  85 LEU N    1 1 
        2  3177 1 1  88 LEU O    O  -6.802 -21.851  10.712 1.00 . A A .  85 LEU O    1 1 
        2  3178 1 1  89 LEU C    C  -4.168 -22.185  11.977 1.00 . A A .  86 LEU C    1 1 
        2  3179 1 1  89 LEU CA   C  -4.695 -20.784  12.317 1.00 . A A .  86 LEU CA   1 1 
        2  3180 1 1  89 LEU CB   C  -3.861 -20.184  13.490 1.00 . A A .  86 LEU CB   1 1 
        2  3181 1 1  89 LEU CD1  C  -3.163 -18.209  14.964 1.00 . A A .  86 LEU CD1  1 1 
        2  3182 1 1  89 LEU CD2  C  -3.676 -17.832  12.484 1.00 . A A .  86 LEU CD2  1 1 
        2  3183 1 1  89 LEU CG   C  -4.015 -18.653  13.751 1.00 . A A .  86 LEU CG   1 1 
        2  3184 1 1  89 LEU H    H  -6.452 -20.441  13.479 1.00 . A A .  86 LEU H    1 1 
        2  3185 1 1  89 LEU HA   H  -4.569 -20.146  11.444 1.00 . A A .  86 LEU HA   1 1 
        2  3186 1 1  89 LEU HB2  H  -4.136 -20.711  14.398 1.00 . A A .  86 LEU HB2  1 1 
        2  3187 1 1  89 LEU HB3  H  -2.808 -20.381  13.297 1.00 . A A .  86 LEU HB3  1 1 
        2  3188 1 1  89 LEU HD11 H  -2.115 -18.409  14.776 1.00 . A A .  86 LEU HD11 1 1 
        2  3189 1 1  89 LEU HD12 H  -3.479 -18.755  15.844 1.00 . A A .  86 LEU HD12 1 1 
        2  3190 1 1  89 LEU HD13 H  -3.301 -17.151  15.139 1.00 . A A .  86 LEU HD13 1 1 
        2  3191 1 1  89 LEU HD21 H  -3.783 -16.777  12.693 1.00 . A A .  86 LEU HD21 1 1 
        2  3192 1 1  89 LEU HD22 H  -4.356 -18.102  11.686 1.00 . A A .  86 LEU HD22 1 1 
        2  3193 1 1  89 LEU HD23 H  -2.659 -18.035  12.170 1.00 . A A .  86 LEU HD23 1 1 
        2  3194 1 1  89 LEU HG   H  -5.051 -18.448  14.000 1.00 . A A .  86 LEU HG   1 1 
        2  3195 1 1  89 LEU N    N  -6.150 -20.809  12.627 1.00 . A A .  86 LEU N    1 1 
        2  3196 1 1  89 LEU O    O  -3.301 -22.325  11.108 1.00 . A A .  86 LEU O    1 1 
        2  3197 1 1  90 GLU C    C  -4.779 -25.079  11.012 1.00 . A A .  87 GLU C    1 1 
        2  3198 1 1  90 GLU CA   C  -4.346 -24.616  12.422 1.00 . A A .  87 GLU CA   1 1 
        2  3199 1 1  90 GLU CB   C  -4.949 -25.551  13.509 1.00 . A A .  87 GLU CB   1 1 
        2  3200 1 1  90 GLU CD   C  -7.061 -26.676  14.452 1.00 . A A .  87 GLU CD   1 1 
        2  3201 1 1  90 GLU CG   C  -6.485 -25.613  13.511 1.00 . A A .  87 GLU CG   1 1 
        2  3202 1 1  90 GLU H    H  -5.435 -23.013  13.304 1.00 . A A .  87 GLU H    1 1 
        2  3203 1 1  90 GLU HA   H  -3.261 -24.671  12.482 1.00 . A A .  87 GLU HA   1 1 
        2  3204 1 1  90 GLU HB2  H  -4.566 -26.558  13.357 1.00 . A A .  87 GLU HB2  1 1 
        2  3205 1 1  90 GLU HB3  H  -4.622 -25.209  14.486 1.00 . A A .  87 GLU HB3  1 1 
        2  3206 1 1  90 GLU HG2  H  -6.864 -24.636  13.797 1.00 . A A .  87 GLU HG2  1 1 
        2  3207 1 1  90 GLU HG3  H  -6.822 -25.829  12.501 1.00 . A A .  87 GLU HG3  1 1 
        2  3208 1 1  90 GLU N    N  -4.729 -23.212  12.649 1.00 . A A .  87 GLU N    1 1 
        2  3209 1 1  90 GLU O    O  -4.101 -25.899  10.382 1.00 . A A .  87 GLU O    1 1 
        2  3210 1 1  90 GLU OE1  O  -6.845 -27.880  14.183 1.00 . A A .  87 GLU OE1  1 1 
        2  3211 1 1  90 GLU OE2  O  -7.746 -26.328  15.438 1.00 . A A .  87 GLU OE2  1 1 
        2  3212 1 1  91 ARG C    C  -5.649 -24.252   8.109 1.00 . A A .  88 ARG C    1 1 
        2  3213 1 1  91 ARG CA   C  -6.484 -24.899   9.216 1.00 . A A .  88 ARG CA   1 1 
        2  3214 1 1  91 ARG CB   C  -7.960 -24.437   9.145 1.00 . A A .  88 ARG CB   1 1 
        2  3215 1 1  91 ARG CD   C -10.266 -24.472  10.275 1.00 . A A .  88 ARG CD   1 1 
        2  3216 1 1  91 ARG CG   C  -8.848 -25.057  10.244 1.00 . A A .  88 ARG CG   1 1 
        2  3217 1 1  91 ARG CZ   C -12.085 -25.992  11.086 1.00 . A A .  88 ARG CZ   1 1 
        2  3218 1 1  91 ARG H    H  -6.390 -23.864  11.069 1.00 . A A .  88 ARG H    1 1 
        2  3219 1 1  91 ARG HA   H  -6.445 -25.985   9.107 1.00 . A A .  88 ARG HA   1 1 
        2  3220 1 1  91 ARG HB2  H  -7.993 -23.354   9.246 1.00 . A A .  88 ARG HB2  1 1 
        2  3221 1 1  91 ARG HB3  H  -8.373 -24.709   8.177 1.00 . A A .  88 ARG HB3  1 1 
        2  3222 1 1  91 ARG HD2  H -10.204 -23.412  10.496 1.00 . A A .  88 ARG HD2  1 1 
        2  3223 1 1  91 ARG HD3  H -10.730 -24.608   9.304 1.00 . A A .  88 ARG HD3  1 1 
        2  3224 1 1  91 ARG HE   H -10.866 -24.900  12.250 1.00 . A A .  88 ARG HE   1 1 
        2  3225 1 1  91 ARG HG2  H  -8.918 -26.126  10.076 1.00 . A A .  88 ARG HG2  1 1 
        2  3226 1 1  91 ARG HG3  H  -8.378 -24.885  11.210 1.00 . A A .  88 ARG HG3  1 1 
        2  3227 1 1  91 ARG HH11 H -12.009 -25.863   9.059 1.00 . A A .  88 ARG HH11 1 1 
        2  3228 1 1  91 ARG HH12 H -13.215 -26.941   9.689 1.00 . A A .  88 ARG HH12 1 1 
        2  3229 1 1  91 ARG HH21 H -12.435 -26.331  13.049 1.00 . A A .  88 ARG HH21 1 1 
        2  3230 1 1  91 ARG HH22 H -13.456 -27.202  11.950 1.00 . A A .  88 ARG HH22 1 1 
        2  3231 1 1  91 ARG N    N  -5.920 -24.547  10.529 1.00 . A A .  88 ARG N    1 1 
        2  3232 1 1  91 ARG NE   N -11.088 -25.121  11.313 1.00 . A A .  88 ARG NE   1 1 
        2  3233 1 1  91 ARG NH1  N -12.465 -26.289   9.844 1.00 . A A .  88 ARG NH1  1 1 
        2  3234 1 1  91 ARG NH2  N -12.707 -26.554  12.109 1.00 . A A .  88 ARG NH2  1 1 
        2  3235 1 1  91 ARG O    O  -5.125 -24.933   7.234 1.00 . A A .  88 ARG O    1 1 
        2  3236 1 1  92 GLU C    C  -3.311 -22.519   7.075 1.00 . A A .  89 GLU C    1 1 
        2  3237 1 1  92 GLU CA   C  -4.782 -22.115   7.211 1.00 . A A .  89 GLU CA   1 1 
        2  3238 1 1  92 GLU CB   C  -4.908 -20.619   7.572 1.00 . A A .  89 GLU CB   1 1 
        2  3239 1 1  92 GLU CD   C  -7.309 -20.359   6.632 1.00 . A A .  89 GLU CD   1 1 
        2  3240 1 1  92 GLU CG   C  -6.351 -20.160   7.824 1.00 . A A .  89 GLU CG   1 1 
        2  3241 1 1  92 GLU H    H  -5.836 -22.484   9.014 1.00 . A A .  89 GLU H    1 1 
        2  3242 1 1  92 GLU HA   H  -5.277 -22.286   6.259 1.00 . A A .  89 GLU HA   1 1 
        2  3243 1 1  92 GLU HB2  H  -4.336 -20.421   8.475 1.00 . A A .  89 GLU HB2  1 1 
        2  3244 1 1  92 GLU HB3  H  -4.496 -20.023   6.762 1.00 . A A .  89 GLU HB3  1 1 
        2  3245 1 1  92 GLU HG2  H  -6.741 -20.709   8.676 1.00 . A A .  89 GLU HG2  1 1 
        2  3246 1 1  92 GLU HG3  H  -6.330 -19.104   8.083 1.00 . A A .  89 GLU HG3  1 1 
        2  3247 1 1  92 GLU N    N  -5.477 -22.931   8.220 1.00 . A A .  89 GLU N    1 1 
        2  3248 1 1  92 GLU O    O  -2.751 -22.452   5.983 1.00 . A A .  89 GLU O    1 1 
        2  3249 1 1  92 GLU OE1  O  -7.377 -19.468   5.761 1.00 . A A .  89 GLU OE1  1 1 
        2  3250 1 1  92 GLU OE2  O  -8.003 -21.402   6.565 1.00 . A A .  89 GLU OE2  1 1 
        2  3251 1 1  93 ARG C    C  -1.221 -24.851   7.560 1.00 . A A .  90 ARG C    1 1 
        2  3252 1 1  93 ARG CA   C  -1.309 -23.452   8.200 1.00 . A A .  90 ARG CA   1 1 
        2  3253 1 1  93 ARG CB   C  -0.678 -23.464   9.624 1.00 . A A .  90 ARG CB   1 1 
        2  3254 1 1  93 ARG CD   C  -0.412 -24.583  11.920 1.00 . A A .  90 ARG CD   1 1 
        2  3255 1 1  93 ARG CG   C  -1.104 -24.622  10.545 1.00 . A A .  90 ARG CG   1 1 
        2  3256 1 1  93 ARG CZ   C  -0.082 -26.928  12.744 1.00 . A A .  90 ARG CZ   1 1 
        2  3257 1 1  93 ARG H    H  -3.189 -22.857   9.053 1.00 . A A .  90 ARG H    1 1 
        2  3258 1 1  93 ARG HA   H  -0.726 -22.774   7.580 1.00 . A A .  90 ARG HA   1 1 
        2  3259 1 1  93 ARG HB2  H   0.403 -23.501   9.518 1.00 . A A .  90 ARG HB2  1 1 
        2  3260 1 1  93 ARG HB3  H  -0.933 -22.529  10.116 1.00 . A A .  90 ARG HB3  1 1 
        2  3261 1 1  93 ARG HD2  H   0.664 -24.544  11.780 1.00 . A A .  90 ARG HD2  1 1 
        2  3262 1 1  93 ARG HD3  H  -0.731 -23.692  12.452 1.00 . A A .  90 ARG HD3  1 1 
        2  3263 1 1  93 ARG HE   H  -1.543 -25.682  13.320 1.00 . A A .  90 ARG HE   1 1 
        2  3264 1 1  93 ARG HG2  H  -2.175 -24.571  10.692 1.00 . A A .  90 ARG HG2  1 1 
        2  3265 1 1  93 ARG HG3  H  -0.860 -25.562  10.059 1.00 . A A .  90 ARG HG3  1 1 
        2  3266 1 1  93 ARG HH11 H   1.343 -26.372  11.398 1.00 . A A .  90 ARG HH11 1 1 
        2  3267 1 1  93 ARG HH12 H   1.492 -27.988  12.009 1.00 . A A .  90 ARG HH12 1 1 
        2  3268 1 1  93 ARG HH21 H  -1.300 -27.781  14.111 1.00 . A A .  90 ARG HH21 1 1 
        2  3269 1 1  93 ARG HH22 H   0.006 -28.775  13.555 1.00 . A A .  90 ARG HH22 1 1 
        2  3270 1 1  93 ARG N    N  -2.699 -22.933   8.201 1.00 . A A .  90 ARG N    1 1 
        2  3271 1 1  93 ARG NE   N  -0.756 -25.765  12.734 1.00 . A A .  90 ARG NE   1 1 
        2  3272 1 1  93 ARG NH1  N   1.006 -27.109  11.988 1.00 . A A .  90 ARG NH1  1 1 
        2  3273 1 1  93 ARG NH2  N  -0.493 -27.905  13.529 1.00 . A A .  90 ARG NH2  1 1 
        2  3274 1 1  93 ARG O    O  -0.188 -25.206   6.994 1.00 . A A .  90 ARG O    1 1 
        2  3275 1 1  94 ARG C    C  -2.244 -26.935   5.551 1.00 . A A .  91 ARG C    1 1 
        2  3276 1 1  94 ARG CA   C  -2.365 -27.000   7.092 1.00 . A A .  91 ARG CA   1 1 
        2  3277 1 1  94 ARG CB   C  -3.699 -27.695   7.476 1.00 . A A .  91 ARG CB   1 1 
        2  3278 1 1  94 ARG CD   C  -5.230 -29.711   6.962 1.00 . A A .  91 ARG CD   1 1 
        2  3279 1 1  94 ARG CG   C  -3.791 -29.177   7.051 1.00 . A A .  91 ARG CG   1 1 
        2  3280 1 1  94 ARG CZ   C  -7.238 -30.079   8.394 1.00 . A A .  91 ARG CZ   1 1 
        2  3281 1 1  94 ARG H    H  -3.087 -25.298   8.146 1.00 . A A .  91 ARG H    1 1 
        2  3282 1 1  94 ARG HA   H  -1.533 -27.574   7.495 1.00 . A A .  91 ARG HA   1 1 
        2  3283 1 1  94 ARG HB2  H  -3.822 -27.640   8.553 1.00 . A A .  91 ARG HB2  1 1 
        2  3284 1 1  94 ARG HB3  H  -4.515 -27.149   7.011 1.00 . A A .  91 ARG HB3  1 1 
        2  3285 1 1  94 ARG HD2  H  -5.767 -29.143   6.207 1.00 . A A .  91 ARG HD2  1 1 
        2  3286 1 1  94 ARG HD3  H  -5.189 -30.750   6.650 1.00 . A A .  91 ARG HD3  1 1 
        2  3287 1 1  94 ARG HE   H  -5.526 -29.214   8.991 1.00 . A A .  91 ARG HE   1 1 
        2  3288 1 1  94 ARG HG2  H  -3.331 -29.288   6.076 1.00 . A A .  91 ARG HG2  1 1 
        2  3289 1 1  94 ARG HG3  H  -3.239 -29.779   7.767 1.00 . A A .  91 ARG HG3  1 1 
        2  3290 1 1  94 ARG HH11 H  -7.436 -30.832   6.517 1.00 . A A .  91 ARG HH11 1 1 
        2  3291 1 1  94 ARG HH12 H  -8.818 -31.025   7.546 1.00 . A A .  91 ARG HH12 1 1 
        2  3292 1 1  94 ARG HH21 H  -7.368 -29.502  10.329 1.00 . A A .  91 ARG HH21 1 1 
        2  3293 1 1  94 ARG HH22 H  -8.786 -30.268   9.684 1.00 . A A .  91 ARG HH22 1 1 
        2  3294 1 1  94 ARG N    N  -2.304 -25.642   7.670 1.00 . A A .  91 ARG N    1 1 
        2  3295 1 1  94 ARG NE   N  -5.981 -29.630   8.227 1.00 . A A .  91 ARG NE   1 1 
        2  3296 1 1  94 ARG NH1  N  -7.881 -30.694   7.404 1.00 . A A .  91 ARG NH1  1 1 
        2  3297 1 1  94 ARG NH2  N  -7.843 -29.939   9.562 1.00 . A A .  91 ARG NH2  1 1 
        2  3298 1 1  94 ARG O    O  -1.544 -27.746   4.932 1.00 . A A .  91 ARG O    1 1 
        2  3299 1 1  95 PHE C    C  -1.725 -24.903   3.076 1.00 . A A .  92 PHE C    1 1 
        2  3300 1 1  95 PHE CA   C  -2.958 -25.728   3.508 1.00 . A A .  92 PHE CA   1 1 
        2  3301 1 1  95 PHE CB   C  -4.280 -25.017   3.113 1.00 . A A .  92 PHE CB   1 1 
        2  3302 1 1  95 PHE CD1  C  -5.943 -26.892   2.660 1.00 . A A .  92 PHE CD1  1 1 
        2  3303 1 1  95 PHE CD2  C  -6.290 -25.541   4.594 1.00 . A A .  92 PHE CD2  1 1 
        2  3304 1 1  95 PHE CE1  C  -7.060 -27.640   2.989 1.00 . A A .  92 PHE CE1  1 1 
        2  3305 1 1  95 PHE CE2  C  -7.408 -26.288   4.922 1.00 . A A .  92 PHE CE2  1 1 
        2  3306 1 1  95 PHE CG   C  -5.536 -25.827   3.458 1.00 . A A .  92 PHE CG   1 1 
        2  3307 1 1  95 PHE CZ   C  -7.790 -27.339   4.121 1.00 . A A .  92 PHE CZ   1 1 
        2  3308 1 1  95 PHE H    H  -3.479 -25.359   5.518 1.00 . A A .  92 PHE H    1 1 
        2  3309 1 1  95 PHE HA   H  -2.919 -26.696   3.014 1.00 . A A .  92 PHE HA   1 1 
        2  3310 1 1  95 PHE HB2  H  -4.339 -24.065   3.630 1.00 . A A .  92 PHE HB2  1 1 
        2  3311 1 1  95 PHE HB3  H  -4.285 -24.833   2.050 1.00 . A A .  92 PHE HB3  1 1 
        2  3312 1 1  95 PHE HD1  H  -5.380 -27.136   1.770 1.00 . A A .  92 PHE HD1  1 1 
        2  3313 1 1  95 PHE HD2  H  -5.996 -24.718   5.230 1.00 . A A .  92 PHE HD2  1 1 
        2  3314 1 1  95 PHE HE1  H  -7.362 -28.466   2.355 1.00 . A A .  92 PHE HE1  1 1 
        2  3315 1 1  95 PHE HE2  H  -7.979 -26.049   5.812 1.00 . A A .  92 PHE HE2  1 1 
        2  3316 1 1  95 PHE HZ   H  -8.661 -27.931   4.376 1.00 . A A .  92 PHE HZ   1 1 
        2  3317 1 1  95 PHE N    N  -2.945 -25.956   4.958 1.00 . A A .  92 PHE N    1 1 
        2  3318 1 1  95 PHE O    O  -1.078 -25.213   2.064 1.00 . A A .  92 PHE O    1 1 
        2  3319 1 1  96 ASP C    C   0.488 -22.638   4.876 1.00 . A A .  93 ASP C    1 1 
        2  3320 1 1  96 ASP CA   C  -0.297 -22.926   3.582 1.00 . A A .  93 ASP CA   1 1 
        2  3321 1 1  96 ASP CB   C  -0.851 -21.596   2.985 1.00 . A A .  93 ASP CB   1 1 
        2  3322 1 1  96 ASP CG   C  -1.713 -21.781   1.721 1.00 . A A .  93 ASP CG   1 1 
        2  3323 1 1  96 ASP H    H  -1.911 -23.732   4.692 1.00 . A A .  93 ASP H    1 1 
        2  3324 1 1  96 ASP HA   H   0.377 -23.385   2.860 1.00 . A A .  93 ASP HA   1 1 
        2  3325 1 1  96 ASP HB2  H  -1.452 -21.100   3.740 1.00 . A A .  93 ASP HB2  1 1 
        2  3326 1 1  96 ASP HB3  H  -0.014 -20.947   2.739 1.00 . A A .  93 ASP HB3  1 1 
        2  3327 1 1  96 ASP N    N  -1.395 -23.869   3.873 1.00 . A A .  93 ASP N    1 1 
        2  3328 1 1  96 ASP O    O   0.164 -21.703   5.606 1.00 . A A .  93 ASP O    1 1 
        2  3329 1 1  96 ASP OD1  O  -1.150 -21.973   0.619 1.00 . A A .  93 ASP OD1  1 1 
        2  3330 1 1  96 ASP OD2  O  -2.964 -21.726   1.819 1.00 . A A .  93 ASP OD2  1 1 
        2  3331 1 1  97 SER C    C   3.313 -22.151   6.309 1.00 . A A .  94 SER C    1 1 
        2  3332 1 1  97 SER CA   C   2.352 -23.353   6.382 1.00 . A A .  94 SER CA   1 1 
        2  3333 1 1  97 SER CB   C   3.139 -24.666   6.588 1.00 . A A .  94 SER CB   1 1 
        2  3334 1 1  97 SER H    H   1.696 -24.201   4.537 1.00 . A A .  94 SER H    1 1 
        2  3335 1 1  97 SER HA   H   1.690 -23.204   7.235 1.00 . A A .  94 SER HA   1 1 
        2  3336 1 1  97 SER HB2  H   2.443 -25.484   6.713 1.00 . A A .  94 SER HB2  1 1 
        2  3337 1 1  97 SER HB3  H   3.756 -24.859   5.719 1.00 . A A .  94 SER HB3  1 1 
        2  3338 1 1  97 SER HG   H   4.844 -24.274   7.477 1.00 . A A .  94 SER HG   1 1 
        2  3339 1 1  97 SER N    N   1.507 -23.471   5.163 1.00 . A A .  94 SER N    1 1 
        2  3340 1 1  97 SER O    O   3.921 -21.752   7.318 1.00 . A A .  94 SER O    1 1 
        2  3341 1 1  97 SER OG   O   3.979 -24.616   7.736 1.00 . A A .  94 SER OG   1 1 
        2  3342 1 1  98 ASP C    C   3.521 -19.073   5.297 1.00 . A A .  95 ASP C    1 1 
        2  3343 1 1  98 ASP CA   C   4.226 -20.374   4.845 1.00 . A A .  95 ASP CA   1 1 
        2  3344 1 1  98 ASP CB   C   4.541 -20.321   3.334 1.00 . A A .  95 ASP CB   1 1 
        2  3345 1 1  98 ASP CG   C   3.270 -20.299   2.467 1.00 . A A .  95 ASP CG   1 1 
        2  3346 1 1  98 ASP H    H   2.922 -21.968   4.369 1.00 . A A .  95 ASP H    1 1 
        2  3347 1 1  98 ASP HA   H   5.160 -20.460   5.392 1.00 . A A .  95 ASP HA   1 1 
        2  3348 1 1  98 ASP HB2  H   5.130 -19.436   3.121 1.00 . A A .  95 ASP HB2  1 1 
        2  3349 1 1  98 ASP HB3  H   5.128 -21.193   3.064 1.00 . A A .  95 ASP HB3  1 1 
        2  3350 1 1  98 ASP N    N   3.417 -21.570   5.117 1.00 . A A .  95 ASP N    1 1 
        2  3351 1 1  98 ASP O    O   3.986 -17.971   4.963 1.00 . A A .  95 ASP O    1 1 
        2  3352 1 1  98 ASP OD1  O   2.716 -21.380   2.188 1.00 . A A .  95 ASP OD1  1 1 
        2  3353 1 1  98 ASP OD2  O   2.823 -19.209   2.063 1.00 . A A .  95 ASP OD2  1 1 
        2  3354 1 1  99 LEU C    C   2.527 -17.451   7.795 1.00 . A A .  96 LEU C    1 1 
        2  3355 1 1  99 LEU CA   C   1.712 -18.050   6.633 1.00 . A A .  96 LEU CA   1 1 
        2  3356 1 1  99 LEU CB   C   0.261 -18.392   7.103 1.00 . A A .  96 LEU CB   1 1 
        2  3357 1 1  99 LEU CD1  C  -1.369 -19.225   8.905 1.00 . A A .  96 LEU CD1  1 1 
        2  3358 1 1  99 LEU CD2  C   0.740 -20.523   8.427 1.00 . A A .  96 LEU CD2  1 1 
        2  3359 1 1  99 LEU CG   C   0.106 -19.141   8.462 1.00 . A A .  96 LEU CG   1 1 
        2  3360 1 1  99 LEU H    H   2.057 -20.096   6.235 1.00 . A A .  96 LEU H    1 1 
        2  3361 1 1  99 LEU HA   H   1.643 -17.302   5.846 1.00 . A A .  96 LEU HA   1 1 
        2  3362 1 1  99 LEU HB2  H  -0.291 -17.457   7.177 1.00 . A A .  96 LEU HB2  1 1 
        2  3363 1 1  99 LEU HB3  H  -0.213 -18.991   6.329 1.00 . A A .  96 LEU HB3  1 1 
        2  3364 1 1  99 LEU HD11 H  -1.776 -18.224   8.983 1.00 . A A .  96 LEU HD11 1 1 
        2  3365 1 1  99 LEU HD12 H  -1.431 -19.706   9.872 1.00 . A A .  96 LEU HD12 1 1 
        2  3366 1 1  99 LEU HD13 H  -1.945 -19.790   8.182 1.00 . A A .  96 LEU HD13 1 1 
        2  3367 1 1  99 LEU HD21 H   1.788 -20.435   8.177 1.00 . A A .  96 LEU HD21 1 1 
        2  3368 1 1  99 LEU HD22 H   0.246 -21.144   7.691 1.00 . A A .  96 LEU HD22 1 1 
        2  3369 1 1  99 LEU HD23 H   0.648 -20.984   9.401 1.00 . A A .  96 LEU HD23 1 1 
        2  3370 1 1  99 LEU HG   H   0.633 -18.580   9.215 1.00 . A A .  96 LEU HG   1 1 
        2  3371 1 1  99 LEU N    N   2.411 -19.203   6.060 1.00 . A A .  96 LEU N    1 1 
        2  3372 1 1  99 LEU O    O   3.219 -18.176   8.531 1.00 . A A .  96 LEU O    1 1 
        2  3373 1 1 100 TRP C    C   1.978 -14.990  10.016 1.00 . A A .  97 TRP C    1 1 
        2  3374 1 1 100 TRP CA   C   3.078 -15.398   9.042 1.00 . A A .  97 TRP CA   1 1 
        2  3375 1 1 100 TRP CB   C   3.806 -14.134   8.526 1.00 . A A .  97 TRP CB   1 1 
        2  3376 1 1 100 TRP CD1  C   4.901 -15.100   6.394 1.00 . A A .  97 TRP CD1  1 1 
        2  3377 1 1 100 TRP CD2  C   6.265 -13.865   7.650 1.00 . A A .  97 TRP CD2  1 1 
        2  3378 1 1 100 TRP CE2  C   6.977 -14.322   6.537 1.00 . A A .  97 TRP CE2  1 1 
        2  3379 1 1 100 TRP CE3  C   6.911 -13.059   8.584 1.00 . A A .  97 TRP CE3  1 1 
        2  3380 1 1 100 TRP CG   C   4.940 -14.387   7.555 1.00 . A A .  97 TRP CG   1 1 
        2  3381 1 1 100 TRP CH2  C   8.925 -13.213   7.257 1.00 . A A .  97 TRP CH2  1 1 
        2  3382 1 1 100 TRP CZ2  C   8.314 -14.009   6.325 1.00 . A A .  97 TRP CZ2  1 1 
        2  3383 1 1 100 TRP CZ3  C   8.234 -12.736   8.378 1.00 . A A .  97 TRP CZ3  1 1 
        2  3384 1 1 100 TRP H    H   1.981 -15.611   7.248 1.00 . A A .  97 TRP H    1 1 
        2  3385 1 1 100 TRP HA   H   3.793 -16.045   9.549 1.00 . A A .  97 TRP HA   1 1 
        2  3386 1 1 100 TRP HB2  H   3.093 -13.498   8.022 1.00 . A A .  97 TRP HB2  1 1 
        2  3387 1 1 100 TRP HB3  H   4.210 -13.589   9.377 1.00 . A A .  97 TRP HB3  1 1 
        2  3388 1 1 100 TRP HD1  H   4.024 -15.623   6.029 1.00 . A A .  97 TRP HD1  1 1 
        2  3389 1 1 100 TRP HE1  H   6.345 -15.534   4.954 1.00 . A A .  97 TRP HE1  1 1 
        2  3390 1 1 100 TRP HE3  H   6.383 -12.688   9.455 1.00 . A A .  97 TRP HE3  1 1 
        2  3391 1 1 100 TRP HH2  H   9.967 -12.937   7.136 1.00 . A A .  97 TRP HH2  1 1 
        2  3392 1 1 100 TRP HZ2  H   8.857 -14.368   5.464 1.00 . A A .  97 TRP HZ2  1 1 
        2  3393 1 1 100 TRP HZ3  H   8.754 -12.112   9.096 1.00 . A A .  97 TRP HZ3  1 1 
        2  3394 1 1 100 TRP N    N   2.461 -16.125   7.928 1.00 . A A .  97 TRP N    1 1 
        2  3395 1 1 100 TRP NE1  N   6.123 -15.081   5.792 1.00 . A A .  97 TRP NE1  1 1 
        2  3396 1 1 100 TRP O    O   1.022 -14.321   9.617 1.00 . A A .  97 TRP O    1 1 
        2  3397 1 1 101 VAL C    C   1.696 -13.814  13.115 1.00 . A A .  98 VAL C    1 1 
        2  3398 1 1 101 VAL CA   C   1.144 -14.999  12.329 1.00 . A A .  98 VAL CA   1 1 
        2  3399 1 1 101 VAL CB   C   0.791 -16.201  13.282 1.00 . A A .  98 VAL CB   1 1 
        2  3400 1 1 101 VAL CG1  C  -0.201 -15.771  14.399 1.00 . A A .  98 VAL CG1  1 1 
        2  3401 1 1 101 VAL CG2  C   0.226 -17.395  12.465 1.00 . A A .  98 VAL CG2  1 1 
        2  3402 1 1 101 VAL H    H   2.940 -15.834  11.551 1.00 . A A .  98 VAL H    1 1 
        2  3403 1 1 101 VAL HA   H   0.226 -14.688  11.832 1.00 . A A .  98 VAL HA   1 1 
        2  3404 1 1 101 VAL HB   H   1.711 -16.530  13.761 1.00 . A A .  98 VAL HB   1 1 
        2  3405 1 1 101 VAL HG11 H  -0.424 -16.616  15.040 1.00 . A A .  98 VAL HG11 1 1 
        2  3406 1 1 101 VAL HG12 H  -1.119 -15.411  13.954 1.00 . A A .  98 VAL HG12 1 1 
        2  3407 1 1 101 VAL HG13 H   0.237 -14.979  14.996 1.00 . A A .  98 VAL HG13 1 1 
        2  3408 1 1 101 VAL HG21 H  -0.682 -17.095  11.956 1.00 . A A .  98 VAL HG21 1 1 
        2  3409 1 1 101 VAL HG22 H   0.006 -18.224  13.126 1.00 . A A .  98 VAL HG22 1 1 
        2  3410 1 1 101 VAL HG23 H   0.957 -17.716  11.729 1.00 . A A .  98 VAL HG23 1 1 
        2  3411 1 1 101 VAL N    N   2.126 -15.355  11.295 1.00 . A A .  98 VAL N    1 1 
        2  3412 1 1 101 VAL O    O   2.728 -13.929  13.771 1.00 . A A .  98 VAL O    1 1 
        2  3413 1 1 102 VAL C    C   0.349 -10.979  14.647 1.00 . A A .  99 VAL C    1 1 
        2  3414 1 1 102 VAL CA   C   1.425 -11.400  13.642 1.00 . A A .  99 VAL CA   1 1 
        2  3415 1 1 102 VAL CB   C   1.619 -10.239  12.575 1.00 . A A .  99 VAL CB   1 1 
        2  3416 1 1 102 VAL CG1  C   2.467  -9.064  13.135 1.00 . A A .  99 VAL CG1  1 1 
        2  3417 1 1 102 VAL CG2  C   2.203 -10.784  11.251 1.00 . A A .  99 VAL CG2  1 1 
        2  3418 1 1 102 VAL H    H   0.167 -12.684  12.488 1.00 . A A .  99 VAL H    1 1 
        2  3419 1 1 102 VAL HA   H   2.367 -11.559  14.163 1.00 . A A .  99 VAL HA   1 1 
        2  3420 1 1 102 VAL HB   H   0.639  -9.828  12.355 1.00 . A A .  99 VAL HB   1 1 
        2  3421 1 1 102 VAL HG11 H   3.455  -9.420  13.400 1.00 . A A .  99 VAL HG11 1 1 
        2  3422 1 1 102 VAL HG12 H   1.990  -8.652  14.015 1.00 . A A .  99 VAL HG12 1 1 
        2  3423 1 1 102 VAL HG13 H   2.562  -8.283  12.384 1.00 . A A .  99 VAL HG13 1 1 
        2  3424 1 1 102 VAL HG21 H   1.556 -11.559  10.858 1.00 . A A .  99 VAL HG21 1 1 
        2  3425 1 1 102 VAL HG22 H   3.186 -11.200  11.431 1.00 . A A .  99 VAL HG22 1 1 
        2  3426 1 1 102 VAL HG23 H   2.283  -9.983  10.525 1.00 . A A .  99 VAL HG23 1 1 
        2  3427 1 1 102 VAL N    N   1.003 -12.669  13.009 1.00 . A A .  99 VAL N    1 1 
        2  3428 1 1 102 VAL O    O  -0.775 -10.670  14.244 1.00 . A A .  99 VAL O    1 1 
        2  3429 1 1 103 GLU C    C  -0.060  -9.008  17.219 1.00 . A A . 100 GLU C    1 1 
        2  3430 1 1 103 GLU CA   C  -0.259 -10.512  16.976 1.00 . A A . 100 GLU CA   1 1 
        2  3431 1 1 103 GLU CB   C  -0.137 -11.349  18.284 1.00 . A A . 100 GLU CB   1 1 
        2  3432 1 1 103 GLU CD   C   1.264 -12.186  20.239 1.00 . A A . 100 GLU CD   1 1 
        2  3433 1 1 103 GLU CG   C   1.274 -11.467  18.884 1.00 . A A . 100 GLU CG   1 1 
        2  3434 1 1 103 GLU H    H   1.564 -11.287  16.209 1.00 . A A . 100 GLU H    1 1 
        2  3435 1 1 103 GLU HA   H  -1.272 -10.657  16.588 1.00 . A A . 100 GLU HA   1 1 
        2  3436 1 1 103 GLU HB2  H  -0.785 -10.911  19.037 1.00 . A A . 100 GLU HB2  1 1 
        2  3437 1 1 103 GLU HB3  H  -0.498 -12.357  18.081 1.00 . A A . 100 GLU HB3  1 1 
        2  3438 1 1 103 GLU HG2  H   1.905 -12.020  18.194 1.00 . A A . 100 GLU HG2  1 1 
        2  3439 1 1 103 GLU HG3  H   1.687 -10.473  19.013 1.00 . A A . 100 GLU HG3  1 1 
        2  3440 1 1 103 GLU N    N   0.675 -10.979  15.943 1.00 . A A . 100 GLU N    1 1 
        2  3441 1 1 103 GLU O    O   0.963  -8.573  17.753 1.00 . A A . 100 GLU O    1 1 
        2  3442 1 1 103 GLU OE1  O   1.154 -13.432  20.261 1.00 . A A . 100 GLU OE1  1 1 
        2  3443 1 1 103 GLU OE2  O   1.331 -11.515  21.293 1.00 . A A . 100 GLU OE2  1 1 
        2  3444 1 1 104 ILE C    C  -2.132  -6.452  18.039 1.00 . A A . 101 ILE C    1 1 
        2  3445 1 1 104 ILE CA   C  -1.080  -6.765  16.959 1.00 . A A . 101 ILE CA   1 1 
        2  3446 1 1 104 ILE CB   C  -1.395  -5.994  15.607 1.00 . A A . 101 ILE CB   1 1 
        2  3447 1 1 104 ILE CD1  C  -3.242  -5.499  13.858 1.00 . A A . 101 ILE CD1  1 1 
        2  3448 1 1 104 ILE CG1  C  -2.808  -6.341  15.045 1.00 . A A . 101 ILE CG1  1 1 
        2  3449 1 1 104 ILE CG2  C  -0.310  -6.294  14.534 1.00 . A A . 101 ILE CG2  1 1 
        2  3450 1 1 104 ILE H    H  -1.776  -8.638  16.265 1.00 . A A . 101 ILE H    1 1 
        2  3451 1 1 104 ILE HA   H  -0.106  -6.434  17.322 1.00 . A A . 101 ILE HA   1 1 
        2  3452 1 1 104 ILE HB   H  -1.357  -4.927  15.817 1.00 . A A . 101 ILE HB   1 1 
        2  3453 1 1 104 ILE HD11 H  -2.558  -5.652  13.037 1.00 . A A . 101 ILE HD11 1 1 
        2  3454 1 1 104 ILE HD12 H  -3.244  -4.454  14.138 1.00 . A A . 101 ILE HD12 1 1 
        2  3455 1 1 104 ILE HD13 H  -4.238  -5.791  13.559 1.00 . A A . 101 ILE HD13 1 1 
        2  3456 1 1 104 ILE HG12 H  -2.824  -7.376  14.732 1.00 . A A . 101 ILE HG12 1 1 
        2  3457 1 1 104 ILE HG13 H  -3.545  -6.208  15.823 1.00 . A A . 101 ILE HG13 1 1 
        2  3458 1 1 104 ILE HG21 H  -0.300  -7.353  14.304 1.00 . A A . 101 ILE HG21 1 1 
        2  3459 1 1 104 ILE HG22 H   0.662  -6.004  14.905 1.00 . A A . 101 ILE HG22 1 1 
        2  3460 1 1 104 ILE HG23 H  -0.520  -5.735  13.629 1.00 . A A . 101 ILE HG23 1 1 
        2  3461 1 1 104 ILE N    N  -1.039  -8.218  16.757 1.00 . A A . 101 ILE N    1 1 
        2  3462 1 1 104 ILE O    O  -3.187  -7.069  18.059 1.00 . A A . 101 ILE O    1 1 
        2  3463 1 1 105 GLU C    C  -3.207  -3.661  19.636 1.00 . A A . 102 GLU C    1 1 
        2  3464 1 1 105 GLU CA   C  -2.793  -5.092  19.983 1.00 . A A . 102 GLU CA   1 1 
        2  3465 1 1 105 GLU CB   C  -2.230  -5.158  21.424 1.00 . A A . 102 GLU CB   1 1 
        2  3466 1 1 105 GLU CD   C  -2.712  -4.743  23.932 1.00 . A A . 102 GLU CD   1 1 
        2  3467 1 1 105 GLU CG   C  -3.271  -4.779  22.503 1.00 . A A . 102 GLU CG   1 1 
        2  3468 1 1 105 GLU H    H  -0.911  -5.206  19.017 1.00 . A A . 102 GLU H    1 1 
        2  3469 1 1 105 GLU HA   H  -3.676  -5.735  19.929 1.00 . A A . 102 GLU HA   1 1 
        2  3470 1 1 105 GLU HB2  H  -1.890  -6.173  21.615 1.00 . A A . 102 GLU HB2  1 1 
        2  3471 1 1 105 GLU HB3  H  -1.379  -4.487  21.506 1.00 . A A . 102 GLU HB3  1 1 
        2  3472 1 1 105 GLU HG2  H  -3.680  -3.801  22.264 1.00 . A A . 102 GLU HG2  1 1 
        2  3473 1 1 105 GLU HG3  H  -4.080  -5.504  22.465 1.00 . A A . 102 GLU HG3  1 1 
        2  3474 1 1 105 GLU N    N  -1.817  -5.560  18.987 1.00 . A A . 102 GLU N    1 1 
        2  3475 1 1 105 GLU O    O  -2.366  -2.753  19.615 1.00 . A A . 102 GLU O    1 1 
        2  3476 1 1 105 GLU OE1  O  -2.600  -5.810  24.571 1.00 . A A . 102 GLU OE1  1 1 
        2  3477 1 1 105 GLU OE2  O  -2.373  -3.643  24.426 1.00 . A A . 102 GLU OE2  1 1 
        2  3478 1 1 106 THR C    C  -6.638  -2.330  19.012 1.00 . A A . 103 THR C    1 1 
        2  3479 1 1 106 THR CA   C  -5.103  -2.196  19.017 1.00 . A A . 103 THR CA   1 1 
        2  3480 1 1 106 THR CB   C  -4.585  -1.633  17.640 1.00 . A A . 103 THR CB   1 1 
        2  3481 1 1 106 THR CG2  C  -4.805  -2.630  16.489 1.00 . A A . 103 THR CG2  1 1 
        2  3482 1 1 106 THR H    H  -5.084  -4.280  19.372 1.00 . A A . 103 THR H    1 1 
        2  3483 1 1 106 THR HA   H  -4.824  -1.495  19.801 1.00 . A A . 103 THR HA   1 1 
        2  3484 1 1 106 THR HB   H  -3.516  -1.451  17.731 1.00 . A A . 103 THR HB   1 1 
        2  3485 1 1 106 THR HG1  H  -5.448  -0.346  16.401 1.00 . A A . 103 THR HG1  1 1 
        2  3486 1 1 106 THR HG21 H  -5.866  -2.805  16.355 1.00 . A A . 103 THR HG21 1 1 
        2  3487 1 1 106 THR HG22 H  -4.316  -3.568  16.717 1.00 . A A . 103 THR HG22 1 1 
        2  3488 1 1 106 THR HG23 H  -4.391  -2.227  15.575 1.00 . A A . 103 THR HG23 1 1 
        2  3489 1 1 106 THR N    N  -4.500  -3.490  19.352 1.00 . A A . 103 THR N    1 1 
        2  3490 1 1 106 THR O    O  -7.175  -3.441  19.011 1.00 . A A . 103 THR O    1 1 
        2  3491 1 1 106 THR OG1  O  -5.223  -0.377  17.337 1.00 . A A . 103 THR OG1  1 1 
        2  3492 1 1 107 ASP C    C  -9.275  -0.876  17.554 1.00 . A A . 104 ASP C    1 1 
        2  3493 1 1 107 ASP CA   C  -8.805  -1.115  19.004 1.00 . A A . 104 ASP CA   1 1 
        2  3494 1 1 107 ASP CB   C  -9.308   0.019  19.945 1.00 . A A . 104 ASP CB   1 1 
        2  3495 1 1 107 ASP CG   C  -8.931   1.450  19.484 1.00 . A A . 104 ASP CG   1 1 
        2  3496 1 1 107 ASP H    H  -6.830  -0.344  19.111 1.00 . A A . 104 ASP H    1 1 
        2  3497 1 1 107 ASP HA   H  -9.204  -2.065  19.354 1.00 . A A . 104 ASP HA   1 1 
        2  3498 1 1 107 ASP HB2  H -10.387  -0.049  20.026 1.00 . A A . 104 ASP HB2  1 1 
        2  3499 1 1 107 ASP HB3  H  -8.888  -0.136  20.934 1.00 . A A . 104 ASP HB3  1 1 
        2  3500 1 1 107 ASP N    N  -7.330  -1.187  19.051 1.00 . A A . 104 ASP N    1 1 
        2  3501 1 1 107 ASP O    O -10.280  -1.442  17.105 1.00 . A A . 104 ASP O    1 1 
        2  3502 1 1 107 ASP OD1  O  -7.720   1.748  19.350 1.00 . A A . 104 ASP OD1  1 1 
        2  3503 1 1 107 ASP OD2  O  -9.837   2.276  19.246 1.00 . A A . 104 ASP OD2  1 1 
        2  3504 1 1 108 GLU C    C  -7.880  -0.434  14.483 1.00 . A A . 105 GLU C    1 1 
        2  3505 1 1 108 GLU CA   C  -8.784   0.361  15.443 1.00 . A A . 105 GLU CA   1 1 
        2  3506 1 1 108 GLU CB   C  -8.566   1.895  15.287 1.00 . A A . 105 GLU CB   1 1 
        2  3507 1 1 108 GLU CD   C  -7.004   3.919  15.675 1.00 . A A . 105 GLU CD   1 1 
        2  3508 1 1 108 GLU CG   C  -7.175   2.393  15.738 1.00 . A A . 105 GLU CG   1 1 
        2  3509 1 1 108 GLU H    H  -7.705   0.320  17.265 1.00 . A A . 105 GLU H    1 1 
        2  3510 1 1 108 GLU HA   H  -9.825   0.132  15.220 1.00 . A A . 105 GLU HA   1 1 
        2  3511 1 1 108 GLU HB2  H  -8.702   2.169  14.245 1.00 . A A . 105 GLU HB2  1 1 
        2  3512 1 1 108 GLU HB3  H  -9.317   2.414  15.871 1.00 . A A . 105 GLU HB3  1 1 
        2  3513 1 1 108 GLU HG2  H  -7.013   2.063  16.759 1.00 . A A . 105 GLU HG2  1 1 
        2  3514 1 1 108 GLU HG3  H  -6.426   1.937  15.101 1.00 . A A . 105 GLU HG3  1 1 
        2  3515 1 1 108 GLU N    N  -8.507  -0.041  16.834 1.00 . A A . 105 GLU N    1 1 
        2  3516 1 1 108 GLU O    O  -6.692  -0.619  14.754 1.00 . A A . 105 GLU O    1 1 
        2  3517 1 1 108 GLU OE1  O  -7.394   4.534  14.655 1.00 . A A . 105 GLU OE1  1 1 
        2  3518 1 1 108 GLU OE2  O  -6.453   4.511  16.625 1.00 . A A . 105 GLU OE2  1 1 
        2  3519 1 1 109 ILE C    C  -7.411  -0.938  11.107 1.00 . A A . 106 ILE C    1 1 
        2  3520 1 1 109 ILE CA   C  -7.715  -1.738  12.390 1.00 . A A . 106 ILE CA   1 1 
        2  3521 1 1 109 ILE CB   C  -8.487  -3.066  12.037 1.00 . A A . 106 ILE CB   1 1 
        2  3522 1 1 109 ILE CD1  C  -6.295  -4.440  11.767 1.00 . A A . 106 ILE CD1  1 1 
        2  3523 1 1 109 ILE CG1  C  -7.608  -3.995  11.139 1.00 . A A . 106 ILE CG1  1 1 
        2  3524 1 1 109 ILE CG2  C  -9.871  -2.791  11.395 1.00 . A A . 106 ILE CG2  1 1 
        2  3525 1 1 109 ILE H    H  -9.402  -0.737  13.216 1.00 . A A . 106 ILE H    1 1 
        2  3526 1 1 109 ILE HA   H  -6.763  -2.022  12.840 1.00 . A A . 106 ILE HA   1 1 
        2  3527 1 1 109 ILE HB   H  -8.675  -3.584  12.972 1.00 . A A . 106 ILE HB   1 1 
        2  3528 1 1 109 ILE HD11 H  -5.665  -3.583  11.943 1.00 . A A . 106 ILE HD11 1 1 
        2  3529 1 1 109 ILE HD12 H  -5.794  -5.119  11.095 1.00 . A A . 106 ILE HD12 1 1 
        2  3530 1 1 109 ILE HD13 H  -6.489  -4.946  12.705 1.00 . A A . 106 ILE HD13 1 1 
        2  3531 1 1 109 ILE HG12 H  -8.161  -4.892  10.900 1.00 . A A . 106 ILE HG12 1 1 
        2  3532 1 1 109 ILE HG13 H  -7.369  -3.480  10.218 1.00 . A A . 106 ILE HG13 1 1 
        2  3533 1 1 109 ILE HG21 H  -9.742  -2.243  10.471 1.00 . A A . 106 ILE HG21 1 1 
        2  3534 1 1 109 ILE HG22 H -10.478  -2.202  12.073 1.00 . A A . 106 ILE HG22 1 1 
        2  3535 1 1 109 ILE HG23 H -10.379  -3.727  11.189 1.00 . A A . 106 ILE HG23 1 1 
        2  3536 1 1 109 ILE N    N  -8.454  -0.922  13.373 1.00 . A A . 106 ILE N    1 1 
        2  3537 1 1 109 ILE O    O  -6.315  -1.054  10.545 1.00 . A A . 106 ILE O    1 1 
        2  3538 1 1 110 GLY C    C  -7.126   1.458   9.147 1.00 . A A . 107 GLY C    1 1 
        2  3539 1 1 110 GLY CA   C  -8.342   0.564   9.381 1.00 . A A . 107 GLY CA   1 1 
        2  3540 1 1 110 GLY H    H  -9.096   0.135  11.322 1.00 . A A . 107 GLY H    1 1 
        2  3541 1 1 110 GLY HA2  H  -8.365  -0.209   8.618 1.00 . A A . 107 GLY HA2  1 1 
        2  3542 1 1 110 GLY HA3  H  -9.235   1.164   9.283 1.00 . A A . 107 GLY HA3  1 1 
        2  3543 1 1 110 GLY N    N  -8.367  -0.078  10.701 1.00 . A A . 107 GLY N    1 1 
        2  3544 1 1 110 GLY O    O  -6.633   1.569   8.027 1.00 . A A . 107 GLY O    1 1 
        2  3545 1 1 111 THR C    C  -4.132   2.324  10.007 1.00 . A A . 108 THR C    1 1 
        2  3546 1 1 111 THR CA   C  -5.503   3.022  10.163 1.00 . A A . 108 THR CA   1 1 
        2  3547 1 1 111 THR CB   C  -5.502   3.927  11.434 1.00 . A A . 108 THR CB   1 1 
        2  3548 1 1 111 THR CG2  C  -5.063   3.169  12.702 1.00 . A A . 108 THR CG2  1 1 
        2  3549 1 1 111 THR H    H  -7.011   1.863  11.103 1.00 . A A . 108 THR H    1 1 
        2  3550 1 1 111 THR HA   H  -5.663   3.663   9.303 1.00 . A A . 108 THR HA   1 1 
        2  3551 1 1 111 THR HB   H  -6.509   4.299  11.591 1.00 . A A . 108 THR HB   1 1 
        2  3552 1 1 111 THR HG1  H  -5.137   5.863  11.335 1.00 . A A . 108 THR HG1  1 1 
        2  3553 1 1 111 THR HG21 H  -5.112   3.832  13.556 1.00 . A A . 108 THR HG21 1 1 
        2  3554 1 1 111 THR HG22 H  -4.046   2.816  12.586 1.00 . A A . 108 THR HG22 1 1 
        2  3555 1 1 111 THR HG23 H  -5.716   2.321  12.870 1.00 . A A . 108 THR HG23 1 1 
        2  3556 1 1 111 THR N    N  -6.620   2.064  10.227 1.00 . A A . 108 THR N    1 1 
        2  3557 1 1 111 THR O    O  -3.167   2.938   9.539 1.00 . A A . 108 THR O    1 1 
        2  3558 1 1 111 THR OG1  O  -4.633   5.047  11.237 1.00 . A A . 108 THR OG1  1 1 
        2  3559 1 1 112 LEU C    C  -2.811  -1.051   9.724 1.00 . A A . 109 LEU C    1 1 
        2  3560 1 1 112 LEU CA   C  -2.791   0.285  10.504 1.00 . A A . 109 LEU CA   1 1 
        2  3561 1 1 112 LEU CB   C  -2.453   0.098  12.018 1.00 . A A . 109 LEU CB   1 1 
        2  3562 1 1 112 LEU CD1  C  -3.924  -1.846  12.890 1.00 . A A . 109 LEU CD1  1 1 
        2  3563 1 1 112 LEU CD2  C  -3.404   0.124  14.416 1.00 . A A . 109 LEU CD2  1 1 
        2  3564 1 1 112 LEU CG   C  -3.639  -0.335  12.958 1.00 . A A . 109 LEU CG   1 1 
        2  3565 1 1 112 LEU H    H  -4.896   0.558  10.585 1.00 . A A . 109 LEU H    1 1 
        2  3566 1 1 112 LEU HA   H  -2.006   0.896  10.058 1.00 . A A . 109 LEU HA   1 1 
        2  3567 1 1 112 LEU HB2  H  -1.663  -0.643  12.100 1.00 . A A . 109 LEU HB2  1 1 
        2  3568 1 1 112 LEU HB3  H  -2.051   1.036  12.388 1.00 . A A . 109 LEU HB3  1 1 
        2  3569 1 1 112 LEU HD11 H  -3.060  -2.400  13.242 1.00 . A A . 109 LEU HD11 1 1 
        2  3570 1 1 112 LEU HD12 H  -4.140  -2.132  11.868 1.00 . A A . 109 LEU HD12 1 1 
        2  3571 1 1 112 LEU HD13 H  -4.777  -2.083  13.511 1.00 . A A . 109 LEU HD13 1 1 
        2  3572 1 1 112 LEU HD21 H  -3.273   1.197  14.442 1.00 . A A . 109 LEU HD21 1 1 
        2  3573 1 1 112 LEU HD22 H  -2.518  -0.352  14.817 1.00 . A A . 109 LEU HD22 1 1 
        2  3574 1 1 112 LEU HD23 H  -4.258  -0.143  15.026 1.00 . A A . 109 LEU HD23 1 1 
        2  3575 1 1 112 LEU HG   H  -4.541   0.162  12.615 1.00 . A A . 109 LEU HG   1 1 
        2  3576 1 1 112 LEU N    N  -4.063   1.031  10.384 1.00 . A A . 109 LEU N    1 1 
        2  3577 1 1 112 LEU O    O  -1.840  -1.815   9.780 1.00 . A A . 109 LEU O    1 1 
        2  3578 1 1 113 LEU C    C  -5.299  -2.250   7.206 1.00 . A A . 110 LEU C    1 1 
        2  3579 1 1 113 LEU CA   C  -4.058  -2.460   8.092 1.00 . A A . 110 LEU CA   1 1 
        2  3580 1 1 113 LEU CB   C  -4.168  -3.797   8.886 1.00 . A A . 110 LEU CB   1 1 
        2  3581 1 1 113 LEU CD1  C  -3.317  -5.298   6.986 1.00 . A A . 110 LEU CD1  1 1 
        2  3582 1 1 113 LEU CD2  C  -4.575  -6.335   8.946 1.00 . A A . 110 LEU CD2  1 1 
        2  3583 1 1 113 LEU CG   C  -4.414  -5.089   8.042 1.00 . A A . 110 LEU CG   1 1 
        2  3584 1 1 113 LEU H    H  -4.672  -0.696   9.080 1.00 . A A . 110 LEU H    1 1 
        2  3585 1 1 113 LEU HA   H  -3.174  -2.496   7.454 1.00 . A A . 110 LEU HA   1 1 
        2  3586 1 1 113 LEU HB2  H  -3.252  -3.932   9.454 1.00 . A A . 110 LEU HB2  1 1 
        2  3587 1 1 113 LEU HB3  H  -4.985  -3.699   9.591 1.00 . A A . 110 LEU HB3  1 1 
        2  3588 1 1 113 LEU HD11 H  -3.524  -6.197   6.418 1.00 . A A . 110 LEU HD11 1 1 
        2  3589 1 1 113 LEU HD12 H  -2.353  -5.395   7.467 1.00 . A A . 110 LEU HD12 1 1 
        2  3590 1 1 113 LEU HD13 H  -3.296  -4.452   6.312 1.00 . A A . 110 LEU HD13 1 1 
        2  3591 1 1 113 LEU HD21 H  -3.667  -6.502   9.514 1.00 . A A . 110 LEU HD21 1 1 
        2  3592 1 1 113 LEU HD22 H  -4.784  -7.205   8.339 1.00 . A A . 110 LEU HD22 1 1 
        2  3593 1 1 113 LEU HD23 H  -5.399  -6.180   9.631 1.00 . A A . 110 LEU HD23 1 1 
        2  3594 1 1 113 LEU HG   H  -5.340  -4.964   7.499 1.00 . A A . 110 LEU HG   1 1 
        2  3595 1 1 113 LEU N    N  -3.912  -1.306   8.996 1.00 . A A . 110 LEU N    1 1 
        2  3596 1 1 113 LEU O    O  -6.377  -1.902   7.705 1.00 . A A . 110 LEU O    1 1 
        2  3597 1 1 114 THR C    C  -6.971  -3.607   4.699 1.00 . A A . 111 THR C    1 1 
        2  3598 1 1 114 THR CA   C  -6.191  -2.295   4.891 1.00 . A A . 111 THR CA   1 1 
        2  3599 1 1 114 THR CB   C  -5.612  -1.855   3.512 1.00 . A A . 111 THR CB   1 1 
        2  3600 1 1 114 THR CG2  C  -6.739  -1.438   2.551 1.00 . A A . 111 THR CG2  1 1 
        2  3601 1 1 114 THR H    H  -4.250  -2.756   5.581 1.00 . A A . 111 THR H    1 1 
        2  3602 1 1 114 THR HA   H  -6.868  -1.519   5.240 1.00 . A A . 111 THR HA   1 1 
        2  3603 1 1 114 THR HB   H  -5.065  -2.685   3.068 1.00 . A A . 111 THR HB   1 1 
        2  3604 1 1 114 THR HG1  H  -5.196  -0.003   4.030 1.00 . A A . 111 THR HG1  1 1 
        2  3605 1 1 114 THR HG21 H  -7.418  -2.273   2.408 1.00 . A A . 111 THR HG21 1 1 
        2  3606 1 1 114 THR HG22 H  -6.322  -1.148   1.594 1.00 . A A . 111 THR HG22 1 1 
        2  3607 1 1 114 THR HG23 H  -7.285  -0.605   2.975 1.00 . A A . 111 THR HG23 1 1 
        2  3608 1 1 114 THR N    N  -5.128  -2.466   5.890 1.00 . A A . 111 THR N    1 1 
        2  3609 1 1 114 THR O    O  -6.369  -4.679   4.545 1.00 . A A . 111 THR O    1 1 
        2  3610 1 1 114 THR OG1  O  -4.707  -0.761   3.694 1.00 . A A . 111 THR OG1  1 1 
        2  3611 1 1 115 LEU C    C -10.327  -4.314   3.514 1.00 . A A . 112 LEU C    1 1 
        2  3612 1 1 115 LEU CA   C  -9.228  -4.647   4.532 1.00 . A A . 112 LEU CA   1 1 
        2  3613 1 1 115 LEU CB   C  -9.870  -5.014   5.893 1.00 . A A . 112 LEU CB   1 1 
        2  3614 1 1 115 LEU CD1  C  -9.568  -5.228   8.403 1.00 . A A . 112 LEU CD1  1 1 
        2  3615 1 1 115 LEU CD2  C  -8.102  -6.606   6.859 1.00 . A A . 112 LEU CD2  1 1 
        2  3616 1 1 115 LEU CG   C  -8.866  -5.280   7.057 1.00 . A A . 112 LEU CG   1 1 
        2  3617 1 1 115 LEU H    H  -8.705  -2.611   4.769 1.00 . A A . 112 LEU H    1 1 
        2  3618 1 1 115 LEU HA   H  -8.655  -5.497   4.168 1.00 . A A . 112 LEU HA   1 1 
        2  3619 1 1 115 LEU HB2  H -10.538  -4.209   6.188 1.00 . A A . 112 LEU HB2  1 1 
        2  3620 1 1 115 LEU HB3  H -10.473  -5.911   5.755 1.00 . A A . 112 LEU HB3  1 1 
        2  3621 1 1 115 LEU HD11 H  -8.852  -5.413   9.190 1.00 . A A . 112 LEU HD11 1 1 
        2  3622 1 1 115 LEU HD12 H -10.350  -5.972   8.444 1.00 . A A . 112 LEU HD12 1 1 
        2  3623 1 1 115 LEU HD13 H  -9.998  -4.243   8.540 1.00 . A A . 112 LEU HD13 1 1 
        2  3624 1 1 115 LEU HD21 H  -7.394  -6.745   7.667 1.00 . A A . 112 LEU HD21 1 1 
        2  3625 1 1 115 LEU HD22 H  -7.564  -6.576   5.922 1.00 . A A . 112 LEU HD22 1 1 
        2  3626 1 1 115 LEU HD23 H  -8.798  -7.436   6.846 1.00 . A A . 112 LEU HD23 1 1 
        2  3627 1 1 115 LEU HG   H  -8.133  -4.492   7.067 1.00 . A A . 112 LEU HG   1 1 
        2  3628 1 1 115 LEU N    N  -8.313  -3.502   4.687 1.00 . A A . 112 LEU N    1 1 
        2  3629 1 1 115 LEU O    O -10.648  -3.144   3.291 1.00 . A A . 112 LEU O    1 1 
        2  3630 1 1 116 VAL C    C -13.337  -5.631   2.803 1.00 . A A . 113 VAL C    1 1 
        2  3631 1 1 116 VAL CA   C -12.053  -5.285   2.016 1.00 . A A . 113 VAL CA   1 1 
        2  3632 1 1 116 VAL CB   C -11.899  -6.261   0.783 1.00 . A A . 113 VAL CB   1 1 
        2  3633 1 1 116 VAL CG1  C -10.698  -5.854  -0.103 1.00 . A A . 113 VAL CG1  1 1 
        2  3634 1 1 116 VAL CG2  C -11.771  -7.740   1.240 1.00 . A A . 113 VAL CG2  1 1 
        2  3635 1 1 116 VAL H    H -10.487  -6.241   3.056 1.00 . A A . 113 VAL H    1 1 
        2  3636 1 1 116 VAL HA   H -12.137  -4.268   1.638 1.00 . A A . 113 VAL HA   1 1 
        2  3637 1 1 116 VAL HB   H -12.798  -6.176   0.172 1.00 . A A . 113 VAL HB   1 1 
        2  3638 1 1 116 VAL HG11 H -10.834  -4.841  -0.466 1.00 . A A . 113 VAL HG11 1 1 
        2  3639 1 1 116 VAL HG12 H -10.619  -6.524  -0.950 1.00 . A A . 113 VAL HG12 1 1 
        2  3640 1 1 116 VAL HG13 H  -9.783  -5.903   0.476 1.00 . A A . 113 VAL HG13 1 1 
        2  3641 1 1 116 VAL HG21 H -11.680  -8.388   0.375 1.00 . A A . 113 VAL HG21 1 1 
        2  3642 1 1 116 VAL HG22 H -12.647  -8.027   1.807 1.00 . A A . 113 VAL HG22 1 1 
        2  3643 1 1 116 VAL HG23 H -10.891  -7.853   1.862 1.00 . A A . 113 VAL HG23 1 1 
        2  3644 1 1 116 VAL N    N -10.882  -5.364   2.903 1.00 . A A . 113 VAL N    1 1 
        2  3645 1 1 116 VAL O    O -14.449  -5.324   2.363 1.00 . A A . 113 VAL O    1 1 
        2  3646 1 1 117 ASP C    C -14.817  -5.719   5.744 1.00 . A A . 114 ASP C    1 1 
        2  3647 1 1 117 ASP CA   C -14.257  -6.801   4.798 1.00 . A A . 114 ASP CA   1 1 
        2  3648 1 1 117 ASP CB   C -13.771  -8.032   5.603 1.00 . A A . 114 ASP CB   1 1 
        2  3649 1 1 117 ASP CG   C -14.896  -8.706   6.414 1.00 . A A . 114 ASP CG   1 1 
        2  3650 1 1 117 ASP H    H -12.240  -6.378   4.308 1.00 . A A . 114 ASP H    1 1 
        2  3651 1 1 117 ASP HA   H -15.051  -7.123   4.124 1.00 . A A . 114 ASP HA   1 1 
        2  3652 1 1 117 ASP HB2  H -13.351  -8.764   4.914 1.00 . A A . 114 ASP HB2  1 1 
        2  3653 1 1 117 ASP HB3  H -12.986  -7.723   6.285 1.00 . A A . 114 ASP HB3  1 1 
        2  3654 1 1 117 ASP N    N -13.156  -6.270   3.979 1.00 . A A . 114 ASP N    1 1 
        2  3655 1 1 117 ASP O    O -15.992  -5.342   5.631 1.00 . A A . 114 ASP O    1 1 
        2  3656 1 1 117 ASP OD1  O -15.591  -9.583   5.862 1.00 . A A . 114 ASP OD1  1 1 
        2  3657 1 1 117 ASP OD2  O -15.101  -8.355   7.600 1.00 . A A . 114 ASP OD2  1 1 
        2  3658 1 1 118 GLN C    C -14.790  -2.903   7.028 1.00 . A A . 115 GLN C    1 1 
        2  3659 1 1 118 GLN CA   C -14.376  -4.238   7.700 1.00 . A A . 115 GLN CA   1 1 
        2  3660 1 1 118 GLN CB   C -13.242  -3.980   8.740 1.00 . A A . 115 GLN CB   1 1 
        2  3661 1 1 118 GLN CD   C -14.098  -5.611  10.547 1.00 . A A . 115 GLN CD   1 1 
        2  3662 1 1 118 GLN CG   C -12.928  -5.170   9.671 1.00 . A A . 115 GLN CG   1 1 
        2  3663 1 1 118 GLN H    H -13.046  -5.578   6.708 1.00 . A A . 115 GLN H    1 1 
        2  3664 1 1 118 GLN HA   H -15.233  -4.649   8.220 1.00 . A A . 115 GLN HA   1 1 
        2  3665 1 1 118 GLN HB2  H -12.331  -3.726   8.201 1.00 . A A . 115 GLN HB2  1 1 
        2  3666 1 1 118 GLN HB3  H -13.513  -3.127   9.360 1.00 . A A . 115 GLN HB3  1 1 
        2  3667 1 1 118 GLN HE21 H -14.689  -6.908   9.166 1.00 . A A . 115 GLN HE21 1 1 
        2  3668 1 1 118 GLN HE22 H -15.640  -6.853  10.606 1.00 . A A . 115 GLN HE22 1 1 
        2  3669 1 1 118 GLN HG2  H -12.625  -6.010   9.059 1.00 . A A . 115 GLN HG2  1 1 
        2  3670 1 1 118 GLN HG3  H -12.101  -4.895  10.314 1.00 . A A . 115 GLN HG3  1 1 
        2  3671 1 1 118 GLN N    N -13.969  -5.243   6.691 1.00 . A A . 115 GLN N    1 1 
        2  3672 1 1 118 GLN NE2  N -14.892  -6.547  10.057 1.00 . A A . 115 GLN NE2  1 1 
        2  3673 1 1 118 GLN O    O -14.055  -2.389   6.171 1.00 . A A . 115 GLN O    1 1 
        2  3674 1 1 118 GLN OE1  O -14.285  -5.110  11.656 1.00 . A A . 115 GLN OE1  1 1 
        2  3675 1 1 119 PRO C    C -15.503   0.106   7.354 1.00 . A A . 116 PRO C    1 1 
        2  3676 1 1 119 PRO CA   C -16.441  -1.029   6.878 1.00 . A A . 116 PRO CA   1 1 
        2  3677 1 1 119 PRO CB   C -17.886  -0.887   7.435 1.00 . A A . 116 PRO CB   1 1 
        2  3678 1 1 119 PRO CD   C -16.984  -2.928   8.338 1.00 . A A . 116 PRO CD   1 1 
        2  3679 1 1 119 PRO CG   C -17.923  -1.779   8.642 1.00 . A A . 116 PRO CG   1 1 
        2  3680 1 1 119 PRO HA   H -16.470  -1.035   5.790 1.00 . A A . 116 PRO HA   1 1 
        2  3681 1 1 119 PRO HB2  H -18.095   0.146   7.692 1.00 . A A . 116 PRO HB2  1 1 
        2  3682 1 1 119 PRO HB3  H -18.598  -1.215   6.683 1.00 . A A . 116 PRO HB3  1 1 
        2  3683 1 1 119 PRO HD2  H -16.500  -3.270   9.246 1.00 . A A . 116 PRO HD2  1 1 
        2  3684 1 1 119 PRO HD3  H -17.510  -3.754   7.869 1.00 . A A . 116 PRO HD3  1 1 
        2  3685 1 1 119 PRO HG2  H -17.583  -1.231   9.519 1.00 . A A . 116 PRO HG2  1 1 
        2  3686 1 1 119 PRO HG3  H -18.930  -2.145   8.807 1.00 . A A . 116 PRO HG3  1 1 
        2  3687 1 1 119 PRO N    N -15.988  -2.336   7.397 1.00 . A A . 116 PRO N    1 1 
        2  3688 1 1 119 PRO O    O -15.335   0.328   8.559 1.00 . A A . 116 PRO O    1 1 
        2  3689 1 1 120 GLN C    C -14.615   3.157   7.066 1.00 . A A . 117 GLN C    1 1 
        2  3690 1 1 120 GLN CA   C -13.889   1.858   6.649 1.00 . A A . 117 GLN CA   1 1 
        2  3691 1 1 120 GLN CB   C -13.018   2.086   5.388 1.00 . A A . 117 GLN CB   1 1 
        2  3692 1 1 120 GLN CD   C -11.422   1.084   3.643 1.00 . A A . 117 GLN CD   1 1 
        2  3693 1 1 120 GLN CG   C -12.246   0.837   4.912 1.00 . A A . 117 GLN CG   1 1 
        2  3694 1 1 120 GLN H    H -15.051   0.539   5.453 1.00 . A A . 117 GLN H    1 1 
        2  3695 1 1 120 GLN HA   H -13.246   1.539   7.467 1.00 . A A . 117 GLN HA   1 1 
        2  3696 1 1 120 GLN HB2  H -13.660   2.414   4.575 1.00 . A A . 117 GLN HB2  1 1 
        2  3697 1 1 120 GLN HB3  H -12.297   2.871   5.596 1.00 . A A . 117 GLN HB3  1 1 
        2  3698 1 1 120 GLN HE21 H  -9.869   1.653   4.731 1.00 . A A . 117 GLN HE21 1 1 
        2  3699 1 1 120 GLN HE22 H  -9.636   1.676   3.022 1.00 . A A . 117 GLN HE22 1 1 
        2  3700 1 1 120 GLN HG2  H -11.576   0.513   5.701 1.00 . A A . 117 GLN HG2  1 1 
        2  3701 1 1 120 GLN HG3  H -12.957   0.041   4.713 1.00 . A A . 117 GLN HG3  1 1 
        2  3702 1 1 120 GLN N    N -14.860   0.777   6.385 1.00 . A A . 117 GLN N    1 1 
        2  3703 1 1 120 GLN NE2  N -10.187   1.519   3.814 1.00 . A A . 117 GLN NE2  1 1 
        2  3704 1 1 120 GLN O    O -14.082   3.963   7.842 1.00 . A A . 117 GLN O    1 1 
        2  3705 1 1 120 GLN OE1  O -11.899   0.903   2.526 1.00 . A A . 117 GLN OE1  1 1 
        2  3706 1 1 121 ALA C    C -18.159   3.922   7.114 1.00 . A A . 118 ALA C    1 1 
        2  3707 1 1 121 ALA CA   C -16.728   4.459   6.864 1.00 . A A . 118 ALA CA   1 1 
        2  3708 1 1 121 ALA CB   C -16.697   5.500   5.722 1.00 . A A . 118 ALA CB   1 1 
        2  3709 1 1 121 ALA H    H -16.181   2.641   5.927 1.00 . A A . 118 ALA H    1 1 
        2  3710 1 1 121 ALA HA   H -16.360   4.943   7.772 1.00 . A A . 118 ALA HA   1 1 
        2  3711 1 1 121 ALA HB1  H -17.318   6.348   5.982 1.00 . A A . 118 ALA HB1  1 1 
        2  3712 1 1 121 ALA HB2  H -17.069   5.053   4.809 1.00 . A A . 118 ALA HB2  1 1 
        2  3713 1 1 121 ALA HB3  H -15.680   5.838   5.563 1.00 . A A . 118 ALA HB3  1 1 
        2  3714 1 1 121 ALA N    N -15.845   3.325   6.548 1.00 . A A . 118 ALA N    1 1 
        2  3715 1 1 121 ALA O    O -18.824   3.504   6.141 1.00 . A A . 118 ALA O    1 1 
        2  3716 1 1 121 ALA OXT  O -18.604   3.901   8.279 1.00 . A A . 118 ALA OXT  1 1 
        3  3717 1 1   4 MET C    C   2.971  -0.932  -1.331 1.00 . A A .   1 MET C    1 1 
        3  3718 1 1   4 MET CA   C   2.908   0.520  -0.818 1.00 . A A .   1 MET CA   1 1 
        3  3719 1 1   4 MET CB   C   4.323   1.027  -0.396 1.00 . A A .   1 MET CB   1 1 
        3  3720 1 1   4 MET CE   C   6.588   3.392  -0.560 1.00 . A A .   1 MET CE   1 1 
        3  3721 1 1   4 MET CG   C   5.377   1.047  -1.518 1.00 . A A .   1 MET CG   1 1 
        3  3722 1 1   4 MET H    H   2.241  -0.077   1.065 1.00 . A A .   1 MET H    1 1 
        3  3723 1 1   4 MET HA   H   2.520   1.154  -1.610 1.00 . A A .   1 MET HA   1 1 
        3  3724 1 1   4 MET HB2  H   4.228   2.036  -0.013 1.00 . A A .   1 MET HB2  1 1 
        3  3725 1 1   4 MET HB3  H   4.697   0.395   0.405 1.00 . A A .   1 MET HB3  1 1 
        3  3726 1 1   4 MET HE1  H   6.150   3.892  -1.412 1.00 . A A .   1 MET HE1  1 1 
        3  3727 1 1   4 MET HE2  H   7.492   3.911  -0.265 1.00 . A A .   1 MET HE2  1 1 
        3  3728 1 1   4 MET HE3  H   5.887   3.403   0.261 1.00 . A A .   1 MET HE3  1 1 
        3  3729 1 1   4 MET HG2  H   5.526   0.036  -1.874 1.00 . A A .   1 MET HG2  1 1 
        3  3730 1 1   4 MET HG3  H   5.009   1.658  -2.333 1.00 . A A .   1 MET HG3  1 1 
        3  3731 1 1   4 MET N    N   1.975   0.618   0.333 1.00 . A A .   1 MET N    1 1 
        3  3732 1 1   4 MET O    O   2.722  -1.872  -0.573 1.00 . A A .   1 MET O    1 1 
        3  3733 1 1   4 MET SD   S   6.984   1.694  -0.997 1.00 . A A .   1 MET SD   1 1 
        3  3734 1 1   5 ARG C    C   4.979  -2.863  -2.809 1.00 . A A .   2 ARG C    1 1 
        3  3735 1 1   5 ARG CA   C   3.570  -2.412  -3.236 1.00 . A A .   2 ARG CA   1 1 
        3  3736 1 1   5 ARG CB   C   3.507  -2.335  -4.782 1.00 . A A .   2 ARG CB   1 1 
        3  3737 1 1   5 ARG CD   C   2.259  -1.631  -6.889 1.00 . A A .   2 ARG CD   1 1 
        3  3738 1 1   5 ARG CG   C   2.239  -1.680  -5.353 1.00 . A A .   2 ARG CG   1 1 
        3  3739 1 1   5 ARG CZ   C   3.836  -0.924  -8.697 1.00 . A A .   2 ARG CZ   1 1 
        3  3740 1 1   5 ARG H    H   3.310  -0.311  -3.206 1.00 . A A .   2 ARG H    1 1 
        3  3741 1 1   5 ARG HA   H   2.832  -3.127  -2.881 1.00 . A A .   2 ARG HA   1 1 
        3  3742 1 1   5 ARG HB2  H   4.361  -1.765  -5.135 1.00 . A A .   2 ARG HB2  1 1 
        3  3743 1 1   5 ARG HB3  H   3.579  -3.343  -5.183 1.00 . A A .   2 ARG HB3  1 1 
        3  3744 1 1   5 ARG HD2  H   2.211  -2.650  -7.273 1.00 . A A .   2 ARG HD2  1 1 
        3  3745 1 1   5 ARG HD3  H   1.390  -1.082  -7.235 1.00 . A A .   2 ARG HD3  1 1 
        3  3746 1 1   5 ARG HE   H   4.069  -0.567  -6.743 1.00 . A A .   2 ARG HE   1 1 
        3  3747 1 1   5 ARG HG2  H   1.371  -2.241  -5.025 1.00 . A A .   2 ARG HG2  1 1 
        3  3748 1 1   5 ARG HG3  H   2.168  -0.665  -4.971 1.00 . A A .   2 ARG HG3  1 1 
        3  3749 1 1   5 ARG HH11 H   2.205  -1.897  -9.412 1.00 . A A .   2 ARG HH11 1 1 
        3  3750 1 1   5 ARG HH12 H   3.345  -1.378 -10.609 1.00 . A A .   2 ARG HH12 1 1 
        3  3751 1 1   5 ARG HH21 H   5.563   0.064  -8.318 1.00 . A A .   2 ARG HH21 1 1 
        3  3752 1 1   5 ARG HH22 H   5.261  -0.293  -9.991 1.00 . A A .   2 ARG HH22 1 1 
        3  3753 1 1   5 ARG N    N   3.279  -1.100  -2.634 1.00 . A A .   2 ARG N    1 1 
        3  3754 1 1   5 ARG NE   N   3.476  -0.979  -7.407 1.00 . A A .   2 ARG NE   1 1 
        3  3755 1 1   5 ARG NH1  N   3.070  -1.445  -9.647 1.00 . A A .   2 ARG NH1  1 1 
        3  3756 1 1   5 ARG NH2  N   4.975  -0.335  -9.028 1.00 . A A .   2 ARG NH2  1 1 
        3  3757 1 1   5 ARG O    O   5.971  -2.189  -3.117 1.00 . A A .   2 ARG O    1 1 
        3  3758 1 1   6 LEU C    C   6.111  -6.027  -1.204 1.00 . A A .   3 LEU C    1 1 
        3  3759 1 1   6 LEU CA   C   6.293  -4.527  -1.516 1.00 . A A .   3 LEU CA   1 1 
        3  3760 1 1   6 LEU CB   C   6.746  -3.700  -0.246 1.00 . A A .   3 LEU CB   1 1 
        3  3761 1 1   6 LEU CD1  C   4.663  -4.057   1.219 1.00 . A A .   3 LEU CD1  1 1 
        3  3762 1 1   6 LEU CD2  C   6.198  -2.103   1.706 1.00 . A A .   3 LEU CD2  1 1 
        3  3763 1 1   6 LEU CG   C   5.617  -3.025   0.613 1.00 . A A .   3 LEU CG   1 1 
        3  3764 1 1   6 LEU H    H   4.211  -4.455  -1.884 1.00 . A A .   3 LEU H    1 1 
        3  3765 1 1   6 LEU HA   H   7.060  -4.446  -2.284 1.00 . A A .   3 LEU HA   1 1 
        3  3766 1 1   6 LEU HB2  H   7.307  -4.361   0.411 1.00 . A A .   3 LEU HB2  1 1 
        3  3767 1 1   6 LEU HB3  H   7.418  -2.920  -0.581 1.00 . A A .   3 LEU HB3  1 1 
        3  3768 1 1   6 LEU HD11 H   4.192  -4.631   0.431 1.00 . A A .   3 LEU HD11 1 1 
        3  3769 1 1   6 LEU HD12 H   3.900  -3.556   1.795 1.00 . A A .   3 LEU HD12 1 1 
        3  3770 1 1   6 LEU HD13 H   5.216  -4.730   1.867 1.00 . A A .   3 LEU HD13 1 1 
        3  3771 1 1   6 LEU HD21 H   6.851  -1.364   1.258 1.00 . A A .   3 LEU HD21 1 1 
        3  3772 1 1   6 LEU HD22 H   6.759  -2.688   2.421 1.00 . A A .   3 LEU HD22 1 1 
        3  3773 1 1   6 LEU HD23 H   5.392  -1.595   2.219 1.00 . A A .   3 LEU HD23 1 1 
        3  3774 1 1   6 LEU HG   H   5.019  -2.401  -0.045 1.00 . A A .   3 LEU HG   1 1 
        3  3775 1 1   6 LEU N    N   5.044  -3.977  -2.073 1.00 . A A .   3 LEU N    1 1 
        3  3776 1 1   6 LEU O    O   5.073  -6.625  -1.539 1.00 . A A .   3 LEU O    1 1 
        3  3777 1 1   7 LYS C    C   6.086  -8.232   1.017 1.00 . A A .   4 LYS C    1 1 
        3  3778 1 1   7 LYS CA   C   7.100  -8.029  -0.133 1.00 . A A .   4 LYS CA   1 1 
        3  3779 1 1   7 LYS CB   C   8.499  -8.492   0.358 1.00 . A A .   4 LYS CB   1 1 
        3  3780 1 1   7 LYS CD   C  10.875  -9.261  -0.101 1.00 . A A .   4 LYS CD   1 1 
        3  3781 1 1   7 LYS CE   C  11.987  -9.534  -1.123 1.00 . A A .   4 LYS CE   1 1 
        3  3782 1 1   7 LYS CG   C   9.599  -8.633  -0.713 1.00 . A A .   4 LYS CG   1 1 
        3  3783 1 1   7 LYS H    H   7.954  -6.108  -0.427 1.00 . A A .   4 LYS H    1 1 
        3  3784 1 1   7 LYS HA   H   6.800  -8.646  -0.973 1.00 . A A .   4 LYS HA   1 1 
        3  3785 1 1   7 LYS HB2  H   8.852  -7.792   1.108 1.00 . A A .   4 LYS HB2  1 1 
        3  3786 1 1   7 LYS HB3  H   8.384  -9.463   0.832 1.00 . A A .   4 LYS HB3  1 1 
        3  3787 1 1   7 LYS HD2  H  11.262  -8.589   0.657 1.00 . A A .   4 LYS HD2  1 1 
        3  3788 1 1   7 LYS HD3  H  10.601 -10.201   0.373 1.00 . A A .   4 LYS HD3  1 1 
        3  3789 1 1   7 LYS HE2  H  11.626 -10.239  -1.861 1.00 . A A .   4 LYS HE2  1 1 
        3  3790 1 1   7 LYS HE3  H  12.255  -8.607  -1.611 1.00 . A A .   4 LYS HE3  1 1 
        3  3791 1 1   7 LYS HG2  H   9.237  -9.268  -1.516 1.00 . A A .   4 LYS HG2  1 1 
        3  3792 1 1   7 LYS HG3  H   9.840  -7.652  -1.111 1.00 . A A .   4 LYS HG3  1 1 
        3  3793 1 1   7 LYS HZ1  H  12.959 -10.983   0.033 1.00 . A A .   4 LYS HZ1  1 1 
        3  3794 1 1   7 LYS HZ2  H  13.596  -9.428   0.210 1.00 . A A .   4 LYS HZ2  1 1 
        3  3795 1 1   7 LYS HZ3  H  13.925 -10.323  -1.186 1.00 . A A .   4 LYS HZ3  1 1 
        3  3796 1 1   7 LYS N    N   7.139  -6.627  -0.585 1.00 . A A .   4 LYS N    1 1 
        3  3797 1 1   7 LYS NZ   N  13.199 -10.105  -0.472 1.00 . A A .   4 LYS NZ   1 1 
        3  3798 1 1   7 LYS O    O   5.688  -7.280   1.691 1.00 . A A .   4 LYS O    1 1 
        3  3799 1 1   8 SER C    C   5.853  -9.632   3.686 1.00 . A A .   5 SER C    1 1 
        3  3800 1 1   8 SER CA   C   5.009  -9.971   2.442 1.00 . A A .   5 SER CA   1 1 
        3  3801 1 1   8 SER CB   C   4.830 -11.508   2.359 1.00 . A A .   5 SER CB   1 1 
        3  3802 1 1   8 SER H    H   5.885 -10.163   0.527 1.00 . A A .   5 SER H    1 1 
        3  3803 1 1   8 SER HA   H   4.044  -9.488   2.503 1.00 . A A .   5 SER HA   1 1 
        3  3804 1 1   8 SER HB2  H   5.778 -12.000   2.546 1.00 . A A .   5 SER HB2  1 1 
        3  3805 1 1   8 SER HB3  H   4.115 -11.832   3.098 1.00 . A A .   5 SER HB3  1 1 
        3  3806 1 1   8 SER HG   H   3.888 -12.722   1.154 1.00 . A A .   5 SER HG   1 1 
        3  3807 1 1   8 SER N    N   5.701  -9.503   1.226 1.00 . A A .   5 SER N    1 1 
        3  3808 1 1   8 SER O    O   5.355  -9.129   4.683 1.00 . A A .   5 SER O    1 1 
        3  3809 1 1   8 SER OG   O   4.381 -11.906   1.081 1.00 . A A .   5 SER OG   1 1 
        3  3810 1 1   9 GLU C    C   8.302  -8.202   4.927 1.00 . A A .   6 GLU C    1 1 
        3  3811 1 1   9 GLU CA   C   8.204  -9.686   4.534 1.00 . A A .   6 GLU CA   1 1 
        3  3812 1 1   9 GLU CB   C   9.544 -10.192   3.916 1.00 . A A .   6 GLU CB   1 1 
        3  3813 1 1   9 GLU CD   C  10.976 -10.608   6.039 1.00 . A A .   6 GLU CD   1 1 
        3  3814 1 1   9 GLU CG   C  10.836  -9.865   4.700 1.00 . A A .   6 GLU CG   1 1 
        3  3815 1 1   9 GLU H    H   7.412 -10.365   2.717 1.00 . A A .   6 GLU H    1 1 
        3  3816 1 1   9 GLU HA   H   7.972 -10.275   5.423 1.00 . A A .   6 GLU HA   1 1 
        3  3817 1 1   9 GLU HB2  H   9.480 -11.275   3.804 1.00 . A A .   6 GLU HB2  1 1 
        3  3818 1 1   9 GLU HB3  H   9.642  -9.761   2.920 1.00 . A A .   6 GLU HB3  1 1 
        3  3819 1 1   9 GLU HG2  H  11.687 -10.108   4.074 1.00 . A A .   6 GLU HG2  1 1 
        3  3820 1 1   9 GLU HG3  H  10.854  -8.795   4.893 1.00 . A A .   6 GLU HG3  1 1 
        3  3821 1 1   9 GLU N    N   7.148  -9.932   3.547 1.00 . A A .   6 GLU N    1 1 
        3  3822 1 1   9 GLU O    O   8.395  -7.865   6.118 1.00 . A A .   6 GLU O    1 1 
        3  3823 1 1   9 GLU OE1  O  10.445 -10.128   7.061 1.00 . A A .   6 GLU OE1  1 1 
        3  3824 1 1   9 GLU OE2  O  11.615 -11.676   6.066 1.00 . A A .   6 GLU OE2  1 1 
        3  3825 1 1  10 MET C    C   7.037  -5.313   4.670 1.00 . A A .   7 MET C    1 1 
        3  3826 1 1  10 MET CA   C   8.387  -5.878   4.170 1.00 . A A .   7 MET CA   1 1 
        3  3827 1 1  10 MET CB   C   8.885  -5.130   2.907 1.00 . A A .   7 MET CB   1 1 
        3  3828 1 1  10 MET CE   C   9.798  -1.823   5.192 1.00 . A A .   7 MET CE   1 1 
        3  3829 1 1  10 MET CG   C   9.177  -3.644   3.154 1.00 . A A .   7 MET CG   1 1 
        3  3830 1 1  10 MET H    H   8.198  -7.638   3.007 1.00 . A A .   7 MET H    1 1 
        3  3831 1 1  10 MET HA   H   9.122  -5.736   4.962 1.00 . A A .   7 MET HA   1 1 
        3  3832 1 1  10 MET HB2  H   9.797  -5.601   2.560 1.00 . A A .   7 MET HB2  1 1 
        3  3833 1 1  10 MET HB3  H   8.135  -5.208   2.126 1.00 . A A .   7 MET HB3  1 1 
        3  3834 1 1  10 MET HE1  H   8.766  -1.908   5.506 1.00 . A A .   7 MET HE1  1 1 
        3  3835 1 1  10 MET HE2  H   9.886  -1.048   4.443 1.00 . A A .   7 MET HE2  1 1 
        3  3836 1 1  10 MET HE3  H  10.410  -1.570   6.044 1.00 . A A .   7 MET HE3  1 1 
        3  3837 1 1  10 MET HG2  H   9.596  -3.213   2.254 1.00 . A A .   7 MET HG2  1 1 
        3  3838 1 1  10 MET HG3  H   8.248  -3.139   3.391 1.00 . A A .   7 MET HG3  1 1 
        3  3839 1 1  10 MET N    N   8.289  -7.317   3.926 1.00 . A A .   7 MET N    1 1 
        3  3840 1 1  10 MET O    O   7.017  -4.330   5.418 1.00 . A A .   7 MET O    1 1 
        3  3841 1 1  10 MET SD   S  10.344  -3.392   4.514 1.00 . A A .   7 MET SD   1 1 
        3  3842 1 1  11 PHE C    C   4.323  -5.781   6.161 1.00 . A A .   8 PHE C    1 1 
        3  3843 1 1  11 PHE CA   C   4.559  -5.516   4.670 1.00 . A A .   8 PHE CA   1 1 
        3  3844 1 1  11 PHE CB   C   3.453  -6.215   3.818 1.00 . A A .   8 PHE CB   1 1 
        3  3845 1 1  11 PHE CD1  C   1.223  -5.869   5.045 1.00 . A A .   8 PHE CD1  1 1 
        3  3846 1 1  11 PHE CD2  C   1.600  -4.632   3.032 1.00 . A A .   8 PHE CD2  1 1 
        3  3847 1 1  11 PHE CE1  C  -0.004  -5.252   5.185 1.00 . A A .   8 PHE CE1  1 1 
        3  3848 1 1  11 PHE CE2  C   0.372  -4.018   3.181 1.00 . A A .   8 PHE CE2  1 1 
        3  3849 1 1  11 PHE CG   C   2.057  -5.569   3.964 1.00 . A A .   8 PHE CG   1 1 
        3  3850 1 1  11 PHE CZ   C  -0.431  -4.329   4.255 1.00 . A A .   8 PHE CZ   1 1 
        3  3851 1 1  11 PHE H    H   6.002  -6.803   3.784 1.00 . A A .   8 PHE H    1 1 
        3  3852 1 1  11 PHE HA   H   4.517  -4.440   4.491 1.00 . A A .   8 PHE HA   1 1 
        3  3853 1 1  11 PHE HB2  H   3.741  -6.169   2.773 1.00 . A A .   8 PHE HB2  1 1 
        3  3854 1 1  11 PHE HB3  H   3.384  -7.256   4.101 1.00 . A A .   8 PHE HB3  1 1 
        3  3855 1 1  11 PHE HD1  H   1.547  -6.600   5.780 1.00 . A A .   8 PHE HD1  1 1 
        3  3856 1 1  11 PHE HD2  H   2.222  -4.385   2.182 1.00 . A A .   8 PHE HD2  1 1 
        3  3857 1 1  11 PHE HE1  H  -0.637  -5.497   6.029 1.00 . A A .   8 PHE HE1  1 1 
        3  3858 1 1  11 PHE HE2  H   0.037  -3.296   2.451 1.00 . A A .   8 PHE HE2  1 1 
        3  3859 1 1  11 PHE HZ   H  -1.395  -3.846   4.372 1.00 . A A .   8 PHE HZ   1 1 
        3  3860 1 1  11 PHE N    N   5.914  -5.974   4.295 1.00 . A A .   8 PHE N    1 1 
        3  3861 1 1  11 PHE O    O   3.856  -4.901   6.879 1.00 . A A .   8 PHE O    1 1 
        3  3862 1 1  12 VAL C    C   5.318  -6.592   8.951 1.00 . A A .   9 VAL C    1 1 
        3  3863 1 1  12 VAL CA   C   4.465  -7.442   7.999 1.00 . A A .   9 VAL CA   1 1 
        3  3864 1 1  12 VAL CB   C   4.776  -8.972   8.205 1.00 . A A .   9 VAL CB   1 1 
        3  3865 1 1  12 VAL CG1  C   3.789  -9.856   7.418 1.00 . A A .   9 VAL CG1  1 1 
        3  3866 1 1  12 VAL CG2  C   6.233  -9.325   7.857 1.00 . A A .   9 VAL CG2  1 1 
        3  3867 1 1  12 VAL H    H   5.054  -7.635   5.972 1.00 . A A .   9 VAL H    1 1 
        3  3868 1 1  12 VAL HA   H   3.417  -7.275   8.242 1.00 . A A .   9 VAL HA   1 1 
        3  3869 1 1  12 VAL HB   H   4.641  -9.197   9.250 1.00 . A A .   9 VAL HB   1 1 
        3  3870 1 1  12 VAL HG11 H   2.778  -9.656   7.749 1.00 . A A .   9 VAL HG11 1 1 
        3  3871 1 1  12 VAL HG12 H   4.014 -10.903   7.585 1.00 . A A .   9 VAL HG12 1 1 
        3  3872 1 1  12 VAL HG13 H   3.867  -9.642   6.360 1.00 . A A .   9 VAL HG13 1 1 
        3  3873 1 1  12 VAL HG21 H   6.419  -9.122   6.810 1.00 . A A .   9 VAL HG21 1 1 
        3  3874 1 1  12 VAL HG22 H   6.416 -10.371   8.058 1.00 . A A .   9 VAL HG22 1 1 
        3  3875 1 1  12 VAL HG23 H   6.908  -8.728   8.460 1.00 . A A .   9 VAL HG23 1 1 
        3  3876 1 1  12 VAL N    N   4.655  -7.010   6.604 1.00 . A A .   9 VAL N    1 1 
        3  3877 1 1  12 VAL O    O   4.849  -6.196  10.016 1.00 . A A .   9 VAL O    1 1 
        3  3878 1 1  13 SER C    C   6.877  -4.001   9.384 1.00 . A A .  10 SER C    1 1 
        3  3879 1 1  13 SER CA   C   7.472  -5.417   9.264 1.00 . A A .  10 SER CA   1 1 
        3  3880 1 1  13 SER CB   C   8.850  -5.381   8.565 1.00 . A A .  10 SER CB   1 1 
        3  3881 1 1  13 SER H    H   6.848  -6.644   7.655 1.00 . A A .  10 SER H    1 1 
        3  3882 1 1  13 SER HA   H   7.587  -5.840  10.259 1.00 . A A .  10 SER HA   1 1 
        3  3883 1 1  13 SER HB2  H   9.187  -6.392   8.385 1.00 . A A .  10 SER HB2  1 1 
        3  3884 1 1  13 SER HB3  H   8.762  -4.866   7.616 1.00 . A A .  10 SER HB3  1 1 
        3  3885 1 1  13 SER HG   H   9.906  -5.159  10.204 1.00 . A A .  10 SER HG   1 1 
        3  3886 1 1  13 SER N    N   6.551  -6.278   8.516 1.00 . A A .  10 SER N    1 1 
        3  3887 1 1  13 SER O    O   6.723  -3.482  10.487 1.00 . A A .  10 SER O    1 1 
        3  3888 1 1  13 SER OG   O   9.824  -4.714   9.354 1.00 . A A .  10 SER OG   1 1 
        3  3889 1 1  14 ALA C    C   4.573  -1.977   8.989 1.00 . A A .  11 ALA C    1 1 
        3  3890 1 1  14 ALA CA   C   5.866  -2.091   8.149 1.00 . A A .  11 ALA CA   1 1 
        3  3891 1 1  14 ALA CB   C   5.592  -1.735   6.678 1.00 . A A .  11 ALA CB   1 1 
        3  3892 1 1  14 ALA H    H   6.554  -3.957   7.409 1.00 . A A .  11 ALA H    1 1 
        3  3893 1 1  14 ALA HA   H   6.595  -1.385   8.534 1.00 . A A .  11 ALA HA   1 1 
        3  3894 1 1  14 ALA HB1  H   6.511  -1.812   6.109 1.00 . A A .  11 ALA HB1  1 1 
        3  3895 1 1  14 ALA HB2  H   5.216  -0.723   6.607 1.00 . A A .  11 ALA HB2  1 1 
        3  3896 1 1  14 ALA HB3  H   4.859  -2.416   6.265 1.00 . A A .  11 ALA HB3  1 1 
        3  3897 1 1  14 ALA N    N   6.462  -3.440   8.234 1.00 . A A .  11 ALA N    1 1 
        3  3898 1 1  14 ALA O    O   4.314  -0.940   9.607 1.00 . A A .  11 ALA O    1 1 
        3  3899 1 1  15 LEU C    C   2.706  -3.020  11.246 1.00 . A A .  12 LEU C    1 1 
        3  3900 1 1  15 LEU CA   C   2.509  -3.195   9.731 1.00 . A A .  12 LEU CA   1 1 
        3  3901 1 1  15 LEU CB   C   1.850  -4.573   9.390 1.00 . A A .  12 LEU CB   1 1 
        3  3902 1 1  15 LEU CD1  C  -0.194  -6.014   8.856 1.00 . A A .  12 LEU CD1  1 1 
        3  3903 1 1  15 LEU CD2  C  -0.214  -4.637  10.978 1.00 . A A .  12 LEU CD2  1 1 
        3  3904 1 1  15 LEU CG   C   0.289  -4.704   9.517 1.00 . A A .  12 LEU CG   1 1 
        3  3905 1 1  15 LEU H    H   4.159  -3.892   8.595 1.00 . A A .  12 LEU H    1 1 
        3  3906 1 1  15 LEU HA   H   1.882  -2.402   9.367 1.00 . A A .  12 LEU HA   1 1 
        3  3907 1 1  15 LEU HB2  H   2.113  -4.807   8.364 1.00 . A A .  12 LEU HB2  1 1 
        3  3908 1 1  15 LEU HB3  H   2.306  -5.332  10.022 1.00 . A A .  12 LEU HB3  1 1 
        3  3909 1 1  15 LEU HD11 H   0.244  -6.867   9.361 1.00 . A A .  12 LEU HD11 1 1 
        3  3910 1 1  15 LEU HD12 H   0.097  -6.027   7.815 1.00 . A A .  12 LEU HD12 1 1 
        3  3911 1 1  15 LEU HD13 H  -1.274  -6.078   8.918 1.00 . A A .  12 LEU HD13 1 1 
        3  3912 1 1  15 LEU HD21 H  -1.293  -4.725  11.001 1.00 . A A .  12 LEU HD21 1 1 
        3  3913 1 1  15 LEU HD22 H   0.072  -3.692  11.417 1.00 . A A .  12 LEU HD22 1 1 
        3  3914 1 1  15 LEU HD23 H   0.223  -5.444  11.555 1.00 . A A .  12 LEU HD23 1 1 
        3  3915 1 1  15 LEU HG   H  -0.172  -3.888   8.975 1.00 . A A .  12 LEU HG   1 1 
        3  3916 1 1  15 LEU N    N   3.815  -3.091   9.037 1.00 . A A .  12 LEU N    1 1 
        3  3917 1 1  15 LEU O    O   1.923  -2.339  11.920 1.00 . A A .  12 LEU O    1 1 
        3  3918 1 1  16 ILE C    C   4.464  -2.111  13.575 1.00 . A A .  13 ILE C    1 1 
        3  3919 1 1  16 ILE CA   C   4.177  -3.564  13.149 1.00 . A A .  13 ILE CA   1 1 
        3  3920 1 1  16 ILE CB   C   5.421  -4.503  13.369 1.00 . A A .  13 ILE CB   1 1 
        3  3921 1 1  16 ILE CD1  C   6.123  -6.979  13.047 1.00 . A A .  13 ILE CD1  1 1 
        3  3922 1 1  16 ILE CG1  C   4.995  -5.989  13.125 1.00 . A A .  13 ILE CG1  1 1 
        3  3923 1 1  16 ILE CG2  C   6.071  -4.325  14.761 1.00 . A A .  13 ILE CG2  1 1 
        3  3924 1 1  16 ILE H    H   4.340  -4.148  11.127 1.00 . A A .  13 ILE H    1 1 
        3  3925 1 1  16 ILE HA   H   3.350  -3.946  13.745 1.00 . A A .  13 ILE HA   1 1 
        3  3926 1 1  16 ILE HB   H   6.168  -4.231  12.625 1.00 . A A .  13 ILE HB   1 1 
        3  3927 1 1  16 ILE HD11 H   5.708  -7.966  12.893 1.00 . A A .  13 ILE HD11 1 1 
        3  3928 1 1  16 ILE HD12 H   6.690  -6.963  13.963 1.00 . A A .  13 ILE HD12 1 1 
        3  3929 1 1  16 ILE HD13 H   6.762  -6.726  12.212 1.00 . A A .  13 ILE HD13 1 1 
        3  3930 1 1  16 ILE HG12 H   4.347  -6.316  13.927 1.00 . A A .  13 ILE HG12 1 1 
        3  3931 1 1  16 ILE HG13 H   4.443  -6.056  12.193 1.00 . A A .  13 ILE HG13 1 1 
        3  3932 1 1  16 ILE HG21 H   6.410  -3.303  14.880 1.00 . A A .  13 ILE HG21 1 1 
        3  3933 1 1  16 ILE HG22 H   6.920  -4.990  14.856 1.00 . A A .  13 ILE HG22 1 1 
        3  3934 1 1  16 ILE HG23 H   5.350  -4.555  15.536 1.00 . A A .  13 ILE HG23 1 1 
        3  3935 1 1  16 ILE N    N   3.778  -3.631  11.743 1.00 . A A .  13 ILE N    1 1 
        3  3936 1 1  16 ILE O    O   3.992  -1.652  14.608 1.00 . A A .  13 ILE O    1 1 
        3  3937 1 1  17 ARG C    C   4.305   0.953  12.882 1.00 . A A .  14 ARG C    1 1 
        3  3938 1 1  17 ARG CA   C   5.540   0.034  13.033 1.00 . A A .  14 ARG CA   1 1 
        3  3939 1 1  17 ARG CB   C   6.743   0.529  12.177 1.00 . A A .  14 ARG CB   1 1 
        3  3940 1 1  17 ARG CD   C   8.225  -1.582  12.253 1.00 . A A .  14 ARG CD   1 1 
        3  3941 1 1  17 ARG CG   C   8.126  -0.081  12.561 1.00 . A A .  14 ARG CG   1 1 
        3  3942 1 1  17 ARG CZ   C   9.791  -3.507  12.593 1.00 . A A .  14 ARG CZ   1 1 
        3  3943 1 1  17 ARG H    H   5.471  -1.761  11.882 1.00 . A A .  14 ARG H    1 1 
        3  3944 1 1  17 ARG HA   H   5.836   0.070  14.080 1.00 . A A .  14 ARG HA   1 1 
        3  3945 1 1  17 ARG HB2  H   6.545   0.295  11.140 1.00 . A A .  14 ARG HB2  1 1 
        3  3946 1 1  17 ARG HB3  H   6.818   1.609  12.273 1.00 . A A .  14 ARG HB3  1 1 
        3  3947 1 1  17 ARG HD2  H   7.459  -2.103  12.818 1.00 . A A .  14 ARG HD2  1 1 
        3  3948 1 1  17 ARG HD3  H   8.034  -1.722  11.195 1.00 . A A .  14 ARG HD3  1 1 
        3  3949 1 1  17 ARG HE   H  10.269  -1.557  12.771 1.00 . A A .  14 ARG HE   1 1 
        3  3950 1 1  17 ARG HG2  H   8.902   0.435  12.006 1.00 . A A .  14 ARG HG2  1 1 
        3  3951 1 1  17 ARG HG3  H   8.298   0.071  13.623 1.00 . A A .  14 ARG HG3  1 1 
        3  3952 1 1  17 ARG HH11 H   7.893  -4.072  12.156 1.00 . A A .  14 ARG HH11 1 1 
        3  3953 1 1  17 ARG HH12 H   9.021  -5.367  12.389 1.00 . A A .  14 ARG HH12 1 1 
        3  3954 1 1  17 ARG HH21 H  11.761  -3.300  13.030 1.00 . A A .  14 ARG HH21 1 1 
        3  3955 1 1  17 ARG HH22 H  11.200  -4.937  12.883 1.00 . A A .  14 ARG HH22 1 1 
        3  3956 1 1  17 ARG N    N   5.188  -1.371  12.736 1.00 . A A .  14 ARG N    1 1 
        3  3957 1 1  17 ARG NE   N   9.535  -2.180  12.576 1.00 . A A .  14 ARG NE   1 1 
        3  3958 1 1  17 ARG NH1  N   8.826  -4.385  12.359 1.00 . A A .  14 ARG NH1  1 1 
        3  3959 1 1  17 ARG NH2  N  11.015  -3.947  12.851 1.00 . A A .  14 ARG NH2  1 1 
        3  3960 1 1  17 ARG O    O   4.258   2.014  13.508 1.00 . A A .  14 ARG O    1 1 
        3  3961 1 1  18 ARG C    C   1.271   1.241  13.310 1.00 . A A .  15 ARG C    1 1 
        3  3962 1 1  18 ARG CA   C   1.998   1.245  11.952 1.00 . A A .  15 ARG CA   1 1 
        3  3963 1 1  18 ARG CB   C   1.053   0.604  10.886 1.00 . A A .  15 ARG CB   1 1 
        3  3964 1 1  18 ARG CD   C   0.529   0.090   8.419 1.00 . A A .  15 ARG CD   1 1 
        3  3965 1 1  18 ARG CG   C   1.550   0.662   9.431 1.00 . A A .  15 ARG CG   1 1 
        3  3966 1 1  18 ARG CZ   C  -1.486   1.079   7.291 1.00 . A A .  15 ARG CZ   1 1 
        3  3967 1 1  18 ARG H    H   3.439  -0.277  11.529 1.00 . A A .  15 ARG H    1 1 
        3  3968 1 1  18 ARG HA   H   2.209   2.273  11.666 1.00 . A A .  15 ARG HA   1 1 
        3  3969 1 1  18 ARG HB2  H   0.904  -0.440  11.146 1.00 . A A .  15 ARG HB2  1 1 
        3  3970 1 1  18 ARG HB3  H   0.087   1.104  10.934 1.00 . A A .  15 ARG HB3  1 1 
        3  3971 1 1  18 ARG HD2  H   0.985   0.075   7.435 1.00 . A A .  15 ARG HD2  1 1 
        3  3972 1 1  18 ARG HD3  H   0.271  -0.927   8.704 1.00 . A A .  15 ARG HD3  1 1 
        3  3973 1 1  18 ARG HE   H  -0.989   1.310   9.217 1.00 . A A .  15 ARG HE   1 1 
        3  3974 1 1  18 ARG HG2  H   1.754   1.695   9.173 1.00 . A A .  15 ARG HG2  1 1 
        3  3975 1 1  18 ARG HG3  H   2.469   0.097   9.356 1.00 . A A .  15 ARG HG3  1 1 
        3  3976 1 1  18 ARG HH11 H  -0.282   0.084   5.995 1.00 . A A .  15 ARG HH11 1 1 
        3  3977 1 1  18 ARG HH12 H  -1.721   0.764   5.298 1.00 . A A .  15 ARG HH12 1 1 
        3  3978 1 1  18 ARG HH21 H  -2.860   2.166   8.304 1.00 . A A .  15 ARG HH21 1 1 
        3  3979 1 1  18 ARG HH22 H  -3.188   1.943   6.614 1.00 . A A .  15 ARG HH22 1 1 
        3  3980 1 1  18 ARG N    N   3.301   0.532  12.061 1.00 . A A .  15 ARG N    1 1 
        3  3981 1 1  18 ARG NE   N  -0.709   0.893   8.372 1.00 . A A .  15 ARG NE   1 1 
        3  3982 1 1  18 ARG NH1  N  -1.137   0.600   6.100 1.00 . A A .  15 ARG NH1  1 1 
        3  3983 1 1  18 ARG NH2  N  -2.601   1.781   7.413 1.00 . A A .  15 ARG NH2  1 1 
        3  3984 1 1  18 ARG O    O   0.745   2.274  13.752 1.00 . A A .  15 ARG O    1 1 
        3  3985 1 1  19 VAL C    C   1.258   0.583  16.397 1.00 . A A .  16 VAL C    1 1 
        3  3986 1 1  19 VAL CA   C   0.512  -0.112  15.235 1.00 . A A .  16 VAL CA   1 1 
        3  3987 1 1  19 VAL CB   C   0.211  -1.626  15.586 1.00 . A A .  16 VAL CB   1 1 
        3  3988 1 1  19 VAL CG1  C  -0.382  -2.396  14.380 1.00 . A A .  16 VAL CG1  1 1 
        3  3989 1 1  19 VAL CG2  C   1.438  -2.354  16.132 1.00 . A A .  16 VAL CG2  1 1 
        3  3990 1 1  19 VAL H    H   1.725  -0.703  13.589 1.00 . A A .  16 VAL H    1 1 
        3  3991 1 1  19 VAL HA   H  -0.448   0.388  15.113 1.00 . A A .  16 VAL HA   1 1 
        3  3992 1 1  19 VAL HB   H  -0.547  -1.632  16.370 1.00 . A A .  16 VAL HB   1 1 
        3  3993 1 1  19 VAL HG11 H  -1.301  -1.925  14.066 1.00 . A A .  16 VAL HG11 1 1 
        3  3994 1 1  19 VAL HG12 H  -0.589  -3.423  14.659 1.00 . A A .  16 VAL HG12 1 1 
        3  3995 1 1  19 VAL HG13 H   0.322  -2.388  13.556 1.00 . A A .  16 VAL HG13 1 1 
        3  3996 1 1  19 VAL HG21 H   1.168  -3.361  16.422 1.00 . A A .  16 VAL HG21 1 1 
        3  3997 1 1  19 VAL HG22 H   1.824  -1.829  16.996 1.00 . A A .  16 VAL HG22 1 1 
        3  3998 1 1  19 VAL HG23 H   2.204  -2.396  15.371 1.00 . A A .  16 VAL HG23 1 1 
        3  3999 1 1  19 VAL N    N   1.241   0.060  13.968 1.00 . A A .  16 VAL N    1 1 
        3  4000 1 1  19 VAL O    O   0.625   1.185  17.250 1.00 . A A .  16 VAL O    1 1 
        3  4001 1 1  20 PHE C    C   3.369   2.748  17.237 1.00 . A A .  17 PHE C    1 1 
        3  4002 1 1  20 PHE CA   C   3.448   1.214  17.416 1.00 . A A .  17 PHE CA   1 1 
        3  4003 1 1  20 PHE CB   C   4.929   0.706  17.395 1.00