NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
436208 2k0l 15651 cing 4-filtered-FRED STAR entry full 882


data_FRED_restraints_with_modified_coordinates_PDB_code_2k0l

# This FRED archive file contains, for PDB entry <2k0l>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2k0l
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2k0l
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        22529.73

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Outer_membrane_protein_A A . 1 1 
    stop_

save_


save_Outer_membrane_protein_A
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Outer membrane protein A"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  ARIMKAIFVLNAAPKDNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVEWAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRFGQEDAAPVVAPAPAPAPEHHHHHH
    _Entity.Number_of_monomers           216

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 ALA . 1 1 
         2 ARG . 1 1 
         3 ILE . 1 1 
         4 MET . 1 1 
         5 LYS . 1 1 
         6 ALA . 1 1 
         7 ILE . 1 1 
         8 PHE . 1 1 
         9 VAL . 1 1 
        10 LEU . 1 1 
        11 ASN . 1 1 
        12 ALA . 1 1 
        13 ALA . 1 1 
        14 PRO . 1 1 
        15 LYS . 1 1 
        16 ASP . 1 1 
        17 ASN . 1 1 
        18 THR . 1 1 
        19 TRP . 1 1 
        20 TYR . 1 1 
        21 ALA . 1 1 
        22 GLY . 1 1 
        23 GLY . 1 1 
        24 LYS . 1 1 
        25 LEU . 1 1 
        26 GLY . 1 1 
        27 TRP . 1 1 
        28 SER . 1 1 
        29 GLN . 1 1 
        30 TYR . 1 1 
        31 HIS . 1 1 
        32 ASP . 1 1 
        33 THR . 1 1 
        34 GLY . 1 1 
        35 PHE . 1 1 
        36 TYR . 1 1 
        37 GLY . 1 1 
        38 ASN . 1 1 
        39 GLY . 1 1 
        40 PHE . 1 1 
        41 GLN . 1 1 
        42 ASN . 1 1 
        43 ASN . 1 1 
        44 ASN . 1 1 
        45 GLY . 1 1 
        46 PRO . 1 1 
        47 THR . 1 1 
        48 ARG . 1 1 
        49 ASN . 1 1 
        50 ASP . 1 1 
        51 GLN . 1 1 
        52 LEU . 1 1 
        53 GLY . 1 1 
        54 ALA . 1 1 
        55 GLY . 1 1 
        56 ALA . 1 1 
        57 PHE . 1 1 
        58 GLY . 1 1 
        59 GLY . 1 1 
        60 TYR . 1 1 
        61 GLN . 1 1 
        62 VAL . 1 1 
        63 ASN . 1 1 
        64 PRO . 1 1 
        65 TYR . 1 1 
        66 LEU . 1 1 
        67 GLY . 1 1 
        68 PHE . 1 1 
        69 GLU . 1 1 
        70 MET . 1 1 
        71 GLY . 1 1 
        72 TYR . 1 1 
        73 ASP . 1 1 
        74 TRP . 1 1 
        75 LEU . 1 1 
        76 GLY . 1 1 
        77 ARG . 1 1 
        78 MET . 1 1 
        79 ALA . 1 1 
        80 TYR . 1 1 
        81 LYS . 1 1 
        82 GLY . 1 1 
        83 SER . 1 1 
        84 VAL . 1 1 
        85 ASP . 1 1 
        86 ASN . 1 1 
        87 GLY . 1 1 
        88 ALA . 1 1 
        89 PHE . 1 1 
        90 LYS . 1 1 
        91 ALA . 1 1 
        92 GLN . 1 1 
        93 GLY . 1 1 
        94 VAL . 1 1 
        95 GLN . 1 1 
        96 LEU . 1 1 
        97 THR . 1 1 
        98 ALA . 1 1 
        99 LYS . 1 1 
       100 LEU . 1 1 
       101 GLY . 1 1 
       102 TYR . 1 1 
       103 PRO . 1 1 
       104 ILE . 1 1 
       105 THR . 1 1 
       106 ASP . 1 1 
       107 ASP . 1 1 
       108 LEU . 1 1 
       109 ASP . 1 1 
       110 ILE . 1 1 
       111 TYR . 1 1 
       112 THR . 1 1 
       113 ARG . 1 1 
       114 LEU . 1 1 
       115 GLY . 1 1 
       116 GLY . 1 1 
       117 MET . 1 1 
       118 VAL . 1 1 
       119 TRP . 1 1 
       120 ARG . 1 1 
       121 ALA . 1 1 
       122 ASP . 1 1 
       123 SER . 1 1 
       124 LYS . 1 1 
       125 GLY . 1 1 
       126 ASN . 1 1 
       127 TYR . 1 1 
       128 ALA . 1 1 
       129 SER . 1 1 
       130 THR . 1 1 
       131 GLY . 1 1 
       132 VAL . 1 1 
       133 SER . 1 1 
       134 ARG . 1 1 
       135 SER . 1 1 
       136 GLU . 1 1 
       137 HIS . 1 1 
       138 ASP . 1 1 
       139 THR . 1 1 
       140 GLY . 1 1 
       141 VAL . 1 1 
       142 SER . 1 1 
       143 PRO . 1 1 
       144 VAL . 1 1 
       145 PHE . 1 1 
       146 ALA . 1 1 
       147 GLY . 1 1 
       148 GLY . 1 1 
       149 VAL . 1 1 
       150 GLU . 1 1 
       151 TRP . 1 1 
       152 ALA . 1 1 
       153 VAL . 1 1 
       154 THR . 1 1 
       155 ARG . 1 1 
       156 ASP . 1 1 
       157 ILE . 1 1 
       158 ALA . 1 1 
       159 THR . 1 1 
       160 ARG . 1 1 
       161 LEU . 1 1 
       162 GLU . 1 1 
       163 TYR . 1 1 
       164 GLN . 1 1 
       165 TRP . 1 1 
       166 VAL . 1 1 
       167 ASN . 1 1 
       168 ASN . 1 1 
       169 ILE . 1 1 
       170 GLY . 1 1 
       171 ASP . 1 1 
       172 ALA . 1 1 
       173 GLY . 1 1 
       174 THR . 1 1 
       175 VAL . 1 1 
       176 GLY . 1 1 
       177 THR . 1 1 
       178 ARG . 1 1 
       179 PRO . 1 1 
       180 ASP . 1 1 
       181 ASN . 1 1 
       182 GLY . 1 1 
       183 MET . 1 1 
       184 LEU . 1 1 
       185 SER . 1 1 
       186 LEU . 1 1 
       187 GLY . 1 1 
       188 VAL . 1 1 
       189 SER . 1 1 
       190 TYR . 1 1 
       191 ARG . 1 1 
       192 PHE . 1 1 
       193 GLY . 1 1 
       194 GLN . 1 1 
       195 GLU . 1 1 
       196 ASP . 1 1 
       197 ALA . 1 1 
       198 ALA . 1 1 
       199 PRO . 1 1 
       200 VAL . 1 1 
       201 VAL . 1 1 
       202 ALA . 1 1 
       203 PRO . 1 1 
       204 ALA . 1 1 
       205 PRO . 1 1 
       206 ALA . 1 1 
       207 PRO . 1 1 
       208 ALA . 1 1 
       209 PRO . 1 1 
       210 GLU . 1 1 
       211 HIS . 1 1 
       212 HIS . 1 1 
       213 HIS . 1 1 
       214 HIS . 1 1 
       215 HIS . 1 1 
       216 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       ALA   1   1 1 1 
       ARG   2   2 1 1 
       ILE   3   3 1 1 
       MET   4   4 1 1 
       LYS   5   5 1 1 
       ALA   6   6 1 1 
       ILE   7   7 1 1 
       PHE   8   8 1 1 
       VAL   9   9 1 1 
       LEU  10  10 1 1 
       ASN  11  11 1 1 
       ALA  12  12 1 1 
       ALA  13  13 1 1 
       PRO  14  14 1 1 
       LYS  15  15 1 1 
       ASP  16  16 1 1 
       ASN  17  17 1 1 
       THR  18  18 1 1 
       TRP  19  19 1 1 
       TYR  20  20 1 1 
       ALA  21  21 1 1 
       GLY  22  22 1 1 
       GLY  23  23 1 1 
       LYS  24  24 1 1 
       LEU  25  25 1 1 
       GLY  26  26 1 1 
       TRP  27  27 1 1 
       SER  28  28 1 1 
       GLN  29  29 1 1 
       TYR  30  30 1 1 
       HIS  31  31 1 1 
       ASP  32  32 1 1 
       THR  33  33 1 1 
       GLY  34  34 1 1 
       PHE  35  35 1 1 
       TYR  36  36 1 1 
       GLY  37  37 1 1 
       ASN  38  38 1 1 
       GLY  39  39 1 1 
       PHE  40  40 1 1 
       GLN  41  41 1 1 
       ASN  42  42 1 1 
       ASN  43  43 1 1 
       ASN  44  44 1 1 
       GLY  45  45 1 1 
       PRO  46  46 1 1 
       THR  47  47 1 1 
       ARG  48  48 1 1 
       ASN  49  49 1 1 
       ASP  50  50 1 1 
       GLN  51  51 1 1 
       LEU  52  52 1 1 
       GLY  53  53 1 1 
       ALA  54  54 1 1 
       GLY  55  55 1 1 
       ALA  56  56 1 1 
       PHE  57  57 1 1 
       GLY  58  58 1 1 
       GLY  59  59 1 1 
       TYR  60  60 1 1 
       GLN  61  61 1 1 
       VAL  62  62 1 1 
       ASN  63  63 1 1 
       PRO  64  64 1 1 
       TYR  65  65 1 1 
       LEU  66  66 1 1 
       GLY  67  67 1 1 
       PHE  68  68 1 1 
       GLU  69  69 1 1 
       MET  70  70 1 1 
       GLY  71  71 1 1 
       TYR  72  72 1 1 
       ASP  73  73 1 1 
       TRP  74  74 1 1 
       LEU  75  75 1 1 
       GLY  76  76 1 1 
       ARG  77  77 1 1 
       MET  78  78 1 1 
       ALA  79  79 1 1 
       TYR  80  80 1 1 
       LYS  81  81 1 1 
       GLY  82  82 1 1 
       SER  83  83 1 1 
       VAL  84  84 1 1 
       ASP  85  85 1 1 
       ASN  86  86 1 1 
       GLY  87  87 1 1 
       ALA  88  88 1 1 
       PHE  89  89 1 1 
       LYS  90  90 1 1 
       ALA  91  91 1 1 
       GLN  92  92 1 1 
       GLY  93  93 1 1 
       VAL  94  94 1 1 
       GLN  95  95 1 1 
       LEU  96  96 1 1 
       THR  97  97 1 1 
       ALA  98  98 1 1 
       LYS  99  99 1 1 
       LEU 100 100 1 1 
       GLY 101 101 1 1 
       TYR 102 102 1 1 
       PRO 103 103 1 1 
       ILE 104 104 1 1 
       THR 105 105 1 1 
       ASP 106 106 1 1 
       ASP 107 107 1 1 
       LEU 108 108 1 1 
       ASP 109 109 1 1 
       ILE 110 110 1 1 
       TYR 111 111 1 1 
       THR 112 112 1 1 
       ARG 113 113 1 1 
       LEU 114 114 1 1 
       GLY 115 115 1 1 
       GLY 116 116 1 1 
       MET 117 117 1 1 
       VAL 118 118 1 1 
       TRP 119 119 1 1 
       ARG 120 120 1 1 
       ALA 121 121 1 1 
       ASP 122 122 1 1 
       SER 123 123 1 1 
       LYS 124 124 1 1 
       GLY 125 125 1 1 
       ASN 126 126 1 1 
       TYR 127 127 1 1 
       ALA 128 128 1 1 
       SER 129 129 1 1 
       THR 130 130 1 1 
       GLY 131 131 1 1 
       VAL 132 132 1 1 
       SER 133 133 1 1 
       ARG 134 134 1 1 
       SER 135 135 1 1 
       GLU 136 136 1 1 
       HIS 137 137 1 1 
       ASP 138 138 1 1 
       THR 139 139 1 1 
       GLY 140 140 1 1 
       VAL 141 141 1 1 
       SER 142 142 1 1 
       PRO 143 143 1 1 
       VAL 144 144 1 1 
       PHE 145 145 1 1 
       ALA 146 146 1 1 
       GLY 147 147 1 1 
       GLY 148 148 1 1 
       VAL 149 149 1 1 
       GLU 150 150 1 1 
       TRP 151 151 1 1 
       ALA 152 152 1 1 
       VAL 153 153 1 1 
       THR 154 154 1 1 
       ARG 155 155 1 1 
       ASP 156 156 1 1 
       ILE 157 157 1 1 
       ALA 158 158 1 1 
       THR 159 159 1 1 
       ARG 160 160 1 1 
       LEU 161 161 1 1 
       GLU 162 162 1 1 
       TYR 163 163 1 1 
       GLN 164 164 1 1 
       TRP 165 165 1 1 
       VAL 166 166 1 1 
       ASN 167 167 1 1 
       ASN 168 168 1 1 
       ILE 169 169 1 1 
       GLY 170 170 1 1 
       ASP 171 171 1 1 
       ALA 172 172 1 1 
       GLY 173 173 1 1 
       THR 174 174 1 1 
       VAL 175 175 1 1 
       GLY 176 176 1 1 
       THR 177 177 1 1 
       ARG 178 178 1 1 
       PRO 179 179 1 1 
       ASP 180 180 1 1 
       ASN 181 181 1 1 
       GLY 182 182 1 1 
       MET 183 183 1 1 
       LEU 184 184 1 1 
       SER 185 185 1 1 
       LEU 186 186 1 1 
       GLY 187 187 1 1 
       VAL 188 188 1 1 
       SER 189 189 1 1 
       TYR 190 190 1 1 
       ARG 191 191 1 1 
       PHE 192 192 1 1 
       GLY 193 193 1 1 
       GLN 194 194 1 1 
       GLU 195 195 1 1 
       ASP 196 196 1 1 
       ALA 197 197 1 1 
       ALA 198 198 1 1 
       PRO 199 199 1 1 
       VAL 200 200 1 1 
       VAL 201 201 1 1 
       ALA 202 202 1 1 
       PRO 203 203 1 1 
       ALA 204 204 1 1 
       PRO 205 205 1 1 
       ALA 206 206 1 1 
       PRO 207 207 1 1 
       ALA 208 208 1 1 
       PRO 209 209 1 1 
       GLU 210 210 1 1 
       HIS 211 211 1 1 
       HIS 212 212 1 1 
       HIS 213 213 1 1 
       HIS 214 214 1 1 
       HIS 215 215 1 1 
       HIS 216 216 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1  18 THR H   .  18 . HN   1 1 
         1 1 2 1 1  61 GLN H   .  61 . HN   1 1 
         2 1 1 1 1  19 TRP H   .  19 . HN   1 1 
         2 1 2 1 1 192 PHE H   . 192 . HN   1 1 
         3 1 1 1 1  20 TYR H   .  20 . HN   1 1 
         3 1 2 1 1  59 GLY H   .  59 . HN   1 1 
         4 1 1 1 1  21 ALA H   .  21 . HN   1 1 
         4 1 2 1 1 190 TYR H   . 190 . HN   1 1 
         5 1 1 1 1  22 GLY H   .  22 . HN   1 1 
         5 1 2 1 1  57 PHE H   .  57 . HN   1 1 
         6 1 1 1 1  23 GLY H   .  23 . HN   1 1 
         6 1 2 1 1 188 VAL H   . 188 . HN   1 1 
         7 1 1 1 1  24 LYS H   .  24 . HN   1 1 
         7 1 2 1 1  55 GLY H   .  55 . HN   1 1 
         8 1 1 1 1  25 LEU H   .  25 . HN   1 1 
         8 1 2 1 1 186 LEU H   . 186 . HN   1 1 
         9 1 1 1 1  26 GLY H   .  26 . HN   1 1 
         9 1 2 1 1  53 GLY H   .  53 . HN   1 1 
        10 1 1 1 1  27 TRP H   .  27 . HN   1 1 
        10 1 2 1 1 184 LEU H   . 184 . HN   1 1 
        11 1 1 1 1  54 ALA H   .  54 . HN   1 1 
        11 1 2 1 1  74 TRP H   .  74 . HN   1 1 
        12 1 1 1 1  56 ALA H   .  56 . HN   1 1 
        12 1 2 1 1  72 TYR H   .  72 . HN   1 1 
        13 1 1 1 1  58 GLY H   .  58 . HN   1 1 
        13 1 2 1 1  70 MET H   .  70 . HN   1 1 
        14 1 1 1 1  60 TYR H   .  60 . HN   1 1 
        14 1 2 1 1  68 PHE H   .  68 . HN   1 1 
        15 1 1 1 1  62 VAL H   .  62 . HN   1 1 
        15 1 2 1 1  66 LEU H   .  66 . HN   1 1 
        16 1 1 1 1  69 GLU H   .  69 . HN   1 1 
        16 1 2 1 1  97 THR H   .  97 . HN   1 1 
        17 1 1 1 1  71 GLY H   .  71 . HN   1 1 
        17 1 2 1 1  95 GLN H   .  95 . HN   1 1 
        18 1 1 1 1  92 GLN H   .  92 . HN   1 1 
        18 1 2 1 1 120 ARG H   . 120 . HN   1 1 
        19 1 1 1 1  94 VAL H   .  94 . HN   1 1 
        19 1 2 1 1 118 VAL H   . 118 . HN   1 1 
        20 1 1 1 1  96 LEU H   .  96 . HN   1 1 
        20 1 2 1 1 116 GLY H   . 116 . HN   1 1 
        21 1 1 1 1  98 ALA H   .  98 . HN   1 1 
        21 1 2 1 1 114 LEU H   . 114 . HN   1 1 
        22 1 1 1 1 100 LEU H   . 100 . HN   1 1 
        22 1 2 1 1 112 THR H   . 112 . HN   1 1 
        23 1 1 1 1 102 TYR H   . 102 . HN   1 1 
        23 1 2 1 1 110 ILE H   . 110 . HN   1 1 
        24 1 1 1 1 104 ILE H   . 104 . HN   1 1 
        24 1 2 1 1 108 LEU H   . 108 . HN   1 1 
        25 1 1 1 1 109 ASP H   . 109 . HN   1 1 
        25 1 2 1 1 150 GLU H   . 150 . HN   1 1 
        26 1 1 1 1 111 TYR H   . 111 . HN   1 1 
        26 1 2 1 1 148 GLY H   . 148 . HN   1 1 
        27 1 1 1 1 113 ARG H   . 113 . HN   1 1 
        27 1 2 1 1 146 ALA H   . 146 . HN   1 1 
        28 1 1 1 1 115 GLY H   . 115 . HN   1 1 
        28 1 2 1 1 144 VAL H   . 144 . HN   1 1 
        29 1 1 1 1 117 MET H   . 117 . HN   1 1 
        29 1 2 1 1 142 SER H   . 142 . HN   1 1 
        30 1 1 1 1 121 ALA H   . 121 . HN   1 1 
        30 1 2 1 1 138 ASP H   . 138 . HN   1 1 
        31 1 1 1 1 147 GLY H   . 147 . HN   1 1 
        31 1 2 1 1 163 TYR H   . 163 . HN   1 1 
        32 1 1 1 1 149 VAL H   . 149 . HN   1 1 
        32 1 2 1 1 161 LEU H   . 161 . HN   1 1 
        33 1 1 1 1 151 TRP H   . 151 . HN   1 1 
        33 1 2 1 1 159 THR H   . 159 . HN   1 1 
        34 1 1 1 1 153 VAL H   . 153 . HN   1 1 
        34 1 2 1 1 157 ILE H   . 157 . HN   1 1 
        35 1 1 1 1 158 ALA H   . 158 . HN   1 1 
        35 1 2 1 1 189 SER H   . 189 . HN   1 1 
        36 1 1 1 1 160 ARG H   . 160 . HN   1 1 
        36 1 2 1 1 187 GLY H   . 187 . HN   1 1 
        37 1 1 1 1 162 GLU H   . 162 . HN   1 1 
        37 1 2 1 1 185 SER H   . 185 . HN   1 1 
        38 1 1 1 1  86 ASN H   .  86 . HN   1 1 
        38 1 2 1 1 126 ASN H   . 126 . HN   1 1 
        39 1 1 1 1   7 ILE H   .   7 . HN   1 1 
        39 1 2 1 1   8 PHE H   .   8 . HN   1 1 
        40 1 1 1 1   8 PHE H   .   8 . HN   1 1 
        40 1 2 1 1   9 VAL H   .   9 . HN   1 1 
        41 1 1 1 1   9 VAL H   .   9 . HN   1 1 
        41 1 2 1 1  10 LEU H   .  10 . HN   1 1 
        42 1 1 1 1  10 LEU H   .  10 . HN   1 1 
        42 1 2 1 1  11 ASN H   .  11 . HN   1 1 
        43 1 1 1 1  11 ASN H   .  11 . HN   1 1 
        43 1 2 1 1  12 ALA H   .  12 . HN   1 1 
        44 1 1 1 1  12 ALA H   .  12 . HN   1 1 
        44 1 2 1 1  13 ALA H   .  13 . HN   1 1 
        45 1 1 1 1  15 LYS H   .  15 . HN   1 1 
        45 1 2 1 1  16 ASP H   .  16 . HN   1 1 
        46 1 1 1 1  16 ASP H   .  16 . HN   1 1 
        46 1 2 1 1  17 ASN H   .  17 . HN   1 1 
        47 1 1 1 1  17 ASN H   .  17 . HN   1 1 
        47 1 2 1 1  18 THR H   .  18 . HN   1 1 
        48 1 1 1 1  18 THR H   .  18 . HN   1 1 
        48 1 2 1 1  19 TRP H   .  19 . HN   1 1 
        49 1 1 1 1  19 TRP H   .  19 . HN   1 1 
        49 1 2 1 1  20 TYR H   .  20 . HN   1 1 
        50 1 1 1 1  20 TYR H   .  20 . HN   1 1 
        50 1 2 1 1  21 ALA H   .  21 . HN   1 1 
        51 1 1 1 1  21 ALA H   .  21 . HN   1 1 
        51 1 2 1 1  22 GLY H   .  22 . HN   1 1 
        52 1 1 1 1  22 GLY H   .  22 . HN   1 1 
        52 1 2 1 1  23 GLY H   .  23 . HN   1 1 
        53 1 1 1 1  23 GLY H   .  23 . HN   1 1 
        53 1 2 1 1  24 LYS H   .  24 . HN   1 1 
        54 1 1 1 1  24 LYS H   .  24 . HN   1 1 
        54 1 2 1 1  25 LEU H   .  25 . HN   1 1 
        55 1 1 1 1  33 THR H   .  33 . HN   1 1 
        55 1 2 1 1  34 GLY H   .  34 . HN   1 1 
        56 1 1 1 1  34 GLY H   .  34 . HN   1 1 
        56 1 2 1 1  35 PHE H   .  35 . HN   1 1 
        57 1 1 1 1  35 PHE H   .  35 . HN   1 1 
        57 1 2 1 1  36 TYR H   .  36 . HN   1 1 
        58 1 1 1 1  43 ASN H   .  43 . HN   1 1 
        58 1 2 1 1  44 ASN H   .  44 . HN   1 1 
        59 1 1 1 1  49 ASN H   .  49 . HN   1 1 
        59 1 2 1 1  50 ASP H   .  50 . HN   1 1 
        60 1 1 1 1  50 ASP H   .  50 . HN   1 1 
        60 1 2 1 1  51 GLN H   .  51 . HN   1 1 
        61 1 1 1 1  56 ALA H   .  56 . HN   1 1 
        61 1 2 1 1  57 PHE H   .  57 . HN   1 1 
        62 1 1 1 1  57 PHE H   .  57 . HN   1 1 
        62 1 2 1 1  58 GLY H   .  58 . HN   1 1 
        63 1 1 1 1  58 GLY H   .  58 . HN   1 1 
        63 1 2 1 1  59 GLY H   .  59 . HN   1 1 
        64 1 1 1 1  59 GLY H   .  59 . HN   1 1 
        64 1 2 1 1  60 TYR H   .  60 . HN   1 1 
        65 1 1 1 1  60 TYR H   .  60 . HN   1 1 
        65 1 2 1 1  61 GLN H   .  61 . HN   1 1 
        66 1 1 1 1  67 GLY H   .  67 . HN   1 1 
        66 1 2 1 1  68 PHE H   .  68 . HN   1 1 
        67 1 1 1 1  68 PHE H   .  68 . HN   1 1 
        67 1 2 1 1  69 GLU H   .  69 . HN   1 1 
        68 1 1 1 1  69 GLU H   .  69 . HN   1 1 
        68 1 2 1 1  70 MET H   .  70 . HN   1 1 
        69 1 1 1 1  70 MET H   .  70 . HN   1 1 
        69 1 2 1 1  71 GLY H   .  71 . HN   1 1 
        70 1 1 1 1  84 VAL H   .  84 . HN   1 1 
        70 1 2 1 1  85 ASP H   .  85 . HN   1 1 
        71 1 1 1 1  85 ASP H   .  85 . HN   1 1 
        71 1 2 1 1  86 ASN H   .  86 . HN   1 1 
        72 1 1 1 1  86 ASN H   .  86 . HN   1 1 
        72 1 2 1 1  87 GLY H   .  87 . HN   1 1 
        73 1 1 1 1  87 GLY H   .  87 . HN   1 1 
        73 1 2 1 1  88 ALA H   .  88 . HN   1 1 
        74 1 1 1 1  95 GLN H   .  95 . HN   1 1 
        74 1 2 1 1  96 LEU H   .  96 . HN   1 1 
        75 1 1 1 1  96 LEU H   .  96 . HN   1 1 
        75 1 2 1 1  97 THR H   .  97 . HN   1 1 
        76 1 1 1 1  97 THR H   .  97 . HN   1 1 
        76 1 2 1 1  98 ALA H   .  98 . HN   1 1 
        77 1 1 1 1  98 ALA H   .  98 . HN   1 1 
        77 1 2 1 1  99 LYS H   .  99 . HN   1 1 
        78 1 1 1 1  99 LYS H   .  99 . HN   1 1 
        78 1 2 1 1 100 LEU H   . 100 . HN   1 1 
        79 1 1 1 1 100 LEU H   . 100 . HN   1 1 
        79 1 2 1 1 101 GLY H   . 101 . HN   1 1 
        80 1 1 1 1 101 GLY H   . 101 . HN   1 1 
        80 1 2 1 1 102 TYR H   . 102 . HN   1 1 
        81 1 1 1 1 108 LEU H   . 108 . HN   1 1 
        81 1 2 1 1 109 ASP H   . 109 . HN   1 1 
        82 1 1 1 1 109 ASP H   . 109 . HN   1 1 
        82 1 2 1 1 110 ILE H   . 110 . HN   1 1 
        83 1 1 1 1 110 ILE H   . 110 . HN   1 1 
        83 1 2 1 1 111 TYR H   . 111 . HN   1 1 
        84 1 1 1 1 111 TYR H   . 111 . HN   1 1 
        84 1 2 1 1 112 THR H   . 112 . HN   1 1 
        85 1 1 1 1 112 THR H   . 112 . HN   1 1 
        85 1 2 1 1 113 ARG H   . 113 . HN   1 1 
        86 1 1 1 1 113 ARG H   . 113 . HN   1 1 
        86 1 2 1 1 114 LEU H   . 114 . HN   1 1 
        87 1 1 1 1 114 LEU H   . 114 . HN   1 1 
        87 1 2 1 1 115 GLY H   . 115 . HN   1 1 
        88 1 1 1 1 115 GLY H   . 115 . HN   1 1 
        88 1 2 1 1 116 GLY H   . 116 . HN   1 1 
        89 1 1 1 1 116 GLY H   . 116 . HN   1 1 
        89 1 2 1 1 117 MET H   . 117 . HN   1 1 
        90 1 1 1 1 119 TRP H   . 119 . HN   1 1 
        90 1 2 1 1 120 ARG H   . 120 . HN   1 1 
        91 1 1 1 1 138 ASP H   . 138 . HN   1 1 
        91 1 2 1 1 139 THR H   . 139 . HN   1 1 
        92 1 1 1 1 147 GLY H   . 147 . HN   1 1 
        92 1 2 1 1 148 GLY H   . 148 . HN   1 1 
        93 1 1 1 1 148 GLY H   . 148 . HN   1 1 
        93 1 2 1 1 149 VAL H   . 149 . HN   1 1 
        94 1 1 1 1 149 VAL H   . 149 . HN   1 1 
        94 1 2 1 1 150 GLU H   . 150 . HN   1 1 
        95 1 1 1 1 150 GLU H   . 150 . HN   1 1 
        95 1 2 1 1 151 TRP H   . 151 . HN   1 1 
        96 1 1 1 1 151 TRP H   . 151 . HN   1 1 
        96 1 2 1 1 152 ALA H   . 152 . HN   1 1 
        97 1 1 1 1 152 ALA H   . 152 . HN   1 1 
        97 1 2 1 1 153 VAL H   . 153 . HN   1 1 
        98 1 1 1 1 158 ALA H   . 158 . HN   1 1 
        98 1 2 1 1 159 THR H   . 159 . HN   1 1 
        99 1 1 1 1 159 THR H   . 159 . HN   1 1 
        99 1 2 1 1 160 ARG H   . 160 . HN   1 1 
       100 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       100 1 2 1 1 161 LEU H   . 161 . HN   1 1 
       101 1 1 1 1 161 LEU H   . 161 . HN   1 1 
       101 1 2 1 1 162 GLU H   . 162 . HN   1 1 
       102 1 1 1 1 162 GLU H   . 162 . HN   1 1 
       102 1 2 1 1 163 TYR H   . 163 . HN   1 1 
       103 1 1 1 1 172 ALA H   . 172 . HN   1 1 
       103 1 2 1 1 173 GLY H   . 173 . HN   1 1 
       104 1 1 1 1 186 LEU H   . 186 . HN   1 1 
       104 1 2 1 1 187 GLY H   . 187 . HN   1 1 
       105 1 1 1 1 187 GLY H   . 187 . HN   1 1 
       105 1 2 1 1 188 VAL H   . 188 . HN   1 1 
       106 1 1 1 1 188 VAL H   . 188 . HN   1 1 
       106 1 2 1 1 189 SER H   . 189 . HN   1 1 
       107 1 1 1 1 189 SER H   . 189 . HN   1 1 
       107 1 2 1 1 190 TYR H   . 190 . HN   1 1 
       108 1 1 1 1 190 TYR H   . 190 . HN   1 1 
       108 1 2 1 1 191 ARG H   . 191 . HN   1 1 
       109 1 1 1 1 191 ARG H   . 191 . HN   1 1 
       109 1 2 1 1 192 PHE H   . 192 . HN   1 1 
       110 1 1 1 1 192 PHE H   . 192 . HN   1 1 
       110 1 2 1 1 193 GLY H   . 193 . HN   1 1 
       111 1 1 1 1 193 GLY H   . 193 . HN   1 1 
       111 1 2 1 1 194 GLN H   . 194 . HN   1 1 
       112 1 1 1 1 194 GLN H   . 194 . HN   1 1 
       112 1 2 1 1 195 GLU H   . 195 . HN   1 1 
       113 1 1 1 1 195 GLU H   . 195 . HN   1 1 
       113 1 2 1 1 196 ASP H   . 196 . HN   1 1 
       114 1 1 1 1 196 ASP H   . 196 . HN   1 1 
       114 1 2 1 1 197 ALA H   . 197 . HN   1 1 
       115 1 1 1 1 200 VAL H   . 200 . HN   1 1 
       115 1 2 1 1 201 VAL H   . 201 . HN   1 1 
       116 1 1 1 1 201 VAL H   . 201 . HN   1 1 
       116 1 2 1 1 202 ALA H   . 202 . HN   1 1 
       117 1 1 1 1  62 VAL H   .  62 . HN   1 1 
       117 1 2 1 1  65 TYR H   .  65 . HN   1 1 
       118 1 1 1 1  63 ASN H   .  63 . HN   1 1 
       118 1 2 1 1  65 TYR H   .  65 . HN   1 1 
       119 1 1 1 1  63 ASN H   .  63 . HN   1 1 
       119 1 2 1 1  66 LEU H   .  66 . HN   1 1 
       120 1 1 1 1  65 TYR H   .  65 . HN   1 1 
       120 1 2 1 1  67 GLY H   .  67 . HN   1 1 
       121 1 1 1 1 105 THR H   . 105 . HN   1 1 
       121 1 2 1 1 107 ASP H   . 107 . HN   1 1 
       122 1 1 1 1 105 THR H   . 105 . HN   1 1 
       122 1 2 1 1 108 LEU H   . 108 . HN   1 1 
       123 1 1 1 1 106 ASP H   . 106 . HN   1 1 
       123 1 2 1 1 108 LEU H   . 108 . HN   1 1 
       124 1 1 1 1 153 VAL H   . 153 . HN   1 1 
       124 1 2 1 1 156 ASP H   . 156 . HN   1 1 
       125 1 1 1 1 154 THR H   . 154 . HN   1 1 
       125 1 2 1 1 156 ASP H   . 156 . HN   1 1 
       126 1 1 1 1 154 THR H   . 154 . HN   1 1 
       126 1 2 1 1 157 ILE H   . 157 . HN   1 1 
       127 1 1 1 1 155 ARG H   . 155 . HN   1 1 
       127 1 2 1 1 157 ILE H   . 157 . HN   1 1 
       128 1 1 1 1  17 ASN H   .  17 . HN   1 1 
       128 1 2 1 1  61 GLN H   .  61 . HN   1 1 
       129 1 1 1 1  19 TRP H   .  19 . HN   1 1 
       129 1 2 1 1  61 GLN H   .  61 . HN   1 1 
       130 1 1 1 1  20 TYR H   .  20 . HN   1 1 
       130 1 2 1 1  58 GLY H   .  58 . HN   1 1 
       131 1 1 1 1  20 TYR H   .  20 . HN   1 1 
       131 1 2 1 1  60 TYR H   .  60 . HN   1 1 
       132 1 1 1 1  21 ALA H   .  21 . HN   1 1 
       132 1 2 1 1  59 GLY H   .  59 . HN   1 1 
       133 1 1 1 1  21 ALA H   .  21 . HN   1 1 
       133 1 2 1 1 189 SER H   . 189 . HN   1 1 
       134 1 1 1 1  21 ALA H   .  21 . HN   1 1 
       134 1 2 1 1 191 ARG H   . 191 . HN   1 1 
       135 1 1 1 1  21 ALA H   .  21 . HN   1 1 
       135 1 2 1 1 192 PHE H   . 192 . HN   1 1 
       136 1 1 1 1  22 GLY H   .  22 . HN   1 1 
       136 1 2 1 1 190 TYR H   . 190 . HN   1 1 
       137 1 1 1 1  23 GLY H   .  23 . HN   1 1 
       137 1 2 1 1  55 GLY H   .  55 . HN   1 1 
       138 1 1 1 1  23 GLY H   .  23 . HN   1 1 
       138 1 2 1 1 189 SER H   . 189 . HN   1 1 
       139 1 1 1 1  25 LEU H   .  25 . HN   1 1 
       139 1 2 1 1  55 GLY H   .  55 . HN   1 1 
       140 1 1 1 1  22 GLY H   .  22 . HN   1 1 
       140 1 2 1 1  58 GLY H   .  58 . HN   1 1 
       141 1 1 1 1  19 TRP H   .  19 . HN   1 1 
       141 1 2 1 1  59 GLY H   .  59 . HN   1 1 
       142 1 1 1 1  62 VAL H   .  62 . HN   1 1 
       142 1 2 1 1  67 GLY H   .  67 . HN   1 1 
       143 1 1 1 1  67 GLY H   .  67 . HN   1 1 
       143 1 2 1 1  98 ALA H   .  98 . HN   1 1 
       144 1 1 1 1  62 VAL H   .  62 . HN   1 1 
       144 1 2 1 1  68 PHE H   .  68 . HN   1 1 
       145 1 1 1 1  68 PHE H   .  68 . HN   1 1 
       145 1 2 1 1  99 LYS H   .  99 . HN   1 1 
       146 1 1 1 1  60 TYR H   .  60 . HN   1 1 
       146 1 2 1 1  69 GLU H   .  69 . HN   1 1 
       147 1 1 1 1  69 GLU H   .  69 . HN   1 1 
       147 1 2 1 1  98 ALA H   .  98 . HN   1 1 
       148 1 1 1 1  98 ALA H   .  98 . HN   1 1 
       148 1 2 1 1 115 GLY H   . 115 . HN   1 1 
       149 1 1 1 1  69 GLU H   .  69 . HN   1 1 
       149 1 2 1 1  99 LYS H   .  99 . HN   1 1 
       150 1 1 1 1  99 LYS H   .  99 . HN   1 1 
       150 1 2 1 1 114 LEU H   . 114 . HN   1 1 
       151 1 1 1 1 102 TYR H   . 102 . HN   1 1 
       151 1 2 1 1 111 TYR H   . 111 . HN   1 1 
       152 1 1 1 1 104 ILE H   . 104 . HN   1 1 
       152 1 2 1 1 110 ILE H   . 110 . HN   1 1 
       153 1 1 1 1 105 THR H   . 105 . HN   1 1 
       153 1 2 1 1 110 ILE H   . 110 . HN   1 1 
       154 1 1 1 1 110 ILE H   . 110 . HN   1 1 
       154 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       155 1 1 1 1 111 TYR H   . 111 . HN   1 1 
       155 1 2 1 1 149 VAL H   . 149 . HN   1 1 
       156 1 1 1 1 101 GLY H   . 101 . HN   1 1 
       156 1 2 1 1 112 THR H   . 112 . HN   1 1 
       157 1 1 1 1 100 LEU H   . 100 . HN   1 1 
       157 1 2 1 1 114 LEU H   . 114 . HN   1 1 
       158 1 1 1 1 119 TRP H   . 119 . HN   1 1 
       158 1 2 1 1 141 VAL H   . 141 . HN   1 1 
       159 1 1 1 1 116 GLY H   . 116 . HN   1 1 
       159 1 2 1 1 144 VAL H   . 144 . HN   1 1 
       160 1 1 1 1 148 GLY H   . 148 . HN   1 1 
       160 1 2 1 1 163 TYR H   . 163 . HN   1 1 
       161 1 1 1 1 152 ALA H   . 152 . HN   1 1 
       161 1 2 1 1 159 THR H   . 159 . HN   1 1 
       162 1 1 1 1 153 VAL H   . 153 . HN   1 1 
       162 1 2 1 1 159 THR H   . 159 . HN   1 1 
       163 1 1 1 1 154 THR H   . 154 . HN   1 1 
       163 1 2 1 1 159 THR H   . 159 . HN   1 1 
       164 1 1 1 1 153 VAL H   . 153 . HN   1 1 
       164 1 2 1 1 158 ALA H   . 158 . HN   1 1 
       165 1 1 1 1 158 ALA H   . 158 . HN   1 1 
       165 1 2 1 1 191 ARG H   . 191 . HN   1 1 
       166 1 1 1 1 159 THR H   . 159 . HN   1 1 
       166 1 2 1 1 189 SER H   . 189 . HN   1 1 
       167 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       167 1 2 1 1 188 VAL H   . 188 . HN   1 1 
       168 1 1 1 1 150 GLU H   . 150 . HN   1 1 
       168 1 2 1 1 161 LEU H   . 161 . HN   1 1 
       169 1 1 1 1 151 TRP H   . 151 . HN   1 1 
       169 1 2 1 1 161 LEU H   . 161 . HN   1 1 
       170 1 1 1 1 158 ALA H   . 158 . HN   1 1 
       170 1 2 1 1 190 TYR H   . 190 . HN   1 1 
       171 1 1 1 1  19 TRP H   .  19 . HN   1 1 
       171 1 2 1 1 191 ARG H   . 191 . HN   1 1 
       172 1 1 1 1  18 THR H   .  18 . HN   1 1 
       172 1 2 1 1 192 PHE H   . 192 . HN   1 1 
       173 1 1 1 1  20 TYR H   .  20 . HN   1 1 
       173 1 2 1 1 192 PHE H   . 192 . HN   1 1 
       174 1 1 1 1  23 GLY H   .  23 . HN   1 1 
       174 1 2 1 1  25 LEU MD1 .  25 . HD1# 1 1 
       175 1 1 1 1  24 LYS H   .  24 . HN   1 1 
       175 1 2 1 1  25 LEU MD1 .  25 . HD1# 1 1 
       176 1 1 1 1  25 LEU MD1 .  25 . HD1# 1 1 
       176 1 2 1 1  55 GLY H   .  55 . HN   1 1 
       177 1 1 1 1  25 LEU MD2 .  25 . HD2# 1 1 
       177 1 2 1 1  55 GLY H   .  55 . HN   1 1 
       178 1 1 1 1  25 LEU MD2 .  25 . HD2# 1 1 
       178 1 2 1 1 184 LEU H   . 184 . HN   1 1 
       179 1 1 1 1  52 LEU MD2 .  52 . HD2# 1 1 
       179 1 2 1 1  53 GLY H   .  53 . HN   1 1 
       180 1 1 1 1  26 GLY H   .  26 . HN   1 1 
       180 1 2 1 1  52 LEU MD2 .  52 . HD2# 1 1 
       181 1 1 1 1  60 TYR H   .  60 . HN   1 1 
       181 1 2 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       182 1 1 1 1  60 TYR H   .  60 . HN   1 1 
       182 1 2 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       183 1 1 1 1  61 GLN H   .  61 . HN   1 1 
       183 1 2 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       184 1 1 1 1  61 GLN H   .  61 . HN   1 1 
       184 1 2 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       185 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       185 1 2 1 1  63 ASN H   .  63 . HN   1 1 
       186 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       186 1 2 1 1  63 ASN H   .  63 . HN   1 1 
       187 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       187 1 2 1 1  65 TYR H   .  65 . HN   1 1 
       188 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       188 1 2 1 1  65 TYR H   .  65 . HN   1 1 
       189 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       189 1 2 1 1  66 LEU H   .  66 . HN   1 1 
       190 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       190 1 2 1 1  66 LEU H   .  66 . HN   1 1 
       191 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       191 1 2 1 1  67 GLY H   .  67 . HN   1 1 
       192 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       192 1 2 1 1  67 GLY H   .  67 . HN   1 1 
       193 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       193 1 2 1 1  68 PHE H   .  68 . HN   1 1 
       194 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       194 1 2 1 1  68 PHE H   .  68 . HN   1 1 
       195 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       195 1 2 1 1  99 LYS H   .  99 . HN   1 1 
       196 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       196 1 2 1 1  99 LYS H   .  99 . HN   1 1 
       197 1 1 1 1  60 TYR H   .  60 . HN   1 1 
       197 1 2 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       198 1 1 1 1  62 VAL H   .  62 . HN   1 1 
       198 1 2 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       199 1 1 1 1  62 VAL H   .  62 . HN   1 1 
       199 1 2 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       200 1 1 1 1  63 ASN H   .  63 . HN   1 1 
       200 1 2 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       201 1 1 1 1  63 ASN H   .  63 . HN   1 1 
       201 1 2 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       202 1 1 1 1  65 TYR H   .  65 . HN   1 1 
       202 1 2 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       203 1 1 1 1  65 TYR H   .  65 . HN   1 1 
       203 1 2 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       204 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       204 1 2 1 1  67 GLY H   .  67 . HN   1 1 
       205 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       205 1 2 1 1  67 GLY H   .  67 . HN   1 1 
       206 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       206 1 2 1 1  68 PHE H   .  68 . HN   1 1 
       207 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       207 1 2 1 1  68 PHE H   .  68 . HN   1 1 
       208 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       208 1 2 1 1  69 GLU H   .  69 . HN   1 1 
       209 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       209 1 2 1 1  98 ALA H   .  98 . HN   1 1 
       210 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       210 1 2 1 1  99 LYS H   .  99 . HN   1 1 
       211 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       211 1 2 1 1  99 LYS H   .  99 . HN   1 1 
       212 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       212 1 2 1 1 100 LEU H   . 100 . HN   1 1 
       213 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       213 1 2 1 1 101 GLY H   . 101 . HN   1 1 
       214 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       214 1 2 1 1 101 GLY H   . 101 . HN   1 1 
       215 1 1 1 1  84 VAL MG1 .  84 . HG1# 1 1 
       215 1 2 1 1  85 ASP H   .  85 . HN   1 1 
       216 1 1 1 1  84 VAL MG2 .  84 . HG2# 1 1 
       216 1 2 1 1  85 ASP H   .  85 . HN   1 1 
       217 1 1 1 1  84 VAL MG1 .  84 . HG1# 1 1 
       217 1 2 1 1  86 ASN H   .  86 . HN   1 1 
       218 1 1 1 1  84 VAL MG2 .  84 . HG2# 1 1 
       218 1 2 1 1  86 ASN H   .  86 . HN   1 1 
       219 1 1 1 1  71 GLY H   .  71 . HN   1 1 
       219 1 2 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       220 1 1 1 1  71 GLY H   .  71 . HN   1 1 
       220 1 2 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       221 1 1 1 1  72 TYR H   .  72 . HN   1 1 
       221 1 2 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       222 1 1 1 1  72 TYR H   .  72 . HN   1 1 
       222 1 2 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       223 1 1 1 1  73 ASP H   .  73 . HN   1 1 
       223 1 2 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       224 1 1 1 1  73 ASP H   .  73 . HN   1 1 
       224 1 2 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       225 1 1 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       225 1 2 1 1  95 GLN H   .  95 . HN   1 1 
       226 1 1 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       226 1 2 1 1  95 GLN H   .  95 . HN   1 1 
       227 1 1 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       227 1 2 1 1 118 VAL H   . 118 . HN   1 1 
       228 1 1 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       228 1 2 1 1 118 VAL H   . 118 . HN   1 1 
       229 1 1 1 1  69 GLU H   .  69 . HN   1 1 
       229 1 2 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       230 1 1 1 1  69 GLU H   .  69 . HN   1 1 
       230 1 2 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       231 1 1 1 1  70 MET H   .  70 . HN   1 1 
       231 1 2 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       232 1 1 1 1  70 MET H   .  70 . HN   1 1 
       232 1 2 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       233 1 1 1 1  71 GLY H   .  71 . HN   1 1 
       233 1 2 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       234 1 1 1 1  71 GLY H   .  71 . HN   1 1 
       234 1 2 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       235 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       235 1 2 1 1  97 THR H   .  97 . HN   1 1 
       236 1 1 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       236 1 2 1 1  97 THR H   .  97 . HN   1 1 
       237 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       237 1 2 1 1  98 ALA H   .  98 . HN   1 1 
       238 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       238 1 2 1 1 116 GLY H   . 116 . HN   1 1 
       239 1 1 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       239 1 2 1 1 116 GLY H   . 116 . HN   1 1 
       240 1 1 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       240 1 2 1 1 112 THR H   . 112 . HN   1 1 
       241 1 1 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       241 1 2 1 1 113 ARG H   . 113 . HN   1 1 
       242 1 1 1 1  67 GLY H   .  67 . HN   1 1 
       242 1 2 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       243 1 1 1 1  99 LYS H   .  99 . HN   1 1 
       243 1 2 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       244 1 1 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       244 1 2 1 1 101 GLY H   . 101 . HN   1 1 
       245 1 1 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       245 1 2 1 1 114 LEU H   . 114 . HN   1 1 
       246 1 1 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       246 1 2 1 1 112 THR H   . 112 . HN   1 1 
       247 1 1 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       247 1 2 1 1 113 ARG H   . 113 . HN   1 1 
       248 1 1 1 1  65 TYR H   .  65 . HN   1 1 
       248 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       249 1 1 1 1  66 LEU H   .  66 . HN   1 1 
       249 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       250 1 1 1 1  67 GLY H   .  67 . HN   1 1 
       250 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       251 1 1 1 1  98 ALA H   .  98 . HN   1 1 
       251 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       252 1 1 1 1  99 LYS H   .  99 . HN   1 1 
       252 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       253 1 1 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       253 1 2 1 1 101 GLY H   . 101 . HN   1 1 
       254 1 1 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       254 1 2 1 1 114 LEU H   . 114 . HN   1 1 
       255 1 1 1 1 102 TYR H   . 102 . HN   1 1 
       255 1 2 1 1 104 ILE MD  . 104 . HD1# 1 1 
       256 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       256 1 2 1 1 105 THR H   . 105 . HN   1 1 
       257 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       257 1 2 1 1 108 LEU H   . 108 . HN   1 1 
       258 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       258 1 2 1 1 109 ASP H   . 109 . HN   1 1 
       259 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       259 1 2 1 1 110 ILE H   . 110 . HN   1 1 
       260 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       260 1 2 1 1 111 TYR H   . 111 . HN   1 1 
       261 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       261 1 2 1 1 149 VAL H   . 149 . HN   1 1 
       262 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       262 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       263 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       263 1 2 1 1 152 ALA H   . 152 . HN   1 1 
       264 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       264 1 2 1 1 152 ALA H   . 152 . HN   1 1 
       265 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       265 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       266 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       266 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       267 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       267 1 2 1 1 110 ILE H   . 110 . HN   1 1 
       268 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       268 1 2 1 1 110 ILE H   . 110 . HN   1 1 
       269 1 1 1 1 104 ILE H   . 104 . HN   1 1 
       269 1 2 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       270 1 1 1 1 104 ILE H   . 104 . HN   1 1 
       270 1 2 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       271 1 1 1 1 105 THR H   . 105 . HN   1 1 
       271 1 2 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       272 1 1 1 1 105 THR H   . 105 . HN   1 1 
       272 1 2 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       273 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       273 1 2 1 1 109 ASP H   . 109 . HN   1 1 
       274 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       274 1 2 1 1 109 ASP H   . 109 . HN   1 1 
       275 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       275 1 2 1 1 111 TYR H   . 111 . HN   1 1 
       276 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       276 1 2 1 1 149 VAL H   . 149 . HN   1 1 
       277 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       277 1 2 1 1 151 TRP H   . 151 . HN   1 1 
       278 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       278 1 2 1 1 151 TRP H   . 151 . HN   1 1 
       279 1 1 1 1 102 TYR H   . 102 . HN   1 1 
       279 1 2 1 1 110 ILE MD  . 110 . HD1# 1 1 
       280 1 1 1 1 104 ILE H   . 104 . HN   1 1 
       280 1 2 1 1 110 ILE MD  . 110 . HD1# 1 1 
       281 1 1 1 1 109 ASP H   . 109 . HN   1 1 
       281 1 2 1 1 110 ILE MD  . 110 . HD1# 1 1 
       282 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       282 1 2 1 1 111 TYR H   . 111 . HN   1 1 
       283 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       283 1 2 1 1 148 GLY H   . 148 . HN   1 1 
       284 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       284 1 2 1 1 149 VAL H   . 149 . HN   1 1 
       285 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       285 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       286 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       286 1 2 1 1 161 LEU H   . 161 . HN   1 1 
       287 1 1 1 1  98 ALA H   .  98 . HN   1 1 
       287 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       288 1 1 1 1  98 ALA H   .  98 . HN   1 1 
       288 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       289 1 1 1 1 100 LEU H   . 100 . HN   1 1 
       289 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       290 1 1 1 1 100 LEU H   . 100 . HN   1 1 
       290 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       291 1 1 1 1 112 THR H   . 112 . HN   1 1 
       291 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       292 1 1 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       292 1 2 1 1 115 GLY H   . 115 . HN   1 1 
       293 1 1 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       293 1 2 1 1 115 GLY H   . 115 . HN   1 1 
       294 1 1 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       294 1 2 1 1 144 VAL H   . 144 . HN   1 1 
       295 1 1 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       295 1 2 1 1 144 VAL H   . 144 . HN   1 1 
       296 1 1 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       296 1 2 1 1 146 ALA H   . 146 . HN   1 1 
       297 1 1 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       297 1 2 1 1 146 ALA H   . 146 . HN   1 1 
       298 1 1 1 1 113 ARG H   . 113 . HN   1 1 
       298 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       299 1 1 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       299 1 2 1 1 119 TRP H   . 119 . HN   1 1 
       300 1 1 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       300 1 2 1 1 119 TRP H   . 119 . HN   1 1 
       301 1 1 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       301 1 2 1 1 141 VAL H   . 141 . HN   1 1 
       302 1 1 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       302 1 2 1 1 141 VAL H   . 141 . HN   1 1 
       303 1 1 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       303 1 2 1 1 142 SER H   . 142 . HN   1 1 
       304 1 1 1 1  96 LEU H   .  96 . HN   1 1 
       304 1 2 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       305 1 1 1 1  96 LEU H   .  96 . HN   1 1 
       305 1 2 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       306 1 1 1 1 116 GLY H   . 116 . HN   1 1 
       306 1 2 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       307 1 1 1 1 117 MET H   . 117 . HN   1 1 
       307 1 2 1 1 141 VAL MG1 . 141 . HG1# 1 1 
       308 1 1 1 1 117 MET H   . 117 . HN   1 1 
       308 1 2 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       309 1 1 1 1 118 VAL H   . 118 . HN   1 1 
       309 1 2 1 1 141 VAL MG1 . 141 . HG1# 1 1 
       310 1 1 1 1 118 VAL H   . 118 . HN   1 1 
       310 1 2 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       311 1 1 1 1 119 TRP H   . 119 . HN   1 1 
       311 1 2 1 1 141 VAL MG1 . 141 . HG1# 1 1 
       312 1 1 1 1 119 TRP H   . 119 . HN   1 1 
       312 1 2 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       313 1 1 1 1 141 VAL MG1 . 141 . HG1# 1 1 
       313 1 2 1 1 142 SER H   . 142 . HN   1 1 
       314 1 1 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       314 1 2 1 1 142 SER H   . 142 . HN   1 1 
       315 1 1 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       315 1 2 1 1 144 VAL H   . 144 . HN   1 1 
       316 1 1 1 1  96 LEU H   .  96 . HN   1 1 
       316 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       317 1 1 1 1  96 LEU H   .  96 . HN   1 1 
       317 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       318 1 1 1 1  97 THR H   .  97 . HN   1 1 
       318 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       319 1 1 1 1  97 THR H   .  97 . HN   1 1 
       319 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       320 1 1 1 1 113 ARG H   . 113 . HN   1 1 
       320 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       321 1 1 1 1 114 LEU H   . 114 . HN   1 1 
       321 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       322 1 1 1 1 114 LEU H   . 114 . HN   1 1 
       322 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       323 1 1 1 1 115 GLY H   . 115 . HN   1 1 
       323 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       324 1 1 1 1 115 GLY H   . 115 . HN   1 1 
       324 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       325 1 1 1 1 116 GLY H   . 116 . HN   1 1 
       325 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       326 1 1 1 1 116 GLY H   . 116 . HN   1 1 
       326 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       327 1 1 1 1 117 MET H   . 117 . HN   1 1 
       327 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       328 1 1 1 1 117 MET H   . 117 . HN   1 1 
       328 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       329 1 1 1 1 118 VAL H   . 118 . HN   1 1 
       329 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       330 1 1 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       330 1 2 1 1 145 PHE H   . 145 . HN   1 1 
       331 1 1 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       331 1 2 1 1 145 PHE H   . 145 . HN   1 1 
       332 1 1 1 1 102 TYR H   . 102 . HN   1 1 
       332 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       333 1 1 1 1 104 ILE H   . 104 . HN   1 1 
       333 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       334 1 1 1 1 105 THR H   . 105 . HN   1 1 
       334 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       335 1 1 1 1 109 ASP H   . 109 . HN   1 1 
       335 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       336 1 1 1 1 109 ASP H   . 109 . HN   1 1 
       336 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       337 1 1 1 1 110 ILE H   . 110 . HN   1 1 
       337 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       338 1 1 1 1 110 ILE H   . 110 . HN   1 1 
       338 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       339 1 1 1 1 111 TYR H   . 111 . HN   1 1 
       339 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       340 1 1 1 1 111 TYR H   . 111 . HN   1 1 
       340 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       341 1 1 1 1 148 GLY H   . 148 . HN   1 1 
       341 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       342 1 1 1 1 148 GLY H   . 148 . HN   1 1 
       342 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       343 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       343 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       344 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       344 1 2 1 1 150 GLU H   . 150 . HN   1 1 
       345 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       345 1 2 1 1 151 TRP H   . 151 . HN   1 1 
       346 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       346 1 2 1 1 151 TRP H   . 151 . HN   1 1 
       347 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       347 1 2 1 1 152 ALA H   . 152 . HN   1 1 
       348 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       348 1 2 1 1 159 THR H   . 159 . HN   1 1 
       349 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       349 1 2 1 1 161 LEU H   . 161 . HN   1 1 
       350 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       350 1 2 1 1 161 LEU H   . 161 . HN   1 1 
       351 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       351 1 2 1 1 162 GLU H   . 162 . HN   1 1 
       352 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       352 1 2 1 1 162 GLU H   . 162 . HN   1 1 
       353 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       353 1 2 1 1 163 TYR H   . 163 . HN   1 1 
       354 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       354 1 2 1 1 187 GLY H   . 187 . HN   1 1 
       355 1 1 1 1 152 ALA H   . 152 . HN   1 1 
       355 1 2 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       356 1 1 1 1 152 ALA H   . 152 . HN   1 1 
       356 1 2 1 1 153 VAL MG2 . 153 . HG2# 1 1 
       357 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       357 1 2 1 1 154 THR H   . 154 . HN   1 1 
       358 1 1 1 1 153 VAL MG2 . 153 . HG2# 1 1 
       358 1 2 1 1 154 THR H   . 154 . HN   1 1 
       359 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       359 1 2 1 1 155 ARG H   . 155 . HN   1 1 
       360 1 1 1 1 153 VAL MG2 . 153 . HG2# 1 1 
       360 1 2 1 1 155 ARG H   . 155 . HN   1 1 
       361 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       361 1 2 1 1 156 ASP H   . 156 . HN   1 1 
       362 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       362 1 2 1 1 157 ILE H   . 157 . HN   1 1 
       363 1 1 1 1 153 VAL MG2 . 153 . HG2# 1 1 
       363 1 2 1 1 157 ILE H   . 157 . HN   1 1 
       364 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       364 1 2 1 1 158 ALA H   . 158 . HN   1 1 
       365 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       365 1 2 1 1 159 THR H   . 159 . HN   1 1 
       366 1 1 1 1 151 TRP H   . 151 . HN   1 1 
       366 1 2 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       367 1 1 1 1 153 VAL H   . 153 . HN   1 1 
       367 1 2 1 1 157 ILE MD  . 157 . HD1# 1 1 
       368 1 1 1 1 154 THR H   . 154 . HN   1 1 
       368 1 2 1 1 157 ILE MD  . 157 . HD1# 1 1 
       369 1 1 1 1 156 ASP H   . 156 . HN   1 1 
       369 1 2 1 1 157 ILE MD  . 157 . HD1# 1 1 
       370 1 1 1 1 157 ILE MD  . 157 . HD1# 1 1 
       370 1 2 1 1 158 ALA H   . 158 . HN   1 1 
       371 1 1 1 1 157 ILE MD  . 157 . HD1# 1 1 
       371 1 2 1 1 159 THR H   . 159 . HN   1 1 
       372 1 1 1 1 157 ILE MD  . 157 . HD1# 1 1 
       372 1 2 1 1 189 SER H   . 189 . HN   1 1 
       373 1 1 1 1 157 ILE MD  . 157 . HD1# 1 1 
       373 1 2 1 1 191 ARG H   . 191 . HN   1 1 
       374 1 1 1 1  25 LEU H   .  25 . HN   1 1 
       374 1 2 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       375 1 1 1 1 147 GLY H   . 147 . HN   1 1 
       375 1 2 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       376 1 1 1 1 149 VAL H   . 149 . HN   1 1 
       376 1 2 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       377 1 1 1 1 149 VAL H   . 149 . HN   1 1 
       377 1 2 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       378 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       378 1 2 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       379 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       379 1 2 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       380 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       380 1 2 1 1 162 GLU H   . 162 . HN   1 1 
       381 1 1 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       381 1 2 1 1 162 GLU H   . 162 . HN   1 1 
       382 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       382 1 2 1 1 186 LEU H   . 186 . HN   1 1 
       383 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       383 1 2 1 1 187 GLY H   . 187 . HN   1 1 
       384 1 1 1 1 163 TYR H   . 163 . HN   1 1 
       384 1 2 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       385 1 1 1 1  25 LEU H   .  25 . HN   1 1 
       385 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       386 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       386 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       387 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       387 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       388 1 1 1 1 161 LEU H   . 161 . HN   1 1 
       388 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       389 1 1 1 1 161 LEU H   . 161 . HN   1 1 
       389 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       390 1 1 1 1 162 GLU H   . 162 . HN   1 1 
       390 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       391 1 1 1 1 162 GLU H   . 162 . HN   1 1 
       391 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       392 1 1 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       392 1 2 1 1 187 GLY H   . 187 . HN   1 1 
       393 1 1 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       393 1 2 1 1 187 GLY H   . 187 . HN   1 1 
       394 1 1 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       394 1 2 1 1 188 VAL H   . 188 . HN   1 1 
       395 1 1 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       395 1 2 1 1 188 VAL H   . 188 . HN   1 1 
       396 1 1 1 1  21 ALA H   .  21 . HN   1 1 
       396 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       397 1 1 1 1  22 GLY H   .  22 . HN   1 1 
       397 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       398 1 1 1 1  23 GLY H   .  23 . HN   1 1 
       398 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       399 1 1 1 1  23 GLY H   .  23 . HN   1 1 
       399 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       400 1 1 1 1  24 LYS H   .  24 . HN   1 1 
       400 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       401 1 1 1 1  24 LYS H   .  24 . HN   1 1 
       401 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       402 1 1 1 1  25 LEU H   .  25 . HN   1 1 
       402 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       403 1 1 1 1  25 LEU H   .  25 . HN   1 1 
       403 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       404 1 1 1 1  57 PHE H   .  57 . HN   1 1 
       404 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       405 1 1 1 1 158 ALA H   . 158 . HN   1 1 
       405 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       406 1 1 1 1 158 ALA H   . 158 . HN   1 1 
       406 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       407 1 1 1 1 159 THR H   . 159 . HN   1 1 
       407 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       408 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       408 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       409 1 1 1 1 160 ARG H   . 160 . HN   1 1 
       409 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       410 1 1 1 1 187 GLY H   . 187 . HN   1 1 
       410 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       411 1 1 1 1 187 GLY H   . 187 . HN   1 1 
       411 1 2 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       412 1 1 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       412 1 2 1 1 189 SER H   . 189 . HN   1 1 
       413 1 1 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       413 1 2 1 1 189 SER H   . 189 . HN   1 1 
       414 1 1 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       414 1 2 1 1 190 TYR H   . 190 . HN   1 1 
       415 1 1 1 1 188 VAL MG2 . 188 . HG2# 1 1 
       415 1 2 1 1 190 TYR H   . 190 . HN   1 1 
       416 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       416 1 2 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       417 1 1 1 1  62 VAL MG1 .  62 . HG1# 1 1 
       417 1 2 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       418 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       418 1 2 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       419 1 1 1 1  62 VAL MG2 .  62 . HG2# 1 1 
       419 1 2 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       420 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       420 1 2 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       421 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       421 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       422 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       422 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       423 1 1 1 1  66 LEU MD1 .  66 . HD1# 1 1 
       423 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       424 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       424 1 2 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       425 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       425 1 2 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       426 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       426 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       427 1 1 1 1  66 LEU MD2 .  66 . HD2# 1 1 
       427 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       428 1 1 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       428 1 2 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       429 1 1 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       429 1 2 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       430 1 1 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       430 1 2 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       431 1 1 1 1  94 VAL MG1 .  94 . HG1# 1 1 
       431 1 2 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       432 1 1 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       432 1 2 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       433 1 1 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       433 1 2 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       434 1 1 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       434 1 2 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       435 1 1 1 1  94 VAL MG2 .  94 . HG2# 1 1 
       435 1 2 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       436 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       436 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       437 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       437 1 2 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       438 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       438 1 2 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       439 1 1 1 1  96 LEU MD1 .  96 . HD1# 1 1 
       439 1 2 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       440 1 1 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       440 1 2 1 1 141 VAL MG1 . 141 . HG1# 1 1 
       441 1 1 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       441 1 2 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       442 1 1 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       442 1 2 1 1 118 VAL MG1 . 118 . HG1# 1 1 
       443 1 1 1 1  96 LEU MD2 .  96 . HD2# 1 1 
       443 1 2 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       444 1 1 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       444 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       445 1 1 1 1 100 LEU MD1 . 100 . HD1# 1 1 
       445 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       446 1 1 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       446 1 2 1 1 114 LEU MD1 . 114 . HD1# 1 1 
       447 1 1 1 1 100 LEU MD2 . 100 . HD2# 1 1 
       447 1 2 1 1 114 LEU MD2 . 114 . HD2# 1 1 
       448 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       448 1 2 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       449 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       449 1 2 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       450 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       450 1 2 1 1 110 ILE MD  . 110 . HD1# 1 1 
       451 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       451 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       452 1 1 1 1 104 ILE MD  . 104 . HD1# 1 1 
       452 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       453 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       453 1 2 1 1 110 ILE MD  . 110 . HD1# 1 1 
       454 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       454 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       455 1 1 1 1 108 LEU MD1 . 108 . HD1# 1 1 
       455 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       456 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       456 1 2 1 1 110 ILE MD  . 110 . HD1# 1 1 
       457 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       457 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       458 1 1 1 1 108 LEU MD2 . 108 . HD2# 1 1 
       458 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       459 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       459 1 2 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       460 1 1 1 1 110 ILE MD  . 110 . HD1# 1 1 
       460 1 2 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       461 1 1 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       461 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       462 1 1 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       462 1 2 1 1 144 VAL MG1 . 144 . HG1# 1 1 
       463 1 1 1 1 141 VAL MG2 . 141 . HG2# 1 1 
       463 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       464 1 1 1 1 118 VAL MG2 . 118 . HG2# 1 1 
       464 1 2 1 1 144 VAL MG2 . 144 . HG2# 1 1 
       465 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       465 1 2 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       466 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       466 1 2 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       467 1 1 1 1 149 VAL MG1 . 149 . HG1# 1 1 
       467 1 2 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       468 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       468 1 2 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       469 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       469 1 2 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       470 1 1 1 1 149 VAL MG2 . 149 . HG2# 1 1 
       470 1 2 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       471 1 1 1 1 153 VAL MG1 . 153 . HG1# 1 1 
       471 1 2 1 1 157 ILE MD  . 157 . HD1# 1 1 
       472 1 1 1 1 153 VAL MG2 . 153 . HG2# 1 1 
       472 1 2 1 1 157 ILE MD  . 157 . HD1# 1 1 
       473 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       473 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       474 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       474 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       475 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       475 1 2 1 1 184 LEU MD1 . 184 . HD1# 1 1 
       476 1 1 1 1 161 LEU MD1 . 161 . HD1# 1 1 
       476 1 2 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       477 1 1 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       477 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       478 1 1 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       478 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       479 1 1 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       479 1 2 1 1 184 LEU MD1 . 184 . HD1# 1 1 
       480 1 1 1 1 161 LEU MD2 . 161 . HD2# 1 1 
       480 1 2 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       481 1 1 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       481 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       482 1 1 1 1 184 LEU MD1 . 184 . HD1# 1 1 
       482 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       483 1 1 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       483 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       484 1 1 1 1  25 LEU MD1 .  25 . HD1# 1 1 
       484 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       485 1 1 1 1  25 LEU MD2 .  25 . HD2# 1 1 
       485 1 2 1 1 186 LEU MD1 . 186 . HD1# 1 1 
       486 1 1 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       486 1 2 1 1 188 VAL MG1 . 188 . HG1# 1 1 
       487 1 1 1 1 184 LEU MD1 . 184 . HD1# 1 1 
       487 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       488 1 1 1 1 184 LEU MD2 . 184 . HD2# 1 1 
       488 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       489 1 1 1 1  25 LEU MD1 .  25 . HD1# 1 1 
       489 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
       490 1 1 1 1  25 LEU MD2 .  25 . HD2# 1 1 
       490 1 2 1 1 186 LEU MD2 . 186 . HD2# 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . 3.3 2.6  3.4 1 1 
         2 1 . . . . . 3.3 2.6  3.4 1 1 
         3 1 . . . . . 3.3 2.6  3.4 1 1 
         4 1 . . . . . 3.3 2.6  3.4 1 1 
         5 1 . . . . . 3.3 2.6  3.4 1 1 
         6 1 . . . . . 3.3 2.6  3.4 1 1 
         7 1 . . . . . 3.3 2.6  3.4 1 1 
         8 1 . . . . . 3.3 2.6  3.4 1 1 
         9 1 . . . . . 3.3 2.6  3.4 1 1 
        10 1 . . . . . 3.3 2.6  4.8 1 1 
        11 1 . . . . . 3.3 2.6  4.8 1 1 
        12 1 . . . . . 3.3 2.6  3.4 1 1 
        13 1 . . . . . 3.3 2.6  3.4 1 1 
        14 1 . . . . . 3.3 2.6  3.4 1 1 
        15 1 . . . . . 3.3 2.6  4.8 1 1 
        16 1 . . . . . 3.3 2.6  3.4 1 1 
        17 1 . . . . . 3.3 2.6  3.4 1 1 
        18 1 . . . . . 3.3 2.6  3.4 1 1 
        19 1 . . . . . 3.3 2.6  3.4 1 1 
        20 1 . . . . . 3.3 2.6  3.4 1 1 
        21 1 . . . . . 3.3 2.6  3.4 1 1 
        22 1 . . . . . 3.3 2.6  3.4 1 1 
        23 1 . . . . . 3.3 2.6  3.4 1 1 
        24 1 . . . . . 3.3 2.6  3.4 1 1 
        25 1 . . . . . 3.3 2.6  3.4 1 1 
        26 1 . . . . . 3.3 2.6  3.4 1 1 
        27 1 . . . . . 3.3 2.6  3.4 1 1 
        28 1 . . . . . 3.3 2.6  3.4 1 1 
        29 1 . . . . . 3.3 2.6  3.4 1 1 
        30 1 . . . . . 3.3 2.6  4.8 1 1 
        31 1 . . . . . 3.3 2.6  3.4 1 1 
        32 1 . . . . . 3.3 2.6  3.4 1 1 
        33 1 . . . . . 3.3 2.6  3.4 1 1 
        34 1 . . . . . 3.3 2.6  4.8 1 1 
        35 1 . . . . . 3.3 2.6  3.4 1 1 
        36 1 . . . . . 3.3 2.6  3.4 1 1 
        37 1 . . . . . 3.3 2.6  3.4 1 1 
        38 1 . . . . . 3.3 2.6  4.8 1 1 
        39 1 . . . . . 4.3 1.8  4.7 1 1 
        40 1 . . . . . 4.3 1.8  4.7 1 1 
        41 1 . . . . . 4.3 1.8  4.7 1 1 
        42 1 . . . . . 4.3 1.8  4.7 1 1 
        43 1 . . . . . 4.3 1.8  4.7 1 1 
        44 1 . . . . . 4.3 1.8  4.7 1 1 
        45 1 . . . . . 4.3 1.8  4.7 1 1 
        46 1 . . . . . 4.3 1.8  4.7 1 1 
        47 1 . . . . . 4.3 1.8  4.7 1 1 
        48 1 . . . . . 4.3 4.1  4.7 1 1 
        49 1 . . . . . 4.3 4.1  4.7 1 1 
        50 1 . . . . . 4.3 4.1  4.7 1 1 
        51 1 . . . . . 4.3 4.1  4.7 1 1 
        52 1 . . . . . 4.3 4.1  4.7 1 1 
        53 1 . . . . . 4.3 4.1  4.7 1 1 
        54 1 . . . . . 4.3 4.1  4.7 1 1 
        55 1 . . . . . 4.3 1.8  4.7 1 1 
        56 1 . . . . . 4.3 1.8  4.7 1 1 
        57 1 . . . . . 4.3 1.8  4.7 1 1 
        58 1 . . . . . 4.3 1.8  4.7 1 1 
        59 1 . . . . . 4.3 1.8  4.7 1 1 
        60 1 . . . . . 4.3 1.8  4.7 1 1 
        61 1 . . . . . 4.3 4.1  4.7 1 1 
        62 1 . . . . . 4.3 4.1  4.7 1 1 
        63 1 . . . . . 4.3 4.1  4.7 1 1 
        64 1 . . . . . 4.3 4.1  4.7 1 1 
        65 1 . . . . . 4.3 4.1  4.7 1 1 
        66 1 . . . . . 4.3 4.1  4.7 1 1 
        67 1 . . . . . 4.3 4.1  4.7 1 1 
        68 1 . . . . . 4.3 4.1  4.7 1 1 
        69 1 . . . . . 4.3 4.1  4.7 1 1 
        70 1 . . . . . 4.3 1.8  4.7 1 1 
        71 1 . . . . . 4.3 1.8  4.7 1 1 
        72 1 . . . . . 4.3 1.8  4.7 1 1 
        73 1 . . . . . 4.3 1.8  4.7 1 1 
        74 1 . . . . . 4.3 4.1  4.7 1 1 
        75 1 . . . . . 4.3 4.1  4.7 1 1 
        76 1 . . . . . 4.3 4.1  4.7 1 1 
        77 1 . . . . . 4.3 4.1  4.7 1 1 
        78 1 . . . . . 4.3 4.1  4.7 1 1 
        79 1 . . . . . 4.3 4.1  4.7 1 1 
        80 1 . . . . . 4.3 4.1  4.7 1 1 
        81 1 . . . . . 4.3 4.1  4.7 1 1 
        82 1 . . . . . 4.3 4.1  4.7 1 1 
        83 1 . . . . . 4.3 4.1  4.7 1 1 
        84 1 . . . . . 4.3 4.1  4.7 1 1 
        85 1 . . . . . 4.3 4.1  4.7 1 1 
        86 1 . . . . . 4.3 4.1  4.7 1 1 
        87 1 . . . . . 4.3 4.1  4.7 1 1 
        88 1 . . . . . 4.3 4.1  4.7 1 1 
        89 1 . . . . . 4.3 4.1  4.7 1 1 
        90 1 . . . . . 4.3 4.1  4.7 1 1 
        91 1 . . . . . 4.3 4.1  4.7 1 1 
        92 1 . . . . . 4.3 4.1  4.7 1 1 
        93 1 . . . . . 4.3 4.1  4.7 1 1 
        94 1 . . . . . 4.3 4.1  4.7 1 1 
        95 1 . . . . . 4.3 4.1  4.7 1 1 
        96 1 . . . . . 4.3 4.1  4.7 1 1 
        97 1 . . . . . 4.3 4.1  4.7 1 1 
        98 1 . . . . . 4.3 4.1  4.7 1 1 
        99 1 . . . . . 4.3 4.1  4.7 1 1 
       100 1 . . . . . 4.3 4.1  4.7 1 1 
       101 1 . . . . . 4.3 4.1  4.7 1 1 
       102 1 . . . . . 4.3 4.1  4.7 1 1 
       103 1 . . . . . 4.3 1.8  4.7 1 1 
       104 1 . . . . . 4.3 4.1  4.7 1 1 
       105 1 . . . . . 4.3 4.1  4.7 1 1 
       106 1 . . . . . 4.3 4.1  4.7 1 1 
       107 1 . . . . . 4.3 4.1  4.7 1 1 
       108 1 . . . . . 4.3 4.1  4.7 1 1 
       109 1 . . . . . 4.3 4.1  4.7 1 1 
       110 1 . . . . . 4.3 4.1  4.7 1 1 
       111 1 . . . . . 4.3 4.1  4.7 1 1 
       112 1 . . . . . 4.3 1.8  4.7 1 1 
       113 1 . . . . . 4.3 1.8  4.7 1 1 
       114 1 . . . . . 4.3 1.8  4.7 1 1 
       115 1 . . . . . 4.3 1.8  4.7 1 1 
       116 1 . . . . . 4.3 1.8  4.7 1 1 
       117 1 . . . . . 4.5 2.5  6.5 1 1 
       118 1 . . . . . 4.5 2.5  6.5 1 1 
       119 1 . . . . . 4.5 2.5  6.5 1 1 
       120 1 . . . . . 4.5 2.5  6.5 1 1 
       121 1 . . . . . 3.8 1.8  5.8 1 1 
       122 1 . . . . . 3.8 1.8  5.8 1 1 
       123 1 . . . . . 3.8 1.8  5.8 1 1 
       124 1 . . . . . 4.5 2.5  6.5 1 1 
       125 1 . . . . . 4.5 2.5  6.5 1 1 
       126 1 . . . . . 4.5 2.5  6.5 1 1 
       127 1 . . . . . 4.5 2.5  6.5 1 1 
       128 1 . . . . . 5.0 1.8  8.0 1 1 
       129 1 . . . . . 5.0 1.8  8.0 1 1 
       130 1 . . . . . 5.0 1.8  8.0 1 1 
       131 1 . . . . . 5.0 1.8  8.0 1 1 
       132 1 . . . . . 5.0 1.8  8.0 1 1 
       133 1 . . . . . 5.0 1.8  8.0 1 1 
       134 1 . . . . . 5.0 1.8  8.0 1 1 
       135 1 . . . . . 5.0 1.8  8.0 1 1 
       136 1 . . . . . 5.0 1.8  8.0 1 1 
       137 1 . . . . . 5.0 1.8  8.0 1 1 
       138 1 . . . . . 5.0 1.8  8.0 1 1 
       139 1 . . . . . 5.0 1.8  8.0 1 1 
       140 1 . . . . . 5.0 1.8  8.0 1 1 
       141 1 . . . . . 5.0 1.8  8.0 1 1 
       142 1 . . . . . 5.0 1.8  8.0 1 1 
       143 1 . . . . . 5.0 1.8  8.0 1 1 
       144 1 . . . . . 5.0 1.8  8.0 1 1 
       145 1 . . . . . 5.0 1.8  8.0 1 1 
       146 1 . . . . . 5.0 1.8  8.0 1 1 
       147 1 . . . . . 5.0 1.8  8.0 1 1 
       148 1 . . . . . 5.0 1.8  8.0 1 1 
       149 1 . . . . . 5.0 1.8  8.0 1 1 
       150 1 . . . . . 5.0 1.8  8.0 1 1 
       151 1 . . . . . 5.0 1.8  8.0 1 1 
       152 1 . . . . . 5.0 1.8  8.0 1 1 
       153 1 . . . . . 5.0 1.8  8.0 1 1 
       154 1 . . . . . 5.0 1.8  8.0 1 1 
       155 1 . . . . . 5.0 1.8  8.0 1 1 
       156 1 . . . . . 5.0 1.8  8.0 1 1 
       157 1 . . . . . 5.0 1.8  8.0 1 1 
       158 1 . . . . . 5.0 1.8  8.0 1 1 
       159 1 . . . . . 5.0 1.8  8.0 1 1 
       160 1 . . . . . 5.0 1.8  8.0 1 1 
       161 1 . . . . . 5.0 1.8  8.0 1 1 
       162 1 . . . . . 5.0 1.8  8.0 1 1 
       163 1 . . . . . 5.0 1.8  8.0 1 1 
       164 1 . . . . . 5.0 1.8  8.0 1 1 
       165 1 . . . . . 5.0 1.8  8.0 1 1 
       166 1 . . . . . 5.0 1.8  8.0 1 1 
       167 1 . . . . . 5.0 1.8  8.0 1 1 
       168 1 . . . . . 5.0 1.8  8.0 1 1 
       169 1 . . . . . 5.0 1.8  8.0 1 1 
       170 1 . . . . . 5.0 1.8  8.0 1 1 
       171 1 . . . . . 5.0 1.8  8.0 1 1 
       172 1 . . . . . 5.0 1.8  8.0 1 1 
       173 1 . . . . . 5.0 1.8  8.0 1 1 
       174 1 . . . . . 7.0 6.0 10.0 1 1 
       175 1 . . . . . 7.0 6.0 10.0 1 1 
       176 1 . . . . . 5.0 3.5  7.0 1 1 
       177 1 . . . . . 7.0 6.0 10.0 1 1 
       178 1 . . . . . 7.0 6.0 10.0 1 1 
       179 1 . . . . . 5.0 3.5  7.0 1 1 
       180 1 . . . . . 7.0 6.0 10.0 1 1 
       181 1 . . . . . 7.0 6.0 10.0 1 1 
       182 1 . . . . . 5.0 3.5  7.0 1 1 
       183 1 . . . . . 7.0 6.0 10.0 1 1 
       184 1 . . . . . 5.0 3.5  7.0 1 1 
       185 1 . . . . . 5.0 3.5  7.0 1 1 
       186 1 . . . . . 5.0 3.5  7.0 1 1 
       187 1 . . . . . 7.0 6.0 10.0 1 1 
       188 1 . . . . . 7.0 6.0 10.0 1 1 
       189 1 . . . . . 7.0 6.0 10.0 1 1 
       190 1 . . . . . 7.0 6.0 10.0 1 1 
       191 1 . . . . . 7.0 6.0 10.0 1 1 
       192 1 . . . . . 5.0 3.5  7.0 1 1 
       193 1 . . . . . 7.0 6.0 10.0 1 1 
       194 1 . . . . . 3.0 2.0  4.5 1 1 
       195 1 . . . . . 7.0 6.0 10.0 1 1 
       196 1 . . . . . 7.0 6.0 10.0 1 1 
       197 1 . . . . . 7.0 6.0 10.0 1 1 
       198 1 . . . . . 5.0 3.5  7.0 1 1 
       199 1 . . . . . 7.0 6.0 10.0 1 1 
       200 1 . . . . . 5.0 3.5  7.0 1 1 
       201 1 . . . . . 5.0 3.5  7.0 1 1 
       202 1 . . . . . 5.0 3.5  7.0 1 1 
       203 1 . . . . . 5.0 3.5  7.0 1 1 
       204 1 . . . . . 3.0 2.0  4.5 1 1 
       205 1 . . . . . 5.0 3.5  7.0 1 1 
       206 1 . . . . . 5.0 3.5  7.0 1 1 
       207 1 . . . . . 7.0 6.0 10.0 1 1 
       208 1 . . . . . 7.0 6.0 10.0 1 1 
       209 1 . . . . . 5.0 3.5  7.0 1 1 
       210 1 . . . . . 3.0 2.0  4.5 1 1 
       211 1 . . . . . 5.0 3.5  7.0 1 1 
       212 1 . . . . . 5.0 3.5  7.0 1 1 
       213 1 . . . . . 7.0 6.0 10.0 1 1 
       214 1 . . . . . 5.0 3.5  7.0 1 1 
       215 1 . . . . . 5.0 3.5  7.0 1 1 
       216 1 . . . . . 5.0 3.5  7.0 1 1 
       217 1 . . . . . 7.0 6.0 10.0 1 1 
       218 1 . . . . . 7.0 6.0 10.0 1 1 
       219 1 . . . . . 5.0 3.5  7.0 1 1 
       220 1 . . . . . 7.0 6.0 10.0 1 1 
       221 1 . . . . . 7.0 6.0 10.0 1 1 
       222 1 . . . . . 7.0 6.0 10.0 1 1 
       223 1 . . . . . 5.0 3.5  7.0 1 1 
       224 1 . . . . . 5.0 3.5  7.0 1 1 
       225 1 . . . . . 3.0 2.0  4.5 1 1 
       226 1 . . . . . 5.0 3.5  7.0 1 1 
       227 1 . . . . . 5.0 3.5  7.0 1 1 
       228 1 . . . . . 5.0 3.5  7.0 1 1 
       229 1 . . . . . 7.0 6.0 10.0 1 1 
       230 1 . . . . . 7.0 6.0 10.0 1 1 
       231 1 . . . . . 7.0 6.0 10.0 1 1 
       232 1 . . . . . 7.0 6.0 10.0 1 1 
       233 1 . . . . . 7.0 6.0 10.0 1 1 
       234 1 . . . . . 5.0 3.5  7.0 1 1 
       235 1 . . . . . 5.0 3.5  7.0 1 1 
       236 1 . . . . . 5.0 3.5  7.0 1 1 
       237 1 . . . . . 7.0 6.0 10.0 1 1 
       238 1 . . . . . 5.0 3.5  7.0 1 1 
       239 1 . . . . . 5.0 3.5  7.0 1 1 
       240 1 . . . . . 5.0 3.5  7.0 1 1 
       241 1 . . . . . 7.0 6.0 10.0 1 1 
       242 1 . . . . . 7.0 6.0 10.0 1 1 
       243 1 . . . . . 7.0 6.0 10.0 1 1 
       244 1 . . . . . 5.0 3.5  7.0 1 1 
       245 1 . . . . . 7.0 6.0 10.0 1 1 
       246 1 . . . . . 5.0 3.5  7.0 1 1 
       247 1 . . . . . 7.0 6.0 10.0 1 1 
       248 1 . . . . . 7.0 6.0 10.0 1 1 
       249 1 . . . . . 7.0 6.0 10.0 1 1 
       250 1 . . . . . 5.0 3.5  7.0 1 1 
       251 1 . . . . . 7.0 6.0 10.0 1 1 
       252 1 . . . . . 5.0 3.5  7.0 1 1 
       253 1 . . . . . 5.0 3.5  7.0 1 1 
       254 1 . . . . . 5.0 3.5  7.0 1 1 
       255 1 . . . . . 7.0 6.0 10.0 1 1 
       256 1 . . . . . 5.0 3.5  7.0 1 1 
       257 1 . . . . . 7.0 6.0 10.0 1 1 
       258 1 . . . . . 5.0 3.5  7.0 1 1 
       259 1 . . . . . 3.0 2.0  4.5 1 1 
       260 1 . . . . . 7.0 6.0 10.0 1 1 
       261 1 . . . . . 7.0 6.0 10.0 1 1 
       262 1 . . . . . 5.0 3.5  7.0 1 1 
       263 1 . . . . . 5.0 3.5  7.0 1 1 
       264 1 . . . . . 5.0 3.5  7.0 1 1 
       265 1 . . . . . 5.0 3.5  7.0 1 1 
       266 1 . . . . . 7.0 6.0 10.0 1 1 
       267 1 . . . . . 7.0 6.0 10.0 1 1 
       268 1 . . . . . 7.0 6.0 10.0 1 1 
       269 1 . . . . . 5.0 3.5  7.0 1 1 
       270 1 . . . . . 5.0 3.5  7.0 1 1 
       271 1 . . . . . 5.0 3.5  7.0 1 1 
       272 1 . . . . . 5.0 3.5  7.0 1 1 
       273 1 . . . . . 5.0 3.5  7.0 1 1 
       274 1 . . . . . 5.0 3.5  7.0 1 1 
       275 1 . . . . . 7.0 6.0 10.0 1 1 
       276 1 . . . . . 7.0 6.0 10.0 1 1 
       277 1 . . . . . 7.0 6.0 10.0 1 1 
       278 1 . . . . . 7.0 6.0 10.0 1 1 
       279 1 . . . . . 5.0 3.5  7.0 1 1 
       280 1 . . . . . 7.0 6.0 10.0 1 1 
       281 1 . . . . . 7.0 6.0 10.0 1 1 
       282 1 . . . . . 5.0 3.5  7.0 1 1 
       283 1 . . . . . 5.0 3.5  7.0 1 1 
       284 1 . . . . . 5.0 3.5  7.0 1 1 
       285 1 . . . . . 5.0 3.5  7.0 1 1 
       286 1 . . . . . 7.0 6.0 10.0 1 1 
       287 1 . . . . . 7.0 6.0 10.0 1 1 
       288 1 . . . . . 5.0 3.5  7.0 1 1 
       289 1 . . . . . 7.0 6.0 10.0 1 1 
       290 1 . . . . . 7.0 6.0 10.0 1 1 
       291 1 . . . . . 7.0 6.0 10.0 1 1 
       292 1 . . . . . 5.0 3.5  7.0 1 1 
       293 1 . . . . . 5.0 3.5  7.0 1 1 
       294 1 . . . . . 7.0 6.0 10.0 1 1 
       295 1 . . . . . 5.0 3.5  7.0 1 1 
       296 1 . . . . . 7.0 6.0 10.0 1 1 
       297 1 . . . . . 7.0 6.0 10.0 1 1 
       298 1 . . . . . 7.0 6.0 10.0 1 1 
       299 1 . . . . . 3.0 2.0  4.5 1 1 
       300 1 . . . . . 5.0 3.5  7.0 1 1 
       301 1 . . . . . 5.0 3.5  7.0 1 1 
       302 1 . . . . . 7.0 6.0 10.0 1 1 
       303 1 . . . . . 5.0 3.5  7.0 1 1 
       304 1 . . . . . 7.0 6.0 10.0 1 1 
       305 1 . . . . . 5.0 3.5  7.0 1 1 
       306 1 . . . . . 7.0 6.0 10.0 1 1 
       307 1 . . . . . 7.0 6.0 10.0 1 1 
       308 1 . . . . . 5.0 3.5  7.0 1 1 
       309 1 . . . . . 7.0 6.0 10.0 1 1 
       310 1 . . . . . 5.0 3.5  7.0 1 1 
       311 1 . . . . . 5.0 3.5  7.0 1 1 
       312 1 . . . . . 5.0 3.5  7.0 1 1 
       313 1 . . . . . 5.0 3.5  7.0 1 1 
       314 1 . . . . . 3.0 2.0  4.5 1 1 
       315 1 . . . . . 7.0 6.0 10.0 1 1 
       316 1 . . . . . 7.0 6.0 10.0 1 1 
       317 1 . . . . . 5.0 3.5  7.0 1 1 
       318 1 . . . . . 7.0 6.0 10.0 1 1 
       319 1 . . . . . 5.0 3.5  7.0 1 1 
       320 1 . . . . . 7.0 6.0 10.0 1 1 
       321 1 . . . . . 7.0 6.0 10.0 1 1 
       322 1 . . . . . 5.0 3.5  7.0 1 1 
       323 1 . . . . . 5.0 3.5  7.0 1 1 
       324 1 . . . . . 3.0 2.0  4.5 1 1 
       325 1 . . . . . 5.0 3.5  7.0 1 1 
       326 1 . . . . . 3.0 2.0  4.5 1 1 
       327 1 . . . . . 3.0 2.0  4.5 1 1 
       328 1 . . . . . 5.0 3.5  7.0 1 1 
       329 1 . . . . . 7.0 6.0 10.0 1 1 
       330 1 . . . . . 5.0 3.5  7.0 1 1 
       331 1 . . . . . 5.0 3.5  7.0 1 1 
       332 1 . . . . . 7.0 6.0 10.0 1 1 
       333 1 . . . . . 7.0 6.0 10.0 1 1 
       334 1 . . . . . 7.0 6.0 10.0 1 1 
       335 1 . . . . . 5.0 3.5  7.0 1 1 
       336 1 . . . . . 5.0 3.5  7.0 1 1 
       337 1 . . . . . 5.0 3.5  7.0 1 1 
       338 1 . . . . . 7.0 6.0 10.0 1 1 
       339 1 . . . . . 5.0 3.5  7.0 1 1 
       340 1 . . . . . 5.0 3.5  7.0 1 1 
       341 1 . . . . . 5.0 3.5  7.0 1 1 
       342 1 . . . . . 5.0 3.5  7.0 1 1 
       343 1 . . . . . 5.0 3.5  7.0 1 1 
       344 1 . . . . . 5.0 3.5  7.0 1 1 
       345 1 . . . . . 7.0 6.0 10.0 1 1 
       346 1 . . . . . 5.0 3.5  7.0 1 1 
       347 1 . . . . . 7.0 6.0 10.0 1 1 
       348 1 . . . . . 7.0 6.0 10.0 1 1 
       349 1 . . . . . 5.0 3.5  7.0 1 1 
       350 1 . . . . . 3.0 2.0  4.5 1 1 
       351 1 . . . . . 7.0 6.0 10.0 1 1 
       352 1 . . . . . 5.0 3.5  7.0 1 1 
       353 1 . . . . . 7.0 6.0 10.0 1 1 
       354 1 . . . . . 7.0 6.0 10.0 1 1 
       355 1 . . . . . 7.0 6.0 10.0 1 1 
       356 1 . . . . . 5.0 3.5  7.0 1 1 
       357 1 . . . . . 3.0 2.0  4.5 1 1 
       358 1 . . . . . 5.0 3.5  7.0 1 1 
       359 1 . . . . . 5.0 3.5  7.0 1 1 
       360 1 . . . . . 7.0 6.0 10.0 1 1 
       361 1 . . . . . 7.0 6.0 10.0 1 1 
       362 1 . . . . . 5.0 3.5  7.0 1 1 
       363 1 . . . . . 7.0 6.0 10.0 1 1 
       364 1 . . . . . 5.0 3.5  7.0 1 1 
       365 1 . . . . . 7.0 6.0  7.0 1 1 
       366 1 . . . . . 7.0 6.0 10.0 1 1 
       367 1 . . . . . 7.0 6.0 10.0 1 1 
       368 1 . . . . . 5.0 3.5  7.0 1 1 
       369 1 . . . . . 5.0 3.5  7.0 1 1 
       370 1 . . . . . 5.0 3.5  7.0 1 1 
       371 1 . . . . . 7.0 6.0 10.0 1 1 
       372 1 . . . . . 7.0 6.0 10.0 1 1 
       373 1 . . . . . 7.0 6.0 10.0 1 1 
       374 1 . . . . . 7.0 6.0 10.0 1 1 
       375 1 . . . . . 7.0 6.0 10.0 1 1 
       376 1 . . . . . 5.0 3.5  7.0 1 1 
       377 1 . . . . . 5.0 3.5  7.0 1 1 
       378 1 . . . . . 7.0 6.0 10.0 1 1 
       379 1 . . . . . 7.0 6.0 10.0 1 1 
       380 1 . . . . . 5.0 3.5  7.0 1 1 
       381 1 . . . . . 3.0 2.0  4.5 1 1 
       382 1 . . . . . 7.0 6.0 10.0 1 1 
       383 1 . . . . . 5.0 3.5  7.0 1 1 
       384 1 . . . . . 5.0 3.5  7.0 1 1 
       385 1 . . . . . 7.0 6.0 10.0 1 1 
       386 1 . . . . . 7.0 6.0 10.0 1 1 
       387 1 . . . . . 7.0 6.0 10.0 1 1 
       388 1 . . . . . 7.0 6.0 10.0 1 1 
       389 1 . . . . . 7.0 6.0 10.0 1 1 
       390 1 . . . . . 7.0 6.0 10.0 1 1 
       391 1 . . . . . 5.0 3.5  7.0 1 1 
       392 1 . . . . . 5.0 3.5  7.0 1 1 
       393 1 . . . . . 5.0 3.5  7.0 1 1 
       394 1 . . . . . 7.0 6.0 10.0 1 1 
       395 1 . . . . . 7.0 6.0 10.0 1 1 
       396 1 . . . . . 7.0 6.0 10.0 1 1 
       397 1 . . . . . 7.0 6.0 10.0 1 1 
       398 1 . . . . . 5.0 3.5  7.0 1 1 
       399 1 . . . . . 3.0 2.0  4.5 1 1 
       400 1 . . . . . 7.0 6.0 10.0 1 1 
       401 1 . . . . . 7.0 6.0 10.0 1 1 
       402 1 . . . . . 7.0 6.0 10.0 1 1 
       403 1 . . . . . 7.0 6.0 10.0 1 1 
       404 1 . . . . . 7.0 6.0 10.0 1 1 
       405 1 . . . . . 5.0 3.5  7.0 1 1 
       406 1 . . . . . 7.0 6.0 10.0 1 1 
       407 1 . . . . . 5.0 3.5  7.0 1 1 
       408 1 . . . . . 5.0 3.5  7.0 1 1 
       409 1 . . . . . 5.0 3.5  7.0 1 1 
       410 1 . . . . . 5.0 3.5  7.0 1 1 
       411 1 . . . . . 5.0 3.5  7.0 1 1 
       412 1 . . . . . 5.0 3.5  7.0 1 1 
       413 1 . . . . . 5.0 3.5  7.0 1 1 
       414 1 . . . . . 7.0 6.0 10.0 1 1 
       415 1 . . . . . 7.0 6.0 10.0 1 1 
       416 1 . . . . . 7.0 6.0 10.0 1 1 
       417 1 . . . . . 7.0 6.0 10.0 1 1 
       418 1 . . . . . 7.0 6.0 10.0 1 1 
       419 1 . . . . . 7.0 6.0 10.0 1 1 
       420 1 . . . . . 7.0 6.0 10.0 1 1 
       421 1 . . . . . 5.0 3.5  7.0 1 1 
       422 1 . . . . . 7.0 6.0 10.0 1 1 
       423 1 . . . . . 7.0 6.0 10.0 1 1 
       424 1 . . . . . 5.0 3.5  7.0 1 1 
       425 1 . . . . . 5.0 3.5  7.0 1 1 
       426 1 . . . . . 7.0 6.0 10.0 1 1 
       427 1 . . . . . 7.0 6.0 10.0 1 1 
       428 1 . . . . . 7.0 6.0  7.0 1 1 
       429 1 . . . . . 7.0 6.0 10.0 1 1 
       430 1 . . . . . 5.0 3.5  7.0 1 1 
       431 1 . . . . . 5.0 3.5  7.0 1 1 
       432 1 . . . . . 7.0 6.0 10.0 1 1 
       433 1 . . . . . 7.0 6.0 10.0 1 1 
       434 1 . . . . . 5.0 3.5  7.0 1 1 
       435 1 . . . . . 5.0 3.5  7.0 1 1 
       436 1 . . . . . 7.0 6.0 10.0 1 1 
       437 1 . . . . . 7.0 6.0 10.0 1 1 
       438 1 . . . . . 7.0 6.0 10.0 1 1 
       439 1 . . . . . 5.0 3.5  7.0 1 1 
       440 1 . . . . . 7.0 6.0 10.0 1 1 
       441 1 . . . . . 7.0 6.0 10.0 1 1 
       442 1 . . . . . 5.0 3.5  7.0 1 1 
       443 1 . . . . . 3.0 2.0  4.5 1 1 
       444 1 . . . . . 7.0 6.0 10.0 1 1 
       445 1 . . . . . 7.0 6.0 10.0 1 1 
       446 1 . . . . . 5.0 3.5  7.0 1 1 
       447 1 . . . . . 5.0 3.5  7.0 1 1 
       448 1 . . . . . 5.0 3.5  7.0 1 1 
       449 1 . . . . . 7.0 6.0 10.0 1 1 
       450 1 . . . . . 3.0 2.0  4.5 1 1 
       451 1 . . . . . 5.0 3.5  7.0 1 1 
       452 1 . . . . . 7.0 6.0 10.0 1 1 
       453 1 . . . . . 7.0 6.0 10.0 1 1 
       454 1 . . . . . 7.0 6.0 10.0 1 1 
       455 1 . . . . . 7.0 6.0 10.0 1 1 
       456 1 . . . . . 7.0 6.0 10.0 1 1 
       457 1 . . . . . 7.0 6.0 10.0 1 1 
       458 1 . . . . . 7.0 6.0 10.0 1 1 
       459 1 . . . . . 3.0 2.0  4.5 1 1 
       460 1 . . . . . 7.0 6.0 10.0 1 1 
       461 1 . . . . . 7.0 6.0 10.0 1 1 
       462 1 . . . . . 7.0 6.0 10.0 1 1 
       463 1 . . . . . 7.0 6.0 10.0 1 1 
       464 1 . . . . . 7.0 6.0 10.0 1 1 
       465 1 . . . . . 7.0 6.0 10.0 1 1 
       466 1 . . . . . 7.0 6.0 10.0 1 1 
       467 1 . . . . . 7.0 6.0 10.0 1 1 
       468 1 . . . . . 5.0 3.5  7.0 1 1 
       469 1 . . . . . 5.0 3.5  7.0 1 1 
       470 1 . . . . . 7.0 6.0 10.0 1 1 
       471 1 . . . . . 5.0 3.5  7.0 1 1 
       472 1 . . . . . 7.0 6.0 10.0 1 1 
       473 1 . . . . . 5.0 3.5  7.0 1 1 
       474 1 . . . . . 3.0 2.0  4.5 1 1 
       475 1 . . . . . 7.0 6.0 10.0 1 1 
       476 1 . . . . . 5.0 3.5  7.0 1 1 
       477 1 . . . . . 5.0 3.5  7.0 1 1 
       478 1 . . . . . 5.0 3.5  7.0 1 1 
       479 1 . . . . . 5.0 3.5  7.0 1 1 
       480 1 . . . . . 3.0 2.0  4.5 1 1 
       481 1 . . . . . 7.0 6.0 10.0 1 1 
       482 1 . . . . . 7.0 6.0 10.0 1 1 
       483 1 . . . . . 7.0 6.0 10.0 1 1 
       484 1 . . . . . 5.0 3.5  7.0 1 1 
       485 1 . . . . . 5.0 3.5  7.0 1 1 
       486 1 . . . . . 7.0 6.0 10.0 1 1 
       487 1 . . . . . 7.0 6.0 10.0 1 1 
       488 1 . . . . . 5.0 3.5  7.0 1 1 
       489 1 . . . . . 7.0 6.0 10.0 1 1 
       490 1 . . . . . 7.0 6.0 10.0 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 2 
         2 1 . . . 1 2 
         3 1 . . . 1 2 
         4 1 . . . 1 2 
         5 1 . . . 1 2 
         6 1 . . . 1 2 
         7 1 . . . 1 2 
         8 1 . . . 1 2 
         9 1 . . . 1 2 
        10 1 . . . 1 2 
        11 1 . . . 1 2 
        12 1 . . . 1 2 
        13 1 . . . 1 2 
        14 1 . . . 1 2 
        15 1 . . . 1 2 
        16 1 . . . 1 2 
        17 1 . . . 1 2 
        18 1 . . . 1 2 
        19 1 . . . 1 2 
        20 1 . . . 1 2 
        21 1 . . . 1 2 
        22 1 . . . 1 2 
        23 1 . . . 1 2 
        24 1 . . . 1 2 
        25 1 . . . 1 2 
        26 1 . . . 1 2 
        27 1 . . . 1 2 
        28 1 . . . 1 2 
        29 1 . . . 1 2 
        30 1 . . . 1 2 
        31 1 . . . 1 2 
        32 1 . . . 1 2 
        33 1 . . . 1 2 
        34 1 . . . 1 2 
        35 1 . . . 1 2 
        36 1 . . . 1 2 
        37 1 . . . 1 2 
        38 1 . . . 1 2 
        39 1 . . . 1 2 
        40 1 . . . 1 2 
        41 1 . . . 1 2 
        42 1 . . . 1 2 
        43 1 . . . 1 2 
        44 1 . . . 1 2 
        45 1 . . . 1 2 
        46 1 . . . 1 2 
        47 1 . . . 1 2 
        48 1 . . . 1 2 
        49 1 . . . 1 2 
        50 1 . . . 1 2 
        51 1 . . . 1 2 
        52 1 . . . 1 2 
        53 1 . . . 1 2 
        54 1 . . . 1 2 
        55 1 . . . 1 2 
        56 1 . . . 1 2 
        57 1 . . . 1 2 
        58 1 . . . 1 2 
        59 1 . . . 1 2 
        60 1 . . . 1 2 
        61 1 . . . 1 2 
        62 1 . . . 1 2 
        63 1 . . . 1 2 
        64 1 . . . 1 2 
        65 1 . . . 1 2 
        66 1 . . . 1 2 
        67 1 . . . 1 2 
        68 1 . . . 1 2 
        69 1 . . . 1 2 
        70 1 . . . 1 2 
        71 1 . . . 1 2 
        72 1 . . . 1 2 
        73 1 . . . 1 2 
        74 1 . . . 1 2 
        75 1 . . . 1 2 
        76 1 . . . 1 2 
        77 1 . . . 1 2 
        78 1 . . . 1 2 
        79 1 . . . 1 2 
        80 1 . . . 1 2 
        81 1 . . . 1 2 
        82 1 . . . 1 2 
        83 1 . . . 1 2 
        84 1 . . . 1 2 
        85 1 . . . 1 2 
        86 1 . . . 1 2 
        87 1 . . . 1 2 
        88 1 . . . 1 2 
        89 1 . . . 1 2 
        90 1 . . . 1 2 
        91 1 . . . 1 2 
        92 1 . . . 1 2 
        93 1 . . . 1 2 
        94 1 . . . 1 2 
        95 1 . . . 1 2 
        96 1 . . . 1 2 
        97 1 . . . 1 2 
        98 1 . . . 1 2 
        99 1 . . . 1 2 
       100 1 . . . 1 2 
       101 1 . . . 1 2 
       102 1 . . . 1 2 
       103 1 . . . 1 2 
       104 1 . . . 1 2 
       105 1 . . . 1 2 
       106 1 . . . 1 2 
       107 1 . . . 1 2 
       108 1 . . . 1 2 
       109 1 . . . 1 2 
       110 1 . . . 1 2 
       111 1 . . . 1 2 
       112 1 . . . 1 2 
       113 1 . . . 1 2 
       114 1 . . . 1 2 
       115 1 . . . 1 2 
       116 1 . . . 1 2 
       117 1 . . . 1 2 
       118 1 . . . 1 2 
       119 1 . . . 1 2 
       120 1 . . . 1 2 
       121 1 . . . 1 2 
       122 1 . . . 1 2 
       123 1 . . . 1 2 
       124 1 . . . 1 2 
       125 1 . . . 1 2 
       126 1 . . . 1 2 
       127 1 . . . 1 2 
       128 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1  20 TYR O .  20 . O  1 2 
         1 1 2 1 1  59 GLY N .  59 . N  1 2 
         2 1 1 1 1  20 TYR O .  20 . O  1 2 
         2 1 2 1 1  59 GLY H .  59 . HN 1 2 
         3 1 1 1 1  20 TYR N .  20 . N  1 2 
         3 1 2 1 1  59 GLY O .  59 . O  1 2 
         4 1 1 1 1  20 TYR H .  20 . HN 1 2 
         4 1 2 1 1  59 GLY O .  59 . O  1 2 
         5 1 1 1 1  22 GLY O .  22 . O  1 2 
         5 1 2 1 1  57 PHE N .  57 . N  1 2 
         6 1 1 1 1  22 GLY O .  22 . O  1 2 
         6 1 2 1 1  57 PHE H .  57 . HN 1 2 
         7 1 1 1 1  22 GLY N .  22 . N  1 2 
         7 1 2 1 1  57 PHE O .  57 . O  1 2 
         8 1 1 1 1  22 GLY H .  22 . HN 1 2 
         8 1 2 1 1  57 PHE O .  57 . O  1 2 
         9 1 1 1 1  24 LYS O .  24 . O  1 2 
         9 1 2 1 1  55 GLY N .  55 . N  1 2 
        10 1 1 1 1  24 LYS O .  24 . O  1 2 
        10 1 2 1 1  55 GLY H .  55 . HN 1 2 
        11 1 1 1 1  24 LYS N .  24 . N  1 2 
        11 1 2 1 1  55 GLY O .  55 . O  1 2 
        12 1 1 1 1  24 LYS H .  24 . HN 1 2 
        12 1 2 1 1  55 GLY O .  55 . O  1 2 
        13 1 1 1 1  26 GLY O .  26 . O  1 2 
        13 1 2 1 1  53 GLY N .  53 . N  1 2 
        14 1 1 1 1  26 GLY O .  26 . O  1 2 
        14 1 2 1 1  53 GLY H .  53 . HN 1 2 
        15 1 1 1 1  26 GLY N .  26 . N  1 2 
        15 1 2 1 1  53 GLY O .  53 . O  1 2 
        16 1 1 1 1  26 GLY H .  26 . HN 1 2 
        16 1 2 1 1  53 GLY O .  53 . O  1 2 
        17 1 1 1 1  54 ALA O .  54 . O  1 2 
        17 1 2 1 1  74 TRP N .  74 . N  1 2 
        18 1 1 1 1  54 ALA O .  54 . O  1 2 
        18 1 2 1 1  74 TRP H .  74 . HN 1 2 
        19 1 1 1 1  54 ALA N .  54 . N  1 2 
        19 1 2 1 1  74 TRP O .  74 . O  1 2 
        20 1 1 1 1  54 ALA H .  54 . HN 1 2 
        20 1 2 1 1  74 TRP O .  74 . O  1 2 
        21 1 1 1 1  56 ALA O .  56 . O  1 2 
        21 1 2 1 1  72 TYR N .  72 . N  1 2 
        22 1 1 1 1  56 ALA O .  56 . O  1 2 
        22 1 2 1 1  72 TYR H .  72 . HN 1 2 
        23 1 1 1 1  56 ALA N .  56 . N  1 2 
        23 1 2 1 1  72 TYR O .  72 . O  1 2 
        24 1 1 1 1  56 ALA H .  56 . HN 1 2 
        24 1 2 1 1  72 TYR O .  72 . O  1 2 
        25 1 1 1 1  58 GLY O .  58 . O  1 2 
        25 1 2 1 1  70 MET N .  70 . N  1 2 
        26 1 1 1 1  58 GLY O .  58 . O  1 2 
        26 1 2 1 1  70 MET H .  70 . HN 1 2 
        27 1 1 1 1  58 GLY N .  58 . N  1 2 
        27 1 2 1 1  70 MET O .  70 . O  1 2 
        28 1 1 1 1  58 GLY H .  58 . HN 1 2 
        28 1 2 1 1  70 MET O .  70 . O  1 2 
        29 1 1 1 1  60 TYR O .  60 . O  1 2 
        29 1 2 1 1  68 PHE N .  68 . N  1 2 
        30 1 1 1 1  60 TYR O .  60 . O  1 2 
        30 1 2 1 1  68 PHE H .  68 . HN 1 2 
        31 1 1 1 1  60 TYR N .  60 . N  1 2 
        31 1 2 1 1  68 PHE O .  68 . O  1 2 
        32 1 1 1 1  60 TYR H .  60 . HN 1 2 
        32 1 2 1 1  68 PHE O .  68 . O  1 2 
        33 1 1 1 1  67 GLY O .  67 . O  1 2 
        33 1 2 1 1  99 LYS N .  99 . N  1 2 
        34 1 1 1 1  67 GLY O .  67 . O  1 2 
        34 1 2 1 1  99 LYS H .  99 . HN 1 2 
        35 1 1 1 1  67 GLY N .  67 . N  1 2 
        35 1 2 1 1  99 LYS O .  99 . O  1 2 
        36 1 1 1 1  67 GLY H .  67 . HN 1 2 
        36 1 2 1 1  99 LYS O .  99 . O  1 2 
        37 1 1 1 1  69 GLU O .  69 . O  1 2 
        37 1 2 1 1  97 THR N .  97 . N  1 2 
        38 1 1 1 1  69 GLU O .  69 . O  1 2 
        38 1 2 1 1  97 THR H .  97 . HN 1 2 
        39 1 1 1 1  69 GLU N .  69 . N  1 2 
        39 1 2 1 1  97 THR O .  97 . O  1 2 
        40 1 1 1 1  69 GLU H .  69 . HN 1 2 
        40 1 2 1 1  97 THR O .  97 . O  1 2 
        41 1 1 1 1  71 GLY O .  71 . O  1 2 
        41 1 2 1 1  95 GLN N .  95 . N  1 2 
        42 1 1 1 1  71 GLY O .  71 . O  1 2 
        42 1 2 1 1  95 GLN H .  95 . HN 1 2 
        43 1 1 1 1  71 GLY N .  71 . N  1 2 
        43 1 2 1 1  95 GLN O .  95 . O  1 2 
        44 1 1 1 1  71 GLY H .  71 . HN 1 2 
        44 1 2 1 1  95 GLN O .  95 . O  1 2 
        45 1 1 1 1  73 ASP O .  73 . O  1 2 
        45 1 2 1 1  93 GLY N .  93 . N  1 2 
        46 1 1 1 1  73 ASP O .  73 . O  1 2 
        46 1 2 1 1  93 GLY H .  93 . HN 1 2 
        47 1 1 1 1  73 ASP N .  73 . N  1 2 
        47 1 2 1 1  93 GLY O .  93 . O  1 2 
        48 1 1 1 1  73 ASP H .  73 . HN 1 2 
        48 1 2 1 1  93 GLY O .  93 . O  1 2 
        49 1 1 1 1  94 VAL O .  94 . O  1 2 
        49 1 2 1 1 118 VAL N . 118 . N  1 2 
        50 1 1 1 1  94 VAL O .  94 . O  1 2 
        50 1 2 1 1 118 VAL H . 118 . HN 1 2 
        51 1 1 1 1  94 VAL N .  94 . N  1 2 
        51 1 2 1 1 118 VAL O . 118 . O  1 2 
        52 1 1 1 1  94 VAL H .  94 . HN 1 2 
        52 1 2 1 1 118 VAL O . 118 . O  1 2 
        53 1 1 1 1  96 LEU O .  96 . O  1 2 
        53 1 2 1 1 116 GLY N . 116 . N  1 2 
        54 1 1 1 1  96 LEU O .  96 . O  1 2 
        54 1 2 1 1 116 GLY H . 116 . HN 1 2 
        55 1 1 1 1  96 LEU N .  96 . N  1 2 
        55 1 2 1 1 116 GLY O . 116 . O  1 2 
        56 1 1 1 1  96 LEU H .  96 . HN 1 2 
        56 1 2 1 1 116 GLY O . 116 . O  1 2 
        57 1 1 1 1  98 ALA O .  98 . O  1 2 
        57 1 2 1 1 114 LEU N . 114 . N  1 2 
        58 1 1 1 1  98 ALA O .  98 . O  1 2 
        58 1 2 1 1 114 LEU H . 114 . HN 1 2 
        59 1 1 1 1  98 ALA N .  98 . N  1 2 
        59 1 2 1 1 114 LEU O . 114 . O  1 2 
        60 1 1 1 1  98 ALA H .  98 . HN 1 2 
        60 1 2 1 1 114 LEU O . 114 . O  1 2 
        61 1 1 1 1 100 LEU O . 100 . O  1 2 
        61 1 2 1 1 112 THR N . 112 . N  1 2 
        62 1 1 1 1 100 LEU O . 100 . O  1 2 
        62 1 2 1 1 112 THR H . 112 . HN 1 2 
        63 1 1 1 1 100 LEU N . 100 . N  1 2 
        63 1 2 1 1 112 THR O . 112 . O  1 2 
        64 1 1 1 1 100 LEU H . 100 . HN 1 2 
        64 1 2 1 1 112 THR O . 112 . O  1 2 
        65 1 1 1 1 102 TYR O . 102 . O  1 2 
        65 1 2 1 1 110 ILE N . 110 . N  1 2 
        66 1 1 1 1 102 TYR O . 102 . O  1 2 
        66 1 2 1 1 110 ILE H . 110 . HN 1 2 
        67 1 1 1 1 102 TYR N . 102 . N  1 2 
        67 1 2 1 1 110 ILE O . 110 . O  1 2 
        68 1 1 1 1 102 TYR H . 102 . HN 1 2 
        68 1 2 1 1 110 ILE O . 110 . O  1 2 
        69 1 1 1 1 109 ASP O . 109 . O  1 2 
        69 1 2 1 1 150 GLU N . 150 . N  1 2 
        70 1 1 1 1 109 ASP O . 109 . O  1 2 
        70 1 2 1 1 150 GLU H . 150 . HN 1 2 
        71 1 1 1 1 109 ASP N . 109 . N  1 2 
        71 1 2 1 1 150 GLU O . 150 . O  1 2 
        72 1 1 1 1 109 ASP H . 109 . HN 1 2 
        72 1 2 1 1 150 GLU O . 150 . O  1 2 
        73 1 1 1 1 111 TYR O . 111 . O  1 2 
        73 1 2 1 1 148 GLY N . 148 . N  1 2 
        74 1 1 1 1 111 TYR O . 111 . O  1 2 
        74 1 2 1 1 148 GLY H . 148 . HN 1 2 
        75 1 1 1 1 111 TYR N . 111 . N  1 2 
        75 1 2 1 1 148 GLY O . 148 . O  1 2 
        76 1 1 1 1 111 TYR H . 111 . HN 1 2 
        76 1 2 1 1 148 GLY O . 148 . O  1 2 
        77 1 1 1 1 113 ARG O . 113 . O  1 2 
        77 1 2 1 1 146 ALA N . 146 . N  1 2 
        78 1 1 1 1 113 ARG O . 113 . O  1 2 
        78 1 2 1 1 146 ALA H . 146 . HN 1 2 
        79 1 1 1 1 113 ARG N . 113 . N  1 2 
        79 1 2 1 1 146 ALA O . 146 . O  1 2 
        80 1 1 1 1 113 ARG H . 113 . HN 1 2 
        80 1 2 1 1 146 ALA O . 146 . O  1 2 
        81 1 1 1 1 115 GLY O . 115 . O  1 2 
        81 1 2 1 1 144 VAL N . 144 . N  1 2 
        82 1 1 1 1 115 GLY O . 115 . O  1 2 
        82 1 2 1 1 144 VAL H . 144 . HN 1 2 
        83 1 1 1 1 115 GLY N . 115 . N  1 2 
        83 1 2 1 1 144 VAL O . 144 . O  1 2 
        84 1 1 1 1 115 GLY H . 115 . HN 1 2 
        84 1 2 1 1 144 VAL O . 144 . O  1 2 
        85 1 1 1 1 117 MET O . 117 . O  1 2 
        85 1 2 1 1 142 SER N . 142 . N  1 2 
        86 1 1 1 1 117 MET O . 117 . O  1 2 
        86 1 2 1 1 142 SER H . 142 . HN 1 2 
        87 1 1 1 1 117 MET N . 117 . N  1 2 
        87 1 2 1 1 142 SER O . 142 . O  1 2 
        88 1 1 1 1 117 MET H . 117 . HN 1 2 
        88 1 2 1 1 142 SER O . 142 . O  1 2 
        89 1 1 1 1 119 TRP O . 119 . O  1 2 
        89 1 2 1 1 140 GLY N . 140 . N  1 2 
        90 1 1 1 1 119 TRP O . 119 . O  1 2 
        90 1 2 1 1 140 GLY H . 140 . HN 1 2 
        91 1 1 1 1 119 TRP N . 119 . N  1 2 
        91 1 2 1 1 140 GLY O . 140 . O  1 2 
        92 1 1 1 1 119 TRP H . 119 . HN 1 2 
        92 1 2 1 1 140 GLY O . 140 . O  1 2 
        93 1 1 1 1 147 GLY O . 147 . O  1 2 
        93 1 2 1 1 163 TYR N . 163 . N  1 2 
        94 1 1 1 1 147 GLY O . 147 . O  1 2 
        94 1 2 1 1 163 TYR H . 163 . HN 1 2 
        95 1 1 1 1 147 GLY N . 147 . N  1 2 
        95 1 2 1 1 163 TYR O . 163 . O  1 2 
        96 1 1 1 1 147 GLY H . 147 . HN 1 2 
        96 1 2 1 1 163 TYR O . 163 . O  1 2 
        97 1 1 1 1 149 VAL O . 149 . O  1 2 
        97 1 2 1 1 161 LEU N . 161 . N  1 2 
        98 1 1 1 1 149 VAL O . 149 . O  1 2 
        98 1 2 1 1 161 LEU H . 161 . HN 1 2 
        99 1 1 1 1 149 VAL N . 149 . N  1 2 
        99 1 2 1 1 161 LEU O . 161 . O  1 2 
       100 1 1 1 1 149 VAL H . 149 . HN 1 2 
       100 1 2 1 1 161 LEU O . 161 . O  1 2 
       101 1 1 1 1 151 TRP O . 151 . O  1 2 
       101 1 2 1 1 159 THR N . 159 . N  1 2 
       102 1 1 1 1 151 TRP O . 151 . O  1 2 
       102 1 2 1 1 159 THR H . 159 . HN 1 2 
       103 1 1 1 1 151 TRP N . 151 . N  1 2 
       103 1 2 1 1 159 THR O . 159 . O  1 2 
       104 1 1 1 1 151 TRP H . 151 . HN 1 2 
       104 1 2 1 1 159 THR O . 159 . O  1 2 
       105 1 1 1 1 158 ALA O . 158 . O  1 2 
       105 1 2 1 1 189 SER N . 189 . N  1 2 
       106 1 1 1 1 158 ALA O . 158 . O  1 2 
       106 1 2 1 1 189 SER H . 189 . HN 1 2 
       107 1 1 1 1 158 ALA N . 158 . N  1 2 
       107 1 2 1 1 189 SER O . 189 . O  1 2 
       108 1 1 1 1 158 ALA H . 158 . HN 1 2 
       108 1 2 1 1 189 SER O . 189 . O  1 2 
       109 1 1 1 1 160 ARG O . 160 . O  1 2 
       109 1 2 1 1 187 GLY N . 187 . N  1 2 
       110 1 1 1 1 160 ARG O . 160 . O  1 2 
       110 1 2 1 1 187 GLY H . 187 . HN 1 2 
       111 1 1 1 1 160 ARG N . 160 . N  1 2 
       111 1 2 1 1 187 GLY O . 187 . O  1 2 
       112 1 1 1 1 160 ARG H . 160 . HN 1 2 
       112 1 2 1 1 187 GLY O . 187 . O  1 2 
       113 1 1 1 1 162 GLU O . 162 . O  1 2 
       113 1 2 1 1 185 SER N . 185 . N  1 2 
       114 1 1 1 1 162 GLU O . 162 . O  1 2 
       114 1 2 1 1 185 SER H . 185 . HN 1 2 
       115 1 1 1 1 162 GLU N . 162 . N  1 2 
       115 1 2 1 1 185 SER O . 185 . O  1 2 
       116 1 1 1 1 162 GLU H . 162 . HN 1 2 
       116 1 2 1 1 185 SER O . 185 . O  1 2 
       117 1 1 1 1  25 LEU N .  25 . N  1 2 
       117 1 2 1 1 186 LEU O . 186 . O  1 2 
       118 1 1 1 1  25 LEU H .  25 . HN 1 2 
       118 1 2 1 1 186 LEU O . 186 . O  1 2 
       119 1 1 1 1  25 LEU O .  25 . O  1 2 
       119 1 2 1 1 186 LEU N . 186 . N  1 2 
       120 1 1 1 1  25 LEU O .  25 . O  1 2 
       120 1 2 1 1 186 LEU H . 186 . HN 1 2 
       121 1 1 1 1  23 GLY N .  23 . N  1 2 
       121 1 2 1 1 188 VAL O . 188 . O  1 2 
       122 1 1 1 1  23 GLY H .  23 . HN 1 2 
       122 1 2 1 1 188 VAL O . 188 . O  1 2 
       123 1 1 1 1  23 GLY O .  23 . O  1 2 
       123 1 2 1 1 188 VAL N . 188 . N  1 2 
       124 1 1 1 1  23 GLY O .  23 . O  1 2 
       124 1 2 1 1 188 VAL H . 188 . HN 1 2 
       125 1 1 1 1  21 ALA N .  21 . N  1 2 
       125 1 2 1 1 190 TYR O . 190 . O  1 2 
       126 1 1 1 1  21 ALA H .  21 . HN 1 2 
       126 1 2 1 1 190 TYR O . 190 . O  1 2 
       127 1 1 1 1  21 ALA O .  21 . O  1 2 
       127 1 2 1 1 190 TYR N . 190 . N  1 2 
       128 1 1 1 1  21 ALA O .  21 . O  1 2 
       128 1 2 1 1 190 TYR H . 190 . HN 1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . 2.9 2.6 3.4 1 2 
         2 1 . . . . . 1.9 1.4 2.0 1 2 
         3 1 . . . . . 2.9 2.6 3.4 1 2 
         4 1 . . . . . 1.9 1.4 2.0 1 2 
         5 1 . . . . . 2.9 2.6 3.4 1 2 
         6 1 . . . . . 1.9 1.4 2.0 1 2 
         7 1 . . . . . 2.9 2.6 3.4 1 2 
         8 1 . . . . . 1.9 1.4 2.0 1 2 
         9 1 . . . . . 2.9 2.6 3.4 1 2 
        10 1 . . . . . 1.9 1.4 2.0 1 2 
        11 1 . . . . . 2.9 2.6 3.4 1 2 
        12 1 . . . . . 1.9 1.4 2.0 1 2 
        13 1 . . . . . 2.9 2.6 3.4 1 2 
        14 1 . . . . . 1.9 1.4 2.0 1 2 
        15 1 . . . . . 2.9 2.6 3.4 1 2 
        16 1 . . . . . 1.9 1.4 2.0 1 2 
        17 1 . . . . . 2.9 2.6 3.4 1 2 
        18 1 . . . . . 1.9 1.4 2.0 1 2 
        19 1 . . . . . 2.9 2.6 3.4 1 2 
        20 1 . . . . . 1.9 1.4 2.0 1 2 
        21 1 . . . . . 2.9 2.6 3.4 1 2 
        22 1 . . . . . 1.9 1.4 2.0 1 2 
        23 1 . . . . . 2.9 2.6 3.4 1 2 
        24 1 . . . . . 1.9 1.4 2.0 1 2 
        25 1 . . . . . 2.9 2.6 3.4 1 2 
        26 1 . . . . . 1.9 1.4 2.0 1 2 
        27 1 . . . . . 2.9 2.6 3.4 1 2 
        28 1 . . . . . 1.9 1.4 2.0 1 2 
        29 1 . . . . . 2.9 2.6 3.4 1 2 
        30 1 . . . . . 1.9 1.4 2.0 1 2 
        31 1 . . . . . 2.9 2.6 3.4 1 2 
        32 1 . . . . . 1.9 1.4 2.0 1 2 
        33 1 . . . . . 2.9 2.6 3.4 1 2 
        34 1 . . . . . 1.9 1.4 2.0 1 2 
        35 1 . . . . . 2.9 2.6 3.4 1 2 
        36 1 . . . . . 1.9 1.4 2.0 1 2 
        37 1 . . . . . 2.9 2.6 3.4 1 2 
        38 1 . . . . . 1.9 1.4 2.0 1 2 
        39 1 . . . . . 2.9 2.6 3.4 1 2 
        40 1 . . . . . 1.9 1.4 2.0 1 2 
        41 1 . . . . . 2.9 2.6 3.4 1 2 
        42 1 . . . . . 1.9 1.4 2.0 1 2 
        43 1 . . . . . 2.9 2.6 3.4 1 2 
        44 1 . . . . . 1.9 1.4 2.0 1 2 
        45 1 . . . . . 2.9 2.6 3.4 1 2 
        46 1 . . . . . 1.9 1.4 2.0 1 2 
        47 1 . . . . . 2.9 2.6 3.4 1 2 
        48 1 . . . . . 1.9 1.4 2.0 1 2 
        49 1 . . . . . 2.9 2.6 3.4 1 2 
        50 1 . . . . . 1.9 1.4 2.0 1 2 
        51 1 . . . . . 2.9 2.6 3.4 1 2 
        52 1 . . . . . 1.9 1.4 2.0 1 2 
        53 1 . . . . . 2.9 2.6 3.4 1 2 
        54 1 . . . . . 1.9 1.4 2.0 1 2 
        55 1 . . . . . 2.9 2.6 3.4 1 2 
        56 1 . . . . . 1.9 1.4 2.0 1 2 
        57 1 . . . . . 2.9 2.6 3.4 1 2 
        58 1 . . . . . 1.9 1.4 2.0 1 2 
        59 1 . . . . . 2.9 2.6 3.4 1 2 
        60 1 . . . . . 1.9 1.4 2.0 1 2 
        61 1 . . . . . 2.9 2.6 3.4 1 2 
        62 1 . . . . . 1.9 1.4 2.0 1 2 
        63 1 . . . . . 2.9 2.6 3.4 1 2 
        64 1 . . . . . 1.9 1.4 2.0 1 2 
        65 1 . . . . . 2.9 2.6 3.4 1 2 
        66 1 . . . . . 1.9 1.4 2.0 1 2 
        67 1 . . . . . 2.9 2.6 3.4 1 2 
        68 1 . . . . . 1.9 1.4 2.0 1 2 
        69 1 . . . . . 2.9 2.6 3.4 1 2 
        70 1 . . . . . 1.9 1.4 2.0 1 2 
        71 1 . . . . . 2.9 2.6 3.4 1 2 
        72 1 . . . . . 1.9 1.4 2.0 1 2 
        73 1 . . . . . 2.9 2.6 3.4 1 2 
        74 1 . . . . . 1.9 1.4 2.0 1 2 
        75 1 . . . . . 2.9 2.6 3.4 1 2 
        76 1 . . . . . 1.9 1.4 2.0 1 2 
        77 1 . . . . . 2.9 2.6 3.4 1 2 
        78 1 . . . . . 1.9 1.4 2.0 1 2 
        79 1 . . . . . 2.9 2.6 3.4 1 2 
        80 1 . . . . . 1.9 1.4 2.0 1 2 
        81 1 . . . . . 2.9 2.6 3.4 1 2 
        82 1 . . . . . 1.9 1.4 2.0 1 2 
        83 1 . . . . . 2.9 2.6 3.4 1 2 
        84 1 . . . . . 1.9 1.4 2.0 1 2 
        85 1 . . . . . 2.9 2.6 3.4 1 2 
        86 1 . . . . . 1.9 1.4 2.0 1 2 
        87 1 . . . . . 2.9 2.6 3.4 1 2 
        88 1 . . . . . 1.9 1.4 2.0 1 2 
        89 1 . . . . . 2.9 2.6 3.4 1 2 
        90 1 . . . . . 1.9 1.4 2.0 1 2 
        91 1 . . . . . 2.9 2.6 3.4 1 2 
        92 1 . . . . . 1.9 1.4 2.0 1 2 
        93 1 . . . . . 2.9 2.6 3.4 1 2 
        94 1 . . . . . 1.9 1.4 2.0 1 2 
        95 1 . . . . . 2.9 2.6 3.4 1 2 
        96 1 . . . . . 1.9 1.4 2.0 1 2 
        97 1 . . . . . 2.9 2.6 3.4 1 2 
        98 1 . . . . . 1.9 1.4 2.0 1 2 
        99 1 . . . . . 2.9 2.6 3.4 1 2 
       100 1 . . . . . 1.9 1.4 2.0 1 2 
       101 1 . . . . . 2.9 2.6 3.4 1 2 
       102 1 . . . . . 1.9 1.4 2.0 1 2 
       103 1 . . . . . 2.9 2.6 3.4 1 2 
       104 1 . . . . . 1.9 1.4 2.0 1 2 
       105 1 . . . . . 2.9 2.6 3.4 1 2 
       106 1 . . . . . 1.9 1.4 2.0 1 2 
       107 1 . . . . . 2.9 2.6 3.4 1 2 
       108 1 . . . . . 1.9 1.4 2.0 1 2 
       109 1 . . . . . 2.9 2.6 3.4 1 2 
       110 1 . . . . . 1.9 1.4 2.0 1 2 
       111 1 . . . . . 2.9 2.6 3.4 1 2 
       112 1 . . . . . 1.9 1.4 2.0 1 2 
       113 1 . . . . . 2.9 2.6 3.4 1 2 
       114 1 . . . . . 1.9 1.4 2.0 1 2 
       115 1 . . . . . 2.9 2.6 3.4 1 2 
       116 1 . . . . . 1.9 1.4 2.0 1 2 
       117 1 . . . . . 2.9 2.6 3.4 1 2 
       118 1 . . . . . 1.9 1.4 2.0 1 2 
       119 1 . . . . . 2.9 2.6 3.4 1 2 
       120 1 . . . . . 1.9 1.4 2.0 1 2 
       121 1 . . . . . 2.9 2.6 3.4 1 2 
       122 1 . . . . . 1.9 1.4 2.0 1 2 
       123 1 . . . . . 2.9 2.6 3.4 1 2 
       124 1 . . . . . 1.9 1.4 2.0 1 2 
       125 1 . . . . . 2.9 2.6 3.4 1 2 
       126 1 . . . . . 1.9 1.4 2.0 1 2 
       127 1 . . . . . 2.9 2.6 3.4 1 2 
       128 1 . . . . . 1.9 1.4 2.0 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   1 ALA C 1 1   2 ARG N  1 1   2 ARG CA 1 1   2 ARG C     -182.0      -18.0 .   1 . C .   2 . N  .   2 . CA .   2 . C 1 1 
         2 . 1 1   2 ARG C 1 1   3 ILE N  1 1   3 ILE CA 1 1   3 ILE C     -179.0      -63.0 .   2 . C .   3 . N  .   3 . CA .   3 . C 1 1 
         3 . 1 1   3 ILE C 1 1   4 MET N  1 1   4 MET CA 1 1   4 MET C -174.99998 -26.999998 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 1 
         4 . 1 1   4 MET C 1 1   5 LYS N  1 1   5 LYS CA 1 1   5 LYS C -179.99998 -23.999998 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 1 
         5 . 1 1   5 LYS C 1 1   6 ALA N  1 1   6 ALA CA 1 1   6 ALA C -118.99999      -59.0 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 1 
         6 . 1 1   6 ALA C 1 1   7 ILE N  1 1   7 ILE CA 1 1   7 ILE C     -185.0      -49.0 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
         7 . 1 1   7 ILE C 1 1   8 PHE N  1 1   8 PHE CA 1 1   8 PHE C     -173.0      -33.0 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 1 
         8 . 1 1   8 PHE C 1 1   9 VAL N  1 1   9 VAL CA 1 1   9 VAL C     -185.0 -60.999996 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
         9 . 1 1   9 VAL C 1 1  10 LEU N  1 1  10 LEU CA 1 1  10 LEU C -174.99998 -26.999998 .   9 . C .  10 . N  .  10 . CA .  10 . C 1 1 
        10 . 1 1  10 LEU C 1 1  11 ASN N  1 1  11 ASN CA 1 1  11 ASN C      -89.0      -57.0 .  10 . C .  11 . N  .  11 . CA .  11 . C 1 1 
        11 . 1 1  11 ASN C 1 1  12 ALA N  1 1  12 ALA CA 1 1  12 ALA C     -174.0      -10.0 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
        12 . 1 1  12 ALA C 1 1  13 ALA N  1 1  13 ALA CA 1 1  13 ALA C     -121.0      -57.0 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        13 . 1 1  13 ALA C 1 1  14 PRO N  1 1  14 PRO CA 1 1  14 PRO C      -75.0      -55.0 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        14 . 1 1  14 PRO C 1 1  15 LYS N  1 1  15 LYS CA 1 1  15 LYS C     -153.0      -37.0 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        15 . 1 1  15 LYS C 1 1  16 ASP N  1 1  16 ASP CA 1 1  16 ASP C      -89.0      -57.0 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        16 . 1 1  16 ASP C 1 1  17 ASN N  1 1  17 ASN CA 1 1  17 ASN C -107.99999      -60.0 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        17 . 1 1  17 ASN C 1 1  18 THR N  1 1  18 THR CA 1 1  18 THR C     -165.0     -101.0 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        18 . 1 1  18 THR C 1 1  19 TRP N  1 1  19 TRP CA 1 1  19 TRP C -150.99998      -87.0 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 1 
        19 . 1 1  19 TRP C 1 1  20 TYR N  1 1  20 TYR CA 1 1  20 TYR C     -173.0     -109.0 .  19 . C .  20 . N  .  20 . CA .  20 . C 1 1 
        20 . 1 1  20 TYR C 1 1  21 ALA N  1 1  21 ALA CA 1 1  21 ALA C -179.99998      -88.0 .  20 . C .  21 . N  .  21 . CA .  21 . C 1 1 
        21 . 1 1  22 GLY C 1 1  23 GLY N  1 1  23 GLY CA 1 1  23 GLY C     -164.0 -123.99999 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 1 
        22 . 1 1  23 GLY C 1 1  24 LYS N  1 1  24 LYS CA 1 1  24 LYS C     -162.0     -110.0 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        23 . 1 1  24 LYS C 1 1  25 LEU N  1 1  25 LEU CA 1 1  25 LEU C     -153.0     -121.0 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        24 . 1 1  25 LEU C 1 1  26 GLY N  1 1  26 GLY CA 1 1  26 GLY C -179.99998        0.0 .  25 . C .  26 . N  .  26 . CA .  26 . C 1 1 
        25 . 1 1  26 GLY C 1 1  27 TRP N  1 1  27 TRP CA 1 1  27 TRP C     -143.0      -79.0 .  26 . C .  27 . N  .  27 . CA .  27 . C 1 1 
        26 . 1 1  27 TRP C 1 1  28 SER N  1 1  28 SER CA 1 1  28 SER C -179.99998        0.0 .  27 . C .  28 . N  .  28 . CA .  28 . C 1 1 
        27 . 1 1  28 SER C 1 1  29 GLN N  1 1  29 GLN CA 1 1  29 GLN C -179.99998        0.0 .  28 . C .  29 . N  .  29 . CA .  29 . C 1 1 
        28 . 1 1  29 GLN C 1 1  30 TYR N  1 1  30 TYR CA 1 1  30 TYR C -179.99998        0.0 .  29 . C .  30 . N  .  30 . CA .  30 . C 1 1 
        29 . 1 1  30 TYR C 1 1  31 HIS N  1 1  31 HIS CA 1 1  31 HIS C -179.99998        0.0 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        30 . 1 1  31 HIS C 1 1  32 ASP N  1 1  32 ASP CA 1 1  32 ASP C -179.99998        0.0 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        31 . 1 1  32 ASP C 1 1  33 THR N  1 1  33 THR CA 1 1  33 THR C -121.99999      -38.0 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        32 . 1 1  33 THR C 1 1  34 GLY N  1 1  34 GLY CA 1 1  34 GLY C       79.0      103.0 .  33 . C .  34 . N  .  34 . CA .  34 . C 1 1 
        33 . 1 1  34 GLY C 1 1  35 PHE N  1 1  35 PHE CA 1 1  35 PHE C     -152.0 -23.999998 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 1 
        34 . 1 1  35 PHE C 1 1  36 TYR N  1 1  36 TYR CA 1 1  36 TYR C     -185.0      -21.0 .  35 . C .  36 . N  .  36 . CA .  36 . C 1 1 
        35 . 1 1  36 TYR C 1 1  37 GLY N  1 1  37 GLY CA 1 1  37 GLY C     -181.0       -1.0 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
        36 . 1 1  37 GLY C 1 1  38 ASN N  1 1  38 ASN CA 1 1  38 ASN C     -121.0      -41.0 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        37 . 1 1  38 ASN C 1 1  39 GLY N  1 1  39 GLY CA 1 1  39 GLY C     -183.0 -2.9999998 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        38 . 1 1  39 GLY C 1 1  40 PHE N  1 1  40 PHE CA 1 1  40 PHE C     -140.0      -40.0 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        39 . 1 1  40 PHE C 1 1  41 GLN N  1 1  41 GLN CA 1 1  41 GLN C     -166.0      -22.0 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        40 . 1 1  41 GLN C 1 1  42 ASN N  1 1  42 ASN CA 1 1  42 ASN C -118.99999      -55.0 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        41 . 1 1  42 ASN C 1 1  43 ASN N  1 1  43 ASN CA 1 1  43 ASN C     -147.0      -15.0 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        42 . 1 1  43 ASN C 1 1  44 ASN N  1 1  44 ASN CA 1 1  44 ASN C     -145.0      -53.0 .  43 . C .  44 . N  .  44 . CA .  44 . C 1 1 
        43 . 1 1  44 ASN C 1 1  45 GLY N  1 1  45 GLY CA 1 1  45 GLY C -179.99998        0.0 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 1 
        44 . 1 1  45 GLY C 1 1  46 PRO N  1 1  46 PRO CA 1 1  46 PRO C -179.99998        0.0 .  45 . C .  46 . N  .  46 . CA .  46 . C 1 1 
        45 . 1 1  46 PRO C 1 1  47 THR N  1 1  47 THR CA 1 1  47 THR C -179.99998        0.0 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 1 
        46 . 1 1  47 THR C 1 1  48 ARG N  1 1  48 ARG CA 1 1  48 ARG C     -166.0      -26.0 .  47 . C .  48 . N  .  48 . CA .  48 . C 1 1 
        47 . 1 1  48 ARG C 1 1  49 ASN N  1 1  49 ASN CA 1 1  49 ASN C     -130.0      -42.0 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        48 . 1 1  49 ASN C 1 1  50 ASP N  1 1  50 ASP CA 1 1  50 ASP C     -120.0      -64.0 .  49 . C .  50 . N  .  50 . CA .  50 . C 1 1 
        49 . 1 1  50 ASP C 1 1  51 GLN N  1 1  51 GLN CA 1 1  51 GLN C     -170.0      -30.0 .  50 . C .  51 . N  .  51 . CA .  51 . C 1 1 
        50 . 1 1  51 GLN C 1 1  52 LEU N  1 1  52 LEU CA 1 1  52 LEU C     -145.0      -73.0 .  51 . C .  52 . N  .  52 . CA .  52 . C 1 1 
        51 . 1 1  52 LEU C 1 1  53 GLY N  1 1  53 GLY CA 1 1  53 GLY C -174.99998      -83.0 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        52 . 1 1  53 GLY C 1 1  54 ALA N  1 1  54 ALA CA 1 1  54 ALA C     -177.0      -85.0 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        53 . 1 1  55 GLY C 1 1  56 ALA N  1 1  56 ALA CA 1 1  56 ALA C     -143.0      -95.0 .  55 . C .  56 . N  .  56 . CA .  56 . C 1 1 
        54 . 1 1  56 ALA C 1 1  57 PHE N  1 1  57 PHE CA 1 1  57 PHE C     -159.0     -103.0 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
        55 . 1 1  57 PHE C 1 1  58 GLY N  1 1  58 GLY CA 1 1  58 GLY C     -174.0     -114.0 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 1 
        56 . 1 1  58 GLY C 1 1  59 GLY N  1 1  59 GLY CA 1 1  59 GLY C     -197.0      -65.0 .  58 . C .  59 . N  .  59 . CA .  59 . C 1 1 
        57 . 1 1  59 GLY C 1 1  60 TYR N  1 1  60 TYR CA 1 1  60 TYR C     -155.0      -91.0 .  59 . C .  60 . N  .  60 . CA .  60 . C 1 1 
        58 . 1 1  60 TYR C 1 1  61 GLN N  1 1  61 GLN CA 1 1  61 GLN C     -131.0  -66.99999 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 1 
        59 . 1 1  66 LEU C 1 1  67 GLY N  1 1  67 GLY CA 1 1  67 GLY C     -166.0     -106.0 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 1 
        60 . 1 1  67 GLY C 1 1  68 PHE N  1 1  68 PHE CA 1 1  68 PHE C     -174.0      -82.0 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
        61 . 1 1  68 PHE C 1 1  69 GLU N  1 1  69 GLU CA 1 1  69 GLU C     -158.0     -110.0 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
        62 . 1 1  69 GLU C 1 1  70 MET N  1 1  70 MET CA 1 1  70 MET C     -148.0  -95.99999 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
        63 . 1 1  70 MET C 1 1  71 GLY N  1 1  71 GLY CA 1 1  71 GLY C     -174.0     -110.0 .  70 . C .  71 . N  .  71 . CA .  71 . C 1 1 
        64 . 1 1  71 GLY C 1 1  72 TYR N  1 1  72 TYR CA 1 1  72 TYR C     -138.0      -98.0 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
        65 . 1 1  72 TYR C 1 1  73 ASP N  1 1  73 ASP CA 1 1  73 ASP C     -156.0      -72.0 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 1 
        66 . 1 1  73 ASP C 1 1  74 TRP N  1 1  74 TRP CA 1 1  74 TRP C     -139.0      -71.0 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
        67 . 1 1  77 ARG C 1 1  78 MET N  1 1  78 MET CA 1 1  78 MET C     -187.0      -39.0 .  77 . C .  78 . N  .  78 . CA .  78 . C 1 1 
        68 . 1 1  78 MET C 1 1  79 ALA N  1 1  79 ALA CA 1 1  79 ALA C -191.99998      -32.0 .  78 . C .  79 . N  .  79 . CA .  79 . C 1 1 
        69 . 1 1  79 ALA C 1 1  80 TYR N  1 1  80 TYR CA 1 1  80 TYR C     -187.0 -26.999998 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
        70 . 1 1  80 TYR C 1 1  81 LYS N  1 1  81 LYS CA 1 1  81 LYS C     -166.0      -30.0 .  80 . C .  81 . N  .  81 . CA .  81 . C 1 1 
        71 . 1 1  81 LYS C 1 1  82 GLY N  1 1  82 GLY CA 1 1  82 GLY C     -183.0 -2.9999998 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
        72 . 1 1  82 GLY C 1 1  83 SER N  1 1  83 SER CA 1 1  83 SER C     -183.0      -39.0 .  82 . C .  83 . N  .  83 . CA .  83 . C 1 1 
        73 . 1 1  83 SER C 1 1  84 VAL N  1 1  84 VAL CA 1 1  84 VAL C     -190.0 -61.999996 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 1 
        74 . 1 1  84 VAL C 1 1  85 ASP N  1 1  85 ASP CA 1 1  85 ASP C     -193.0      -21.0 .  84 . C .  85 . N  .  85 . CA .  85 . C 1 1 
        75 . 1 1  85 ASP C 1 1  86 ASN N  1 1  86 ASN CA 1 1  86 ASN C     -143.0 -26.999998 .  85 . C .  86 . N  .  86 . CA .  86 . C 1 1 
        76 . 1 1  87 GLY C 1 1  88 ALA N  1 1  88 ALA CA 1 1  88 ALA C     -150.0      -10.0 .  87 . C .  88 . N  .  88 . CA .  88 . C 1 1 
        77 . 1 1  90 LYS C 1 1  91 ALA N  1 1  91 ALA CA 1 1  91 ALA C -191.99998      -88.0 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 1 
        78 . 1 1  91 ALA C 1 1  92 GLN N  1 1  92 GLN CA 1 1  92 GLN C -174.99998      -91.0 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 1 
        79 . 1 1  93 GLY C 1 1  94 VAL N  1 1  94 VAL CA 1 1  94 VAL C     -160.0      -92.0 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
        80 . 1 1  94 VAL C 1 1  95 GLN N  1 1  95 GLN CA 1 1  95 GLN C     -145.0     -109.0 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 1 
        81 . 1 1  95 GLN C 1 1  96 LEU N  1 1  96 LEU CA 1 1  96 LEU C     -148.0      -56.0 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 1 
        82 . 1 1  96 LEU C 1 1  97 THR N  1 1  97 THR CA 1 1  97 THR C     -155.0     -107.0 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
        83 . 1 1  97 THR C 1 1  98 ALA N  1 1  98 ALA CA 1 1  98 ALA C     -164.0      -72.0 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
        84 . 1 1  98 ALA C 1 1  99 LYS N  1 1  99 LYS CA 1 1  99 LYS C     -137.0      -85.0 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
        85 . 1 1  99 LYS C 1 1 100 LEU N  1 1 100 LEU CA 1 1 100 LEU C     -136.0      -80.0 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
        86 . 1 1 100 LEU C 1 1 101 GLY N  1 1 101 GLY CA 1 1 101 GLY C     -168.0      -92.0 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
        87 . 1 1 101 GLY C 1 1 102 TYR N  1 1 102 TYR CA 1 1 102 TYR C     -166.0  -89.99999 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
        88 . 1 1 107 ASP C 1 1 108 LEU N  1 1 108 LEU CA 1 1 108 LEU C     -179.0  -66.99999 . 107 . C . 108 . N  . 108 . CA . 108 . C 1 1 
        89 . 1 1 108 LEU C 1 1 109 ASP N  1 1 109 ASP CA 1 1 109 ASP C     -145.0      -93.0 . 108 . C . 109 . N  . 109 . CA . 109 . C 1 1 
        90 . 1 1 109 ASP C 1 1 110 ILE N  1 1 110 ILE CA 1 1 110 ILE C     -143.0 -115.00001 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 1 
        91 . 1 1 110 ILE C 1 1 111 TYR N  1 1 111 TYR CA 1 1 111 TYR C     -167.0     -103.0 . 110 . C . 111 . N  . 111 . CA . 111 . C 1 1 
        92 . 1 1 111 TYR C 1 1 112 THR N  1 1 112 THR CA 1 1 112 THR C     -165.0     -105.0 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 1 
        93 . 1 1 112 THR C 1 1 113 ARG N  1 1 113 ARG CA 1 1 113 ARG C     -162.0      -86.0 . 112 . C . 113 . N  . 113 . CA . 113 . C 1 1 
        94 . 1 1 113 ARG C 1 1 114 LEU N  1 1 114 LEU CA 1 1 114 LEU C     -145.0     -109.0 . 113 . C . 114 . N  . 114 . CA . 114 . C 1 1 
        95 . 1 1 115 GLY C 1 1 116 GLY N  1 1 116 GLY CA 1 1 116 GLY C     -159.0      -87.0 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 1 
        96 . 1 1 116 GLY C 1 1 117 MET N  1 1 117 MET CA 1 1 117 MET C     -160.0     -100.0 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
        97 . 1 1 117 MET C 1 1 118 VAL N  1 1 118 VAL CA 1 1 118 VAL C     -135.0      -79.0 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
        98 . 1 1 118 VAL C 1 1 119 TRP N  1 1 119 TRP CA 1 1 119 TRP C -150.99998     -103.0 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
        99 . 1 1 119 TRP C 1 1 120 ARG N  1 1 120 ARG CA 1 1 120 ARG C     -154.0      -98.0 . 119 . C . 120 . N  . 120 . CA . 120 . C 1 1 
       100 . 1 1 120 ARG C 1 1 121 ALA N  1 1 121 ALA CA 1 1 121 ALA C     -178.0 -61.999996 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 1 
       101 . 1 1 121 ALA C 1 1 122 ASP N  1 1 122 ASP CA 1 1 122 ASP C     -168.0      -52.0 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 1 
       102 . 1 1 122 ASP C 1 1 123 SER N  1 1 123 SER CA 1 1 123 SER C     -193.0      -29.0 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 1 
       103 . 1 1 123 SER C 1 1 124 LYS N  1 1 124 LYS CA 1 1 124 LYS C     -178.0      -26.0 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 1 
       104 . 1 1 124 LYS C 1 1 125 GLY N  1 1 125 GLY CA 1 1 125 GLY C -179.99998        0.0 . 124 . C . 125 . N  . 125 . CA . 125 . C 1 1 
       105 . 1 1 125 GLY C 1 1 126 ASN N  1 1 126 ASN CA 1 1 126 ASN C     -147.0 -26.999998 . 125 . C . 126 . N  . 126 . CA . 126 . C 1 1 
       106 . 1 1 126 ASN C 1 1 127 TYR N  1 1 127 TYR CA 1 1 127 TYR C     -185.0       -5.0 . 126 . C . 127 . N  . 127 . CA . 127 . C 1 1 
       107 . 1 1 127 TYR C 1 1 128 ALA N  1 1 128 ALA CA 1 1 128 ALA C     -146.0      -22.0 . 127 . C . 128 . N  . 128 . CA . 128 . C 1 1 
       108 . 1 1 128 ALA C 1 1 129 SER N  1 1 129 SER CA 1 1 129 SER C     -176.0 -23.999998 . 128 . C . 129 . N  . 129 . CA . 129 . C 1 1 
       109 . 1 1 129 SER C 1 1 130 THR N  1 1 130 THR CA 1 1 130 THR C     -185.0       -5.0 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 1 
       110 . 1 1 130 THR C 1 1 131 GLY N  1 1 131 GLY CA 1 1 131 GLY C -179.99998        0.0 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 1 
       111 . 1 1 131 GLY C 1 1 132 VAL N  1 1 132 VAL CA 1 1 132 VAL C     -182.0 -61.999996 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 1 
       112 . 1 1 132 VAL C 1 1 133 SER N  1 1 133 SER CA 1 1 133 SER C     -182.0      -42.0 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 1 
       113 . 1 1 133 SER C 1 1 134 ARG N  1 1 134 ARG CA 1 1 134 ARG C     -173.0      -25.0 . 133 . C . 134 . N  . 134 . CA . 134 . C 1 1 
       114 . 1 1 134 ARG C 1 1 135 SER N  1 1 135 SER CA 1 1 135 SER C     -159.0      -35.0 . 134 . C . 135 . N  . 135 . CA . 135 . C 1 1 
       115 . 1 1 135 SER C 1 1 136 GLU N  1 1 136 GLU CA 1 1 136 GLU C     -141.0      -29.0 . 135 . C . 136 . N  . 136 . CA . 136 . C 1 1 
       116 . 1 1 136 GLU C 1 1 137 HIS N  1 1 137 HIS CA 1 1 137 HIS C -150.99998 -30.999998 . 136 . C . 137 . N  . 137 . CA . 137 . C 1 1 
       117 . 1 1 137 HIS C 1 1 138 ASP N  1 1 138 ASP CA 1 1 138 ASP C     -149.0 -60.999996 . 137 . C . 138 . N  . 138 . CA . 138 . C 1 1 
       118 . 1 1 138 ASP C 1 1 139 THR N  1 1 139 THR CA 1 1 139 THR C     -143.0     -103.0 . 138 . C . 139 . N  . 139 . CA . 139 . C 1 1 
       119 . 1 1 140 GLY C 1 1 141 VAL N  1 1 141 VAL CA 1 1 141 VAL C     -146.0      -74.0 . 140 . C . 141 . N  . 141 . CA . 141 . C 1 1 
       120 . 1 1 141 VAL C 1 1 142 SER N  1 1 142 SER CA 1 1 142 SER C     -157.0      -89.0 . 141 . C . 142 . N  . 142 . CA . 142 . C 1 1 
       121 . 1 1 142 SER C 1 1 143 PRO N  1 1 143 PRO CA 1 1 143 PRO C     -166.0      -74.0 . 142 . C . 143 . N  . 143 . CA . 143 . C 1 1 
       122 . 1 1 143 PRO C 1 1 144 VAL N  1 1 144 VAL CA 1 1 144 VAL C     -157.0      -93.0 . 143 . C . 144 . N  . 144 . CA . 144 . C 1 1 
       123 . 1 1 144 VAL C 1 1 145 PHE N  1 1 145 PHE CA 1 1 145 PHE C     -149.0     -105.0 . 144 . C . 145 . N  . 145 . CA . 145 . C 1 1 
       124 . 1 1 145 PHE C 1 1 146 ALA N  1 1 146 ALA CA 1 1 146 ALA C     -138.0 -101.99999 . 145 . C . 146 . N  . 146 . CA . 146 . C 1 1 
       125 . 1 1 146 ALA C 1 1 147 GLY N  1 1 147 GLY CA 1 1 147 GLY C     -177.0     -105.0 . 146 . C . 147 . N  . 147 . CA . 147 . C 1 1 
       126 . 1 1 148 GLY C 1 1 149 VAL N  1 1 149 VAL CA 1 1 149 VAL C     -153.0     -113.0 . 148 . C . 149 . N  . 149 . CA . 149 . C 1 1 
       127 . 1 1 149 VAL C 1 1 150 GLU N  1 1 150 GLU CA 1 1 150 GLU C     -158.0     -110.0 . 149 . C . 150 . N  . 150 . CA . 150 . C 1 1 
       128 . 1 1 150 GLU C 1 1 151 TRP N  1 1 151 TRP CA 1 1 151 TRP C     -137.0      -89.0 . 150 . C . 151 . N  . 151 . CA . 151 . C 1 1 
       129 . 1 1 151 TRP C 1 1 152 ALA N  1 1 152 ALA CA 1 1 152 ALA C     -135.0      -59.0 . 151 . C . 152 . N  . 152 . CA . 152 . C 1 1 
       130 . 1 1 152 ALA C 1 1 153 VAL N  1 1 153 VAL CA 1 1 153 VAL C     -116.0      -84.0 . 152 . C . 153 . N  . 153 . CA . 153 . C 1 1 
       131 . 1 1 156 ASP C 1 1 157 ILE N  1 1 157 ILE CA 1 1 157 ILE C     -152.0      -84.0 . 156 . C . 157 . N  . 157 . CA . 157 . C 1 1 
       132 . 1 1 157 ILE C 1 1 158 ALA N  1 1 158 ALA CA 1 1 158 ALA C     -140.0     -112.0 . 157 . C . 158 . N  . 158 . CA . 158 . C 1 1 
       133 . 1 1 158 ALA C 1 1 159 THR N  1 1 159 THR CA 1 1 159 THR C     -149.0     -101.0 . 158 . C . 159 . N  . 159 . CA . 159 . C 1 1 
       134 . 1 1 159 THR C 1 1 160 ARG N  1 1 160 ARG CA 1 1 160 ARG C     -137.0     -109.0 . 159 . C . 160 . N  . 160 . CA . 160 . C 1 1 
       135 . 1 1 160 ARG C 1 1 161 LEU N  1 1 161 LEU CA 1 1 161 LEU C     -168.0      -92.0 . 160 . C . 161 . N  . 161 . CA . 161 . C 1 1 
       136 . 1 1 161 LEU C 1 1 162 GLU N  1 1 162 GLU CA 1 1 162 GLU C     -143.0     -107.0 . 161 . C . 162 . N  . 162 . CA . 162 . C 1 1 
       137 . 1 1 162 GLU C 1 1 163 TYR N  1 1 163 TYR CA 1 1 163 TYR C -133.99998  -89.99999 . 162 . C . 163 . N  . 163 . CA . 163 . C 1 1 
       138 . 1 1 163 TYR C 1 1 164 GLN N  1 1 164 GLN CA 1 1 164 GLN C -179.99998        0.0 . 163 . C . 164 . N  . 164 . CA . 164 . C 1 1 
       139 . 1 1 164 GLN C 1 1 165 TRP N  1 1 165 TRP CA 1 1 165 TRP C -179.99998        0.0 . 164 . C . 165 . N  . 165 . CA . 165 . C 1 1 
       140 . 1 1 165 TRP C 1 1 166 VAL N  1 1 166 VAL CA 1 1 166 VAL C -179.99998        0.0 . 165 . C . 166 . N  . 166 . CA . 166 . C 1 1 
       141 . 1 1 166 VAL C 1 1 167 ASN N  1 1 167 ASN CA 1 1 167 ASN C -179.99998        0.0 . 166 . C . 167 . N  . 167 . CA . 167 . C 1 1 
       142 . 1 1 167 ASN C 1 1 168 ASN N  1 1 168 ASN CA 1 1 168 ASN C -179.99998        0.0 . 167 . C . 168 . N  . 168 . CA . 168 . C 1 1 
       143 . 1 1 168 ASN C 1 1 169 ILE N  1 1 169 ILE CA 1 1 169 ILE C -179.99998        0.0 . 168 . C . 169 . N  . 169 . CA . 169 . C 1 1 
       144 . 1 1 169 ILE C 1 1 170 GLY N  1 1 170 GLY CA 1 1 170 GLY C -179.99998        0.0 . 169 . C . 170 . N  . 170 . CA . 170 . C 1 1 
       145 . 1 1 170 GLY C 1 1 171 ASP N  1 1 171 ASP CA 1 1 171 ASP C -179.99998        0.0 . 170 . C . 171 . N  . 171 . CA . 171 . C 1 1 
       146 . 1 1 171 ASP C 1 1 172 ALA N  1 1 172 ALA CA 1 1 172 ALA C     -184.0      -32.0 . 171 . C . 172 . N  . 172 . CA . 172 . C 1 1 
       147 . 1 1 172 ALA C 1 1 173 GLY N  1 1 173 GLY CA 1 1 173 GLY C     -182.0       -2.0 . 172 . C . 173 . N  . 173 . CA . 173 . C 1 1 
       148 . 1 1 173 GLY C 1 1 174 THR N  1 1 174 THR CA 1 1 174 THR C     -172.0      -72.0 . 173 . C . 174 . N  . 174 . CA . 174 . C 1 1 
       149 . 1 1 174 THR C 1 1 175 VAL N  1 1 175 VAL CA 1 1 175 VAL C     -193.0      -85.0 . 174 . C . 175 . N  . 175 . CA . 175 . C 1 1 
       150 . 1 1 175 VAL C 1 1 176 GLY N  1 1 176 GLY CA 1 1 176 GLY C -179.99998        0.0 . 175 . C . 176 . N  . 176 . CA . 176 . C 1 1 
       151 . 1 1 176 GLY C 1 1 177 THR N  1 1 177 THR CA 1 1 177 THR C     -149.0      -93.0 . 176 . C . 177 . N  . 177 . CA . 177 . C 1 1 
       152 . 1 1 177 THR C 1 1 178 ARG N  1 1 178 ARG CA 1 1 178 ARG C     -132.0 -47.999996 . 177 . C . 178 . N  . 178 . CA . 178 . C 1 1 
       153 . 1 1 182 GLY C 1 1 183 MET N  1 1 183 MET CA 1 1 183 MET C     -162.0      -82.0 . 182 . C . 183 . N  . 183 . CA . 183 . C 1 1 
       154 . 1 1 183 MET C 1 1 184 LEU N  1 1 184 LEU CA 1 1 184 LEU C -133.99998      -78.0 . 183 . C . 184 . N  . 184 . CA . 184 . C 1 1 
       155 . 1 1 184 LEU C 1 1 185 SER N  1 1 185 SER CA 1 1 185 SER C     -171.0      -95.0 . 184 . C . 185 . N  . 185 . CA . 185 . C 1 1 
       156 . 1 1 185 SER C 1 1 186 LEU N  1 1 186 LEU CA 1 1 186 LEU C -150.99998      -99.0 . 185 . C . 186 . N  . 186 . CA . 186 . C 1 1 
       157 . 1 1 186 LEU C 1 1 187 GLY N  1 1 187 GLY CA 1 1 187 GLY C     -167.0      -83.0 . 186 . C . 187 . N  . 187 . CA . 187 . C 1 1 
       158 . 1 1 187 GLY C 1 1 188 VAL N  1 1 188 VAL CA 1 1 188 VAL C     -171.0      -79.0 . 187 . C . 188 . N  . 188 . CA . 188 . C 1 1 
       159 . 1 1 188 VAL C 1 1 189 SER N  1 1 189 SER CA 1 1 189 SER C     -154.0     -114.0 . 188 . C . 189 . N  . 189 . CA . 189 . C 1 1 
       160 . 1 1 189 SER C 1 1 190 TYR N  1 1 190 TYR CA 1 1 190 TYR C     -148.0  -95.99999 . 189 . C . 190 . N  . 190 . CA . 190 . C 1 1 
       161 . 1 1 190 TYR C 1 1 191 ARG N  1 1 191 ARG CA 1 1 191 ARG C     -156.0      -64.0 . 190 . C . 191 . N  . 191 . CA . 191 . C 1 1 
       162 . 1 1 191 ARG C 1 1 192 PHE N  1 1 192 PHE CA 1 1 192 PHE C     -183.0      -59.0 . 191 . C . 192 . N  . 192 . CA . 192 . C 1 1 
       163 . 1 1 192 PHE C 1 1 193 GLY N  1 1 193 GLY CA 1 1 193 GLY C -179.99998        0.0 . 192 . C . 193 . N  . 193 . CA . 193 . C 1 1 
       164 . 1 1 193 GLY C 1 1 194 GLN N  1 1 194 GLN CA 1 1 194 GLN C     -165.0      -37.0 . 193 . C . 194 . N  . 194 . CA . 194 . C 1 1 
       165 . 1 1 194 GLN C 1 1 195 GLU N  1 1 195 GLU CA 1 1 195 GLU C     -128.0      -36.0 . 194 . C . 195 . N  . 195 . CA . 195 . C 1 1 
       166 . 1 1 195 GLU C 1 1 196 ASP N  1 1 196 ASP CA 1 1 196 ASP C     -149.0      -21.0 . 195 . C . 196 . N  . 196 . CA . 196 . C 1 1 
       167 . 1 1 196 ASP C 1 1 197 ALA N  1 1 197 ALA CA 1 1 197 ALA C     -149.0      -13.0 . 196 . C . 197 . N  . 197 . CA . 197 . C 1 1 
       168 . 1 1 197 ALA C 1 1 198 ALA N  1 1 198 ALA CA 1 1 198 ALA C     -173.0        7.0 . 197 . C . 198 . N  . 198 . CA . 198 . C 1 1 
       169 . 1 1 198 ALA C 1 1 199 PRO N  1 1 199 PRO CA 1 1 199 PRO C -179.99998        0.0 . 198 . C . 199 . N  . 199 . CA . 199 . C 1 1 
       170 . 1 1 199 PRO C 1 1 200 VAL N  1 1 200 VAL CA 1 1 200 VAL C -179.99998      -52.0 . 199 . C . 200 . N  . 200 . CA . 200 . C 1 1 
       171 . 1 1 200 VAL C 1 1 201 VAL N  1 1 201 VAL CA 1 1 201 VAL C     -144.0      -56.0 . 200 . C . 201 . N  . 201 . CA . 201 . C 1 1 
       172 . 1 1 201 VAL C 1 1 202 ALA N  1 1 202 ALA CA 1 1 202 ALA C     -140.0      -44.0 . 201 . C . 202 . N  . 202 . CA . 202 . C 1 1 
       173 . 1 1 202 ALA C 1 1 203 PRO N  1 1 203 PRO CA 1 1 203 PRO C -179.99998        0.0 . 202 . C . 203 . N  . 203 . CA . 203 . C 1 1 
       174 . 1 1 203 PRO C 1 1 204 ALA N  1 1 204 ALA CA 1 1 204 ALA C -127.00001      -43.0 . 203 . C . 204 . N  . 204 . CA . 204 . C 1 1 
       175 . 1 1 204 ALA C 1 1 205 PRO N  1 1 205 PRO CA 1 1 205 PRO C -179.99998        0.0 . 204 . C . 205 . N  . 205 . CA . 205 . C 1 1 
       176 . 1 1 205 PRO C 1 1 206 ALA N  1 1 206 ALA CA 1 1 206 ALA C     -143.0 -50.999996 . 205 . C . 206 . N  . 206 . CA . 206 . C 1 1 
       177 . 1 1 206 ALA C 1 1 207 PRO N  1 1 207 PRO CA 1 1 207 PRO C -179.99998        0.0 . 206 . C . 207 . N  . 207 . CA . 207 . C 1 1 
       178 . 1 1 207 PRO C 1 1 208 ALA N  1 1 208 ALA CA 1 1 208 ALA C     -160.0      -28.0 . 207 . C . 208 . N  . 208 . CA . 208 . C 1 1 
       179 . 1 1 208 ALA C 1 1 209 PRO N  1 1 209 PRO CA 1 1 209 PRO C -179.99998        0.0 . 208 . C . 209 . N  . 209 . CA . 209 . C 1 1 
       180 . 1 1  18 THR N 1 1  18 THR CA 1 1  18 THR C  1 1  19 TRP N      130.0      194.0 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
       181 . 1 1  19 TRP N 1 1  19 TRP CA 1 1  19 TRP C  1 1  20 TYR N      130.0      170.0 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 1 
       182 . 1 1  20 TYR N 1 1  20 TYR CA 1 1  20 TYR C  1 1  21 ALA N      136.0  179.99998 .  20 . N .  20 . CA .  20 . C  .  21 . N 1 1 
       183 . 1 1  21 ALA N 1 1  21 ALA CA 1 1  21 ALA C  1 1  22 GLY N      140.0  179.99998 .  21 . N .  21 . CA .  21 . C  .  22 . N 1 1 
       184 . 1 1  23 GLY N 1 1  23 GLY CA 1 1  23 GLY C  1 1  24 LYS N      133.0      185.0 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 1 
       185 . 1 1  24 LYS N 1 1  24 LYS CA 1 1  24 LYS C  1 1  25 LEU N      128.0      176.0 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
       186 . 1 1  25 LEU N 1 1  25 LEU CA 1 1  25 LEU C  1 1  26 GLY N      131.0      167.0 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
       187 . 1 1  27 TRP N 1 1  27 TRP CA 1 1  27 TRP C  1 1  28 SER N      100.0      160.0 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
       188 . 1 1  51 GLN N 1 1  51 GLN CA 1 1  51 GLN C  1 1  52 LEU N       66.0      198.0 .  51 . N .  51 . CA .  51 . C  .  52 . N 1 1 
       189 . 1 1  52 LEU N 1 1  52 LEU CA 1 1  52 LEU C  1 1  53 GLY N      114.0      182.0 .  52 . N .  52 . CA .  52 . C  .  53 . N 1 1 
       190 . 1 1  53 GLY N 1 1  53 GLY CA 1 1  53 GLY C  1 1  54 ALA N      125.0      181.0 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
       191 . 1 1  54 ALA N 1 1  54 ALA CA 1 1  54 ALA C  1 1  55 GLY N      125.0      181.0 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
       192 . 1 1  56 ALA N 1 1  56 ALA CA 1 1  56 ALA C  1 1  57 PHE N  123.99999      168.0 .  56 . N .  56 . CA .  56 . C  .  57 . N 1 1 
       193 . 1 1  57 PHE N 1 1  57 PHE CA 1 1  57 PHE C  1 1  58 GLY N  115.00001      187.0 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
       194 . 1 1  58 GLY N 1 1  58 GLY CA 1 1  58 GLY C  1 1  59 GLY N      125.0      181.0 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 1 
       195 . 1 1  59 GLY N 1 1  59 GLY CA 1 1  59 GLY C  1 1  60 TYR N      130.0      194.0 .  59 . N .  59 . CA .  59 . C  .  60 . N 1 1 
       196 . 1 1  60 TYR N 1 1  60 TYR CA 1 1  60 TYR C  1 1  61 GLN N      105.0      161.0 .  60 . N .  60 . CA .  60 . C  .  61 . N 1 1 
       197 . 1 1  61 GLN N 1 1  61 GLN CA 1 1  61 GLN C  1 1  62 VAL N       85.0      137.0 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 1 
       198 . 1 1  66 LEU N 1 1  66 LEU CA 1 1  66 LEU C  1 1  67 GLY N      116.0      164.0 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
       199 . 1 1  67 GLY N 1 1  67 GLY CA 1 1  67 GLY C  1 1  68 PHE N      121.0      177.0 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 1 
       200 . 1 1  68 PHE N 1 1  68 PHE CA 1 1  68 PHE C  1 1  69 GLU N  118.99999      167.0 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
       201 . 1 1  69 GLU N 1 1  69 GLU CA 1 1  69 GLU C  1 1  70 MET N      112.0      168.0 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
       202 . 1 1  70 MET N 1 1  70 MET CA 1 1  70 MET C  1 1  71 GLY N      105.0      181.0 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
       203 . 1 1  71 GLY N 1 1  71 GLY CA 1 1  71 GLY C  1 1  72 TYR N  115.00001      195.0 .  71 . N .  71 . CA .  71 . C  .  72 . N 1 1 
       204 . 1 1  72 TYR N 1 1  72 TYR CA 1 1  72 TYR C  1 1  73 ASP N  115.00001      155.0 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
       205 . 1 1  73 ASP N 1 1  73 ASP CA 1 1  73 ASP C  1 1  74 TRP N      103.0      167.0 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 1 
       206 . 1 1  74 TRP N 1 1  74 TRP CA 1 1  74 TRP C  1 1  75 LEU N      109.0      157.0 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
       207 . 1 1  91 ALA N 1 1  91 ALA CA 1 1  91 ALA C  1 1  92 GLN N      106.0      182.0 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 1 
       208 . 1 1  92 GLN N 1 1  92 GLN CA 1 1  92 GLN C  1 1  93 GLY N      125.0      177.0 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 1 
       209 . 1 1  94 VAL N 1 1  94 VAL CA 1 1  94 VAL C  1 1  95 GLN N      118.0      170.0 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
       210 . 1 1  95 GLN N 1 1  95 GLN CA 1 1  95 GLN C  1 1  96 LEU N      130.0      174.0 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 1 
       211 . 1 1  96 LEU N 1 1  96 LEU CA 1 1  96 LEU C  1 1  97 THR N       94.0      170.0 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 1 
       212 . 1 1  97 THR N 1 1  97 THR CA 1 1  97 THR C  1 1  98 ALA N      138.0      178.0 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
       213 . 1 1  98 ALA N 1 1  98 ALA CA 1 1  98 ALA C  1 1  99 LYS N   95.99999  179.99998 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
       214 . 1 1  99 LYS N 1 1  99 LYS CA 1 1  99 LYS C  1 1 100 LEU N  107.99999      132.0 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
       215 . 1 1 100 LEU N 1 1 100 LEU CA 1 1 100 LEU C  1 1 101 GLY N      101.0      161.0 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
       216 . 1 1 101 GLY N 1 1 101 GLY CA 1 1 101 GLY C  1 1 102 TYR N      114.0      190.0 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
       217 . 1 1 102 TYR N 1 1 102 TYR CA 1 1 102 TYR C  1 1 103 PRO N      123.0  174.99998 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
       218 . 1 1 103 PRO N 1 1 103 PRO CA 1 1 103 PRO C  1 1 104 ILE N   95.99999      172.0 . 103 . N . 103 . CA . 103 . C  . 104 . N 1 1 
       219 . 1 1 108 LEU N 1 1 108 LEU CA 1 1 108 LEU C  1 1 109 ASP N  101.99999      170.0 . 108 . N . 108 . CA . 108 . C  . 109 . N 1 1 
       220 . 1 1 109 ASP N 1 1 109 ASP CA 1 1 109 ASP C  1 1 110 ILE N      118.0      170.0 . 109 . N . 109 . CA . 109 . C  . 110 . N 1 1 
       221 . 1 1 110 ILE N 1 1 110 ILE CA 1 1 110 ILE C  1 1 111 TYR N  101.99999      166.0 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 1 
       222 . 1 1 111 TYR N 1 1 111 TYR CA 1 1 111 TYR C  1 1 112 THR N      138.0      178.0 . 111 . N . 111 . CA . 111 . C  . 112 . N 1 1 
       223 . 1 1 112 THR N 1 1 112 THR CA 1 1 112 THR C  1 1 113 ARG N  127.00001      179.0 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 1 
       224 . 1 1 113 ARG N 1 1 113 ARG CA 1 1 113 ARG C  1 1 114 LEU N      128.0      164.0 . 113 . N . 113 . CA . 113 . C  . 114 . N 1 1 
       225 . 1 1 114 LEU N 1 1 114 LEU CA 1 1 114 LEU C  1 1 115 GLY N      123.0  162.99998 . 114 . N . 114 . CA . 114 . C  . 115 . N 1 1 
       226 . 1 1 116 GLY N 1 1 116 GLY CA 1 1 116 GLY C  1 1 117 MET N      121.0      169.0 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 1 
       227 . 1 1 117 MET N 1 1 117 MET CA 1 1 117 MET C  1 1 118 VAL N      103.0      183.0 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
       228 . 1 1 118 VAL N 1 1 118 VAL CA 1 1 118 VAL C  1 1 119 TRP N      112.0      144.0 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
       229 . 1 1 119 TRP N 1 1 119 TRP CA 1 1 119 TRP C  1 1 120 ARG N      132.0      196.0 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
       230 . 1 1 120 ARG N 1 1 120 ARG CA 1 1 120 ARG C  1 1 121 ALA N      104.0      164.0 . 120 . N . 120 . CA . 120 . C  . 121 . N 1 1 
       231 . 1 1 121 ALA N 1 1 121 ALA CA 1 1 121 ALA C  1 1 122 ASP N      121.0      169.0 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 1 
       232 . 1 1 122 ASP N 1 1 122 ASP CA 1 1 122 ASP C  1 1 123 SER N      114.0      162.0 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 1 
       233 . 1 1 136 GLU N 1 1 136 GLU CA 1 1 136 GLU C  1 1 137 HIS N       66.0      210.0 . 136 . N . 136 . CA . 136 . C  . 137 . N 1 1 
       234 . 1 1 137 HIS N 1 1 137 HIS CA 1 1 137 HIS C  1 1 138 ASP N  53.999996      198.0 . 137 . N . 137 . CA . 137 . C  . 138 . N 1 1 
       235 . 1 1 138 ASP N 1 1 138 ASP CA 1 1 138 ASP C  1 1 139 THR N  115.00001      167.0 . 138 . N . 138 . CA . 138 . C  . 139 . N 1 1 
       236 . 1 1 139 THR N 1 1 139 THR CA 1 1 139 THR C  1 1 140 GLY N      111.0      167.0 . 139 . N . 139 . CA . 139 . C  . 140 . N 1 1 
       237 . 1 1 141 VAL N 1 1 141 VAL CA 1 1 141 VAL C  1 1 142 SER N      123.0  150.99998 . 141 . N . 141 . CA . 141 . C  . 142 . N 1 1 
       238 . 1 1 142 SER N 1 1 142 SER CA 1 1 142 SER C  1 1 143 PRO N      116.0      168.0 . 142 . N . 142 . CA . 142 . C  . 143 . N 1 1 
       239 . 1 1 143 PRO N 1 1 143 PRO CA 1 1 143 PRO C  1 1 144 VAL N       93.0      181.0 . 143 . N . 143 . CA . 143 . C  . 144 . N 1 1 
       240 . 1 1 144 VAL N 1 1 144 VAL CA 1 1 144 VAL C  1 1 145 PHE N  107.99999      168.0 . 144 . N . 144 . CA . 144 . C  . 145 . N 1 1 
       241 . 1 1 145 PHE N 1 1 145 PHE CA 1 1 145 PHE C  1 1 146 ALA N  118.99999      179.0 . 145 . N . 145 . CA . 145 . C  . 146 . N 1 1 
       242 . 1 1 146 ALA N 1 1 146 ALA CA 1 1 146 ALA C  1 1 147 GLY N  116.99999      169.0 . 146 . N . 146 . CA . 146 . C  . 147 . N 1 1 
       243 . 1 1 147 GLY N 1 1 147 GLY CA 1 1 147 GLY C  1 1 148 GLY N      125.0      181.0 . 147 . N . 147 . CA . 147 . C  . 148 . N 1 1 
       244 . 1 1 149 VAL N 1 1 149 VAL CA 1 1 149 VAL C  1 1 150 GLU N      109.0      185.0 . 149 . N . 149 . CA . 149 . C  . 150 . N 1 1 
       245 . 1 1 150 GLU N 1 1 150 GLU CA 1 1 150 GLU C  1 1 151 TRP N  107.99999      152.0 . 150 . N . 150 . CA . 150 . C  . 151 . N 1 1 
       246 . 1 1 151 TRP N 1 1 151 TRP CA 1 1 151 TRP C  1 1 152 ALA N      111.0      139.0 . 151 . N . 151 . CA . 151 . C  . 152 . N 1 1 
       247 . 1 1 152 ALA N 1 1 152 ALA CA 1 1 152 ALA C  1 1 153 VAL N       97.0      137.0 . 152 . N . 152 . CA . 152 . C  . 153 . N 1 1 
       248 . 1 1 157 ILE N 1 1 157 ILE CA 1 1 157 ILE C  1 1 158 ALA N      101.0      161.0 . 157 . N . 157 . CA . 157 . C  . 158 . N 1 1 
       249 . 1 1 158 ALA N 1 1 158 ALA CA 1 1 158 ALA C  1 1 159 THR N  115.00001  174.99998 . 158 . N . 158 . CA . 158 . C  . 159 . N 1 1 
       250 . 1 1 159 THR N 1 1 159 THR CA 1 1 159 THR C  1 1 160 ARG N       91.0      191.0 . 159 . N . 159 . CA . 159 . C  . 160 . N 1 1 
       251 . 1 1 160 ARG N 1 1 160 ARG CA 1 1 160 ARG C  1 1 161 LEU N      123.0  162.99998 . 160 . N . 160 . CA . 160 . C  . 161 . N 1 1 
       252 . 1 1 161 LEU N 1 1 161 LEU CA 1 1 161 LEU C  1 1 162 GLU N      110.0      158.0 . 161 . N . 161 . CA . 161 . C  . 162 . N 1 1 
       253 . 1 1 162 GLU N 1 1 162 GLU CA 1 1 162 GLU C  1 1 163 TYR N      121.0      145.0 . 162 . N . 162 . CA . 162 . C  . 163 . N 1 1 
       254 . 1 1 163 TYR N 1 1 163 TYR CA 1 1 163 TYR C  1 1 164 GLN N  101.99999      166.0 . 163 . N . 163 . CA . 163 . C  . 164 . N 1 1 
       255 . 1 1 183 MET N 1 1 183 MET CA 1 1 183 MET C  1 1 184 LEU N       97.0      173.0 . 183 . N . 183 . CA . 183 . C  . 184 . N 1 1 
       256 . 1 1 184 LEU N 1 1 184 LEU CA 1 1 184 LEU C  1 1 185 SER N   95.99999      168.0 . 184 . N . 184 . CA . 184 . C  . 185 . N 1 1 
       257 . 1 1 185 SER N 1 1 185 SER CA 1 1 185 SER C  1 1 186 LEU N  115.00001      183.0 . 185 . N . 185 . CA . 185 . C  . 186 . N 1 1 
       258 . 1 1 186 LEU N 1 1 186 LEU CA 1 1 186 LEU C  1 1 187 GLY N  121.99999      170.0 . 186 . N . 186 . CA . 186 . C  . 187 . N 1 1 
       259 . 1 1 187 GLY N 1 1 187 GLY CA 1 1 187 GLY C  1 1 188 VAL N      107.0      183.0 . 187 . N . 187 . CA . 187 . C  . 188 . N 1 1 
       260 . 1 1 188 VAL N 1 1 188 VAL CA 1 1 188 VAL C  1 1 189 SER N      121.0      173.0 . 188 . N . 188 . CA . 188 . C  . 189 . N 1 1 
       261 . 1 1 189 SER N 1 1 189 SER CA 1 1 189 SER C  1 1 190 TYR N  118.99999  174.99998 . 189 . N . 189 . CA . 189 . C  . 190 . N 1 1 
       262 . 1 1 190 TYR N 1 1 190 TYR CA 1 1 190 TYR C  1 1 191 ARG N      116.0      160.0 . 190 . N . 190 . CA . 190 . C  . 191 . N 1 1 
       263 . 1 1 191 ARG N 1 1 191 ARG CA 1 1 191 ARG C  1 1 192 PHE N      105.0      157.0 . 191 . N . 191 . CA . 191 . C  . 192 . N 1 1 
       264 . 1 1 192 PHE N 1 1 192 PHE CA 1 1 192 PHE C  1 1 193 GLY N       89.0      189.0 . 192 . N . 192 . CA . 192 . C  . 193 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 ALA C    C  35.432  12.434  -9.918 1.00 . A A .   1 ALA C    1 1 
        1     2 1 1   1 ALA CA   C  34.883  13.129  -8.678 1.00 . A A .   1 ALA CA   1 1 
        1     3 1 1   1 ALA CB   C  33.640  13.933  -9.030 1.00 . A A .   1 ALA CB   1 1 
        1     4 1 1   1 ALA H1   H  36.567  13.408  -7.531 1.00 . A A .   1 ALA H1   1 1 
        1     5 1 1   1 ALA H2   H  35.416  14.678  -7.433 1.00 . A A .   1 ALA H2   1 1 
        1     6 1 1   1 ALA H3   H  36.398  14.512  -8.832 1.00 . A A .   1 ALA H3   1 1 
        1     7 1 1   1 ALA HA   H  34.602  12.379  -7.953 1.00 . A A .   1 ALA HA   1 1 
        1     8 1 1   1 ALA HB1  H  32.945  13.901  -8.204 1.00 . A A .   1 ALA HB1  1 1 
        1     9 1 1   1 ALA HB2  H  33.175  13.509  -9.908 1.00 . A A .   1 ALA HB2  1 1 
        1    10 1 1   1 ALA HB3  H  33.918  14.957  -9.229 1.00 . A A .   1 ALA HB3  1 1 
        1    11 1 1   1 ALA N    N  35.908  14.011  -8.063 1.00 . A A .   1 ALA N    1 1 
        1    12 1 1   1 ALA O    O  35.380  12.977 -11.022 1.00 . A A .   1 ALA O    1 1 
        1    13 1 1   2 ARG C    C  36.161   8.981 -10.703 1.00 . A A .   2 ARG C    1 1 
        1    14 1 1   2 ARG CA   C  36.520  10.458 -10.833 1.00 . A A .   2 ARG CA   1 1 
        1    15 1 1   2 ARG CB   C  38.041  10.622 -10.878 1.00 . A A .   2 ARG CB   1 1 
        1    16 1 1   2 ARG CD   C  38.824   8.910 -12.546 1.00 . A A .   2 ARG CD   1 1 
        1    17 1 1   2 ARG CG   C  38.638  10.392 -12.257 1.00 . A A .   2 ARG CG   1 1 
        1    18 1 1   2 ARG CZ   C  40.663   7.338 -13.014 1.00 . A A .   2 ARG CZ   1 1 
        1    19 1 1   2 ARG H    H  35.974  10.849  -8.826 1.00 . A A .   2 ARG H    1 1 
        1    20 1 1   2 ARG HA   H  36.099  10.839 -11.751 1.00 . A A .   2 ARG HA   1 1 
        1    21 1 1   2 ARG HB2  H  38.292  11.624 -10.563 1.00 . A A .   2 ARG HB2  1 1 
        1    22 1 1   2 ARG HB3  H  38.488   9.917 -10.194 1.00 . A A .   2 ARG HB3  1 1 
        1    23 1 1   2 ARG HD2  H  38.494   8.343 -11.688 1.00 . A A .   2 ARG HD2  1 1 
        1    24 1 1   2 ARG HD3  H  38.223   8.646 -13.404 1.00 . A A .   2 ARG HD3  1 1 
        1    25 1 1   2 ARG HE   H  40.860   9.319 -12.874 1.00 . A A .   2 ARG HE   1 1 
        1    26 1 1   2 ARG HG2  H  37.976  10.812 -13.000 1.00 . A A .   2 ARG HG2  1 1 
        1    27 1 1   2 ARG HG3  H  39.598  10.883 -12.309 1.00 . A A .   2 ARG HG3  1 1 
        1    28 1 1   2 ARG HH11 H  38.855   6.464 -12.768 1.00 . A A .   2 ARG HH11 1 1 
        1    29 1 1   2 ARG HH12 H  40.164   5.380 -13.098 1.00 . A A .   2 ARG HH12 1 1 
        1    30 1 1   2 ARG HH21 H  42.583   7.895 -13.308 1.00 . A A .   2 ARG HH21 1 1 
        1    31 1 1   2 ARG HH22 H  42.281   6.192 -13.404 1.00 . A A .   2 ARG HH22 1 1 
        1    32 1 1   2 ARG N    N  35.960  11.229  -9.730 1.00 . A A .   2 ARG N    1 1 
        1    33 1 1   2 ARG NE   N  40.219   8.579 -12.825 1.00 . A A .   2 ARG NE   1 1 
        1    34 1 1   2 ARG NH1  N  39.825   6.310 -12.955 1.00 . A A .   2 ARG NH1  1 1 
        1    35 1 1   2 ARG NH2  N  41.948   7.124 -13.262 1.00 . A A .   2 ARG NH2  1 1 
        1    36 1 1   2 ARG O    O  36.881   8.211 -10.066 1.00 . A A .   2 ARG O    1 1 
        1    37 1 1   3 ILE C    C  34.147   6.725 -12.635 1.00 . A A .   3 ILE C    1 1 
        1    38 1 1   3 ILE CA   C  34.590   7.208 -11.259 1.00 . A A .   3 ILE CA   1 1 
        1    39 1 1   3 ILE CB   C  33.425   7.034 -10.266 1.00 . A A .   3 ILE CB   1 1 
        1    40 1 1   3 ILE CD1  C  32.557   7.904  -8.037 1.00 . A A .   3 ILE CD1  1 1 
        1    41 1 1   3 ILE CG1  C  33.761   7.698  -8.929 1.00 . A A .   3 ILE CG1  1 1 
        1    42 1 1   3 ILE CG2  C  33.114   5.558 -10.067 1.00 . A A .   3 ILE CG2  1 1 
        1    43 1 1   3 ILE H    H  34.512   9.253 -11.800 1.00 . A A .   3 ILE H    1 1 
        1    44 1 1   3 ILE HA   H  35.416   6.598 -10.923 1.00 . A A .   3 ILE HA   1 1 
        1    45 1 1   3 ILE HB   H  32.550   7.507 -10.685 1.00 . A A .   3 ILE HB   1 1 
        1    46 1 1   3 ILE HD11 H  32.680   7.332  -7.129 1.00 . A A .   3 ILE HD11 1 1 
        1    47 1 1   3 ILE HD12 H  31.666   7.575  -8.552 1.00 . A A .   3 ILE HD12 1 1 
        1    48 1 1   3 ILE HD13 H  32.465   8.952  -7.793 1.00 . A A .   3 ILE HD13 1 1 
        1    49 1 1   3 ILE HG12 H  34.467   7.080  -8.395 1.00 . A A .   3 ILE HG12 1 1 
        1    50 1 1   3 ILE HG13 H  34.205   8.665  -9.117 1.00 . A A .   3 ILE HG13 1 1 
        1    51 1 1   3 ILE HG21 H  32.046   5.423  -9.983 1.00 . A A .   3 ILE HG21 1 1 
        1    52 1 1   3 ILE HG22 H  33.593   5.207  -9.165 1.00 . A A .   3 ILE HG22 1 1 
        1    53 1 1   3 ILE HG23 H  33.482   4.995 -10.912 1.00 . A A .   3 ILE HG23 1 1 
        1    54 1 1   3 ILE N    N  35.044   8.593 -11.309 1.00 . A A .   3 ILE N    1 1 
        1    55 1 1   3 ILE O    O  33.493   7.456 -13.380 1.00 . A A .   3 ILE O    1 1 
        1    56 1 1   4 MET C    C  32.637   4.751 -14.382 1.00 . A A .   4 MET C    1 1 
        1    57 1 1   4 MET CA   C  34.149   4.908 -14.256 1.00 . A A .   4 MET CA   1 1 
        1    58 1 1   4 MET CB   C  34.831   3.550 -14.433 1.00 . A A .   4 MET CB   1 1 
        1    59 1 1   4 MET CE   C  36.305   5.425 -17.297 1.00 . A A .   4 MET CE   1 1 
        1    60 1 1   4 MET CG   C  35.296   3.284 -15.855 1.00 . A A .   4 MET CG   1 1 
        1    61 1 1   4 MET H    H  35.030   4.957 -12.332 1.00 . A A .   4 MET H    1 1 
        1    62 1 1   4 MET HA   H  34.495   5.578 -15.029 1.00 . A A .   4 MET HA   1 1 
        1    63 1 1   4 MET HB2  H  35.691   3.505 -13.781 1.00 . A A .   4 MET HB2  1 1 
        1    64 1 1   4 MET HB3  H  34.137   2.772 -14.153 1.00 . A A .   4 MET HB3  1 1 
        1    65 1 1   4 MET HE1  H  36.051   5.028 -18.269 1.00 . A A .   4 MET HE1  1 1 
        1    66 1 1   4 MET HE2  H  37.093   6.156 -17.402 1.00 . A A .   4 MET HE2  1 1 
        1    67 1 1   4 MET HE3  H  35.435   5.894 -16.861 1.00 . A A .   4 MET HE3  1 1 
        1    68 1 1   4 MET HG2  H  35.418   2.219 -15.987 1.00 . A A .   4 MET HG2  1 1 
        1    69 1 1   4 MET HG3  H  34.543   3.647 -16.540 1.00 . A A .   4 MET HG3  1 1 
        1    70 1 1   4 MET N    N  34.508   5.490 -12.968 1.00 . A A .   4 MET N    1 1 
        1    71 1 1   4 MET O    O  31.980   4.225 -13.484 1.00 . A A .   4 MET O    1 1 
        1    72 1 1   4 MET SD   S  36.862   4.094 -16.236 1.00 . A A .   4 MET SD   1 1 
        1    73 1 1   5 LYS C    C  30.375   4.845 -17.224 1.00 . A A .   5 LYS C    1 1 
        1    74 1 1   5 LYS CA   C  30.657   5.120 -15.750 1.00 . A A .   5 LYS CA   1 1 
        1    75 1 1   5 LYS CB   C  29.961   6.411 -15.315 1.00 . A A .   5 LYS CB   1 1 
        1    76 1 1   5 LYS CD   C  31.237   8.499 -14.725 1.00 . A A .   5 LYS CD   1 1 
        1    77 1 1   5 LYS CE   C  30.370   9.702 -14.384 1.00 . A A .   5 LYS CE   1 1 
        1    78 1 1   5 LYS CG   C  30.628   7.671 -15.846 1.00 . A A .   5 LYS CG   1 1 
        1    79 1 1   5 LYS H    H  32.668   5.619 -16.183 1.00 . A A .   5 LYS H    1 1 
        1    80 1 1   5 LYS HA   H  30.272   4.299 -15.164 1.00 . A A .   5 LYS HA   1 1 
        1    81 1 1   5 LYS HB2  H  28.941   6.394 -15.670 1.00 . A A .   5 LYS HB2  1 1 
        1    82 1 1   5 LYS HB3  H  29.957   6.458 -14.236 1.00 . A A .   5 LYS HB3  1 1 
        1    83 1 1   5 LYS HD2  H  31.336   7.880 -13.846 1.00 . A A .   5 LYS HD2  1 1 
        1    84 1 1   5 LYS HD3  H  32.212   8.846 -15.035 1.00 . A A .   5 LYS HD3  1 1 
        1    85 1 1   5 LYS HE2  H  30.871  10.597 -14.722 1.00 . A A .   5 LYS HE2  1 1 
        1    86 1 1   5 LYS HE3  H  29.423   9.606 -14.895 1.00 . A A .   5 LYS HE3  1 1 
        1    87 1 1   5 LYS HG2  H  31.410   7.388 -16.535 1.00 . A A .   5 LYS HG2  1 1 
        1    88 1 1   5 LYS HG3  H  29.889   8.267 -16.362 1.00 . A A .   5 LYS HG3  1 1 
        1    89 1 1   5 LYS HZ1  H  30.906  10.317 -12.461 1.00 . A A .   5 LYS HZ1  1 1 
        1    90 1 1   5 LYS HZ2  H  30.043   8.862 -12.499 1.00 . A A .   5 LYS HZ2  1 1 
        1    91 1 1   5 LYS HZ3  H  29.239  10.330 -12.744 1.00 . A A .   5 LYS HZ3  1 1 
        1    92 1 1   5 LYS N    N  32.092   5.210 -15.504 1.00 . A A .   5 LYS N    1 1 
        1    93 1 1   5 LYS NZ   N  30.122   9.811 -12.920 1.00 . A A .   5 LYS NZ   1 1 
        1    94 1 1   5 LYS O    O  29.815   5.685 -17.929 1.00 . A A .   5 LYS O    1 1 
        1    95 1 1   6 ALA C    C  29.571   2.118 -19.178 1.00 . A A .   6 ALA C    1 1 
        1    96 1 1   6 ALA CA   C  30.561   3.274 -19.075 1.00 . A A .   6 ALA CA   1 1 
        1    97 1 1   6 ALA CB   C  31.885   2.896 -19.721 1.00 . A A .   6 ALA CB   1 1 
        1    98 1 1   6 ALA H    H  31.211   3.035 -17.075 1.00 . A A .   6 ALA H    1 1 
        1    99 1 1   6 ALA HA   H  30.160   4.127 -19.603 1.00 . A A .   6 ALA HA   1 1 
        1   100 1 1   6 ALA HB1  H  32.521   2.422 -18.988 1.00 . A A .   6 ALA HB1  1 1 
        1   101 1 1   6 ALA HB2  H  32.370   3.786 -20.095 1.00 . A A .   6 ALA HB2  1 1 
        1   102 1 1   6 ALA HB3  H  31.706   2.213 -20.538 1.00 . A A .   6 ALA HB3  1 1 
        1   103 1 1   6 ALA N    N  30.770   3.662 -17.685 1.00 . A A .   6 ALA N    1 1 
        1   104 1 1   6 ALA O    O  28.426   2.304 -19.589 1.00 . A A .   6 ALA O    1 1 
        1   105 1 1   7 ILE C    C  29.520  -1.227 -17.723 1.00 . A A .   7 ILE C    1 1 
        1   106 1 1   7 ILE CA   C  29.175  -0.260 -18.850 1.00 . A A .   7 ILE CA   1 1 
        1   107 1 1   7 ILE CB   C  29.311  -0.993 -20.199 1.00 . A A .   7 ILE CB   1 1 
        1   108 1 1   7 ILE CD1  C  30.922  -2.632 -21.293 1.00 . A A .   7 ILE CD1  1 1 
        1   109 1 1   7 ILE CG1  C  30.768  -1.387 -20.446 1.00 . A A .   7 ILE CG1  1 1 
        1   110 1 1   7 ILE CG2  C  28.792  -0.120 -21.331 1.00 . A A .   7 ILE CG2  1 1 
        1   111 1 1   7 ILE H    H  30.944   0.842 -18.482 1.00 . A A .   7 ILE H    1 1 
        1   112 1 1   7 ILE HA   H  28.149   0.057 -18.738 1.00 . A A .   7 ILE HA   1 1 
        1   113 1 1   7 ILE HB   H  28.706  -1.886 -20.160 1.00 . A A .   7 ILE HB   1 1 
        1   114 1 1   7 ILE HD11 H  30.839  -2.370 -22.337 1.00 . A A .   7 ILE HD11 1 1 
        1   115 1 1   7 ILE HD12 H  30.148  -3.340 -21.036 1.00 . A A .   7 ILE HD12 1 1 
        1   116 1 1   7 ILE HD13 H  31.890  -3.075 -21.109 1.00 . A A .   7 ILE HD13 1 1 
        1   117 1 1   7 ILE HG12 H  31.272  -0.578 -20.953 1.00 . A A .   7 ILE HG12 1 1 
        1   118 1 1   7 ILE HG13 H  31.252  -1.568 -19.497 1.00 . A A .   7 ILE HG13 1 1 
        1   119 1 1   7 ILE HG21 H  28.961  -0.617 -22.275 1.00 . A A .   7 ILE HG21 1 1 
        1   120 1 1   7 ILE HG22 H  29.313   0.826 -21.324 1.00 . A A .   7 ILE HG22 1 1 
        1   121 1 1   7 ILE HG23 H  27.734   0.050 -21.198 1.00 . A A .   7 ILE HG23 1 1 
        1   122 1 1   7 ILE N    N  30.021   0.926 -18.801 1.00 . A A .   7 ILE N    1 1 
        1   123 1 1   7 ILE O    O  29.376  -2.441 -17.866 1.00 . A A .   7 ILE O    1 1 
        1   124 1 1   8 PHE C    C  29.506  -1.112 -14.227 1.00 . A A .   8 PHE C    1 1 
        1   125 1 1   8 PHE CA   C  30.341  -1.493 -15.446 1.00 . A A .   8 PHE CA   1 1 
        1   126 1 1   8 PHE CB   C  31.830  -1.330 -15.134 1.00 . A A .   8 PHE CB   1 1 
        1   127 1 1   8 PHE CD1  C  33.055  -0.692 -17.229 1.00 . A A .   8 PHE CD1  1 1 
        1   128 1 1   8 PHE CD2  C  33.240  -2.938 -16.447 1.00 . A A .   8 PHE CD2  1 1 
        1   129 1 1   8 PHE CE1  C  33.880  -0.992 -18.296 1.00 . A A .   8 PHE CE1  1 1 
        1   130 1 1   8 PHE CE2  C  34.065  -3.244 -17.513 1.00 . A A .   8 PHE CE2  1 1 
        1   131 1 1   8 PHE CG   C  32.726  -1.660 -16.293 1.00 . A A .   8 PHE CG   1 1 
        1   132 1 1   8 PHE CZ   C  34.385  -2.270 -18.439 1.00 . A A .   8 PHE CZ   1 1 
        1   133 1 1   8 PHE H    H  30.068   0.294 -16.546 1.00 . A A .   8 PHE H    1 1 
        1   134 1 1   8 PHE HA   H  30.145  -2.526 -15.693 1.00 . A A .   8 PHE HA   1 1 
        1   135 1 1   8 PHE HB2  H  32.021  -0.307 -14.847 1.00 . A A .   8 PHE HB2  1 1 
        1   136 1 1   8 PHE HB3  H  32.091  -1.983 -14.314 1.00 . A A .   8 PHE HB3  1 1 
        1   137 1 1   8 PHE HD1  H  32.661   0.307 -17.118 1.00 . A A .   8 PHE HD1  1 1 
        1   138 1 1   8 PHE HD2  H  32.990  -3.700 -15.724 1.00 . A A .   8 PHE HD2  1 1 
        1   139 1 1   8 PHE HE1  H  34.128  -0.229 -19.019 1.00 . A A .   8 PHE HE1  1 1 
        1   140 1 1   8 PHE HE2  H  34.458  -4.244 -17.622 1.00 . A A .   8 PHE HE2  1 1 
        1   141 1 1   8 PHE HZ   H  35.030  -2.507 -19.272 1.00 . A A .   8 PHE HZ   1 1 
        1   142 1 1   8 PHE N    N  29.975  -0.680 -16.600 1.00 . A A .   8 PHE N    1 1 
        1   143 1 1   8 PHE O    O  30.006  -0.490 -13.289 1.00 . A A .   8 PHE O    1 1 
        1   144 1 1   9 VAL C    C  27.453  -2.224 -12.032 1.00 . A A .   9 VAL C    1 1 
        1   145 1 1   9 VAL CA   C  27.328  -1.188 -13.144 1.00 . A A .   9 VAL CA   1 1 
        1   146 1 1   9 VAL CB   C  25.863  -1.131 -13.615 1.00 . A A .   9 VAL CB   1 1 
        1   147 1 1   9 VAL CG1  C  25.611   0.128 -14.431 1.00 . A A .   9 VAL CG1  1 1 
        1   148 1 1   9 VAL CG2  C  25.510  -2.375 -14.418 1.00 . A A .   9 VAL CG2  1 1 
        1   149 1 1   9 VAL H    H  27.892  -1.983 -15.023 1.00 . A A .   9 VAL H    1 1 
        1   150 1 1   9 VAL HA   H  27.595  -0.218 -12.750 1.00 . A A .   9 VAL HA   1 1 
        1   151 1 1   9 VAL HB   H  25.226  -1.100 -12.743 1.00 . A A .   9 VAL HB   1 1 
        1   152 1 1   9 VAL HG11 H  24.635   0.523 -14.190 1.00 . A A .   9 VAL HG11 1 1 
        1   153 1 1   9 VAL HG12 H  25.653  -0.110 -15.483 1.00 . A A .   9 VAL HG12 1 1 
        1   154 1 1   9 VAL HG13 H  26.365   0.865 -14.198 1.00 . A A .   9 VAL HG13 1 1 
        1   155 1 1   9 VAL HG21 H  24.437  -2.442 -14.525 1.00 . A A .   9 VAL HG21 1 1 
        1   156 1 1   9 VAL HG22 H  25.876  -3.251 -13.904 1.00 . A A .   9 VAL HG22 1 1 
        1   157 1 1   9 VAL HG23 H  25.965  -2.313 -15.395 1.00 . A A .   9 VAL HG23 1 1 
        1   158 1 1   9 VAL N    N  28.232  -1.490 -14.247 1.00 . A A .   9 VAL N    1 1 
        1   159 1 1   9 VAL O    O  27.412  -3.428 -12.284 1.00 . A A .   9 VAL O    1 1 
        1   160 1 1  10 LEU C    C  26.500  -2.550  -8.757 1.00 . A A .  10 LEU C    1 1 
        1   161 1 1  10 LEU CA   C  27.735  -2.631  -9.649 1.00 . A A .  10 LEU CA   1 1 
        1   162 1 1  10 LEU CB   C  28.985  -2.271  -8.843 1.00 . A A .  10 LEU CB   1 1 
        1   163 1 1  10 LEU CD1  C  30.192  -4.462  -9.012 1.00 . A A .  10 LEU CD1  1 1 
        1   164 1 1  10 LEU CD2  C  30.522  -2.716 -10.771 1.00 . A A .  10 LEU CD2  1 1 
        1   165 1 1  10 LEU CG   C  30.269  -2.969  -9.293 1.00 . A A .  10 LEU CG   1 1 
        1   166 1 1  10 LEU H    H  27.629  -0.776 -10.664 1.00 . A A .  10 LEU H    1 1 
        1   167 1 1  10 LEU HA   H  27.833  -3.642 -10.016 1.00 . A A .  10 LEU HA   1 1 
        1   168 1 1  10 LEU HB2  H  29.137  -1.204  -8.911 1.00 . A A .  10 LEU HB2  1 1 
        1   169 1 1  10 LEU HB3  H  28.807  -2.526  -7.809 1.00 . A A .  10 LEU HB3  1 1 
        1   170 1 1  10 LEU HD11 H  30.731  -5.001  -9.777 1.00 . A A .  10 LEU HD11 1 1 
        1   171 1 1  10 LEU HD12 H  29.158  -4.775  -9.012 1.00 . A A .  10 LEU HD12 1 1 
        1   172 1 1  10 LEU HD13 H  30.631  -4.670  -8.047 1.00 . A A .  10 LEU HD13 1 1 
        1   173 1 1  10 LEU HD21 H  31.583  -2.611 -10.942 1.00 . A A .  10 LEU HD21 1 1 
        1   174 1 1  10 LEU HD22 H  30.018  -1.809 -11.072 1.00 . A A .  10 LEU HD22 1 1 
        1   175 1 1  10 LEU HD23 H  30.144  -3.546 -11.349 1.00 . A A .  10 LEU HD23 1 1 
        1   176 1 1  10 LEU HG   H  31.104  -2.568  -8.736 1.00 . A A .  10 LEU HG   1 1 
        1   177 1 1  10 LEU N    N  27.604  -1.746 -10.801 1.00 . A A .  10 LEU N    1 1 
        1   178 1 1  10 LEU O    O  26.123  -3.528  -8.112 1.00 . A A .  10 LEU O    1 1 
        1   179 1 1  11 ASN C    C  23.484  -1.906  -8.504 1.00 . A A .  11 ASN C    1 1 
        1   180 1 1  11 ASN CA   C  24.682  -1.168  -7.913 1.00 . A A .  11 ASN CA   1 1 
        1   181 1 1  11 ASN CB   C  24.374   0.326  -7.797 1.00 . A A .  11 ASN CB   1 1 
        1   182 1 1  11 ASN CG   C  24.124   0.756  -6.365 1.00 . A A .  11 ASN CG   1 1 
        1   183 1 1  11 ASN H    H  26.224  -0.635  -9.262 1.00 . A A .  11 ASN H    1 1 
        1   184 1 1  11 ASN HA   H  24.881  -1.563  -6.927 1.00 . A A .  11 ASN HA   1 1 
        1   185 1 1  11 ASN HB2  H  25.211   0.891  -8.180 1.00 . A A .  11 ASN HB2  1 1 
        1   186 1 1  11 ASN HB3  H  23.494   0.554  -8.382 1.00 . A A .  11 ASN HB3  1 1 
        1   187 1 1  11 ASN HD21 H  23.253   2.430  -6.994 1.00 . A A .  11 ASN HD21 1 1 
        1   188 1 1  11 ASN HD22 H  23.333   2.223  -5.280 1.00 . A A .  11 ASN HD22 1 1 
        1   189 1 1  11 ASN N    N  25.875  -1.377  -8.726 1.00 . A A .  11 ASN N    1 1 
        1   190 1 1  11 ASN ND2  N  23.507   1.921  -6.196 1.00 . A A .  11 ASN ND2  1 1 
        1   191 1 1  11 ASN O    O  22.791  -2.644  -7.805 1.00 . A A .  11 ASN O    1 1 
        1   192 1 1  11 ASN OD1  O  24.479   0.051  -5.421 1.00 . A A .  11 ASN OD1  1 1 
        1   193 1 1  12 ALA C    C  22.475  -2.635 -11.936 1.00 . A A .  12 ALA C    1 1 
        1   194 1 1  12 ALA CA   C  22.133  -2.345 -10.479 1.00 . A A .  12 ALA CA   1 1 
        1   195 1 1  12 ALA CB   C  20.886  -1.477 -10.391 1.00 . A A .  12 ALA CB   1 1 
        1   196 1 1  12 ALA H    H  23.835  -1.100 -10.300 1.00 . A A .  12 ALA H    1 1 
        1   197 1 1  12 ALA HA   H  21.929  -3.279  -9.975 1.00 . A A .  12 ALA HA   1 1 
        1   198 1 1  12 ALA HB1  H  20.934  -0.868  -9.500 1.00 . A A .  12 ALA HB1  1 1 
        1   199 1 1  12 ALA HB2  H  20.011  -2.108 -10.349 1.00 . A A .  12 ALA HB2  1 1 
        1   200 1 1  12 ALA HB3  H  20.829  -0.839 -11.260 1.00 . A A .  12 ALA HB3  1 1 
        1   201 1 1  12 ALA N    N  23.247  -1.700  -9.795 1.00 . A A .  12 ALA N    1 1 
        1   202 1 1  12 ALA O    O  23.098  -1.816 -12.613 1.00 . A A .  12 ALA O    1 1 
        1   203 1 1  13 ALA C    C  21.603  -3.286 -14.774 1.00 . A A .  13 ALA C    1 1 
        1   204 1 1  13 ALA CA   C  22.327  -4.203 -13.791 1.00 . A A .  13 ALA CA   1 1 
        1   205 1 1  13 ALA CB   C  21.911  -5.651 -14.009 1.00 . A A .  13 ALA CB   1 1 
        1   206 1 1  13 ALA H    H  21.572  -4.415 -11.825 1.00 . A A .  13 ALA H    1 1 
        1   207 1 1  13 ALA HA   H  23.391  -4.129 -13.962 1.00 . A A .  13 ALA HA   1 1 
        1   208 1 1  13 ALA HB1  H  21.003  -5.682 -14.592 1.00 . A A .  13 ALA HB1  1 1 
        1   209 1 1  13 ALA HB2  H  21.741  -6.124 -13.053 1.00 . A A .  13 ALA HB2  1 1 
        1   210 1 1  13 ALA HB3  H  22.695  -6.175 -14.535 1.00 . A A .  13 ALA HB3  1 1 
        1   211 1 1  13 ALA N    N  22.064  -3.805 -12.413 1.00 . A A .  13 ALA N    1 1 
        1   212 1 1  13 ALA O    O  20.743  -2.498 -14.381 1.00 . A A .  13 ALA O    1 1 
        1   213 1 1  14 PRO C    C  19.884  -2.973 -17.408 1.00 . A A .  14 PRO C    1 1 
        1   214 1 1  14 PRO CA   C  21.320  -2.550 -17.110 1.00 . A A .  14 PRO CA   1 1 
        1   215 1 1  14 PRO CB   C  22.213  -2.786 -18.330 1.00 . A A .  14 PRO CB   1 1 
        1   216 1 1  14 PRO CD   C  22.961  -4.290 -16.627 1.00 . A A .  14 PRO CD   1 1 
        1   217 1 1  14 PRO CG   C  22.793  -4.141 -18.115 1.00 . A A .  14 PRO CG   1 1 
        1   218 1 1  14 PRO HA   H  21.338  -1.503 -16.845 1.00 . A A .  14 PRO HA   1 1 
        1   219 1 1  14 PRO HB2  H  21.616  -2.749 -19.229 1.00 . A A .  14 PRO HB2  1 1 
        1   220 1 1  14 PRO HB3  H  22.983  -2.030 -18.369 1.00 . A A .  14 PRO HB3  1 1 
        1   221 1 1  14 PRO HD2  H  22.768  -5.309 -16.327 1.00 . A A .  14 PRO HD2  1 1 
        1   222 1 1  14 PRO HD3  H  23.953  -3.988 -16.327 1.00 . A A .  14 PRO HD3  1 1 
        1   223 1 1  14 PRO HG2  H  22.117  -4.894 -18.493 1.00 . A A .  14 PRO HG2  1 1 
        1   224 1 1  14 PRO HG3  H  23.751  -4.213 -18.608 1.00 . A A .  14 PRO HG3  1 1 
        1   225 1 1  14 PRO N    N  21.943  -3.377 -16.072 1.00 . A A .  14 PRO N    1 1 
        1   226 1 1  14 PRO O    O  19.560  -3.358 -18.532 1.00 . A A .  14 PRO O    1 1 
        1   227 1 1  15 LYS C    C  16.750  -2.516 -15.553 1.00 . A A .  15 LYS C    1 1 
        1   228 1 1  15 LYS CA   C  17.626  -3.269 -16.550 1.00 . A A .  15 LYS CA   1 1 
        1   229 1 1  15 LYS CB   C  17.455  -4.780 -16.365 1.00 . A A .  15 LYS CB   1 1 
        1   230 1 1  15 LYS CD   C  17.974  -5.617 -18.676 1.00 . A A .  15 LYS CD   1 1 
        1   231 1 1  15 LYS CE   C  17.881  -6.956 -19.389 1.00 . A A .  15 LYS CE   1 1 
        1   232 1 1  15 LYS CG   C  16.912  -5.485 -17.597 1.00 . A A .  15 LYS CG   1 1 
        1   233 1 1  15 LYS H    H  19.344  -2.580 -15.523 1.00 . A A .  15 LYS H    1 1 
        1   234 1 1  15 LYS HA   H  17.321  -3.002 -17.550 1.00 . A A .  15 LYS HA   1 1 
        1   235 1 1  15 LYS HB2  H  18.414  -5.212 -16.123 1.00 . A A .  15 LYS HB2  1 1 
        1   236 1 1  15 LYS HB3  H  16.773  -4.958 -15.545 1.00 . A A .  15 LYS HB3  1 1 
        1   237 1 1  15 LYS HD2  H  17.839  -4.826 -19.399 1.00 . A A .  15 LYS HD2  1 1 
        1   238 1 1  15 LYS HD3  H  18.950  -5.528 -18.221 1.00 . A A .  15 LYS HD3  1 1 
        1   239 1 1  15 LYS HE2  H  18.186  -7.735 -18.705 1.00 . A A .  15 LYS HE2  1 1 
        1   240 1 1  15 LYS HE3  H  16.856  -7.121 -19.687 1.00 . A A .  15 LYS HE3  1 1 
        1   241 1 1  15 LYS HG2  H  16.575  -6.471 -17.316 1.00 . A A .  15 LYS HG2  1 1 
        1   242 1 1  15 LYS HG3  H  16.081  -4.916 -17.989 1.00 . A A .  15 LYS HG3  1 1 
        1   243 1 1  15 LYS HZ1  H  19.526  -6.317 -20.507 1.00 . A A .  15 LYS HZ1  1 1 
        1   244 1 1  15 LYS HZ2  H  18.196  -6.778 -21.446 1.00 . A A .  15 LYS HZ2  1 1 
        1   245 1 1  15 LYS HZ3  H  19.158  -7.956 -20.706 1.00 . A A .  15 LYS HZ3  1 1 
        1   246 1 1  15 LYS N    N  19.027  -2.896 -16.395 1.00 . A A .  15 LYS N    1 1 
        1   247 1 1  15 LYS NZ   N  18.751  -7.005 -20.596 1.00 . A A .  15 LYS NZ   1 1 
        1   248 1 1  15 LYS O    O  17.019  -2.515 -14.352 1.00 . A A .  15 LYS O    1 1 
        1   249 1 1  16 ASP C    C  13.646  -2.000 -14.700 1.00 . A A .  16 ASP C    1 1 
        1   250 1 1  16 ASP CA   C  14.783  -1.118 -15.214 1.00 . A A .  16 ASP CA   1 1 
        1   251 1 1  16 ASP CB   C  14.211   0.071 -15.987 1.00 . A A .  16 ASP CB   1 1 
        1   252 1 1  16 ASP CG   C  15.209   1.204 -16.127 1.00 . A A .  16 ASP CG   1 1 
        1   253 1 1  16 ASP H    H  15.538  -1.913 -17.025 1.00 . A A .  16 ASP H    1 1 
        1   254 1 1  16 ASP HA   H  15.343  -0.747 -14.368 1.00 . A A .  16 ASP HA   1 1 
        1   255 1 1  16 ASP HB2  H  13.923  -0.254 -16.976 1.00 . A A .  16 ASP HB2  1 1 
        1   256 1 1  16 ASP HB3  H  13.340   0.445 -15.469 1.00 . A A .  16 ASP HB3  1 1 
        1   257 1 1  16 ASP N    N  15.700  -1.875 -16.059 1.00 . A A .  16 ASP N    1 1 
        1   258 1 1  16 ASP O    O  12.491  -1.575 -14.654 1.00 . A A .  16 ASP O    1 1 
        1   259 1 1  16 ASP OD1  O  16.421   0.918 -16.225 1.00 . A A .  16 ASP OD1  1 1 
        1   260 1 1  16 ASP OD2  O  14.779   2.376 -16.139 1.00 . A A .  16 ASP OD2  1 1 
        1   261 1 1  17 ASN C    C  13.143  -4.360 -12.297 1.00 . A A .  17 ASN C    1 1 
        1   262 1 1  17 ASN CA   C  12.981  -4.162 -13.801 1.00 . A A .  17 ASN CA   1 1 
        1   263 1 1  17 ASN CB   C  13.095  -5.507 -14.520 1.00 . A A .  17 ASN CB   1 1 
        1   264 1 1  17 ASN CG   C  12.512  -5.466 -15.919 1.00 . A A .  17 ASN CG   1 1 
        1   265 1 1  17 ASN H    H  14.912  -3.513 -14.368 1.00 . A A .  17 ASN H    1 1 
        1   266 1 1  17 ASN HA   H  12.004  -3.743 -13.993 1.00 . A A .  17 ASN HA   1 1 
        1   267 1 1  17 ASN HB2  H  14.136  -5.782 -14.593 1.00 . A A .  17 ASN HB2  1 1 
        1   268 1 1  17 ASN HB3  H  12.567  -6.258 -13.951 1.00 . A A .  17 ASN HB3  1 1 
        1   269 1 1  17 ASN HD21 H  12.119  -7.414 -15.839 1.00 . A A .  17 ASN HD21 1 1 
        1   270 1 1  17 ASN HD22 H  11.673  -6.618 -17.306 1.00 . A A .  17 ASN HD22 1 1 
        1   271 1 1  17 ASN N    N  13.977  -3.228 -14.312 1.00 . A A .  17 ASN N    1 1 
        1   272 1 1  17 ASN ND2  N  12.055  -6.615 -16.404 1.00 . A A .  17 ASN ND2  1 1 
        1   273 1 1  17 ASN O    O  13.734  -5.344 -11.852 1.00 . A A .  17 ASN O    1 1 
        1   274 1 1  17 ASN OD1  O  12.471  -4.414 -16.557 1.00 . A A .  17 ASN OD1  1 1 
        1   275 1 1  18 THR C    C  11.346  -3.829  -9.456 1.00 . A A .  18 THR C    1 1 
        1   276 1 1  18 THR CA   C  12.702  -3.494 -10.067 1.00 . A A .  18 THR CA   1 1 
        1   277 1 1  18 THR CB   C  13.217  -2.170  -9.499 1.00 . A A .  18 THR CB   1 1 
        1   278 1 1  18 THR CG2  C  13.754  -2.292  -8.089 1.00 . A A .  18 THR CG2  1 1 
        1   279 1 1  18 THR H    H  12.155  -2.660 -11.934 1.00 . A A .  18 THR H    1 1 
        1   280 1 1  18 THR HA   H  13.400  -4.278  -9.816 1.00 . A A .  18 THR HA   1 1 
        1   281 1 1  18 THR HB   H  12.406  -1.457  -9.483 1.00 . A A .  18 THR HB   1 1 
        1   282 1 1  18 THR HG1  H  13.922  -1.496 -11.197 1.00 . A A .  18 THR HG1  1 1 
        1   283 1 1  18 THR HG21 H  14.687  -1.755  -8.011 1.00 . A A .  18 THR HG21 1 1 
        1   284 1 1  18 THR HG22 H  13.918  -3.334  -7.855 1.00 . A A .  18 THR HG22 1 1 
        1   285 1 1  18 THR HG23 H  13.039  -1.876  -7.395 1.00 . A A .  18 THR HG23 1 1 
        1   286 1 1  18 THR N    N  12.614  -3.421 -11.520 1.00 . A A .  18 THR N    1 1 
        1   287 1 1  18 THR O    O  10.309  -3.677 -10.101 1.00 . A A .  18 THR O    1 1 
        1   288 1 1  18 THR OG1  O  14.254  -1.647 -10.309 1.00 . A A .  18 THR OG1  1 1 
        1   289 1 1  19 TRP C    C  10.247  -4.344  -6.019 1.00 . A A .  19 TRP C    1 1 
        1   290 1 1  19 TRP CA   C  10.132  -4.644  -7.510 1.00 . A A .  19 TRP CA   1 1 
        1   291 1 1  19 TRP CB   C   9.814  -6.125  -7.723 1.00 . A A .  19 TRP CB   1 1 
        1   292 1 1  19 TRP CD1  C   8.215  -6.525  -5.761 1.00 . A A .  19 TRP CD1  1 1 
        1   293 1 1  19 TRP CD2  C   7.373  -7.079  -7.760 1.00 . A A .  19 TRP CD2  1 1 
        1   294 1 1  19 TRP CE2  C   6.403  -7.345  -6.776 1.00 . A A .  19 TRP CE2  1 1 
        1   295 1 1  19 TRP CE3  C   7.068  -7.349  -9.097 1.00 . A A .  19 TRP CE3  1 1 
        1   296 1 1  19 TRP CG   C   8.525  -6.554  -7.090 1.00 . A A .  19 TRP CG   1 1 
        1   297 1 1  19 TRP CH2  C   4.878  -8.121  -8.403 1.00 . A A .  19 TRP CH2  1 1 
        1   298 1 1  19 TRP CZ2  C   5.150  -7.867  -7.087 1.00 . A A .  19 TRP CZ2  1 1 
        1   299 1 1  19 TRP CZ3  C   5.824  -7.867  -9.404 1.00 . A A .  19 TRP CZ3  1 1 
        1   300 1 1  19 TRP H    H  12.220  -4.386  -7.745 1.00 . A A .  19 TRP H    1 1 
        1   301 1 1  19 TRP HA   H   9.331  -4.050  -7.924 1.00 . A A .  19 TRP HA   1 1 
        1   302 1 1  19 TRP HB2  H   9.746  -6.323  -8.782 1.00 . A A .  19 TRP HB2  1 1 
        1   303 1 1  19 TRP HB3  H  10.609  -6.721  -7.300 1.00 . A A .  19 TRP HB3  1 1 
        1   304 1 1  19 TRP HD1  H   8.884  -6.178  -4.987 1.00 . A A .  19 TRP HD1  1 1 
        1   305 1 1  19 TRP HE1  H   6.489  -7.075  -4.697 1.00 . A A .  19 TRP HE1  1 1 
        1   306 1 1  19 TRP HE3  H   7.784  -7.159  -9.883 1.00 . A A .  19 TRP HE3  1 1 
        1   307 1 1  19 TRP HH2  H   3.919  -8.527  -8.689 1.00 . A A .  19 TRP HH2  1 1 
        1   308 1 1  19 TRP HZ2  H   4.409  -8.068  -6.326 1.00 . A A .  19 TRP HZ2  1 1 
        1   309 1 1  19 TRP HZ3  H   5.570  -8.082 -10.432 1.00 . A A .  19 TRP HZ3  1 1 
        1   310 1 1  19 TRP N    N  11.361  -4.286  -8.208 1.00 . A A .  19 TRP N    1 1 
        1   311 1 1  19 TRP NE1  N   6.940  -6.998  -5.563 1.00 . A A .  19 TRP NE1  1 1 
        1   312 1 1  19 TRP O    O  11.215  -4.738  -5.370 1.00 . A A .  19 TRP O    1 1 
        1   313 1 1  20 TYR C    C   7.851  -3.501  -3.471 1.00 . A A .  20 TYR C    1 1 
        1   314 1 1  20 TYR CA   C   9.239  -3.293  -4.068 1.00 . A A .  20 TYR CA   1 1 
        1   315 1 1  20 TYR CB   C   9.679  -1.839  -3.876 1.00 . A A .  20 TYR CB   1 1 
        1   316 1 1  20 TYR CD1  C   7.817  -0.427  -4.834 1.00 . A A .  20 TYR CD1  1 1 
        1   317 1 1  20 TYR CD2  C   9.907  -0.463  -5.981 1.00 . A A .  20 TYR CD2  1 1 
        1   318 1 1  20 TYR CE1  C   7.306   0.438  -5.783 1.00 . A A .  20 TYR CE1  1 1 
        1   319 1 1  20 TYR CE2  C   9.404   0.403  -6.933 1.00 . A A .  20 TYR CE2  1 1 
        1   320 1 1  20 TYR CG   C   9.124  -0.892  -4.916 1.00 . A A .  20 TYR CG   1 1 
        1   321 1 1  20 TYR CZ   C   8.103   0.849  -6.831 1.00 . A A .  20 TYR CZ   1 1 
        1   322 1 1  20 TYR H    H   8.507  -3.360  -6.053 1.00 . A A .  20 TYR H    1 1 
        1   323 1 1  20 TYR HA   H   9.937  -3.941  -3.559 1.00 . A A .  20 TYR HA   1 1 
        1   324 1 1  20 TYR HB2  H   9.348  -1.496  -2.907 1.00 . A A .  20 TYR HB2  1 1 
        1   325 1 1  20 TYR HB3  H  10.757  -1.788  -3.921 1.00 . A A .  20 TYR HB3  1 1 
        1   326 1 1  20 TYR HD1  H   7.195  -0.751  -4.012 1.00 . A A .  20 TYR HD1  1 1 
        1   327 1 1  20 TYR HD2  H  10.925  -0.814  -6.059 1.00 . A A .  20 TYR HD2  1 1 
        1   328 1 1  20 TYR HE1  H   6.288   0.787  -5.702 1.00 . A A .  20 TYR HE1  1 1 
        1   329 1 1  20 TYR HE2  H  10.028   0.725  -7.754 1.00 . A A .  20 TYR HE2  1 1 
        1   330 1 1  20 TYR HH   H   8.161   2.486  -7.839 1.00 . A A .  20 TYR HH   1 1 
        1   331 1 1  20 TYR N    N   9.252  -3.645  -5.483 1.00 . A A .  20 TYR N    1 1 
        1   332 1 1  20 TYR O    O   6.841  -3.195  -4.103 1.00 . A A .  20 TYR O    1 1 
        1   333 1 1  20 TYR OH   O   7.598   1.710  -7.778 1.00 . A A .  20 TYR OH   1 1 
        1   334 1 1  21 ALA C    C   6.575  -3.765  -0.136 1.00 . A A .  21 ALA C    1 1 
        1   335 1 1  21 ALA CA   C   6.542  -4.276  -1.572 1.00 . A A .  21 ALA CA   1 1 
        1   336 1 1  21 ALA CB   C   6.215  -5.761  -1.597 1.00 . A A .  21 ALA CB   1 1 
        1   337 1 1  21 ALA H    H   8.649  -4.251  -1.796 1.00 . A A .  21 ALA H    1 1 
        1   338 1 1  21 ALA HA   H   5.767  -3.752  -2.112 1.00 . A A .  21 ALA HA   1 1 
        1   339 1 1  21 ALA HB1  H   5.607  -5.981  -2.462 1.00 . A A .  21 ALA HB1  1 1 
        1   340 1 1  21 ALA HB2  H   5.675  -6.026  -0.700 1.00 . A A .  21 ALA HB2  1 1 
        1   341 1 1  21 ALA HB3  H   7.131  -6.331  -1.647 1.00 . A A .  21 ALA HB3  1 1 
        1   342 1 1  21 ALA N    N   7.809  -4.026  -2.250 1.00 . A A .  21 ALA N    1 1 
        1   343 1 1  21 ALA O    O   7.627  -3.745   0.503 1.00 . A A .  21 ALA O    1 1 
        1   344 1 1  22 GLY C    C   3.901  -2.735   2.211 1.00 . A A .  22 GLY C    1 1 
        1   345 1 1  22 GLY CA   C   5.331  -2.849   1.723 1.00 . A A .  22 GLY CA   1 1 
        1   346 1 1  22 GLY H    H   4.608  -3.394  -0.190 1.00 . A A .  22 GLY H    1 1 
        1   347 1 1  22 GLY HA2  H   5.872  -3.516   2.378 1.00 . A A .  22 GLY HA2  1 1 
        1   348 1 1  22 GLY HA3  H   5.792  -1.873   1.762 1.00 . A A .  22 GLY HA3  1 1 
        1   349 1 1  22 GLY N    N   5.415  -3.353   0.366 1.00 . A A .  22 GLY N    1 1 
        1   350 1 1  22 GLY O    O   2.987  -3.306   1.616 1.00 . A A .  22 GLY O    1 1 
        1   351 1 1  23 GLY C    C   2.218  -0.512   4.591 1.00 . A A .  23 GLY C    1 1 
        1   352 1 1  23 GLY CA   C   2.375  -1.823   3.846 1.00 . A A .  23 GLY CA   1 1 
        1   353 1 1  23 GLY H    H   4.472  -1.564   3.730 1.00 . A A .  23 GLY H    1 1 
        1   354 1 1  23 GLY HA2  H   1.658  -1.854   3.039 1.00 . A A .  23 GLY HA2  1 1 
        1   355 1 1  23 GLY HA3  H   2.170  -2.637   4.526 1.00 . A A .  23 GLY HA3  1 1 
        1   356 1 1  23 GLY N    N   3.706  -1.996   3.298 1.00 . A A .  23 GLY N    1 1 
        1   357 1 1  23 GLY O    O   3.115  -0.098   5.328 1.00 . A A .  23 GLY O    1 1 
        1   358 1 1  24 LYS C    C  -0.441   1.325   5.928 1.00 . A A .  24 LYS C    1 1 
        1   359 1 1  24 LYS CA   C   0.805   1.416   5.054 1.00 . A A .  24 LYS CA   1 1 
        1   360 1 1  24 LYS CB   C   0.633   2.524   4.014 1.00 . A A .  24 LYS CB   1 1 
        1   361 1 1  24 LYS CD   C  -0.741   3.403   2.102 1.00 . A A .  24 LYS CD   1 1 
        1   362 1 1  24 LYS CE   C  -2.225   3.404   1.767 1.00 . A A .  24 LYS CE   1 1 
        1   363 1 1  24 LYS CG   C  -0.353   2.176   2.911 1.00 . A A .  24 LYS CG   1 1 
        1   364 1 1  24 LYS H    H   0.402  -0.238   3.794 1.00 . A A .  24 LYS H    1 1 
        1   365 1 1  24 LYS HA   H   1.650   1.652   5.681 1.00 . A A .  24 LYS HA   1 1 
        1   366 1 1  24 LYS HB2  H   0.283   3.417   4.511 1.00 . A A .  24 LYS HB2  1 1 
        1   367 1 1  24 LYS HB3  H   1.591   2.728   3.559 1.00 . A A .  24 LYS HB3  1 1 
        1   368 1 1  24 LYS HD2  H  -0.512   4.289   2.675 1.00 . A A .  24 LYS HD2  1 1 
        1   369 1 1  24 LYS HD3  H  -0.174   3.410   1.183 1.00 . A A .  24 LYS HD3  1 1 
        1   370 1 1  24 LYS HE2  H  -2.402   4.117   0.976 1.00 . A A .  24 LYS HE2  1 1 
        1   371 1 1  24 LYS HE3  H  -2.505   2.417   1.431 1.00 . A A .  24 LYS HE3  1 1 
        1   372 1 1  24 LYS HG2  H   0.100   1.451   2.251 1.00 . A A .  24 LYS HG2  1 1 
        1   373 1 1  24 LYS HG3  H  -1.242   1.754   3.357 1.00 . A A .  24 LYS HG3  1 1 
        1   374 1 1  24 LYS HZ1  H  -3.922   3.190   2.967 1.00 . A A .  24 LYS HZ1  1 1 
        1   375 1 1  24 LYS HZ2  H  -3.332   4.774   2.891 1.00 . A A .  24 LYS HZ2  1 1 
        1   376 1 1  24 LYS HZ3  H  -2.528   3.615   3.824 1.00 . A A .  24 LYS HZ3  1 1 
        1   377 1 1  24 LYS N    N   1.077   0.143   4.396 1.00 . A A .  24 LYS N    1 1 
        1   378 1 1  24 LYS NZ   N  -3.060   3.771   2.945 1.00 . A A .  24 LYS NZ   1 1 
        1   379 1 1  24 LYS O    O  -1.355   0.548   5.650 1.00 . A A .  24 LYS O    1 1 
        1   380 1 1  25 LEU C    C  -2.086   3.575   8.129 1.00 . A A .  25 LEU C    1 1 
        1   381 1 1  25 LEU CA   C  -1.600   2.147   7.906 1.00 . A A .  25 LEU CA   1 1 
        1   382 1 1  25 LEU CB   C  -1.213   1.510   9.244 1.00 . A A .  25 LEU CB   1 1 
        1   383 1 1  25 LEU CD1  C  -2.971   0.026  10.250 1.00 . A A .  25 LEU CD1  1 1 
        1   384 1 1  25 LEU CD2  C  -1.837   1.744  11.664 1.00 . A A .  25 LEU CD2  1 1 
        1   385 1 1  25 LEU CG   C  -2.347   1.412  10.270 1.00 . A A .  25 LEU CG   1 1 
        1   386 1 1  25 LEU H    H   0.288   2.726   7.152 1.00 . A A .  25 LEU H    1 1 
        1   387 1 1  25 LEU HA   H  -2.399   1.573   7.461 1.00 . A A .  25 LEU HA   1 1 
        1   388 1 1  25 LEU HB2  H  -0.844   0.513   9.049 1.00 . A A .  25 LEU HB2  1 1 
        1   389 1 1  25 LEU HB3  H  -0.414   2.092   9.677 1.00 . A A .  25 LEU HB3  1 1 
        1   390 1 1  25 LEU HD11 H  -3.765  -0.021  10.981 1.00 . A A .  25 LEU HD11 1 1 
        1   391 1 1  25 LEU HD12 H  -2.219  -0.711  10.489 1.00 . A A .  25 LEU HD12 1 1 
        1   392 1 1  25 LEU HD13 H  -3.373  -0.175   9.269 1.00 . A A .  25 LEU HD13 1 1 
        1   393 1 1  25 LEU HD21 H  -0.780   1.531  11.721 1.00 . A A .  25 LEU HD21 1 1 
        1   394 1 1  25 LEU HD22 H  -2.364   1.145  12.392 1.00 . A A .  25 LEU HD22 1 1 
        1   395 1 1  25 LEU HD23 H  -2.005   2.791  11.870 1.00 . A A .  25 LEU HD23 1 1 
        1   396 1 1  25 LEU HG   H  -3.116   2.128  10.015 1.00 . A A .  25 LEU HG   1 1 
        1   397 1 1  25 LEU N    N  -0.469   2.128   6.987 1.00 . A A .  25 LEU N    1 1 
        1   398 1 1  25 LEU O    O  -1.283   4.505   8.248 1.00 . A A .  25 LEU O    1 1 
        1   399 1 1  26 GLY C    C  -5.492   5.037   8.411 1.00 . A A .  26 GLY C    1 1 
        1   400 1 1  26 GLY CA   C  -3.976   5.060   8.388 1.00 . A A .  26 GLY CA   1 1 
        1   401 1 1  26 GLY H    H  -3.992   2.964   8.077 1.00 . A A .  26 GLY H    1 1 
        1   402 1 1  26 GLY HA2  H  -3.619   5.452   9.329 1.00 . A A .  26 GLY HA2  1 1 
        1   403 1 1  26 GLY HA3  H  -3.649   5.711   7.591 1.00 . A A .  26 GLY HA3  1 1 
        1   404 1 1  26 GLY N    N  -3.403   3.743   8.181 1.00 . A A .  26 GLY N    1 1 
        1   405 1 1  26 GLY O    O  -6.097   4.130   8.982 1.00 . A A .  26 GLY O    1 1 
        1   406 1 1  27 TRP C    C  -8.065   5.924   6.310 1.00 . A A .  27 TRP C    1 1 
        1   407 1 1  27 TRP CA   C  -7.560   6.130   7.735 1.00 . A A .  27 TRP CA   1 1 
        1   408 1 1  27 TRP CB   C  -8.024   7.489   8.261 1.00 . A A .  27 TRP CB   1 1 
        1   409 1 1  27 TRP CD1  C  -6.916   7.187  10.552 1.00 . A A .  27 TRP CD1  1 1 
        1   410 1 1  27 TRP CD2  C  -8.913   8.197  10.622 1.00 . A A .  27 TRP CD2  1 1 
        1   411 1 1  27 TRP CE2  C  -8.416   8.094  11.935 1.00 . A A .  27 TRP CE2  1 1 
        1   412 1 1  27 TRP CE3  C -10.158   8.801  10.419 1.00 . A A .  27 TRP CE3  1 1 
        1   413 1 1  27 TRP CG   C  -7.938   7.611   9.752 1.00 . A A .  27 TRP CG   1 1 
        1   414 1 1  27 TRP CH2  C -10.336   9.156  12.809 1.00 . A A .  27 TRP CH2  1 1 
        1   415 1 1  27 TRP CZ2  C  -9.121   8.571  13.038 1.00 . A A .  27 TRP CZ2  1 1 
        1   416 1 1  27 TRP CZ3  C -10.856   9.273  11.514 1.00 . A A .  27 TRP CZ3  1 1 
        1   417 1 1  27 TRP H    H  -5.566   6.729   7.349 1.00 . A A .  27 TRP H    1 1 
        1   418 1 1  27 TRP HA   H  -7.965   5.352   8.364 1.00 . A A .  27 TRP HA   1 1 
        1   419 1 1  27 TRP HB2  H  -7.410   8.264   7.828 1.00 . A A .  27 TRP HB2  1 1 
        1   420 1 1  27 TRP HB3  H  -9.053   7.647   7.971 1.00 . A A .  27 TRP HB3  1 1 
        1   421 1 1  27 TRP HD1  H  -6.024   6.698  10.191 1.00 . A A .  27 TRP HD1  1 1 
        1   422 1 1  27 TRP HE1  H  -6.617   7.268  12.630 1.00 . A A .  27 TRP HE1  1 1 
        1   423 1 1  27 TRP HE3  H -10.575   8.900   9.427 1.00 . A A .  27 TRP HE3  1 1 
        1   424 1 1  27 TRP HH2  H -10.917   9.539  13.635 1.00 . A A .  27 TRP HH2  1 1 
        1   425 1 1  27 TRP HZ2  H  -8.734   8.489  14.043 1.00 . A A .  27 TRP HZ2  1 1 
        1   426 1 1  27 TRP HZ3  H -11.819   9.742  11.376 1.00 . A A .  27 TRP HZ3  1 1 
        1   427 1 1  27 TRP N    N  -6.105   6.037   7.787 1.00 . A A .  27 TRP N    1 1 
        1   428 1 1  27 TRP NE1  N  -7.196   7.473  11.866 1.00 . A A .  27 TRP NE1  1 1 
        1   429 1 1  27 TRP O    O  -7.530   6.500   5.362 1.00 . A A .  27 TRP O    1 1 
        1   430 1 1  28 SER C    C -10.905   5.678   4.605 1.00 . A A .  28 SER C    1 1 
        1   431 1 1  28 SER CA   C  -9.671   4.817   4.855 1.00 . A A .  28 SER CA   1 1 
        1   432 1 1  28 SER CB   C -10.037   3.336   4.743 1.00 . A A .  28 SER CB   1 1 
        1   433 1 1  28 SER H    H  -9.479   4.668   6.958 1.00 . A A .  28 SER H    1 1 
        1   434 1 1  28 SER HA   H  -8.926   5.052   4.110 1.00 . A A .  28 SER HA   1 1 
        1   435 1 1  28 SER HB2  H -11.013   3.175   5.175 1.00 . A A .  28 SER HB2  1 1 
        1   436 1 1  28 SER HB3  H -10.053   3.050   3.701 1.00 . A A .  28 SER HB3  1 1 
        1   437 1 1  28 SER HG   H  -9.286   1.600   5.253 1.00 . A A .  28 SER HG   1 1 
        1   438 1 1  28 SER N    N  -9.096   5.098   6.166 1.00 . A A .  28 SER N    1 1 
        1   439 1 1  28 SER O    O -11.036   6.300   3.551 1.00 . A A .  28 SER O    1 1 
        1   440 1 1  28 SER OG   O  -9.096   2.525   5.425 1.00 . A A .  28 SER OG   1 1 
        1   441 1 1  29 GLN C    C -13.248   7.354   6.701 1.00 . A A .  29 GLN C    1 1 
        1   442 1 1  29 GLN CA   C -13.032   6.491   5.463 1.00 . A A .  29 GLN CA   1 1 
        1   443 1 1  29 GLN CB   C -14.235   5.569   5.255 1.00 . A A .  29 GLN CB   1 1 
        1   444 1 1  29 GLN CD   C -14.712   3.634   3.699 1.00 . A A .  29 GLN CD   1 1 
        1   445 1 1  29 GLN CG   C -14.413   5.117   3.815 1.00 . A A .  29 GLN CG   1 1 
        1   446 1 1  29 GLN H    H -11.648   5.190   6.396 1.00 . A A .  29 GLN H    1 1 
        1   447 1 1  29 GLN HA   H -12.932   7.136   4.602 1.00 . A A .  29 GLN HA   1 1 
        1   448 1 1  29 GLN HB2  H -14.112   4.692   5.874 1.00 . A A .  29 GLN HB2  1 1 
        1   449 1 1  29 GLN HB3  H -15.130   6.091   5.560 1.00 . A A .  29 GLN HB3  1 1 
        1   450 1 1  29 GLN HE21 H -15.080   3.835   1.755 1.00 . A A .  29 GLN HE21 1 1 
        1   451 1 1  29 GLN HE22 H -15.244   2.236   2.389 1.00 . A A .  29 GLN HE22 1 1 
        1   452 1 1  29 GLN HG2  H -15.233   5.668   3.377 1.00 . A A .  29 GLN HG2  1 1 
        1   453 1 1  29 GLN HG3  H -13.506   5.330   3.269 1.00 . A A .  29 GLN HG3  1 1 
        1   454 1 1  29 GLN N    N -11.808   5.707   5.579 1.00 . A A .  29 GLN N    1 1 
        1   455 1 1  29 GLN NE2  N -15.045   3.190   2.493 1.00 . A A .  29 GLN NE2  1 1 
        1   456 1 1  29 GLN O    O -12.712   7.068   7.772 1.00 . A A .  29 GLN O    1 1 
        1   457 1 1  29 GLN OE1  O -14.643   2.896   4.682 1.00 . A A .  29 GLN OE1  1 1 
        1   458 1 1  30 TYR C    C -15.319  10.396   7.224 1.00 . A A .  30 TYR C    1 1 
        1   459 1 1  30 TYR CA   C -14.328   9.319   7.652 1.00 . A A .  30 TYR CA   1 1 
        1   460 1 1  30 TYR CB   C -13.039   9.968   8.161 1.00 . A A .  30 TYR CB   1 1 
        1   461 1 1  30 TYR CD1  C -14.028  10.452  10.433 1.00 . A A .  30 TYR CD1  1 1 
        1   462 1 1  30 TYR CD2  C -12.665  12.125   9.420 1.00 . A A .  30 TYR CD2  1 1 
        1   463 1 1  30 TYR CE1  C -14.221  11.268  11.531 1.00 . A A .  30 TYR CE1  1 1 
        1   464 1 1  30 TYR CE2  C -12.854  12.947  10.515 1.00 . A A .  30 TYR CE2  1 1 
        1   465 1 1  30 TYR CG   C -13.248  10.865   9.361 1.00 . A A .  30 TYR CG   1 1 
        1   466 1 1  30 TYR CZ   C -13.633  12.514  11.567 1.00 . A A .  30 TYR CZ   1 1 
        1   467 1 1  30 TYR H    H -14.436   8.587   5.669 1.00 . A A .  30 TYR H    1 1 
        1   468 1 1  30 TYR HA   H -14.767   8.739   8.449 1.00 . A A .  30 TYR HA   1 1 
        1   469 1 1  30 TYR HB2  H -12.341   9.194   8.443 1.00 . A A .  30 TYR HB2  1 1 
        1   470 1 1  30 TYR HB3  H -12.608  10.564   7.370 1.00 . A A .  30 TYR HB3  1 1 
        1   471 1 1  30 TYR HD1  H -14.487   9.474  10.403 1.00 . A A .  30 TYR HD1  1 1 
        1   472 1 1  30 TYR HD2  H -12.056  12.461   8.594 1.00 . A A .  30 TYR HD2  1 1 
        1   473 1 1  30 TYR HE1  H -14.831  10.929  12.355 1.00 . A A .  30 TYR HE1  1 1 
        1   474 1 1  30 TYR HE2  H -12.393  13.923  10.542 1.00 . A A .  30 TYR HE2  1 1 
        1   475 1 1  30 TYR HH   H -14.747  13.306  12.919 1.00 . A A .  30 TYR HH   1 1 
        1   476 1 1  30 TYR N    N -14.037   8.412   6.547 1.00 . A A .  30 TYR N    1 1 
        1   477 1 1  30 TYR O    O -15.312  10.838   6.075 1.00 . A A .  30 TYR O    1 1 
        1   478 1 1  30 TYR OH   O -13.823  13.330  12.658 1.00 . A A .  30 TYR OH   1 1 
        1   479 1 1  31 HIS C    C -16.740  13.188   8.446 1.00 . A A .  31 HIS C    1 1 
        1   480 1 1  31 HIS CA   C -17.167  11.840   7.872 1.00 . A A .  31 HIS CA   1 1 
        1   481 1 1  31 HIS CB   C -18.525  11.433   8.448 1.00 . A A .  31 HIS CB   1 1 
        1   482 1 1  31 HIS CD2  C -20.376  12.849   7.308 1.00 . A A .  31 HIS CD2  1 1 
        1   483 1 1  31 HIS CE1  C -21.212  11.296   6.007 1.00 . A A .  31 HIS CE1  1 1 
        1   484 1 1  31 HIS CG   C -19.672  11.713   7.527 1.00 . A A .  31 HIS CG   1 1 
        1   485 1 1  31 HIS H    H -16.126  10.424   9.053 1.00 . A A .  31 HIS H    1 1 
        1   486 1 1  31 HIS HA   H -17.253  11.931   6.800 1.00 . A A .  31 HIS HA   1 1 
        1   487 1 1  31 HIS HB2  H -18.517  10.373   8.655 1.00 . A A .  31 HIS HB2  1 1 
        1   488 1 1  31 HIS HB3  H -18.696  11.973   9.368 1.00 . A A .  31 HIS HB3  1 1 
        1   489 1 1  31 HIS HD1  H -19.928   9.826   6.624 1.00 . A A .  31 HIS HD1  1 1 
        1   490 1 1  31 HIS HD2  H -20.219  13.804   7.791 1.00 . A A .  31 HIS HD2  1 1 
        1   491 1 1  31 HIS HE1  H -21.825  10.784   5.279 1.00 . A A .  31 HIS HE1  1 1 
        1   492 1 1  31 HIS HE2  H -21.915  13.217   5.928 1.00 . A A .  31 HIS HE2  1 1 
        1   493 1 1  31 HIS N    N -16.170  10.815   8.155 1.00 . A A .  31 HIS N    1 1 
        1   494 1 1  31 HIS ND1  N -20.222  10.759   6.697 1.00 . A A .  31 HIS ND1  1 1 
        1   495 1 1  31 HIS NE2  N -21.327  12.562   6.360 1.00 . A A .  31 HIS NE2  1 1 
        1   496 1 1  31 HIS O    O -16.432  13.299   9.633 1.00 . A A .  31 HIS O    1 1 
        1   497 1 1  32 ASP C    C -17.264  16.601   7.423 1.00 . A A .  32 ASP C    1 1 
        1   498 1 1  32 ASP CA   C -16.333  15.549   8.019 1.00 . A A .  32 ASP CA   1 1 
        1   499 1 1  32 ASP CB   C -14.889  15.837   7.604 1.00 . A A .  32 ASP CB   1 1 
        1   500 1 1  32 ASP CG   C -14.641  15.548   6.137 1.00 . A A .  32 ASP CG   1 1 
        1   501 1 1  32 ASP H    H -16.979  14.058   6.662 1.00 . A A .  32 ASP H    1 1 
        1   502 1 1  32 ASP HA   H -16.404  15.591   9.095 1.00 . A A .  32 ASP HA   1 1 
        1   503 1 1  32 ASP HB2  H -14.668  16.878   7.789 1.00 . A A .  32 ASP HB2  1 1 
        1   504 1 1  32 ASP HB3  H -14.223  15.222   8.191 1.00 . A A .  32 ASP HB3  1 1 
        1   505 1 1  32 ASP N    N -16.723  14.209   7.596 1.00 . A A .  32 ASP N    1 1 
        1   506 1 1  32 ASP O    O -17.745  17.488   8.128 1.00 . A A .  32 ASP O    1 1 
        1   507 1 1  32 ASP OD1  O -14.530  14.357   5.776 1.00 . A A .  32 ASP OD1  1 1 
        1   508 1 1  32 ASP OD2  O -14.558  16.512   5.347 1.00 . A A .  32 ASP OD2  1 1 
        1   509 1 1  33 THR C    C -19.788  16.860   5.264 1.00 . A A .  33 THR C    1 1 
        1   510 1 1  33 THR CA   C -18.387  17.438   5.433 1.00 . A A .  33 THR CA   1 1 
        1   511 1 1  33 THR CB   C -17.804  17.800   4.066 1.00 . A A .  33 THR CB   1 1 
        1   512 1 1  33 THR CG2  C -18.148  19.205   3.621 1.00 . A A .  33 THR CG2  1 1 
        1   513 1 1  33 THR H    H -17.101  15.767   5.614 1.00 . A A .  33 THR H    1 1 
        1   514 1 1  33 THR HA   H -18.450  18.332   6.035 1.00 . A A .  33 THR HA   1 1 
        1   515 1 1  33 THR HB   H -18.193  17.114   3.327 1.00 . A A .  33 THR HB   1 1 
        1   516 1 1  33 THR HG1  H -16.028  18.288   4.731 1.00 . A A .  33 THR HG1  1 1 
        1   517 1 1  33 THR HG21 H -17.343  19.874   3.886 1.00 . A A .  33 THR HG21 1 1 
        1   518 1 1  33 THR HG22 H -19.057  19.524   4.109 1.00 . A A .  33 THR HG22 1 1 
        1   519 1 1  33 THR HG23 H -18.291  19.219   2.550 1.00 . A A .  33 THR HG23 1 1 
        1   520 1 1  33 THR N    N -17.514  16.495   6.122 1.00 . A A .  33 THR N    1 1 
        1   521 1 1  33 THR O    O -19.972  15.642   5.266 1.00 . A A .  33 THR O    1 1 
        1   522 1 1  33 THR OG1  O -16.392  17.686   4.078 1.00 . A A .  33 THR OG1  1 1 
        1   523 1 1  34 GLY C    C -22.870  17.144   6.275 1.00 . A A .  34 GLY C    1 1 
        1   524 1 1  34 GLY CA   C -22.145  17.299   4.952 1.00 . A A .  34 GLY CA   1 1 
        1   525 1 1  34 GLY H    H -20.566  18.698   5.127 1.00 . A A .  34 GLY H    1 1 
        1   526 1 1  34 GLY HA2  H -22.672  18.021   4.347 1.00 . A A .  34 GLY HA2  1 1 
        1   527 1 1  34 GLY HA3  H -22.145  16.347   4.441 1.00 . A A .  34 GLY HA3  1 1 
        1   528 1 1  34 GLY N    N -20.773  17.740   5.120 1.00 . A A .  34 GLY N    1 1 
        1   529 1 1  34 GLY O    O -22.243  16.928   7.312 1.00 . A A .  34 GLY O    1 1 
        1   530 1 1  35 PHE C    C -26.334  16.445   7.135 1.00 . A A .  35 PHE C    1 1 
        1   531 1 1  35 PHE CA   C -25.005  17.126   7.443 1.00 . A A .  35 PHE CA   1 1 
        1   532 1 1  35 PHE CB   C -25.255  18.502   8.064 1.00 . A A .  35 PHE CB   1 1 
        1   533 1 1  35 PHE CD1  C -23.593  18.118   9.905 1.00 . A A .  35 PHE CD1  1 1 
        1   534 1 1  35 PHE CD2  C -23.645  20.258   8.853 1.00 . A A .  35 PHE CD2  1 1 
        1   535 1 1  35 PHE CE1  C -22.570  18.545  10.730 1.00 . A A .  35 PHE CE1  1 1 
        1   536 1 1  35 PHE CE2  C -22.622  20.690   9.674 1.00 . A A .  35 PHE CE2  1 1 
        1   537 1 1  35 PHE CG   C -24.142  18.969   8.958 1.00 . A A .  35 PHE CG   1 1 
        1   538 1 1  35 PHE CZ   C -22.083  19.833  10.614 1.00 . A A .  35 PHE CZ   1 1 
        1   539 1 1  35 PHE H    H -24.636  17.427   5.381 1.00 . A A .  35 PHE H    1 1 
        1   540 1 1  35 PHE HA   H -24.457  16.518   8.147 1.00 . A A .  35 PHE HA   1 1 
        1   541 1 1  35 PHE HB2  H -25.373  19.229   7.275 1.00 . A A .  35 PHE HB2  1 1 
        1   542 1 1  35 PHE HB3  H -26.161  18.464   8.651 1.00 . A A .  35 PHE HB3  1 1 
        1   543 1 1  35 PHE HD1  H -23.973  17.111   9.996 1.00 . A A .  35 PHE HD1  1 1 
        1   544 1 1  35 PHE HD2  H -24.066  20.929   8.119 1.00 . A A .  35 PHE HD2  1 1 
        1   545 1 1  35 PHE HE1  H -22.150  17.873  11.463 1.00 . A A .  35 PHE HE1  1 1 
        1   546 1 1  35 PHE HE2  H -22.243  21.698   9.582 1.00 . A A .  35 PHE HE2  1 1 
        1   547 1 1  35 PHE HZ   H -21.283  20.169  11.257 1.00 . A A .  35 PHE HZ   1 1 
        1   548 1 1  35 PHE N    N -24.194  17.255   6.238 1.00 . A A .  35 PHE N    1 1 
        1   549 1 1  35 PHE O    O -26.596  16.060   5.996 1.00 . A A .  35 PHE O    1 1 
        1   550 1 1  36 TYR C    C -29.539  16.397   8.805 1.00 . A A .  36 TYR C    1 1 
        1   551 1 1  36 TYR CA   C -28.473  15.664   7.997 1.00 . A A .  36 TYR CA   1 1 
        1   552 1 1  36 TYR CB   C -28.406  14.198   8.430 1.00 . A A .  36 TYR CB   1 1 
        1   553 1 1  36 TYR CD1  C -28.977  13.249   6.161 1.00 . A A .  36 TYR CD1  1 1 
        1   554 1 1  36 TYR CD2  C -27.121  12.321   7.334 1.00 . A A .  36 TYR CD2  1 1 
        1   555 1 1  36 TYR CE1  C -28.758  12.374   5.114 1.00 . A A .  36 TYR CE1  1 1 
        1   556 1 1  36 TYR CE2  C -26.896  11.442   6.291 1.00 . A A .  36 TYR CE2  1 1 
        1   557 1 1  36 TYR CG   C -28.163  13.238   7.287 1.00 . A A .  36 TYR CG   1 1 
        1   558 1 1  36 TYR CZ   C -27.717  11.473   5.184 1.00 . A A .  36 TYR CZ   1 1 
        1   559 1 1  36 TYR H    H -26.904  16.627   9.043 1.00 . A A .  36 TYR H    1 1 
        1   560 1 1  36 TYR HA   H -28.736  15.709   6.951 1.00 . A A .  36 TYR HA   1 1 
        1   561 1 1  36 TYR HB2  H -27.602  14.076   9.140 1.00 . A A .  36 TYR HB2  1 1 
        1   562 1 1  36 TYR HB3  H -29.339  13.925   8.900 1.00 . A A .  36 TYR HB3  1 1 
        1   563 1 1  36 TYR HD1  H -29.791  13.956   6.108 1.00 . A A .  36 TYR HD1  1 1 
        1   564 1 1  36 TYR HD2  H -26.480  12.299   8.203 1.00 . A A .  36 TYR HD2  1 1 
        1   565 1 1  36 TYR HE1  H -29.402  12.398   4.247 1.00 . A A .  36 TYR HE1  1 1 
        1   566 1 1  36 TYR HE2  H -26.080  10.737   6.347 1.00 . A A .  36 TYR HE2  1 1 
        1   567 1 1  36 TYR HH   H -28.336  10.261   3.826 1.00 . A A .  36 TYR HH   1 1 
        1   568 1 1  36 TYR N    N -27.170  16.299   8.158 1.00 . A A .  36 TYR N    1 1 
        1   569 1 1  36 TYR O    O -29.239  17.033   9.816 1.00 . A A .  36 TYR O    1 1 
        1   570 1 1  36 TYR OH   O -27.496  10.599   4.144 1.00 . A A .  36 TYR OH   1 1 
        1   571 1 1  37 GLY C    C -32.667  16.011   9.923 1.00 . A A .  37 GLY C    1 1 
        1   572 1 1  37 GLY CA   C -31.877  16.963   9.046 1.00 . A A .  37 GLY CA   1 1 
        1   573 1 1  37 GLY H    H -30.965  15.783   7.543 1.00 . A A .  37 GLY H    1 1 
        1   574 1 1  37 GLY HA2  H -31.473  17.752   9.663 1.00 . A A .  37 GLY HA2  1 1 
        1   575 1 1  37 GLY HA3  H -32.543  17.397   8.315 1.00 . A A .  37 GLY HA3  1 1 
        1   576 1 1  37 GLY N    N -30.786  16.304   8.353 1.00 . A A .  37 GLY N    1 1 
        1   577 1 1  37 GLY O    O -33.894  16.087   9.986 1.00 . A A .  37 GLY O    1 1 
        1   578 1 1  38 ASN C    C -32.316  14.456  12.942 1.00 . A A .  38 ASN C    1 1 
        1   579 1 1  38 ASN CA   C -32.604  14.139  11.478 1.00 . A A .  38 ASN CA   1 1 
        1   580 1 1  38 ASN CB   C -32.123  12.725  11.146 1.00 . A A .  38 ASN CB   1 1 
        1   581 1 1  38 ASN CG   C -32.267  12.396   9.673 1.00 . A A .  38 ASN CG   1 1 
        1   582 1 1  38 ASN H    H -30.986  15.100  10.508 1.00 . A A .  38 ASN H    1 1 
        1   583 1 1  38 ASN HA   H -33.669  14.196  11.312 1.00 . A A .  38 ASN HA   1 1 
        1   584 1 1  38 ASN HB2  H -31.082  12.632  11.417 1.00 . A A .  38 ASN HB2  1 1 
        1   585 1 1  38 ASN HB3  H -32.703  12.012  11.714 1.00 . A A .  38 ASN HB3  1 1 
        1   586 1 1  38 ASN HD21 H -33.843  11.248  10.057 1.00 . A A .  38 ASN HD21 1 1 
        1   587 1 1  38 ASN HD22 H -33.380  11.355   8.397 1.00 . A A .  38 ASN HD22 1 1 
        1   588 1 1  38 ASN N    N -31.961  15.111  10.600 1.00 . A A .  38 ASN N    1 1 
        1   589 1 1  38 ASN ND2  N -33.264  11.585   9.342 1.00 . A A .  38 ASN ND2  1 1 
        1   590 1 1  38 ASN O    O -31.202  14.841  13.298 1.00 . A A .  38 ASN O    1 1 
        1   591 1 1  38 ASN OD1  O -31.490  12.867   8.842 1.00 . A A .  38 ASN OD1  1 1 
        1   592 1 1  39 GLY C    C -32.123  13.671  15.849 1.00 . A A .  39 GLY C    1 1 
        1   593 1 1  39 GLY CA   C -33.165  14.564  15.203 1.00 . A A .  39 GLY CA   1 1 
        1   594 1 1  39 GLY H    H -34.194  13.982  13.447 1.00 . A A .  39 GLY H    1 1 
        1   595 1 1  39 GLY HA2  H -32.867  15.594  15.327 1.00 . A A .  39 GLY HA2  1 1 
        1   596 1 1  39 GLY HA3  H -34.111  14.411  15.700 1.00 . A A .  39 GLY HA3  1 1 
        1   597 1 1  39 GLY N    N -33.329  14.291  13.787 1.00 . A A .  39 GLY N    1 1 
        1   598 1 1  39 GLY O    O -31.324  14.130  16.666 1.00 . A A .  39 GLY O    1 1 
        1   599 1 1  40 PHE C    C -29.828  11.549  15.336 1.00 . A A .  40 PHE C    1 1 
        1   600 1 1  40 PHE CA   C -31.180  11.435  16.033 1.00 . A A .  40 PHE CA   1 1 
        1   601 1 1  40 PHE CB   C -31.720  10.011  15.893 1.00 . A A .  40 PHE CB   1 1 
        1   602 1 1  40 PHE CD1  C -32.014   9.015  18.177 1.00 . A A .  40 PHE CD1  1 1 
        1   603 1 1  40 PHE CD2  C -33.956   9.741  16.999 1.00 . A A .  40 PHE CD2  1 1 
        1   604 1 1  40 PHE CE1  C -32.804   8.618  19.240 1.00 . A A .  40 PHE CE1  1 1 
        1   605 1 1  40 PHE CE2  C -34.751   9.346  18.059 1.00 . A A .  40 PHE CE2  1 1 
        1   606 1 1  40 PHE CG   C -32.581   9.580  17.046 1.00 . A A .  40 PHE CG   1 1 
        1   607 1 1  40 PHE CZ   C -34.174   8.784  19.181 1.00 . A A .  40 PHE CZ   1 1 
        1   608 1 1  40 PHE H    H -32.792  12.089  14.827 1.00 . A A .  40 PHE H    1 1 
        1   609 1 1  40 PHE HA   H -31.051  11.660  17.081 1.00 . A A .  40 PHE HA   1 1 
        1   610 1 1  40 PHE HB2  H -32.314   9.945  14.994 1.00 . A A .  40 PHE HB2  1 1 
        1   611 1 1  40 PHE HB3  H -30.890   9.324  15.821 1.00 . A A .  40 PHE HB3  1 1 
        1   612 1 1  40 PHE HD1  H -30.943   8.884  18.225 1.00 . A A .  40 PHE HD1  1 1 
        1   613 1 1  40 PHE HD2  H -34.409  10.181  16.123 1.00 . A A .  40 PHE HD2  1 1 
        1   614 1 1  40 PHE HE1  H -32.350   8.178  20.116 1.00 . A A .  40 PHE HE1  1 1 
        1   615 1 1  40 PHE HE2  H -35.822   9.478  18.010 1.00 . A A .  40 PHE HE2  1 1 
        1   616 1 1  40 PHE HZ   H -34.792   8.474  20.010 1.00 . A A .  40 PHE HZ   1 1 
        1   617 1 1  40 PHE N    N -32.131  12.394  15.483 1.00 . A A .  40 PHE N    1 1 
        1   618 1 1  40 PHE O    O -29.669  11.120  14.193 1.00 . A A .  40 PHE O    1 1 
        1   619 1 1  41 GLN C    C -26.561  11.251  16.035 1.00 . A A .  41 GLN C    1 1 
        1   620 1 1  41 GLN CA   C -27.517  12.301  15.479 1.00 . A A .  41 GLN CA   1 1 
        1   621 1 1  41 GLN CB   C -26.990  13.703  15.789 1.00 . A A .  41 GLN CB   1 1 
        1   622 1 1  41 GLN CD   C -26.946  16.140  15.126 1.00 . A A .  41 GLN CD   1 1 
        1   623 1 1  41 GLN CG   C -27.328  14.730  14.721 1.00 . A A .  41 GLN CG   1 1 
        1   624 1 1  41 GLN H    H -29.044  12.452  16.938 1.00 . A A .  41 GLN H    1 1 
        1   625 1 1  41 GLN HA   H -27.583  12.180  14.409 1.00 . A A .  41 GLN HA   1 1 
        1   626 1 1  41 GLN HB2  H -27.414  14.036  16.725 1.00 . A A .  41 GLN HB2  1 1 
        1   627 1 1  41 GLN HB3  H -25.916  13.658  15.887 1.00 . A A .  41 GLN HB3  1 1 
        1   628 1 1  41 GLN HE21 H -25.031  15.754  14.757 1.00 . A A .  41 GLN HE21 1 1 
        1   629 1 1  41 GLN HE22 H -25.380  17.351  15.316 1.00 . A A .  41 GLN HE22 1 1 
        1   630 1 1  41 GLN HG2  H -26.798  14.476  13.815 1.00 . A A .  41 GLN HG2  1 1 
        1   631 1 1  41 GLN HG3  H -28.392  14.700  14.535 1.00 . A A .  41 GLN HG3  1 1 
        1   632 1 1  41 GLN N    N -28.856  12.130  16.032 1.00 . A A .  41 GLN N    1 1 
        1   633 1 1  41 GLN NE2  N -25.655  16.446  15.060 1.00 . A A .  41 GLN NE2  1 1 
        1   634 1 1  41 GLN O    O -26.063  10.399  15.299 1.00 . A A .  41 GLN O    1 1 
        1   635 1 1  41 GLN OE1  O -27.800  16.946  15.494 1.00 . A A .  41 GLN OE1  1 1 
        1   636 1 1  42 ASN C    C -26.185   9.416  18.890 1.00 . A A .  42 ASN C    1 1 
        1   637 1 1  42 ASN CA   C -25.409  10.374  17.992 1.00 . A A .  42 ASN CA   1 1 
        1   638 1 1  42 ASN CB   C -24.358  11.122  18.813 1.00 . A A .  42 ASN CB   1 1 
        1   639 1 1  42 ASN CG   C -23.005  10.438  18.783 1.00 . A A .  42 ASN CG   1 1 
        1   640 1 1  42 ASN H    H -26.734  12.021  17.872 1.00 . A A .  42 ASN H    1 1 
        1   641 1 1  42 ASN HA   H -24.911   9.803  17.222 1.00 . A A .  42 ASN HA   1 1 
        1   642 1 1  42 ASN HB2  H -24.243  12.120  18.417 1.00 . A A .  42 ASN HB2  1 1 
        1   643 1 1  42 ASN HB3  H -24.688  11.182  19.840 1.00 . A A .  42 ASN HB3  1 1 
        1   644 1 1  42 ASN HD21 H -22.459  11.389  20.442 1.00 . A A .  42 ASN HD21 1 1 
        1   645 1 1  42 ASN HD22 H -21.282  10.318  19.769 1.00 . A A .  42 ASN HD22 1 1 
        1   646 1 1  42 ASN N    N -26.307  11.319  17.338 1.00 . A A .  42 ASN N    1 1 
        1   647 1 1  42 ASN ND2  N -22.164  10.746  19.764 1.00 . A A .  42 ASN ND2  1 1 
        1   648 1 1  42 ASN O    O -26.500   9.741  20.035 1.00 . A A .  42 ASN O    1 1 
        1   649 1 1  42 ASN OD1  O -22.720   9.640  17.890 1.00 . A A .  42 ASN OD1  1 1 
        1   650 1 1  43 ASN C    C -26.375   6.670  20.255 1.00 . A A .  43 ASN C    1 1 
        1   651 1 1  43 ASN CA   C -27.226   7.228  19.118 1.00 . A A .  43 ASN CA   1 1 
        1   652 1 1  43 ASN CB   C -27.671   6.093  18.195 1.00 . A A .  43 ASN CB   1 1 
        1   653 1 1  43 ASN CG   C -26.513   5.479  17.434 1.00 . A A .  43 ASN CG   1 1 
        1   654 1 1  43 ASN H    H -26.208   8.033  17.446 1.00 . A A .  43 ASN H    1 1 
        1   655 1 1  43 ASN HA   H -28.099   7.703  19.538 1.00 . A A .  43 ASN HA   1 1 
        1   656 1 1  43 ASN HB2  H -28.140   5.319  18.786 1.00 . A A .  43 ASN HB2  1 1 
        1   657 1 1  43 ASN HB3  H -28.385   6.477  17.481 1.00 . A A .  43 ASN HB3  1 1 
        1   658 1 1  43 ASN HD21 H -27.530   3.785  17.206 1.00 . A A .  43 ASN HD21 1 1 
        1   659 1 1  43 ASN HD22 H -25.948   3.810  16.512 1.00 . A A .  43 ASN HD22 1 1 
        1   660 1 1  43 ASN N    N -26.488   8.234  18.363 1.00 . A A .  43 ASN N    1 1 
        1   661 1 1  43 ASN ND2  N -26.680   4.232  17.008 1.00 . A A .  43 ASN ND2  1 1 
        1   662 1 1  43 ASN O    O -26.880   6.389  21.342 1.00 . A A .  43 ASN O    1 1 
        1   663 1 1  43 ASN OD1  O -25.481   6.117  17.230 1.00 . A A .  43 ASN OD1  1 1 
        1   664 1 1  44 ASN C    C -22.909   6.860  21.089 1.00 . A A .  44 ASN C    1 1 
        1   665 1 1  44 ASN CA   C -24.158   5.990  20.996 1.00 . A A .  44 ASN CA   1 1 
        1   666 1 1  44 ASN CB   C -23.767   4.551  20.656 1.00 . A A .  44 ASN CB   1 1 
        1   667 1 1  44 ASN CG   C -24.775   3.542  21.171 1.00 . A A .  44 ASN CG   1 1 
        1   668 1 1  44 ASN H    H -24.738   6.756  19.110 1.00 . A A .  44 ASN H    1 1 
        1   669 1 1  44 ASN HA   H -24.662   6.002  21.950 1.00 . A A .  44 ASN HA   1 1 
        1   670 1 1  44 ASN HB2  H -23.697   4.447  19.584 1.00 . A A .  44 ASN HB2  1 1 
        1   671 1 1  44 ASN HB3  H -22.806   4.331  21.098 1.00 . A A .  44 ASN HB3  1 1 
        1   672 1 1  44 ASN HD21 H -23.306   2.324  21.731 1.00 . A A .  44 ASN HD21 1 1 
        1   673 1 1  44 ASN HD22 H -24.909   1.759  22.042 1.00 . A A .  44 ASN HD22 1 1 
        1   674 1 1  44 ASN N    N -25.081   6.514  19.995 1.00 . A A .  44 ASN N    1 1 
        1   675 1 1  44 ASN ND2  N -24.280   2.429  21.701 1.00 . A A .  44 ASN ND2  1 1 
        1   676 1 1  44 ASN O    O -22.435   7.393  20.085 1.00 . A A .  44 ASN O    1 1 
        1   677 1 1  44 ASN OD1  O -25.984   3.759  21.092 1.00 . A A .  44 ASN OD1  1 1 
        1   678 1 1  45 GLY C    C -20.126   7.084  23.304 1.00 . A A .  45 GLY C    1 1 
        1   679 1 1  45 GLY CA   C -21.191   7.808  22.501 1.00 . A A .  45 GLY CA   1 1 
        1   680 1 1  45 GLY H    H -22.801   6.553  23.064 1.00 . A A .  45 GLY H    1 1 
        1   681 1 1  45 GLY HA2  H -20.782   8.073  21.538 1.00 . A A .  45 GLY HA2  1 1 
        1   682 1 1  45 GLY HA3  H -21.467   8.712  23.024 1.00 . A A .  45 GLY HA3  1 1 
        1   683 1 1  45 GLY N    N -22.380   7.001  22.300 1.00 . A A .  45 GLY N    1 1 
        1   684 1 1  45 GLY O    O -19.801   7.494  24.418 1.00 . A A .  45 GLY O    1 1 
        1   685 1 1  46 PRO C    C -17.352   6.092  23.896 1.00 . A A .  46 PRO C    1 1 
        1   686 1 1  46 PRO CA   C -18.518   5.220  23.444 1.00 . A A .  46 PRO CA   1 1 
        1   687 1 1  46 PRO CB   C -18.057   4.219  22.380 1.00 . A A .  46 PRO CB   1 1 
        1   688 1 1  46 PRO CD   C -19.883   5.435  21.434 1.00 . A A .  46 PRO CD   1 1 
        1   689 1 1  46 PRO CG   C -19.215   4.089  21.453 1.00 . A A .  46 PRO CG   1 1 
        1   690 1 1  46 PRO HA   H -18.918   4.687  24.294 1.00 . A A .  46 PRO HA   1 1 
        1   691 1 1  46 PRO HB2  H -17.185   4.606  21.873 1.00 . A A .  46 PRO HB2  1 1 
        1   692 1 1  46 PRO HB3  H -17.819   3.276  22.849 1.00 . A A .  46 PRO HB3  1 1 
        1   693 1 1  46 PRO HD2  H -19.473   6.048  20.644 1.00 . A A .  46 PRO HD2  1 1 
        1   694 1 1  46 PRO HD3  H -20.950   5.325  21.313 1.00 . A A .  46 PRO HD3  1 1 
        1   695 1 1  46 PRO HG2  H -18.866   3.828  20.465 1.00 . A A .  46 PRO HG2  1 1 
        1   696 1 1  46 PRO HG3  H -19.897   3.337  21.822 1.00 . A A .  46 PRO HG3  1 1 
        1   697 1 1  46 PRO N    N -19.558   5.995  22.758 1.00 . A A .  46 PRO N    1 1 
        1   698 1 1  46 PRO O    O -17.401   7.317  23.786 1.00 . A A .  46 PRO O    1 1 
        1   699 1 1  47 THR C    C -13.852   5.601  24.254 1.00 . A A .  47 THR C    1 1 
        1   700 1 1  47 THR CA   C -15.124   6.172  24.873 1.00 . A A .  47 THR CA   1 1 
        1   701 1 1  47 THR CB   C -15.036   6.107  26.399 1.00 . A A .  47 THR CB   1 1 
        1   702 1 1  47 THR CG2  C -14.487   7.373  27.021 1.00 . A A .  47 THR CG2  1 1 
        1   703 1 1  47 THR H    H -16.323   4.475  24.466 1.00 . A A .  47 THR H    1 1 
        1   704 1 1  47 THR HA   H -15.225   7.204  24.572 1.00 . A A .  47 THR HA   1 1 
        1   705 1 1  47 THR HB   H -14.382   5.292  26.676 1.00 . A A .  47 THR HB   1 1 
        1   706 1 1  47 THR HG1  H -16.212   5.632  27.891 1.00 . A A .  47 THR HG1  1 1 
        1   707 1 1  47 THR HG21 H -13.609   7.136  27.604 1.00 . A A .  47 THR HG21 1 1 
        1   708 1 1  47 THR HG22 H -15.237   7.813  27.662 1.00 . A A .  47 THR HG22 1 1 
        1   709 1 1  47 THR HG23 H -14.224   8.073  26.242 1.00 . A A .  47 THR HG23 1 1 
        1   710 1 1  47 THR N    N -16.303   5.453  24.405 1.00 . A A .  47 THR N    1 1 
        1   711 1 1  47 THR O    O -12.768   5.716  24.827 1.00 . A A .  47 THR O    1 1 
        1   712 1 1  47 THR OG1  O -16.311   5.867  26.966 1.00 . A A .  47 THR OG1  1 1 
        1   713 1 1  48 ARG C    C -12.963   4.604  20.883 1.00 . A A .  48 ARG C    1 1 
        1   714 1 1  48 ARG CA   C -12.848   4.400  22.390 1.00 . A A .  48 ARG CA   1 1 
        1   715 1 1  48 ARG CB   C -12.744   2.907  22.707 1.00 . A A .  48 ARG CB   1 1 
        1   716 1 1  48 ARG CD   C -11.703   1.543  24.545 1.00 . A A .  48 ARG CD   1 1 
        1   717 1 1  48 ARG CG   C -12.739   2.599  24.196 1.00 . A A .  48 ARG CG   1 1 
        1   718 1 1  48 ARG CZ   C -10.643   0.677  26.594 1.00 . A A .  48 ARG CZ   1 1 
        1   719 1 1  48 ARG H    H -14.878   4.928  22.675 1.00 . A A .  48 ARG H    1 1 
        1   720 1 1  48 ARG HA   H -11.956   4.897  22.741 1.00 . A A .  48 ARG HA   1 1 
        1   721 1 1  48 ARG HB2  H -13.584   2.397  22.259 1.00 . A A .  48 ARG HB2  1 1 
        1   722 1 1  48 ARG HB3  H -11.830   2.523  22.278 1.00 . A A .  48 ARG HB3  1 1 
        1   723 1 1  48 ARG HD2  H -11.943   0.632  24.016 1.00 . A A .  48 ARG HD2  1 1 
        1   724 1 1  48 ARG HD3  H -10.731   1.894  24.231 1.00 . A A .  48 ARG HD3  1 1 
        1   725 1 1  48 ARG HE   H -12.447   1.526  26.510 1.00 . A A .  48 ARG HE   1 1 
        1   726 1 1  48 ARG HG2  H -12.513   3.503  24.740 1.00 . A A .  48 ARG HG2  1 1 
        1   727 1 1  48 ARG HG3  H -13.717   2.240  24.482 1.00 . A A .  48 ARG HG3  1 1 
        1   728 1 1  48 ARG HH11 H  -9.525   0.468  24.921 1.00 . A A .  48 ARG HH11 1 1 
        1   729 1 1  48 ARG HH12 H  -8.803  -0.132  26.376 1.00 . A A .  48 ARG HH12 1 1 
        1   730 1 1  48 ARG HH21 H -11.498   0.737  28.424 1.00 . A A .  48 ARG HH21 1 1 
        1   731 1 1  48 ARG HH22 H  -9.923   0.020  28.365 1.00 . A A .  48 ARG HH22 1 1 
        1   732 1 1  48 ARG N    N -13.989   4.987  23.083 1.00 . A A .  48 ARG N    1 1 
        1   733 1 1  48 ARG NE   N -11.667   1.263  25.978 1.00 . A A .  48 ARG NE   1 1 
        1   734 1 1  48 ARG NH1  N  -9.569   0.307  25.907 1.00 . A A .  48 ARG NH1  1 1 
        1   735 1 1  48 ARG NH2  N -10.692   0.460  27.902 1.00 . A A .  48 ARG NH2  1 1 
        1   736 1 1  48 ARG O    O -13.838   4.029  20.234 1.00 . A A .  48 ARG O    1 1 
        1   737 1 1  49 ASN C    C -11.035   4.851  18.180 1.00 . A A .  49 ASN C    1 1 
        1   738 1 1  49 ASN CA   C -12.077   5.702  18.900 1.00 . A A .  49 ASN CA   1 1 
        1   739 1 1  49 ASN CB   C -11.808   7.187  18.647 1.00 . A A .  49 ASN CB   1 1 
        1   740 1 1  49 ASN CG   C -13.044   8.041  18.855 1.00 . A A .  49 ASN CG   1 1 
        1   741 1 1  49 ASN H    H -11.401   5.852  20.901 1.00 . A A .  49 ASN H    1 1 
        1   742 1 1  49 ASN HA   H -13.055   5.452  18.516 1.00 . A A .  49 ASN HA   1 1 
        1   743 1 1  49 ASN HB2  H -11.040   7.528  19.325 1.00 . A A .  49 ASN HB2  1 1 
        1   744 1 1  49 ASN HB3  H -11.469   7.317  17.630 1.00 . A A .  49 ASN HB3  1 1 
        1   745 1 1  49 ASN HD21 H -12.738   8.949  17.112 1.00 . A A .  49 ASN HD21 1 1 
        1   746 1 1  49 ASN HD22 H -14.124   9.474  17.999 1.00 . A A .  49 ASN HD22 1 1 
        1   747 1 1  49 ASN N    N -12.075   5.424  20.332 1.00 . A A .  49 ASN N    1 1 
        1   748 1 1  49 ASN ND2  N -13.331   8.909  17.891 1.00 . A A .  49 ASN ND2  1 1 
        1   749 1 1  49 ASN O    O -10.131   5.375  17.527 1.00 . A A .  49 ASN O    1 1 
        1   750 1 1  49 ASN OD1  O -13.732   7.922  19.868 1.00 . A A .  49 ASN OD1  1 1 
        1   751 1 1  50 ASP C    C -10.509   2.509  16.169 1.00 . A A .  50 ASP C    1 1 
        1   752 1 1  50 ASP CA   C -10.237   2.609  17.666 1.00 . A A .  50 ASP CA   1 1 
        1   753 1 1  50 ASP CB   C -10.340   1.225  18.308 1.00 . A A .  50 ASP CB   1 1 
        1   754 1 1  50 ASP CG   C  -9.770   1.195  19.712 1.00 . A A .  50 ASP CG   1 1 
        1   755 1 1  50 ASP H    H -11.906   3.176  18.837 1.00 . A A .  50 ASP H    1 1 
        1   756 1 1  50 ASP HA   H  -9.237   2.990  17.813 1.00 . A A .  50 ASP HA   1 1 
        1   757 1 1  50 ASP HB2  H -11.379   0.934  18.356 1.00 . A A .  50 ASP HB2  1 1 
        1   758 1 1  50 ASP HB3  H  -9.799   0.513  17.703 1.00 . A A .  50 ASP HB3  1 1 
        1   759 1 1  50 ASP N    N -11.166   3.534  18.304 1.00 . A A .  50 ASP N    1 1 
        1   760 1 1  50 ASP O    O -11.278   1.658  15.723 1.00 . A A .  50 ASP O    1 1 
        1   761 1 1  50 ASP OD1  O  -8.836   1.976  19.991 1.00 . A A .  50 ASP OD1  1 1 
        1   762 1 1  50 ASP OD2  O -10.256   0.389  20.534 1.00 . A A .  50 ASP OD2  1 1 
        1   763 1 1  51 GLN C    C  -8.696   3.297  13.242 1.00 . A A .  51 GLN C    1 1 
        1   764 1 1  51 GLN CA   C -10.044   3.393  13.949 1.00 . A A .  51 GLN CA   1 1 
        1   765 1 1  51 GLN CB   C -10.774   4.664  13.510 1.00 . A A .  51 GLN CB   1 1 
        1   766 1 1  51 GLN CD   C -12.984   5.749  12.945 1.00 . A A .  51 GLN CD   1 1 
        1   767 1 1  51 GLN CG   C -12.287   4.524  13.504 1.00 . A A .  51 GLN CG   1 1 
        1   768 1 1  51 GLN H    H  -9.271   4.038  15.812 1.00 . A A .  51 GLN H    1 1 
        1   769 1 1  51 GLN HA   H -10.640   2.535  13.680 1.00 . A A .  51 GLN HA   1 1 
        1   770 1 1  51 GLN HB2  H -10.511   5.467  14.182 1.00 . A A .  51 GLN HB2  1 1 
        1   771 1 1  51 GLN HB3  H -10.454   4.922  12.511 1.00 . A A .  51 GLN HB3  1 1 
        1   772 1 1  51 GLN HE21 H -13.314   6.430  14.784 1.00 . A A .  51 GLN HE21 1 1 
        1   773 1 1  51 GLN HE22 H -13.902   7.424  13.499 1.00 . A A .  51 GLN HE22 1 1 
        1   774 1 1  51 GLN HG2  H -12.555   3.670  12.899 1.00 . A A .  51 GLN HG2  1 1 
        1   775 1 1  51 GLN HG3  H -12.625   4.366  14.518 1.00 . A A .  51 GLN HG3  1 1 
        1   776 1 1  51 GLN N    N  -9.872   3.384  15.397 1.00 . A A .  51 GLN N    1 1 
        1   777 1 1  51 GLN NE2  N -13.446   6.622  13.832 1.00 . A A .  51 GLN NE2  1 1 
        1   778 1 1  51 GLN O    O  -8.020   4.305  13.034 1.00 . A A .  51 GLN O    1 1 
        1   779 1 1  51 GLN OE1  O -13.105   5.908  11.731 1.00 . A A .  51 GLN OE1  1 1 
        1   780 1 1  52 LEU C    C  -7.229   0.958  10.972 1.00 . A A .  52 LEU C    1 1 
        1   781 1 1  52 LEU CA   C  -7.042   1.853  12.193 1.00 . A A .  52 LEU CA   1 1 
        1   782 1 1  52 LEU CB   C  -6.030   1.221  13.151 1.00 . A A .  52 LEU CB   1 1 
        1   783 1 1  52 LEU CD1  C  -4.596   3.274  13.248 1.00 . A A .  52 LEU CD1  1 1 
        1   784 1 1  52 LEU CD2  C  -6.276   2.840  15.049 1.00 . A A .  52 LEU CD2  1 1 
        1   785 1 1  52 LEU CG   C  -5.302   2.205  14.067 1.00 . A A .  52 LEU CG   1 1 
        1   786 1 1  52 LEU H    H  -8.892   1.315  13.070 1.00 . A A .  52 LEU H    1 1 
        1   787 1 1  52 LEU HA   H  -6.665   2.811  11.868 1.00 . A A .  52 LEU HA   1 1 
        1   788 1 1  52 LEU HB2  H  -6.551   0.503  13.769 1.00 . A A .  52 LEU HB2  1 1 
        1   789 1 1  52 LEU HB3  H  -5.291   0.695  12.565 1.00 . A A .  52 LEU HB3  1 1 
        1   790 1 1  52 LEU HD11 H  -3.811   3.721  13.839 1.00 . A A .  52 LEU HD11 1 1 
        1   791 1 1  52 LEU HD12 H  -5.307   4.035  12.959 1.00 . A A .  52 LEU HD12 1 1 
        1   792 1 1  52 LEU HD13 H  -4.170   2.826  12.363 1.00 . A A .  52 LEU HD13 1 1 
        1   793 1 1  52 LEU HD21 H  -5.796   2.955  16.009 1.00 . A A .  52 LEU HD21 1 1 
        1   794 1 1  52 LEU HD22 H  -7.145   2.207  15.154 1.00 . A A .  52 LEU HD22 1 1 
        1   795 1 1  52 LEU HD23 H  -6.579   3.809  14.680 1.00 . A A .  52 LEU HD23 1 1 
        1   796 1 1  52 LEU HG   H  -4.553   1.672  14.635 1.00 . A A .  52 LEU HG   1 1 
        1   797 1 1  52 LEU N    N  -8.310   2.079  12.876 1.00 . A A .  52 LEU N    1 1 
        1   798 1 1  52 LEU O    O  -7.756  -0.149  11.077 1.00 . A A .  52 LEU O    1 1 
        1   799 1 1  53 GLY C    C  -5.570   0.248   8.041 1.00 . A A .  53 GLY C    1 1 
        1   800 1 1  53 GLY CA   C  -6.916   0.677   8.591 1.00 . A A .  53 GLY CA   1 1 
        1   801 1 1  53 GLY H    H  -6.377   2.333   9.795 1.00 . A A .  53 GLY H    1 1 
        1   802 1 1  53 GLY HA2  H  -7.510  -0.203   8.788 1.00 . A A .  53 GLY HA2  1 1 
        1   803 1 1  53 GLY HA3  H  -7.419   1.281   7.850 1.00 . A A .  53 GLY HA3  1 1 
        1   804 1 1  53 GLY N    N  -6.791   1.445   9.816 1.00 . A A .  53 GLY N    1 1 
        1   805 1 1  53 GLY O    O  -4.649   1.059   7.936 1.00 . A A .  53 GLY O    1 1 
        1   806 1 1  54 ALA C    C  -4.276  -1.666   5.630 1.00 . A A .  54 ALA C    1 1 
        1   807 1 1  54 ALA CA   C  -4.211  -1.563   7.148 1.00 . A A .  54 ALA CA   1 1 
        1   808 1 1  54 ALA CB   C  -3.910  -2.923   7.759 1.00 . A A .  54 ALA CB   1 1 
        1   809 1 1  54 ALA H    H  -6.226  -1.629   7.794 1.00 . A A .  54 ALA H    1 1 
        1   810 1 1  54 ALA HA   H  -3.413  -0.888   7.419 1.00 . A A .  54 ALA HA   1 1 
        1   811 1 1  54 ALA HB1  H  -3.286  -2.796   8.631 1.00 . A A .  54 ALA HB1  1 1 
        1   812 1 1  54 ALA HB2  H  -3.394  -3.537   7.035 1.00 . A A .  54 ALA HB2  1 1 
        1   813 1 1  54 ALA HB3  H  -4.834  -3.403   8.043 1.00 . A A .  54 ALA HB3  1 1 
        1   814 1 1  54 ALA N    N  -5.455  -1.030   7.689 1.00 . A A .  54 ALA N    1 1 
        1   815 1 1  54 ALA O    O  -5.329  -1.960   5.063 1.00 . A A .  54 ALA O    1 1 
        1   816 1 1  55 GLY C    C  -1.767  -1.950   2.995 1.00 . A A .  55 GLY C    1 1 
        1   817 1 1  55 GLY CA   C  -3.109  -1.488   3.527 1.00 . A A .  55 GLY CA   1 1 
        1   818 1 1  55 GLY H    H  -2.338  -1.187   5.475 1.00 . A A .  55 GLY H    1 1 
        1   819 1 1  55 GLY HA2  H  -3.870  -2.176   3.193 1.00 . A A .  55 GLY HA2  1 1 
        1   820 1 1  55 GLY HA3  H  -3.324  -0.509   3.125 1.00 . A A .  55 GLY HA3  1 1 
        1   821 1 1  55 GLY N    N  -3.148  -1.419   4.974 1.00 . A A .  55 GLY N    1 1 
        1   822 1 1  55 GLY O    O  -0.736  -1.339   3.274 1.00 . A A .  55 GLY O    1 1 
        1   823 1 1  56 ALA C    C  -0.358  -3.027   0.225 1.00 . A A .  56 ALA C    1 1 
        1   824 1 1  56 ALA CA   C  -0.559  -3.568   1.635 1.00 . A A .  56 ALA CA   1 1 
        1   825 1 1  56 ALA CB   C  -0.604  -5.090   1.624 1.00 . A A .  56 ALA CB   1 1 
        1   826 1 1  56 ALA H    H  -2.636  -3.468   2.027 1.00 . A A .  56 ALA H    1 1 
        1   827 1 1  56 ALA HA   H   0.272  -3.258   2.253 1.00 . A A .  56 ALA HA   1 1 
        1   828 1 1  56 ALA HB1  H  -1.589  -5.422   1.917 1.00 . A A .  56 ALA HB1  1 1 
        1   829 1 1  56 ALA HB2  H   0.127  -5.477   2.317 1.00 . A A .  56 ALA HB2  1 1 
        1   830 1 1  56 ALA HB3  H  -0.384  -5.451   0.630 1.00 . A A .  56 ALA HB3  1 1 
        1   831 1 1  56 ALA N    N  -1.781  -3.029   2.218 1.00 . A A .  56 ALA N    1 1 
        1   832 1 1  56 ALA O    O  -1.247  -3.131  -0.619 1.00 . A A .  56 ALA O    1 1 
        1   833 1 1  57 PHE C    C   2.253  -2.605  -2.015 1.00 . A A .  57 PHE C    1 1 
        1   834 1 1  57 PHE CA   C   1.104  -1.870  -1.334 1.00 . A A .  57 PHE CA   1 1 
        1   835 1 1  57 PHE CB   C   1.446  -0.385  -1.199 1.00 . A A .  57 PHE CB   1 1 
        1   836 1 1  57 PHE CD1  C  -0.905   0.383  -0.770 1.00 . A A .  57 PHE CD1  1 1 
        1   837 1 1  57 PHE CD2  C   0.382   1.536  -2.413 1.00 . A A .  57 PHE CD2  1 1 
        1   838 1 1  57 PHE CE1  C  -1.975   1.224  -1.013 1.00 . A A .  57 PHE CE1  1 1 
        1   839 1 1  57 PHE CE2  C  -0.684   2.380  -2.661 1.00 . A A .  57 PHE CE2  1 1 
        1   840 1 1  57 PHE CG   C   0.284   0.529  -1.467 1.00 . A A .  57 PHE CG   1 1 
        1   841 1 1  57 PHE CZ   C  -1.864   2.223  -1.960 1.00 . A A .  57 PHE CZ   1 1 
        1   842 1 1  57 PHE H    H   1.476  -2.375   0.689 1.00 . A A .  57 PHE H    1 1 
        1   843 1 1  57 PHE HA   H   0.219  -1.968  -1.946 1.00 . A A .  57 PHE HA   1 1 
        1   844 1 1  57 PHE HB2  H   1.793  -0.195  -0.196 1.00 . A A .  57 PHE HB2  1 1 
        1   845 1 1  57 PHE HB3  H   2.232  -0.138  -1.899 1.00 . A A .  57 PHE HB3  1 1 
        1   846 1 1  57 PHE HD1  H  -0.993  -0.398  -0.029 1.00 . A A .  57 PHE HD1  1 1 
        1   847 1 1  57 PHE HD2  H   1.304   1.660  -2.962 1.00 . A A .  57 PHE HD2  1 1 
        1   848 1 1  57 PHE HE1  H  -2.896   1.099  -0.464 1.00 . A A .  57 PHE HE1  1 1 
        1   849 1 1  57 PHE HE2  H  -0.595   3.161  -3.402 1.00 . A A .  57 PHE HE2  1 1 
        1   850 1 1  57 PHE HZ   H  -2.698   2.882  -2.152 1.00 . A A .  57 PHE HZ   1 1 
        1   851 1 1  57 PHE N    N   0.806  -2.437  -0.024 1.00 . A A .  57 PHE N    1 1 
        1   852 1 1  57 PHE O    O   3.190  -3.063  -1.361 1.00 . A A .  57 PHE O    1 1 
        1   853 1 1  58 GLY C    C   3.426  -2.702  -5.449 1.00 . A A .  58 GLY C    1 1 
        1   854 1 1  58 GLY CA   C   3.208  -3.367  -4.105 1.00 . A A .  58 GLY CA   1 1 
        1   855 1 1  58 GLY H    H   1.403  -2.309  -3.799 1.00 . A A .  58 GLY H    1 1 
        1   856 1 1  58 GLY HA2  H   4.132  -3.343  -3.546 1.00 . A A .  58 GLY HA2  1 1 
        1   857 1 1  58 GLY HA3  H   2.920  -4.396  -4.266 1.00 . A A .  58 GLY HA3  1 1 
        1   858 1 1  58 GLY N    N   2.173  -2.702  -3.337 1.00 . A A .  58 GLY N    1 1 
        1   859 1 1  58 GLY O    O   2.483  -2.534  -6.223 1.00 . A A .  58 GLY O    1 1 
        1   860 1 1  59 GLY C    C   6.037  -2.364  -7.784 1.00 . A A .  59 GLY C    1 1 
        1   861 1 1  59 GLY CA   C   4.964  -1.653  -6.984 1.00 . A A .  59 GLY CA   1 1 
        1   862 1 1  59 GLY H    H   5.377  -2.461  -5.070 1.00 . A A .  59 GLY H    1 1 
        1   863 1 1  59 GLY HA2  H   4.063  -1.609  -7.576 1.00 . A A .  59 GLY HA2  1 1 
        1   864 1 1  59 GLY HA3  H   5.294  -0.645  -6.779 1.00 . A A .  59 GLY HA3  1 1 
        1   865 1 1  59 GLY N    N   4.665  -2.310  -5.726 1.00 . A A .  59 GLY N    1 1 
        1   866 1 1  59 GLY O    O   6.959  -2.952  -7.219 1.00 . A A .  59 GLY O    1 1 
        1   867 1 1  60 TYR C    C   6.926  -2.225 -11.344 1.00 . A A .  60 TYR C    1 1 
        1   868 1 1  60 TYR CA   C   6.883  -2.937  -9.996 1.00 . A A .  60 TYR CA   1 1 
        1   869 1 1  60 TYR CB   C   6.539  -4.415 -10.192 1.00 . A A .  60 TYR CB   1 1 
        1   870 1 1  60 TYR CD1  C   4.048  -4.776 -10.001 1.00 . A A .  60 TYR CD1  1 1 
        1   871 1 1  60 TYR CD2  C   5.017  -4.749 -12.179 1.00 . A A .  60 TYR CD2  1 1 
        1   872 1 1  60 TYR CE1  C   2.801  -4.994 -10.555 1.00 . A A .  60 TYR CE1  1 1 
        1   873 1 1  60 TYR CE2  C   3.773  -4.966 -12.740 1.00 . A A .  60 TYR CE2  1 1 
        1   874 1 1  60 TYR CG   C   5.176  -4.650 -10.802 1.00 . A A .  60 TYR CG   1 1 
        1   875 1 1  60 TYR CZ   C   2.668  -5.088 -11.924 1.00 . A A .  60 TYR CZ   1 1 
        1   876 1 1  60 TYR H    H   5.160  -1.815  -9.495 1.00 . A A .  60 TYR H    1 1 
        1   877 1 1  60 TYR HA   H   7.855  -2.862  -9.533 1.00 . A A .  60 TYR HA   1 1 
        1   878 1 1  60 TYR HB2  H   7.274  -4.865 -10.843 1.00 . A A .  60 TYR HB2  1 1 
        1   879 1 1  60 TYR HB3  H   6.564  -4.912  -9.233 1.00 . A A .  60 TYR HB3  1 1 
        1   880 1 1  60 TYR HD1  H   4.155  -4.701  -8.929 1.00 . A A .  60 TYR HD1  1 1 
        1   881 1 1  60 TYR HD2  H   5.885  -4.654 -12.816 1.00 . A A .  60 TYR HD2  1 1 
        1   882 1 1  60 TYR HE1  H   1.936  -5.088  -9.915 1.00 . A A .  60 TYR HE1  1 1 
        1   883 1 1  60 TYR HE2  H   3.670  -5.040 -13.813 1.00 . A A .  60 TYR HE2  1 1 
        1   884 1 1  60 TYR HH   H   1.339  -4.780 -13.278 1.00 . A A .  60 TYR HH   1 1 
        1   885 1 1  60 TYR N    N   5.917  -2.303  -9.107 1.00 . A A .  60 TYR N    1 1 
        1   886 1 1  60 TYR O    O   5.896  -2.045 -11.997 1.00 . A A .  60 TYR O    1 1 
        1   887 1 1  60 TYR OH   O   1.428  -5.304 -12.478 1.00 . A A .  60 TYR OH   1 1 
        1   888 1 1  61 GLN C    C   8.722  -2.086 -14.121 1.00 . A A .  61 GLN C    1 1 
        1   889 1 1  61 GLN CA   C   8.304  -1.117 -13.019 1.00 . A A .  61 GLN CA   1 1 
        1   890 1 1  61 GLN CB   C   9.350  -0.010 -12.868 1.00 . A A .  61 GLN CB   1 1 
        1   891 1 1  61 GLN CD   C   9.347   2.482 -12.453 1.00 . A A .  61 GLN CD   1 1 
        1   892 1 1  61 GLN CG   C   8.867   1.351 -13.342 1.00 . A A .  61 GLN CG   1 1 
        1   893 1 1  61 GLN H    H   8.904  -1.986 -11.184 1.00 . A A .  61 GLN H    1 1 
        1   894 1 1  61 GLN HA   H   7.359  -0.672 -13.289 1.00 . A A .  61 GLN HA   1 1 
        1   895 1 1  61 GLN HB2  H   9.622   0.072 -11.826 1.00 . A A .  61 GLN HB2  1 1 
        1   896 1 1  61 GLN HB3  H  10.227  -0.275 -13.440 1.00 . A A .  61 GLN HB3  1 1 
        1   897 1 1  61 GLN HE21 H   8.732   3.824 -13.786 1.00 . A A .  61 GLN HE21 1 1 
        1   898 1 1  61 GLN HE22 H   9.463   4.465 -12.358 1.00 . A A .  61 GLN HE22 1 1 
        1   899 1 1  61 GLN HG2  H   9.233   1.521 -14.343 1.00 . A A .  61 GLN HG2  1 1 
        1   900 1 1  61 GLN HG3  H   7.787   1.353 -13.349 1.00 . A A .  61 GLN HG3  1 1 
        1   901 1 1  61 GLN N    N   8.123  -1.816 -11.752 1.00 . A A .  61 GLN N    1 1 
        1   902 1 1  61 GLN NE2  N   9.162   3.715 -12.912 1.00 . A A .  61 GLN NE2  1 1 
        1   903 1 1  61 GLN O    O   9.565  -2.958 -13.909 1.00 . A A .  61 GLN O    1 1 
        1   904 1 1  61 GLN OE1  O   9.878   2.251 -11.367 1.00 . A A .  61 GLN OE1  1 1 
        1   905 1 1  62 VAL C    C   9.171  -2.011 -17.526 1.00 . A A .  62 VAL C    1 1 
        1   906 1 1  62 VAL CA   C   8.439  -2.786 -16.435 1.00 . A A .  62 VAL CA   1 1 
        1   907 1 1  62 VAL CB   C   7.164  -3.414 -17.031 1.00 . A A .  62 VAL CB   1 1 
        1   908 1 1  62 VAL CG1  C   7.514  -4.386 -18.148 1.00 . A A .  62 VAL CG1  1 1 
        1   909 1 1  62 VAL CG2  C   6.355  -4.108 -15.946 1.00 . A A .  62 VAL CG2  1 1 
        1   910 1 1  62 VAL H    H   7.464  -1.211 -15.407 1.00 . A A .  62 VAL H    1 1 
        1   911 1 1  62 VAL HA   H   9.077  -3.583 -16.084 1.00 . A A .  62 VAL HA   1 1 
        1   912 1 1  62 VAL HB   H   6.559  -2.622 -17.450 1.00 . A A .  62 VAL HB   1 1 
        1   913 1 1  62 VAL HG11 H   7.967  -5.270 -17.727 1.00 . A A .  62 VAL HG11 1 1 
        1   914 1 1  62 VAL HG12 H   8.207  -3.916 -18.830 1.00 . A A .  62 VAL HG12 1 1 
        1   915 1 1  62 VAL HG13 H   6.616  -4.661 -18.681 1.00 . A A .  62 VAL HG13 1 1 
        1   916 1 1  62 VAL HG21 H   5.321  -4.172 -16.253 1.00 . A A .  62 VAL HG21 1 1 
        1   917 1 1  62 VAL HG22 H   6.424  -3.544 -15.028 1.00 . A A .  62 VAL HG22 1 1 
        1   918 1 1  62 VAL HG23 H   6.746  -5.103 -15.788 1.00 . A A .  62 VAL HG23 1 1 
        1   919 1 1  62 VAL N    N   8.128  -1.926 -15.299 1.00 . A A .  62 VAL N    1 1 
        1   920 1 1  62 VAL O    O   9.982  -2.573 -18.263 1.00 . A A .  62 VAL O    1 1 
        1   921 1 1  63 ASN C    C   9.911   1.477 -18.020 1.00 . A A .  63 ASN C    1 1 
        1   922 1 1  63 ASN CA   C   9.514   0.133 -18.624 1.00 . A A .  63 ASN CA   1 1 
        1   923 1 1  63 ASN CB   C   8.570   0.351 -19.807 1.00 . A A .  63 ASN CB   1 1 
        1   924 1 1  63 ASN CG   C   8.438  -0.883 -20.678 1.00 . A A .  63 ASN CG   1 1 
        1   925 1 1  63 ASN H    H   8.227  -0.327 -17.008 1.00 . A A .  63 ASN H    1 1 
        1   926 1 1  63 ASN HA   H  10.404  -0.369 -18.972 1.00 . A A .  63 ASN HA   1 1 
        1   927 1 1  63 ASN HB2  H   7.590   0.612 -19.435 1.00 . A A .  63 ASN HB2  1 1 
        1   928 1 1  63 ASN HB3  H   8.946   1.160 -20.416 1.00 . A A .  63 ASN HB3  1 1 
        1   929 1 1  63 ASN HD21 H  10.185  -0.490 -21.543 1.00 . A A .  63 ASN HD21 1 1 
        1   930 1 1  63 ASN HD22 H   9.373  -1.909 -22.101 1.00 . A A .  63 ASN HD22 1 1 
        1   931 1 1  63 ASN N    N   8.882  -0.718 -17.623 1.00 . A A .  63 ASN N    1 1 
        1   932 1 1  63 ASN ND2  N   9.433  -1.118 -21.526 1.00 . A A .  63 ASN ND2  1 1 
        1   933 1 1  63 ASN O    O   9.308   1.932 -17.048 1.00 . A A .  63 ASN O    1 1 
        1   934 1 1  63 ASN OD1  O   7.455  -1.618 -20.588 1.00 . A A .  63 ASN OD1  1 1 
        1   935 1 1  64 PRO C    C  10.395   4.546 -18.342 1.00 . A A .  64 PRO C    1 1 
        1   936 1 1  64 PRO CA   C  11.410   3.433 -18.103 1.00 . A A .  64 PRO CA   1 1 
        1   937 1 1  64 PRO CB   C  12.681   3.680 -18.921 1.00 . A A .  64 PRO CB   1 1 
        1   938 1 1  64 PRO CD   C  11.710   1.662 -19.753 1.00 . A A .  64 PRO CD   1 1 
        1   939 1 1  64 PRO CG   C  12.496   2.877 -20.161 1.00 . A A .  64 PRO CG   1 1 
        1   940 1 1  64 PRO HA   H  11.657   3.394 -17.052 1.00 . A A .  64 PRO HA   1 1 
        1   941 1 1  64 PRO HB2  H  12.771   4.734 -19.141 1.00 . A A .  64 PRO HB2  1 1 
        1   942 1 1  64 PRO HB3  H  13.543   3.348 -18.361 1.00 . A A .  64 PRO HB3  1 1 
        1   943 1 1  64 PRO HD2  H  11.055   1.351 -20.553 1.00 . A A .  64 PRO HD2  1 1 
        1   944 1 1  64 PRO HD3  H  12.375   0.859 -19.473 1.00 . A A .  64 PRO HD3  1 1 
        1   945 1 1  64 PRO HG2  H  11.947   3.452 -20.892 1.00 . A A .  64 PRO HG2  1 1 
        1   946 1 1  64 PRO HG3  H  13.458   2.585 -20.557 1.00 . A A .  64 PRO HG3  1 1 
        1   947 1 1  64 PRO N    N  10.936   2.134 -18.590 1.00 . A A .  64 PRO N    1 1 
        1   948 1 1  64 PRO O    O  10.656   5.489 -19.089 1.00 . A A .  64 PRO O    1 1 
        1   949 1 1  65 TYR C    C   7.270   5.438 -16.625 1.00 . A A .  65 TYR C    1 1 
        1   950 1 1  65 TYR CA   C   8.180   5.424 -17.850 1.00 . A A .  65 TYR CA   1 1 
        1   951 1 1  65 TYR CB   C   7.356   5.146 -19.110 1.00 . A A .  65 TYR CB   1 1 
        1   952 1 1  65 TYR CD1  C   6.668   7.557 -19.403 1.00 . A A .  65 TYR CD1  1 1 
        1   953 1 1  65 TYR CD2  C   7.365   6.344 -21.333 1.00 . A A .  65 TYR CD2  1 1 
        1   954 1 1  65 TYR CE1  C   6.456   8.680 -20.180 1.00 . A A .  65 TYR CE1  1 1 
        1   955 1 1  65 TYR CE2  C   7.156   7.462 -22.117 1.00 . A A .  65 TYR CE2  1 1 
        1   956 1 1  65 TYR CG   C   7.126   6.372 -19.965 1.00 . A A .  65 TYR CG   1 1 
        1   957 1 1  65 TYR CZ   C   6.701   8.627 -21.536 1.00 . A A .  65 TYR CZ   1 1 
        1   958 1 1  65 TYR H    H   9.085   3.653 -17.124 1.00 . A A .  65 TYR H    1 1 
        1   959 1 1  65 TYR HA   H   8.649   6.391 -17.945 1.00 . A A .  65 TYR HA   1 1 
        1   960 1 1  65 TYR HB2  H   7.872   4.414 -19.714 1.00 . A A .  65 TYR HB2  1 1 
        1   961 1 1  65 TYR HB3  H   6.391   4.753 -18.824 1.00 . A A .  65 TYR HB3  1 1 
        1   962 1 1  65 TYR HD1  H   6.477   7.595 -18.341 1.00 . A A .  65 TYR HD1  1 1 
        1   963 1 1  65 TYR HD2  H   7.721   5.429 -21.785 1.00 . A A .  65 TYR HD2  1 1 
        1   964 1 1  65 TYR HE1  H   6.100   9.592 -19.725 1.00 . A A .  65 TYR HE1  1 1 
        1   965 1 1  65 TYR HE2  H   7.348   7.421 -23.179 1.00 . A A .  65 TYR HE2  1 1 
        1   966 1 1  65 TYR HH   H   5.631   9.683 -22.735 1.00 . A A .  65 TYR HH   1 1 
        1   967 1 1  65 TYR N    N   9.235   4.428 -17.705 1.00 . A A .  65 TYR N    1 1 
        1   968 1 1  65 TYR O    O   6.933   6.501 -16.104 1.00 . A A .  65 TYR O    1 1 
        1   969 1 1  65 TYR OH   O   6.492   9.743 -22.313 1.00 . A A .  65 TYR OH   1 1 
        1   970 1 1  66 LEU C    C   5.918   2.691 -14.533 1.00 . A A .  66 LEU C    1 1 
        1   971 1 1  66 LEU CA   C   6.000   4.137 -15.010 1.00 . A A .  66 LEU CA   1 1 
        1   972 1 1  66 LEU CB   C   4.600   4.655 -15.344 1.00 . A A .  66 LEU CB   1 1 
        1   973 1 1  66 LEU CD1  C   2.564   3.764 -16.511 1.00 . A A .  66 LEU CD1  1 1 
        1   974 1 1  66 LEU CD2  C   4.174   5.219 -17.752 1.00 . A A .  66 LEU CD2  1 1 
        1   975 1 1  66 LEU CG   C   4.025   4.157 -16.673 1.00 . A A .  66 LEU CG   1 1 
        1   976 1 1  66 LEU H    H   7.172   3.439 -16.629 1.00 . A A .  66 LEU H    1 1 
        1   977 1 1  66 LEU HA   H   6.418   4.741 -14.219 1.00 . A A .  66 LEU HA   1 1 
        1   978 1 1  66 LEU HB2  H   3.931   4.358 -14.550 1.00 . A A .  66 LEU HB2  1 1 
        1   979 1 1  66 LEU HB3  H   4.637   5.734 -15.376 1.00 . A A .  66 LEU HB3  1 1 
        1   980 1 1  66 LEU HD11 H   2.377   3.488 -15.483 1.00 . A A .  66 LEU HD11 1 1 
        1   981 1 1  66 LEU HD12 H   2.343   2.926 -17.155 1.00 . A A .  66 LEU HD12 1 1 
        1   982 1 1  66 LEU HD13 H   1.935   4.600 -16.779 1.00 . A A .  66 LEU HD13 1 1 
        1   983 1 1  66 LEU HD21 H   4.975   5.893 -17.486 1.00 . A A .  66 LEU HD21 1 1 
        1   984 1 1  66 LEU HD22 H   3.252   5.774 -17.842 1.00 . A A .  66 LEU HD22 1 1 
        1   985 1 1  66 LEU HD23 H   4.402   4.744 -18.695 1.00 . A A .  66 LEU HD23 1 1 
        1   986 1 1  66 LEU HG   H   4.572   3.280 -16.987 1.00 . A A .  66 LEU HG   1 1 
        1   987 1 1  66 LEU N    N   6.873   4.253 -16.172 1.00 . A A .  66 LEU N    1 1 
        1   988 1 1  66 LEU O    O   6.282   1.766 -15.259 1.00 . A A .  66 LEU O    1 1 
        1   989 1 1  67 GLY C    C   3.924   0.878 -12.236 1.00 . A A .  67 GLY C    1 1 
        1   990 1 1  67 GLY CA   C   5.318   1.166 -12.757 1.00 . A A .  67 GLY CA   1 1 
        1   991 1 1  67 GLY H    H   5.163   3.278 -12.773 1.00 . A A .  67 GLY H    1 1 
        1   992 1 1  67 GLY HA2  H   5.559   0.447 -13.526 1.00 . A A .  67 GLY HA2  1 1 
        1   993 1 1  67 GLY HA3  H   6.022   1.058 -11.945 1.00 . A A .  67 GLY HA3  1 1 
        1   994 1 1  67 GLY N    N   5.438   2.503 -13.308 1.00 . A A .  67 GLY N    1 1 
        1   995 1 1  67 GLY O    O   3.187   1.795 -11.876 1.00 . A A .  67 GLY O    1 1 
        1   996 1 1  68 PHE C    C   2.238  -0.885 -10.188 1.00 . A A .  68 PHE C    1 1 
        1   997 1 1  68 PHE CA   C   2.247  -0.805 -11.710 1.00 . A A .  68 PHE CA   1 1 
        1   998 1 1  68 PHE CB   C   1.852  -2.156 -12.310 1.00 . A A .  68 PHE CB   1 1 
        1   999 1 1  68 PHE CD1  C  -0.199  -1.317 -13.489 1.00 . A A .  68 PHE CD1  1 1 
        1  1000 1 1  68 PHE CD2  C   1.348  -2.653 -14.717 1.00 . A A .  68 PHE CD2  1 1 
        1  1001 1 1  68 PHE CE1  C  -1.000  -1.209 -14.610 1.00 . A A .  68 PHE CE1  1 1 
        1  1002 1 1  68 PHE CE2  C   0.551  -2.549 -15.841 1.00 . A A .  68 PHE CE2  1 1 
        1  1003 1 1  68 PHE CG   C   0.983  -2.040 -13.530 1.00 . A A .  68 PHE CG   1 1 
        1  1004 1 1  68 PHE CZ   C  -0.624  -1.825 -15.788 1.00 . A A .  68 PHE CZ   1 1 
        1  1005 1 1  68 PHE H    H   4.195  -1.087 -12.493 1.00 . A A .  68 PHE H    1 1 
        1  1006 1 1  68 PHE HA   H   1.533  -0.058 -12.024 1.00 . A A .  68 PHE HA   1 1 
        1  1007 1 1  68 PHE HB2  H   2.746  -2.692 -12.590 1.00 . A A .  68 PHE HB2  1 1 
        1  1008 1 1  68 PHE HB3  H   1.312  -2.727 -11.569 1.00 . A A .  68 PHE HB3  1 1 
        1  1009 1 1  68 PHE HD1  H  -0.493  -0.835 -12.569 1.00 . A A .  68 PHE HD1  1 1 
        1  1010 1 1  68 PHE HD2  H   2.267  -3.219 -14.760 1.00 . A A .  68 PHE HD2  1 1 
        1  1011 1 1  68 PHE HE1  H  -1.919  -0.643 -14.565 1.00 . A A .  68 PHE HE1  1 1 
        1  1012 1 1  68 PHE HE2  H   0.847  -3.032 -16.761 1.00 . A A .  68 PHE HE2  1 1 
        1  1013 1 1  68 PHE HZ   H  -1.249  -1.742 -16.665 1.00 . A A .  68 PHE HZ   1 1 
        1  1014 1 1  68 PHE N    N   3.562  -0.400 -12.194 1.00 . A A .  68 PHE N    1 1 
        1  1015 1 1  68 PHE O    O   3.216  -1.316  -9.577 1.00 . A A .  68 PHE O    1 1 
        1  1016 1 1  69 GLU C    C  -0.239  -1.248  -7.695 1.00 . A A .  69 GLU C    1 1 
        1  1017 1 1  69 GLU CA   C   1.009  -0.487  -8.128 1.00 . A A .  69 GLU CA   1 1 
        1  1018 1 1  69 GLU CB   C   0.963   0.940  -7.579 1.00 . A A .  69 GLU CB   1 1 
        1  1019 1 1  69 GLU CD   C   3.014   0.870  -6.105 1.00 . A A .  69 GLU CD   1 1 
        1  1020 1 1  69 GLU CG   C   1.512   1.067  -6.167 1.00 . A A .  69 GLU CG   1 1 
        1  1021 1 1  69 GLU H    H   0.387  -0.127 -10.117 1.00 . A A .  69 GLU H    1 1 
        1  1022 1 1  69 GLU HA   H   1.877  -0.988  -7.728 1.00 . A A .  69 GLU HA   1 1 
        1  1023 1 1  69 GLU HB2  H   1.543   1.580  -8.226 1.00 . A A .  69 GLU HB2  1 1 
        1  1024 1 1  69 GLU HB3  H  -0.062   1.279  -7.575 1.00 . A A .  69 GLU HB3  1 1 
        1  1025 1 1  69 GLU HG2  H   1.278   2.051  -5.790 1.00 . A A .  69 GLU HG2  1 1 
        1  1026 1 1  69 GLU HG3  H   1.040   0.322  -5.543 1.00 . A A .  69 GLU HG3  1 1 
        1  1027 1 1  69 GLU N    N   1.133  -0.464  -9.579 1.00 . A A .  69 GLU N    1 1 
        1  1028 1 1  69 GLU O    O  -1.361  -0.862  -8.025 1.00 . A A .  69 GLU O    1 1 
        1  1029 1 1  69 GLU OE1  O   3.690   1.136  -7.120 1.00 . A A .  69 GLU OE1  1 1 
        1  1030 1 1  69 GLU OE2  O   3.514   0.448  -5.040 1.00 . A A .  69 GLU OE2  1 1 
        1  1031 1 1  70 MET C    C  -1.320  -2.948  -4.958 1.00 . A A .  70 MET C    1 1 
        1  1032 1 1  70 MET CA   C  -1.138  -3.141  -6.459 1.00 . A A .  70 MET CA   1 1 
        1  1033 1 1  70 MET CB   C  -0.890  -4.618  -6.770 1.00 . A A .  70 MET CB   1 1 
        1  1034 1 1  70 MET CE   C  -0.898  -6.766 -10.211 1.00 . A A .  70 MET CE   1 1 
        1  1035 1 1  70 MET CG   C  -0.511  -4.879  -8.219 1.00 . A A .  70 MET CG   1 1 
        1  1036 1 1  70 MET H    H   0.884  -2.578  -6.715 1.00 . A A .  70 MET H    1 1 
        1  1037 1 1  70 MET HA   H  -2.038  -2.821  -6.964 1.00 . A A .  70 MET HA   1 1 
        1  1038 1 1  70 MET HB2  H  -0.088  -4.977  -6.141 1.00 . A A .  70 MET HB2  1 1 
        1  1039 1 1  70 MET HB3  H  -1.787  -5.177  -6.549 1.00 . A A .  70 MET HB3  1 1 
        1  1040 1 1  70 MET HE1  H  -0.134  -6.517 -10.933 1.00 . A A .  70 MET HE1  1 1 
        1  1041 1 1  70 MET HE2  H  -1.731  -6.087 -10.319 1.00 . A A .  70 MET HE2  1 1 
        1  1042 1 1  70 MET HE3  H  -1.235  -7.779 -10.378 1.00 . A A .  70 MET HE3  1 1 
        1  1043 1 1  70 MET HG2  H  -1.312  -4.532  -8.855 1.00 . A A .  70 MET HG2  1 1 
        1  1044 1 1  70 MET HG3  H   0.391  -4.330  -8.446 1.00 . A A .  70 MET HG3  1 1 
        1  1045 1 1  70 MET N    N  -0.034  -2.326  -6.948 1.00 . A A .  70 MET N    1 1 
        1  1046 1 1  70 MET O    O  -0.382  -3.132  -4.182 1.00 . A A .  70 MET O    1 1 
        1  1047 1 1  70 MET SD   S  -0.224  -6.627  -8.558 1.00 . A A .  70 MET SD   1 1 
        1  1048 1 1  71 GLY C    C  -3.713  -3.418  -2.562 1.00 . A A .  71 GLY C    1 1 
        1  1049 1 1  71 GLY CA   C  -2.802  -2.357  -3.146 1.00 . A A .  71 GLY CA   1 1 
        1  1050 1 1  71 GLY H    H  -3.238  -2.438  -5.218 1.00 . A A .  71 GLY H    1 1 
        1  1051 1 1  71 GLY HA2  H  -1.868  -2.363  -2.605 1.00 . A A .  71 GLY HA2  1 1 
        1  1052 1 1  71 GLY HA3  H  -3.269  -1.391  -3.026 1.00 . A A .  71 GLY HA3  1 1 
        1  1053 1 1  71 GLY N    N  -2.528  -2.573  -4.555 1.00 . A A .  71 GLY N    1 1 
        1  1054 1 1  71 GLY O    O  -4.382  -4.145  -3.296 1.00 . A A .  71 GLY O    1 1 
        1  1055 1 1  72 TYR C    C  -5.257  -3.861   0.658 1.00 . A A .  72 TYR C    1 1 
        1  1056 1 1  72 TYR CA   C  -4.573  -4.486  -0.553 1.00 . A A .  72 TYR CA   1 1 
        1  1057 1 1  72 TYR CB   C  -3.735  -5.688  -0.115 1.00 . A A .  72 TYR CB   1 1 
        1  1058 1 1  72 TYR CD1  C  -4.272  -7.391  -1.899 1.00 . A A .  72 TYR CD1  1 1 
        1  1059 1 1  72 TYR CD2  C  -2.015  -6.651  -1.692 1.00 . A A .  72 TYR CD2  1 1 
        1  1060 1 1  72 TYR CE1  C  -3.908  -8.220  -2.943 1.00 . A A .  72 TYR CE1  1 1 
        1  1061 1 1  72 TYR CE2  C  -1.644  -7.478  -2.735 1.00 . A A .  72 TYR CE2  1 1 
        1  1062 1 1  72 TYR CG   C  -3.333  -6.594  -1.257 1.00 . A A .  72 TYR CG   1 1 
        1  1063 1 1  72 TYR CZ   C  -2.593  -8.260  -3.357 1.00 . A A .  72 TYR CZ   1 1 
        1  1064 1 1  72 TYR H    H  -3.181  -2.898  -0.706 1.00 . A A .  72 TYR H    1 1 
        1  1065 1 1  72 TYR HA   H  -5.329  -4.818  -1.247 1.00 . A A .  72 TYR HA   1 1 
        1  1066 1 1  72 TYR HB2  H  -2.832  -5.334   0.360 1.00 . A A .  72 TYR HB2  1 1 
        1  1067 1 1  72 TYR HB3  H  -4.302  -6.275   0.592 1.00 . A A .  72 TYR HB3  1 1 
        1  1068 1 1  72 TYR HD1  H  -5.301  -7.357  -1.573 1.00 . A A .  72 TYR HD1  1 1 
        1  1069 1 1  72 TYR HD2  H  -1.273  -6.038  -1.202 1.00 . A A .  72 TYR HD2  1 1 
        1  1070 1 1  72 TYR HE1  H  -4.652  -8.833  -3.431 1.00 . A A .  72 TYR HE1  1 1 
        1  1071 1 1  72 TYR HE2  H  -0.614  -7.509  -3.059 1.00 . A A .  72 TYR HE2  1 1 
        1  1072 1 1  72 TYR HH   H  -2.906  -9.064  -5.075 1.00 . A A .  72 TYR HH   1 1 
        1  1073 1 1  72 TYR N    N  -3.738  -3.507  -1.237 1.00 . A A .  72 TYR N    1 1 
        1  1074 1 1  72 TYR O    O  -4.596  -3.462   1.616 1.00 . A A .  72 TYR O    1 1 
        1  1075 1 1  72 TYR OH   O  -2.228  -9.084  -4.397 1.00 . A A .  72 TYR OH   1 1 
        1  1076 1 1  73 ASP C    C  -7.650  -4.236   2.776 1.00 . A A .  73 ASP C    1 1 
        1  1077 1 1  73 ASP CA   C  -7.351  -3.194   1.702 1.00 . A A .  73 ASP CA   1 1 
        1  1078 1 1  73 ASP CB   C  -8.656  -2.594   1.171 1.00 . A A .  73 ASP CB   1 1 
        1  1079 1 1  73 ASP CG   C  -8.692  -1.083   1.302 1.00 . A A .  73 ASP CG   1 1 
        1  1080 1 1  73 ASP H    H  -7.053  -4.109  -0.184 1.00 . A A .  73 ASP H    1 1 
        1  1081 1 1  73 ASP HA   H  -6.756  -2.406   2.140 1.00 . A A .  73 ASP HA   1 1 
        1  1082 1 1  73 ASP HB2  H  -8.762  -2.847   0.127 1.00 . A A .  73 ASP HB2  1 1 
        1  1083 1 1  73 ASP HB3  H  -9.488  -3.005   1.724 1.00 . A A .  73 ASP HB3  1 1 
        1  1084 1 1  73 ASP N    N  -6.582  -3.775   0.608 1.00 . A A .  73 ASP N    1 1 
        1  1085 1 1  73 ASP O    O  -8.372  -5.205   2.532 1.00 . A A .  73 ASP O    1 1 
        1  1086 1 1  73 ASP OD1  O  -7.654  -0.440   1.043 1.00 . A A .  73 ASP OD1  1 1 
        1  1087 1 1  73 ASP OD2  O  -9.760  -0.544   1.662 1.00 . A A .  73 ASP OD2  1 1 
        1  1088 1 1  74 TRP C    C  -7.495  -4.182   6.389 1.00 . A A .  74 TRP C    1 1 
        1  1089 1 1  74 TRP CA   C  -7.297  -4.944   5.081 1.00 . A A .  74 TRP CA   1 1 
        1  1090 1 1  74 TRP CB   C  -6.112  -5.902   5.211 1.00 . A A .  74 TRP CB   1 1 
        1  1091 1 1  74 TRP CD1  C  -7.439  -7.836   6.242 1.00 . A A .  74 TRP CD1  1 1 
        1  1092 1 1  74 TRP CD2  C  -5.490  -7.414   7.259 1.00 . A A .  74 TRP CD2  1 1 
        1  1093 1 1  74 TRP CE2  C  -6.117  -8.490   7.917 1.00 . A A .  74 TRP CE2  1 1 
        1  1094 1 1  74 TRP CE3  C  -4.248  -6.972   7.723 1.00 . A A .  74 TRP CE3  1 1 
        1  1095 1 1  74 TRP CG   C  -6.353  -7.011   6.189 1.00 . A A .  74 TRP CG   1 1 
        1  1096 1 1  74 TRP CH2  C  -4.327  -8.673   9.447 1.00 . A A .  74 TRP CH2  1 1 
        1  1097 1 1  74 TRP CZ2  C  -5.543  -9.127   9.014 1.00 . A A .  74 TRP CZ2  1 1 
        1  1098 1 1  74 TRP CZ3  C  -3.680  -7.606   8.812 1.00 . A A .  74 TRP CZ3  1 1 
        1  1099 1 1  74 TRP H    H  -6.527  -3.236   4.096 1.00 . A A .  74 TRP H    1 1 
        1  1100 1 1  74 TRP HA   H  -8.189  -5.517   4.876 1.00 . A A .  74 TRP HA   1 1 
        1  1101 1 1  74 TRP HB2  H  -5.908  -6.345   4.248 1.00 . A A .  74 TRP HB2  1 1 
        1  1102 1 1  74 TRP HB3  H  -5.244  -5.348   5.538 1.00 . A A .  74 TRP HB3  1 1 
        1  1103 1 1  74 TRP HD1  H  -8.276  -7.783   5.561 1.00 . A A .  74 TRP HD1  1 1 
        1  1104 1 1  74 TRP HE1  H  -7.954  -9.421   7.519 1.00 . A A .  74 TRP HE1  1 1 
        1  1105 1 1  74 TRP HE3  H  -3.734  -6.150   7.247 1.00 . A A .  74 TRP HE3  1 1 
        1  1106 1 1  74 TRP HH2  H  -3.846  -9.138  10.295 1.00 . A A .  74 TRP HH2  1 1 
        1  1107 1 1  74 TRP HZ2  H  -6.029  -9.952   9.514 1.00 . A A .  74 TRP HZ2  1 1 
        1  1108 1 1  74 TRP HZ3  H  -2.721  -7.277   9.185 1.00 . A A .  74 TRP HZ3  1 1 
        1  1109 1 1  74 TRP N    N  -7.091  -4.027   3.965 1.00 . A A .  74 TRP N    1 1 
        1  1110 1 1  74 TRP NE1  N  -7.305  -8.728   7.278 1.00 . A A .  74 TRP NE1  1 1 
        1  1111 1 1  74 TRP O    O  -6.943  -3.096   6.581 1.00 . A A .  74 TRP O    1 1 
        1  1112 1 1  75 LEU C    C  -9.260  -2.802   8.405 1.00 . A A .  75 LEU C    1 1 
        1  1113 1 1  75 LEU CA   C  -8.556  -4.143   8.581 1.00 . A A .  75 LEU CA   1 1 
        1  1114 1 1  75 LEU CB   C  -7.255  -3.951   9.363 1.00 . A A .  75 LEU CB   1 1 
        1  1115 1 1  75 LEU CD1  C  -7.334  -5.608  11.243 1.00 . A A .  75 LEU CD1  1 1 
        1  1116 1 1  75 LEU CD2  C  -6.273  -3.371  11.595 1.00 . A A .  75 LEU CD2  1 1 
        1  1117 1 1  75 LEU CG   C  -7.377  -4.132  10.877 1.00 . A A .  75 LEU CG   1 1 
        1  1118 1 1  75 LEU H    H  -8.692  -5.627   7.078 1.00 . A A .  75 LEU H    1 1 
        1  1119 1 1  75 LEU HA   H  -9.203  -4.806   9.135 1.00 . A A .  75 LEU HA   1 1 
        1  1120 1 1  75 LEU HB2  H  -6.529  -4.661   8.993 1.00 . A A .  75 LEU HB2  1 1 
        1  1121 1 1  75 LEU HB3  H  -6.888  -2.954   9.172 1.00 . A A .  75 LEU HB3  1 1 
        1  1122 1 1  75 LEU HD11 H  -8.265  -6.076  10.961 1.00 . A A .  75 LEU HD11 1 1 
        1  1123 1 1  75 LEU HD12 H  -7.187  -5.711  12.308 1.00 . A A .  75 LEU HD12 1 1 
        1  1124 1 1  75 LEU HD13 H  -6.518  -6.085  10.720 1.00 . A A .  75 LEU HD13 1 1 
        1  1125 1 1  75 LEU HD21 H  -5.460  -4.045  11.823 1.00 . A A .  75 LEU HD21 1 1 
        1  1126 1 1  75 LEU HD22 H  -6.662  -2.953  12.512 1.00 . A A .  75 LEU HD22 1 1 
        1  1127 1 1  75 LEU HD23 H  -5.913  -2.575  10.960 1.00 . A A .  75 LEU HD23 1 1 
        1  1128 1 1  75 LEU HG   H  -8.327  -3.735  11.205 1.00 . A A .  75 LEU HG   1 1 
        1  1129 1 1  75 LEU N    N  -8.284  -4.761   7.289 1.00 . A A .  75 LEU N    1 1 
        1  1130 1 1  75 LEU O    O  -9.176  -2.179   7.347 1.00 . A A .  75 LEU O    1 1 
        1  1131 1 1  76 GLY C    C -11.747  -0.993  10.448 1.00 . A A .  76 GLY C    1 1 
        1  1132 1 1  76 GLY CA   C -10.665  -1.100   9.392 1.00 . A A .  76 GLY CA   1 1 
        1  1133 1 1  76 GLY H    H  -9.986  -2.904  10.267 1.00 . A A .  76 GLY H    1 1 
        1  1134 1 1  76 GLY HA2  H  -9.958  -0.296   9.533 1.00 . A A .  76 GLY HA2  1 1 
        1  1135 1 1  76 GLY HA3  H -11.118  -0.999   8.417 1.00 . A A .  76 GLY HA3  1 1 
        1  1136 1 1  76 GLY N    N  -9.955  -2.364   9.450 1.00 . A A .  76 GLY N    1 1 
        1  1137 1 1  76 GLY O    O -12.082   0.104  10.894 1.00 . A A .  76 GLY O    1 1 
        1  1138 1 1  77 ARG C    C -12.846  -2.818  13.146 1.00 . A A .  77 ARG C    1 1 
        1  1139 1 1  77 ARG CA   C -13.345  -2.166  11.861 1.00 . A A .  77 ARG CA   1 1 
        1  1140 1 1  77 ARG CB   C -14.568  -2.920  11.335 1.00 . A A .  77 ARG CB   1 1 
        1  1141 1 1  77 ARG CD   C -16.767  -3.869  12.094 1.00 . A A .  77 ARG CD   1 1 
        1  1142 1 1  77 ARG CG   C -15.829  -2.674  12.147 1.00 . A A .  77 ARG CG   1 1 
        1  1143 1 1  77 ARG CZ   C -18.362  -4.980  13.610 1.00 . A A .  77 ARG CZ   1 1 
        1  1144 1 1  77 ARG H    H -11.985  -2.978  10.457 1.00 . A A .  77 ARG H    1 1 
        1  1145 1 1  77 ARG HA   H -13.628  -1.146  12.076 1.00 . A A .  77 ARG HA   1 1 
        1  1146 1 1  77 ARG HB2  H -14.755  -2.614  10.316 1.00 . A A .  77 ARG HB2  1 1 
        1  1147 1 1  77 ARG HB3  H -14.356  -3.979  11.350 1.00 . A A .  77 ARG HB3  1 1 
        1  1148 1 1  77 ARG HD2  H -17.348  -3.815  11.185 1.00 . A A .  77 ARG HD2  1 1 
        1  1149 1 1  77 ARG HD3  H -16.177  -4.774  12.090 1.00 . A A .  77 ARG HD3  1 1 
        1  1150 1 1  77 ARG HE   H -17.785  -3.075  13.752 1.00 . A A .  77 ARG HE   1 1 
        1  1151 1 1  77 ARG HG2  H -15.554  -2.491  13.174 1.00 . A A .  77 ARG HG2  1 1 
        1  1152 1 1  77 ARG HG3  H -16.338  -1.809  11.748 1.00 . A A .  77 ARG HG3  1 1 
        1  1153 1 1  77 ARG HH11 H -17.638  -6.167  12.141 1.00 . A A .  77 ARG HH11 1 1 
        1  1154 1 1  77 ARG HH12 H -18.759  -6.924  13.221 1.00 . A A .  77 ARG HH12 1 1 
        1  1155 1 1  77 ARG HH21 H -19.261  -4.069  15.174 1.00 . A A .  77 ARG HH21 1 1 
        1  1156 1 1  77 ARG HH22 H -19.681  -5.733  14.943 1.00 . A A .  77 ARG HH22 1 1 
        1  1157 1 1  77 ARG N    N -12.295  -2.136  10.850 1.00 . A A .  77 ARG N    1 1 
        1  1158 1 1  77 ARG NE   N -17.678  -3.901  13.236 1.00 . A A .  77 ARG NE   1 1 
        1  1159 1 1  77 ARG NH1  N -18.243  -6.117  12.935 1.00 . A A .  77 ARG NH1  1 1 
        1  1160 1 1  77 ARG NH2  N -19.167  -4.923  14.662 1.00 . A A .  77 ARG NH2  1 1 
        1  1161 1 1  77 ARG O    O -11.982  -3.695  13.113 1.00 . A A .  77 ARG O    1 1 
        1  1162 1 1  78 MET C    C -14.105  -3.824  16.138 1.00 . A A .  78 MET C    1 1 
        1  1163 1 1  78 MET CA   C -13.006  -2.928  15.572 1.00 . A A .  78 MET CA   1 1 
        1  1164 1 1  78 MET CB   C -12.698  -1.793  16.552 1.00 . A A .  78 MET CB   1 1 
        1  1165 1 1  78 MET CE   C  -9.769  -4.164  16.892 1.00 . A A .  78 MET CE   1 1 
        1  1166 1 1  78 MET CG   C -11.308  -1.876  17.162 1.00 . A A .  78 MET CG   1 1 
        1  1167 1 1  78 MET H    H -14.079  -1.685  14.237 1.00 . A A .  78 MET H    1 1 
        1  1168 1 1  78 MET HA   H -12.115  -3.520  15.429 1.00 . A A .  78 MET HA   1 1 
        1  1169 1 1  78 MET HB2  H -12.781  -0.851  16.029 1.00 . A A .  78 MET HB2  1 1 
        1  1170 1 1  78 MET HB3  H -13.422  -1.814  17.353 1.00 . A A .  78 MET HB3  1 1 
        1  1171 1 1  78 MET HE1  H -10.243  -4.864  16.220 1.00 . A A .  78 MET HE1  1 1 
        1  1172 1 1  78 MET HE2  H  -9.023  -4.678  17.480 1.00 . A A .  78 MET HE2  1 1 
        1  1173 1 1  78 MET HE3  H  -9.298  -3.379  16.320 1.00 . A A .  78 MET HE3  1 1 
        1  1174 1 1  78 MET HG2  H -10.577  -1.745  16.379 1.00 . A A .  78 MET HG2  1 1 
        1  1175 1 1  78 MET HG3  H -11.201  -1.083  17.888 1.00 . A A .  78 MET HG3  1 1 
        1  1176 1 1  78 MET N    N -13.395  -2.386  14.276 1.00 . A A .  78 MET N    1 1 
        1  1177 1 1  78 MET O    O -15.130  -3.339  16.616 1.00 . A A .  78 MET O    1 1 
        1  1178 1 1  78 MET SD   S -11.002  -3.454  17.980 1.00 . A A .  78 MET SD   1 1 
        1  1179 1 1  79 ALA C    C -14.280  -7.507  16.591 1.00 . A A .  79 ALA C    1 1 
        1  1180 1 1  79 ALA CA   C -14.855  -6.095  16.586 1.00 . A A .  79 ALA CA   1 1 
        1  1181 1 1  79 ALA CB   C -16.128  -6.044  15.754 1.00 . A A .  79 ALA CB   1 1 
        1  1182 1 1  79 ALA H    H -13.047  -5.460  15.687 1.00 . A A .  79 ALA H    1 1 
        1  1183 1 1  79 ALA HA   H -15.104  -5.814  17.599 1.00 . A A .  79 ALA HA   1 1 
        1  1184 1 1  79 ALA HB1  H -16.564  -7.031  15.703 1.00 . A A .  79 ALA HB1  1 1 
        1  1185 1 1  79 ALA HB2  H -15.892  -5.703  14.756 1.00 . A A .  79 ALA HB2  1 1 
        1  1186 1 1  79 ALA HB3  H -16.830  -5.363  16.211 1.00 . A A .  79 ALA HB3  1 1 
        1  1187 1 1  79 ALA N    N -13.883  -5.133  16.080 1.00 . A A .  79 ALA N    1 1 
        1  1188 1 1  79 ALA O    O -14.266  -8.186  15.565 1.00 . A A .  79 ALA O    1 1 
        1  1189 1 1  80 TYR C    C -13.375  -9.783  19.326 1.00 . A A .  80 TYR C    1 1 
        1  1190 1 1  80 TYR CA   C -13.231  -9.276  17.894 1.00 . A A .  80 TYR CA   1 1 
        1  1191 1 1  80 TYR CB   C -11.756  -9.262  17.481 1.00 . A A .  80 TYR CB   1 1 
        1  1192 1 1  80 TYR CD1  C -11.837 -10.303  15.183 1.00 . A A .  80 TYR CD1  1 1 
        1  1193 1 1  80 TYR CD2  C -10.607 -11.431  16.886 1.00 . A A .  80 TYR CD2  1 1 
        1  1194 1 1  80 TYR CE1  C -11.508 -11.297  14.281 1.00 . A A .  80 TYR CE1  1 1 
        1  1195 1 1  80 TYR CE2  C -10.273 -12.428  15.989 1.00 . A A .  80 TYR CE2  1 1 
        1  1196 1 1  80 TYR CG   C -11.393 -10.352  16.498 1.00 . A A .  80 TYR CG   1 1 
        1  1197 1 1  80 TYR CZ   C -10.726 -12.357  14.689 1.00 . A A .  80 TYR CZ   1 1 
        1  1198 1 1  80 TYR H    H -13.846  -7.355  18.537 1.00 . A A .  80 TYR H    1 1 
        1  1199 1 1  80 TYR HA   H -13.772  -9.939  17.236 1.00 . A A .  80 TYR HA   1 1 
        1  1200 1 1  80 TYR HB2  H -11.527  -8.313  17.021 1.00 . A A .  80 TYR HB2  1 1 
        1  1201 1 1  80 TYR HB3  H -11.139  -9.388  18.359 1.00 . A A .  80 TYR HB3  1 1 
        1  1202 1 1  80 TYR HD1  H -12.449  -9.471  14.866 1.00 . A A .  80 TYR HD1  1 1 
        1  1203 1 1  80 TYR HD2  H -10.254 -11.484  17.905 1.00 . A A .  80 TYR HD2  1 1 
        1  1204 1 1  80 TYR HE1  H -11.862 -11.241  13.262 1.00 . A A .  80 TYR HE1  1 1 
        1  1205 1 1  80 TYR HE2  H  -9.661 -13.259  16.309 1.00 . A A .  80 TYR HE2  1 1 
        1  1206 1 1  80 TYR HH   H -11.147 -13.529  13.224 1.00 . A A .  80 TYR HH   1 1 
        1  1207 1 1  80 TYR N    N -13.806  -7.943  17.754 1.00 . A A .  80 TYR N    1 1 
        1  1208 1 1  80 TYR O    O -12.411  -9.796  20.093 1.00 . A A .  80 TYR O    1 1 
        1  1209 1 1  80 TYR OH   O -10.396 -13.349  13.794 1.00 . A A .  80 TYR OH   1 1 
        1  1210 1 1  81 LYS C    C -16.175 -11.479  21.051 1.00 . A A .  81 LYS C    1 1 
        1  1211 1 1  81 LYS CA   C -14.859 -10.708  21.020 1.00 . A A .  81 LYS CA   1 1 
        1  1212 1 1  81 LYS CB   C -14.906  -9.557  22.026 1.00 . A A .  81 LYS CB   1 1 
        1  1213 1 1  81 LYS CD   C -15.585  -8.848  24.339 1.00 . A A .  81 LYS CD   1 1 
        1  1214 1 1  81 LYS CE   C -15.988  -9.322  25.726 1.00 . A A .  81 LYS CE   1 1 
        1  1215 1 1  81 LYS CG   C -15.158 -10.008  23.456 1.00 . A A .  81 LYS CG   1 1 
        1  1216 1 1  81 LYS H    H -15.314 -10.164  19.025 1.00 . A A .  81 LYS H    1 1 
        1  1217 1 1  81 LYS HA   H -14.057 -11.378  21.290 1.00 . A A .  81 LYS HA   1 1 
        1  1218 1 1  81 LYS HB2  H -13.963  -9.030  21.998 1.00 . A A .  81 LYS HB2  1 1 
        1  1219 1 1  81 LYS HB3  H -15.696  -8.877  21.742 1.00 . A A .  81 LYS HB3  1 1 
        1  1220 1 1  81 LYS HD2  H -14.762  -8.156  24.432 1.00 . A A .  81 LYS HD2  1 1 
        1  1221 1 1  81 LYS HD3  H -16.427  -8.349  23.880 1.00 . A A .  81 LYS HD3  1 1 
        1  1222 1 1  81 LYS HE2  H -15.138  -9.800  26.190 1.00 . A A .  81 LYS HE2  1 1 
        1  1223 1 1  81 LYS HE3  H -16.284  -8.466  26.314 1.00 . A A .  81 LYS HE3  1 1 
        1  1224 1 1  81 LYS HG2  H -15.939 -10.754  23.455 1.00 . A A .  81 LYS HG2  1 1 
        1  1225 1 1  81 LYS HG3  H -14.249 -10.436  23.853 1.00 . A A .  81 LYS HG3  1 1 
        1  1226 1 1  81 LYS HZ1  H -17.793 -10.013  24.933 1.00 . A A .  81 LYS HZ1  1 1 
        1  1227 1 1  81 LYS HZ2  H -17.614 -10.309  26.589 1.00 . A A .  81 LYS HZ2  1 1 
        1  1228 1 1  81 LYS HZ3  H -16.763 -11.245  25.467 1.00 . A A .  81 LYS HZ3  1 1 
        1  1229 1 1  81 LYS N    N -14.586 -10.199  19.680 1.00 . A A .  81 LYS N    1 1 
        1  1230 1 1  81 LYS NZ   N -17.119 -10.290  25.675 1.00 . A A .  81 LYS NZ   1 1 
        1  1231 1 1  81 LYS O    O -17.252 -10.886  21.105 1.00 . A A .  81 LYS O    1 1 
        1  1232 1 1  82 GLY C    C -16.951 -15.093  21.305 1.00 . A A .  82 GLY C    1 1 
        1  1233 1 1  82 GLY CA   C -17.268 -13.635  21.040 1.00 . A A .  82 GLY CA   1 1 
        1  1234 1 1  82 GLY H    H -15.193 -13.221  20.972 1.00 . A A .  82 GLY H    1 1 
        1  1235 1 1  82 GLY HA2  H -17.929 -13.274  21.815 1.00 . A A .  82 GLY HA2  1 1 
        1  1236 1 1  82 GLY HA3  H -17.770 -13.554  20.087 1.00 . A A .  82 GLY HA3  1 1 
        1  1237 1 1  82 GLY N    N -16.079 -12.804  21.015 1.00 . A A .  82 GLY N    1 1 
        1  1238 1 1  82 GLY O    O -15.818 -15.534  21.114 1.00 . A A .  82 GLY O    1 1 
        1  1239 1 1  83 SER C    C -17.550 -18.058  20.759 1.00 . A A .  83 SER C    1 1 
        1  1240 1 1  83 SER CA   C -17.778 -17.261  22.040 1.00 . A A .  83 SER CA   1 1 
        1  1241 1 1  83 SER CB   C -19.000 -17.807  22.782 1.00 . A A .  83 SER CB   1 1 
        1  1242 1 1  83 SER H    H -18.836 -15.435  21.880 1.00 . A A .  83 SER H    1 1 
        1  1243 1 1  83 SER HA   H -16.909 -17.363  22.673 1.00 . A A .  83 SER HA   1 1 
        1  1244 1 1  83 SER HB2  H -19.874 -17.702  22.158 1.00 . A A .  83 SER HB2  1 1 
        1  1245 1 1  83 SER HB3  H -18.843 -18.851  23.010 1.00 . A A .  83 SER HB3  1 1 
        1  1246 1 1  83 SER HG   H -19.851 -16.398  23.844 1.00 . A A .  83 SER HG   1 1 
        1  1247 1 1  83 SER N    N -17.955 -15.844  21.747 1.00 . A A .  83 SER N    1 1 
        1  1248 1 1  83 SER O    O -16.627 -18.869  20.677 1.00 . A A .  83 SER O    1 1 
        1  1249 1 1  83 SER OG   O -19.217 -17.103  23.993 1.00 . A A .  83 SER OG   1 1 
        1  1250 1 1  84 VAL C    C -18.581 -17.578  17.321 1.00 . A A .  84 VAL C    1 1 
        1  1251 1 1  84 VAL CA   C -18.286 -18.517  18.486 1.00 . A A .  84 VAL CA   1 1 
        1  1252 1 1  84 VAL CB   C -19.245 -19.719  18.417 1.00 . A A .  84 VAL CB   1 1 
        1  1253 1 1  84 VAL CG1  C -18.782 -20.827  19.351 1.00 . A A .  84 VAL CG1  1 1 
        1  1254 1 1  84 VAL CG2  C -20.666 -19.289  18.750 1.00 . A A .  84 VAL CG2  1 1 
        1  1255 1 1  84 VAL H    H -19.111 -17.163  19.888 1.00 . A A .  84 VAL H    1 1 
        1  1256 1 1  84 VAL HA   H -17.274 -18.884  18.392 1.00 . A A .  84 VAL HA   1 1 
        1  1257 1 1  84 VAL HB   H -19.236 -20.104  17.407 1.00 . A A .  84 VAL HB   1 1 
        1  1258 1 1  84 VAL HG11 H -18.192 -20.402  20.149 1.00 . A A .  84 VAL HG11 1 1 
        1  1259 1 1  84 VAL HG12 H -18.183 -21.536  18.799 1.00 . A A .  84 VAL HG12 1 1 
        1  1260 1 1  84 VAL HG13 H -19.642 -21.330  19.768 1.00 . A A .  84 VAL HG13 1 1 
        1  1261 1 1  84 VAL HG21 H -21.179 -20.098  19.248 1.00 . A A .  84 VAL HG21 1 1 
        1  1262 1 1  84 VAL HG22 H -21.189 -19.038  17.839 1.00 . A A .  84 VAL HG22 1 1 
        1  1263 1 1  84 VAL HG23 H -20.638 -18.426  19.399 1.00 . A A .  84 VAL HG23 1 1 
        1  1264 1 1  84 VAL N    N -18.396 -17.821  19.762 1.00 . A A .  84 VAL N    1 1 
        1  1265 1 1  84 VAL O    O -19.604 -16.894  17.306 1.00 . A A .  84 VAL O    1 1 
        1  1266 1 1  85 ASP C    C -17.968 -17.532  13.906 1.00 . A A .  85 ASP C    1 1 
        1  1267 1 1  85 ASP CA   C -17.841 -16.697  15.176 1.00 . A A .  85 ASP CA   1 1 
        1  1268 1 1  85 ASP CB   C -16.657 -15.736  15.051 1.00 . A A .  85 ASP CB   1 1 
        1  1269 1 1  85 ASP CG   C -16.898 -14.423  15.769 1.00 . A A .  85 ASP CG   1 1 
        1  1270 1 1  85 ASP H    H -16.883 -18.120  16.416 1.00 . A A .  85 ASP H    1 1 
        1  1271 1 1  85 ASP HA   H -18.746 -16.123  15.307 1.00 . A A .  85 ASP HA   1 1 
        1  1272 1 1  85 ASP HB2  H -15.779 -16.200  15.474 1.00 . A A .  85 ASP HB2  1 1 
        1  1273 1 1  85 ASP HB3  H -16.480 -15.527  14.006 1.00 . A A .  85 ASP HB3  1 1 
        1  1274 1 1  85 ASP N    N -17.678 -17.551  16.346 1.00 . A A .  85 ASP N    1 1 
        1  1275 1 1  85 ASP O    O -17.971 -18.762  13.957 1.00 . A A .  85 ASP O    1 1 
        1  1276 1 1  85 ASP OD1  O -17.032 -14.441  17.011 1.00 . A A .  85 ASP OD1  1 1 
        1  1277 1 1  85 ASP OD2  O -16.953 -13.376  15.090 1.00 . A A .  85 ASP OD2  1 1 
        1  1278 1 1  86 ASN C    C -17.021 -17.205  10.574 1.00 . A A .  86 ASN C    1 1 
        1  1279 1 1  86 ASN CA   C -18.201 -17.534  11.482 1.00 . A A .  86 ASN CA   1 1 
        1  1280 1 1  86 ASN CB   C -19.511 -17.137  10.799 1.00 . A A .  86 ASN CB   1 1 
        1  1281 1 1  86 ASN CG   C -19.923 -18.122   9.723 1.00 . A A .  86 ASN CG   1 1 
        1  1282 1 1  86 ASN H    H -18.066 -15.875  12.790 1.00 . A A .  86 ASN H    1 1 
        1  1283 1 1  86 ASN HA   H -18.211 -18.598  11.668 1.00 . A A .  86 ASN HA   1 1 
        1  1284 1 1  86 ASN HB2  H -20.296 -17.091  11.539 1.00 . A A .  86 ASN HB2  1 1 
        1  1285 1 1  86 ASN HB3  H -19.392 -16.164  10.345 1.00 . A A .  86 ASN HB3  1 1 
        1  1286 1 1  86 ASN HD21 H -21.466 -18.719  10.827 1.00 . A A .  86 ASN HD21 1 1 
        1  1287 1 1  86 ASN HD22 H -21.292 -19.499   9.295 1.00 . A A .  86 ASN HD22 1 1 
        1  1288 1 1  86 ASN N    N -18.074 -16.855  12.767 1.00 . A A .  86 ASN N    1 1 
        1  1289 1 1  86 ASN ND2  N -21.003 -18.854   9.974 1.00 . A A .  86 ASN ND2  1 1 
        1  1290 1 1  86 ASN O    O -16.482 -16.100  10.616 1.00 . A A .  86 ASN O    1 1 
        1  1291 1 1  86 ASN OD1  O -19.280 -18.224   8.679 1.00 . A A .  86 ASN OD1  1 1 
        1  1292 1 1  87 GLY C    C -15.692 -18.689   7.527 1.00 . A A .  87 GLY C    1 1 
        1  1293 1 1  87 GLY CA   C -15.511 -17.964   8.846 1.00 . A A .  87 GLY CA   1 1 
        1  1294 1 1  87 GLY H    H -17.093 -19.034   9.762 1.00 . A A .  87 GLY H    1 1 
        1  1295 1 1  87 GLY HA2  H -15.412 -16.907   8.652 1.00 . A A .  87 GLY HA2  1 1 
        1  1296 1 1  87 GLY HA3  H -14.606 -18.319   9.318 1.00 . A A .  87 GLY HA3  1 1 
        1  1297 1 1  87 GLY N    N -16.625 -18.172   9.753 1.00 . A A .  87 GLY N    1 1 
        1  1298 1 1  87 GLY O    O -14.737 -19.236   6.976 1.00 . A A .  87 GLY O    1 1 
        1  1299 1 1  88 ALA C    C -16.484 -18.691   4.600 1.00 . A A .  88 ALA C    1 1 
        1  1300 1 1  88 ALA CA   C -17.223 -19.354   5.757 1.00 . A A .  88 ALA CA   1 1 
        1  1301 1 1  88 ALA CB   C -18.722 -19.344   5.503 1.00 . A A .  88 ALA CB   1 1 
        1  1302 1 1  88 ALA H    H -17.640 -18.238   7.506 1.00 . A A .  88 ALA H    1 1 
        1  1303 1 1  88 ALA HA   H -16.902 -20.383   5.835 1.00 . A A .  88 ALA HA   1 1 
        1  1304 1 1  88 ALA HB1  H -19.246 -19.537   6.428 1.00 . A A .  88 ALA HB1  1 1 
        1  1305 1 1  88 ALA HB2  H -18.971 -20.109   4.782 1.00 . A A .  88 ALA HB2  1 1 
        1  1306 1 1  88 ALA HB3  H -19.015 -18.378   5.119 1.00 . A A .  88 ALA HB3  1 1 
        1  1307 1 1  88 ALA N    N -16.920 -18.692   7.020 1.00 . A A .  88 ALA N    1 1 
        1  1308 1 1  88 ALA O    O -15.672 -19.324   3.925 1.00 . A A .  88 ALA O    1 1 
        1  1309 1 1  89 PHE C    C -15.219 -15.577   3.863 1.00 . A A .  89 PHE C    1 1 
        1  1310 1 1  89 PHE CA   C -16.133 -16.661   3.302 1.00 . A A .  89 PHE CA   1 1 
        1  1311 1 1  89 PHE CB   C -17.191 -16.032   2.393 1.00 . A A .  89 PHE CB   1 1 
        1  1312 1 1  89 PHE CD1  C -16.770 -17.025   0.129 1.00 . A A .  89 PHE CD1  1 1 
        1  1313 1 1  89 PHE CD2  C -18.780 -17.614   1.268 1.00 . A A .  89 PHE CD2  1 1 
        1  1314 1 1  89 PHE CE1  C -17.132 -17.831  -0.934 1.00 . A A .  89 PHE CE1  1 1 
        1  1315 1 1  89 PHE CE2  C -19.148 -18.422   0.208 1.00 . A A .  89 PHE CE2  1 1 
        1  1316 1 1  89 PHE CG   C -17.589 -16.907   1.240 1.00 . A A .  89 PHE CG   1 1 
        1  1317 1 1  89 PHE CZ   C -18.322 -18.530  -0.894 1.00 . A A .  89 PHE CZ   1 1 
        1  1318 1 1  89 PHE H    H -17.426 -16.963   4.950 1.00 . A A .  89 PHE H    1 1 
        1  1319 1 1  89 PHE HA   H -15.539 -17.351   2.722 1.00 . A A .  89 PHE HA   1 1 
        1  1320 1 1  89 PHE HB2  H -18.078 -15.825   2.974 1.00 . A A .  89 PHE HB2  1 1 
        1  1321 1 1  89 PHE HB3  H -16.806 -15.106   1.992 1.00 . A A .  89 PHE HB3  1 1 
        1  1322 1 1  89 PHE HD1  H -15.839 -16.478   0.097 1.00 . A A .  89 PHE HD1  1 1 
        1  1323 1 1  89 PHE HD2  H -19.427 -17.529   2.129 1.00 . A A .  89 PHE HD2  1 1 
        1  1324 1 1  89 PHE HE1  H -16.484 -17.914  -1.794 1.00 . A A .  89 PHE HE1  1 1 
        1  1325 1 1  89 PHE HE2  H -20.079 -18.968   0.242 1.00 . A A .  89 PHE HE2  1 1 
        1  1326 1 1  89 PHE HZ   H -18.607 -19.161  -1.723 1.00 . A A .  89 PHE HZ   1 1 
        1  1327 1 1  89 PHE N    N -16.770 -17.412   4.377 1.00 . A A .  89 PHE N    1 1 
        1  1328 1 1  89 PHE O    O -15.534 -14.947   4.872 1.00 . A A .  89 PHE O    1 1 
        1  1329 1 1  90 LYS C    C -13.140 -13.156   2.690 1.00 . A A .  90 LYS C    1 1 
        1  1330 1 1  90 LYS CA   C -13.128 -14.355   3.632 1.00 . A A .  90 LYS CA   1 1 
        1  1331 1 1  90 LYS CB   C -11.721 -14.952   3.698 1.00 . A A .  90 LYS CB   1 1 
        1  1332 1 1  90 LYS CD   C -10.175 -16.591   4.809 1.00 . A A .  90 LYS CD   1 1 
        1  1333 1 1  90 LYS CE   C -10.302 -17.832   3.939 1.00 . A A .  90 LYS CE   1 1 
        1  1334 1 1  90 LYS CG   C -11.494 -15.842   4.909 1.00 . A A .  90 LYS CG   1 1 
        1  1335 1 1  90 LYS H    H -13.893 -15.898   2.402 1.00 . A A .  90 LYS H    1 1 
        1  1336 1 1  90 LYS HA   H -13.416 -14.025   4.619 1.00 . A A .  90 LYS HA   1 1 
        1  1337 1 1  90 LYS HB2  H -11.551 -15.541   2.809 1.00 . A A .  90 LYS HB2  1 1 
        1  1338 1 1  90 LYS HB3  H -11.002 -14.147   3.729 1.00 . A A .  90 LYS HB3  1 1 
        1  1339 1 1  90 LYS HD2  H  -9.432 -15.937   4.378 1.00 . A A .  90 LYS HD2  1 1 
        1  1340 1 1  90 LYS HD3  H  -9.865 -16.887   5.801 1.00 . A A .  90 LYS HD3  1 1 
        1  1341 1 1  90 LYS HE2  H  -9.851 -18.666   4.457 1.00 . A A .  90 LYS HE2  1 1 
        1  1342 1 1  90 LYS HE3  H -11.350 -18.036   3.774 1.00 . A A .  90 LYS HE3  1 1 
        1  1343 1 1  90 LYS HG2  H -11.481 -15.228   5.797 1.00 . A A .  90 LYS HG2  1 1 
        1  1344 1 1  90 LYS HG3  H -12.301 -16.557   4.975 1.00 . A A .  90 LYS HG3  1 1 
        1  1345 1 1  90 LYS HZ1  H  -9.553 -16.648   2.389 1.00 . A A .  90 LYS HZ1  1 1 
        1  1346 1 1  90 LYS HZ2  H -10.172 -18.138   1.877 1.00 . A A .  90 LYS HZ2  1 1 
        1  1347 1 1  90 LYS HZ3  H  -8.672 -18.067   2.654 1.00 . A A .  90 LYS HZ3  1 1 
        1  1348 1 1  90 LYS N    N -14.087 -15.364   3.201 1.00 . A A .  90 LYS N    1 1 
        1  1349 1 1  90 LYS NZ   N  -9.628 -17.659   2.623 1.00 . A A .  90 LYS NZ   1 1 
        1  1350 1 1  90 LYS O    O -13.208 -13.314   1.471 1.00 . A A .  90 LYS O    1 1 
        1  1351 1 1  91 ALA C    C -11.689 -10.105   2.429 1.00 . A A .  91 ALA C    1 1 
        1  1352 1 1  91 ALA CA   C -13.077 -10.734   2.472 1.00 . A A .  91 ALA CA   1 1 
        1  1353 1 1  91 ALA CB   C -14.089  -9.746   3.032 1.00 . A A .  91 ALA CB   1 1 
        1  1354 1 1  91 ALA H    H -13.021 -11.898   4.239 1.00 . A A .  91 ALA H    1 1 
        1  1355 1 1  91 ALA HA   H -13.377 -10.988   1.465 1.00 . A A .  91 ALA HA   1 1 
        1  1356 1 1  91 ALA HB1  H -15.087 -10.133   2.889 1.00 . A A .  91 ALA HB1  1 1 
        1  1357 1 1  91 ALA HB2  H -13.993  -8.801   2.519 1.00 . A A .  91 ALA HB2  1 1 
        1  1358 1 1  91 ALA HB3  H -13.907  -9.603   4.087 1.00 . A A .  91 ALA HB3  1 1 
        1  1359 1 1  91 ALA N    N -13.074 -11.959   3.262 1.00 . A A .  91 ALA N    1 1 
        1  1360 1 1  91 ALA O    O -10.935 -10.174   3.400 1.00 . A A .  91 ALA O    1 1 
        1  1361 1 1  92 GLN C    C -10.114  -7.810   0.012 1.00 . A A .  92 GLN C    1 1 
        1  1362 1 1  92 GLN CA   C -10.060  -8.847   1.128 1.00 . A A .  92 GLN CA   1 1 
        1  1363 1 1  92 GLN CB   C  -8.986  -9.892   0.817 1.00 . A A .  92 GLN CB   1 1 
        1  1364 1 1  92 GLN CD   C  -8.239 -11.919   2.129 1.00 . A A .  92 GLN CD   1 1 
        1  1365 1 1  92 GLN CG   C  -8.258 -10.405   2.050 1.00 . A A .  92 GLN CG   1 1 
        1  1366 1 1  92 GLN H    H -12.002  -9.468   0.560 1.00 . A A .  92 GLN H    1 1 
        1  1367 1 1  92 GLN HA   H  -9.810  -8.351   2.054 1.00 . A A .  92 GLN HA   1 1 
        1  1368 1 1  92 GLN HB2  H  -9.451 -10.733   0.323 1.00 . A A .  92 GLN HB2  1 1 
        1  1369 1 1  92 GLN HB3  H  -8.256  -9.455   0.151 1.00 . A A .  92 GLN HB3  1 1 
        1  1370 1 1  92 GLN HE21 H -10.176 -11.993   1.689 1.00 . A A .  92 GLN HE21 1 1 
        1  1371 1 1  92 GLN HE22 H  -9.405 -13.518   1.941 1.00 . A A .  92 GLN HE22 1 1 
        1  1372 1 1  92 GLN HG2  H  -7.239 -10.048   2.025 1.00 . A A .  92 GLN HG2  1 1 
        1  1373 1 1  92 GLN HG3  H  -8.752 -10.019   2.930 1.00 . A A .  92 GLN HG3  1 1 
        1  1374 1 1  92 GLN N    N -11.358  -9.490   1.298 1.00 . A A .  92 GLN N    1 1 
        1  1375 1 1  92 GLN NE2  N  -9.390 -12.540   1.896 1.00 . A A .  92 GLN NE2  1 1 
        1  1376 1 1  92 GLN O    O -10.617  -8.084  -1.078 1.00 . A A .  92 GLN O    1 1 
        1  1377 1 1  92 GLN OE1  O  -7.201 -12.525   2.397 1.00 . A A .  92 GLN OE1  1 1 
        1  1378 1 1  93 GLY C    C  -8.413  -5.631  -1.638 1.00 . A A .  93 GLY C    1 1 
        1  1379 1 1  93 GLY CA   C  -9.605  -5.561  -0.703 1.00 . A A .  93 GLY CA   1 1 
        1  1380 1 1  93 GLY H    H  -9.212  -6.453   1.178 1.00 . A A .  93 GLY H    1 1 
        1  1381 1 1  93 GLY HA2  H -10.510  -5.638  -1.287 1.00 . A A .  93 GLY HA2  1 1 
        1  1382 1 1  93 GLY HA3  H  -9.596  -4.608  -0.198 1.00 . A A .  93 GLY HA3  1 1 
        1  1383 1 1  93 GLY N    N  -9.598  -6.617   0.290 1.00 . A A .  93 GLY N    1 1 
        1  1384 1 1  93 GLY O    O  -7.280  -5.823  -1.197 1.00 . A A .  93 GLY O    1 1 
        1  1385 1 1  94 VAL C    C  -7.618  -4.210  -4.749 1.00 . A A .  94 VAL C    1 1 
        1  1386 1 1  94 VAL CA   C  -7.612  -5.499  -3.936 1.00 . A A .  94 VAL CA   1 1 
        1  1387 1 1  94 VAL CB   C  -7.754  -6.707  -4.889 1.00 . A A .  94 VAL CB   1 1 
        1  1388 1 1  94 VAL CG1  C  -7.010  -7.914  -4.339 1.00 . A A .  94 VAL CG1  1 1 
        1  1389 1 1  94 VAL CG2  C  -9.219  -7.046  -5.129 1.00 . A A .  94 VAL CG2  1 1 
        1  1390 1 1  94 VAL H    H  -9.593  -5.307  -3.219 1.00 . A A .  94 VAL H    1 1 
        1  1391 1 1  94 VAL HA   H  -6.665  -5.581  -3.420 1.00 . A A .  94 VAL HA   1 1 
        1  1392 1 1  94 VAL HB   H  -7.309  -6.443  -5.838 1.00 . A A .  94 VAL HB   1 1 
        1  1393 1 1  94 VAL HG11 H  -7.129  -7.952  -3.266 1.00 . A A .  94 VAL HG11 1 1 
        1  1394 1 1  94 VAL HG12 H  -5.961  -7.832  -4.582 1.00 . A A .  94 VAL HG12 1 1 
        1  1395 1 1  94 VAL HG13 H  -7.412  -8.815  -4.778 1.00 . A A .  94 VAL HG13 1 1 
        1  1396 1 1  94 VAL HG21 H  -9.290  -8.006  -5.618 1.00 . A A .  94 VAL HG21 1 1 
        1  1397 1 1  94 VAL HG22 H  -9.665  -6.290  -5.756 1.00 . A A .  94 VAL HG22 1 1 
        1  1398 1 1  94 VAL HG23 H  -9.740  -7.084  -4.184 1.00 . A A .  94 VAL HG23 1 1 
        1  1399 1 1  94 VAL N    N  -8.669  -5.465  -2.932 1.00 . A A .  94 VAL N    1 1 
        1  1400 1 1  94 VAL O    O  -8.629  -3.852  -5.354 1.00 . A A .  94 VAL O    1 1 
        1  1401 1 1  95 GLN C    C  -5.493  -2.362  -6.697 1.00 . A A .  95 GLN C    1 1 
        1  1402 1 1  95 GLN CA   C  -6.386  -2.240  -5.466 1.00 . A A .  95 GLN CA   1 1 
        1  1403 1 1  95 GLN CB   C  -5.842  -1.151  -4.540 1.00 . A A .  95 GLN CB   1 1 
        1  1404 1 1  95 GLN CD   C  -4.737   1.120  -4.526 1.00 . A A .  95 GLN CD   1 1 
        1  1405 1 1  95 GLN CG   C  -5.758   0.219  -5.192 1.00 . A A .  95 GLN CG   1 1 
        1  1406 1 1  95 GLN H    H  -5.724  -3.829  -4.232 1.00 . A A .  95 GLN H    1 1 
        1  1407 1 1  95 GLN HA   H  -7.377  -1.959  -5.786 1.00 . A A .  95 GLN HA   1 1 
        1  1408 1 1  95 GLN HB2  H  -6.485  -1.077  -3.676 1.00 . A A .  95 GLN HB2  1 1 
        1  1409 1 1  95 GLN HB3  H  -4.851  -1.433  -4.217 1.00 . A A .  95 GLN HB3  1 1 
        1  1410 1 1  95 GLN HE21 H  -3.302  -0.216  -4.863 1.00 . A A .  95 GLN HE21 1 1 
        1  1411 1 1  95 GLN HE22 H  -2.809   1.226  -4.049 1.00 . A A .  95 GLN HE22 1 1 
        1  1412 1 1  95 GLN HG2  H  -5.484   0.094  -6.229 1.00 . A A .  95 GLN HG2  1 1 
        1  1413 1 1  95 GLN HG3  H  -6.728   0.692  -5.131 1.00 . A A .  95 GLN HG3  1 1 
        1  1414 1 1  95 GLN N    N  -6.493  -3.503  -4.745 1.00 . A A .  95 GLN N    1 1 
        1  1415 1 1  95 GLN NE2  N  -3.490   0.664  -4.474 1.00 . A A .  95 GLN NE2  1 1 
        1  1416 1 1  95 GLN O    O  -4.471  -3.049  -6.678 1.00 . A A .  95 GLN O    1 1 
        1  1417 1 1  95 GLN OE1  O  -5.063   2.213  -4.063 1.00 . A A .  95 GLN OE1  1 1 
        1  1418 1 1  96 LEU C    C  -4.900  -0.235  -9.464 1.00 . A A .  96 LEU C    1 1 
        1  1419 1 1  96 LEU CA   C  -5.144  -1.673  -9.014 1.00 . A A .  96 LEU CA   1 1 
        1  1420 1 1  96 LEU CB   C  -5.916  -2.446 -10.089 1.00 . A A .  96 LEU CB   1 1 
        1  1421 1 1  96 LEU CD1  C  -5.348  -3.670 -12.206 1.00 . A A .  96 LEU CD1  1 1 
        1  1422 1 1  96 LEU CD2  C  -6.207  -1.324 -12.314 1.00 . A A .  96 LEU CD2  1 1 
        1  1423 1 1  96 LEU CG   C  -5.372  -2.315 -11.515 1.00 . A A .  96 LEU CG   1 1 
        1  1424 1 1  96 LEU H    H  -6.711  -1.141  -7.701 1.00 . A A .  96 LEU H    1 1 
        1  1425 1 1  96 LEU HA   H  -4.193  -2.155  -8.839 1.00 . A A .  96 LEU HA   1 1 
        1  1426 1 1  96 LEU HB2  H  -5.911  -3.493  -9.819 1.00 . A A .  96 LEU HB2  1 1 
        1  1427 1 1  96 LEU HB3  H  -6.939  -2.099 -10.085 1.00 . A A .  96 LEU HB3  1 1 
        1  1428 1 1  96 LEU HD11 H  -6.360  -4.020 -12.346 1.00 . A A .  96 LEU HD11 1 1 
        1  1429 1 1  96 LEU HD12 H  -4.805  -4.377 -11.595 1.00 . A A .  96 LEU HD12 1 1 
        1  1430 1 1  96 LEU HD13 H  -4.863  -3.577 -13.166 1.00 . A A .  96 LEU HD13 1 1 
        1  1431 1 1  96 LEU HD21 H  -5.816  -1.252 -13.319 1.00 . A A .  96 LEU HD21 1 1 
        1  1432 1 1  96 LEU HD22 H  -6.166  -0.354 -11.842 1.00 . A A .  96 LEU HD22 1 1 
        1  1433 1 1  96 LEU HD23 H  -7.231  -1.664 -12.351 1.00 . A A .  96 LEU HD23 1 1 
        1  1434 1 1  96 LEU HG   H  -4.358  -1.943 -11.474 1.00 . A A .  96 LEU HG   1 1 
        1  1435 1 1  96 LEU N    N  -5.891  -1.674  -7.762 1.00 . A A .  96 LEU N    1 1 
        1  1436 1 1  96 LEU O    O  -5.845   0.494  -9.770 1.00 . A A .  96 LEU O    1 1 
        1  1437 1 1  97 THR C    C  -1.889   1.635 -10.444 1.00 . A A .  97 THR C    1 1 
        1  1438 1 1  97 THR CA   C  -3.300   1.543  -9.878 1.00 . A A .  97 THR CA   1 1 
        1  1439 1 1  97 THR CB   C  -3.432   2.482  -8.675 1.00 . A A .  97 THR CB   1 1 
        1  1440 1 1  97 THR CG2  C  -2.837   1.918  -7.401 1.00 . A A .  97 THR CG2  1 1 
        1  1441 1 1  97 THR H    H  -2.918  -0.434  -9.217 1.00 . A A .  97 THR H    1 1 
        1  1442 1 1  97 THR HA   H  -4.001   1.851 -10.638 1.00 . A A .  97 THR HA   1 1 
        1  1443 1 1  97 THR HB   H  -4.479   2.674  -8.494 1.00 . A A .  97 THR HB   1 1 
        1  1444 1 1  97 THR HG1  H  -3.039   4.355  -8.259 1.00 . A A .  97 THR HG1  1 1 
        1  1445 1 1  97 THR HG21 H  -3.420   2.249  -6.555 1.00 . A A .  97 THR HG21 1 1 
        1  1446 1 1  97 THR HG22 H  -1.820   2.266  -7.294 1.00 . A A .  97 THR HG22 1 1 
        1  1447 1 1  97 THR HG23 H  -2.846   0.839  -7.444 1.00 . A A .  97 THR HG23 1 1 
        1  1448 1 1  97 THR N    N  -3.636   0.180  -9.484 1.00 . A A .  97 THR N    1 1 
        1  1449 1 1  97 THR O    O  -1.077   0.725 -10.277 1.00 . A A .  97 THR O    1 1 
        1  1450 1 1  97 THR OG1  O  -2.790   3.718  -8.932 1.00 . A A .  97 THR OG1  1 1 
        1  1451 1 1  98 ALA C    C   0.499   3.973 -10.834 1.00 . A A .  98 ALA C    1 1 
        1  1452 1 1  98 ALA CA   C  -0.291   2.988 -11.688 1.00 . A A .  98 ALA CA   1 1 
        1  1453 1 1  98 ALA CB   C  -0.427   3.506 -13.112 1.00 . A A .  98 ALA CB   1 1 
        1  1454 1 1  98 ALA H    H  -2.296   3.443 -11.192 1.00 . A A .  98 ALA H    1 1 
        1  1455 1 1  98 ALA HA   H   0.237   2.045 -11.718 1.00 . A A .  98 ALA HA   1 1 
        1  1456 1 1  98 ALA HB1  H  -1.017   4.410 -13.111 1.00 . A A .  98 ALA HB1  1 1 
        1  1457 1 1  98 ALA HB2  H  -0.913   2.758 -13.721 1.00 . A A .  98 ALA HB2  1 1 
        1  1458 1 1  98 ALA HB3  H   0.553   3.716 -13.514 1.00 . A A .  98 ALA HB3  1 1 
        1  1459 1 1  98 ALA N    N  -1.605   2.753 -11.104 1.00 . A A .  98 ALA N    1 1 
        1  1460 1 1  98 ALA O    O  -0.004   5.039 -10.477 1.00 . A A .  98 ALA O    1 1 
        1  1461 1 1  99 LYS C    C   3.770   4.997 -10.464 1.00 . A A .  99 LYS C    1 1 
        1  1462 1 1  99 LYS CA   C   2.581   4.459  -9.674 1.00 . A A .  99 LYS CA   1 1 
        1  1463 1 1  99 LYS CB   C   3.077   3.687  -8.448 1.00 . A A .  99 LYS CB   1 1 
        1  1464 1 1  99 LYS CD   C   5.358   3.820  -7.393 1.00 . A A .  99 LYS CD   1 1 
        1  1465 1 1  99 LYS CE   C   6.367   4.352  -8.397 1.00 . A A .  99 LYS CE   1 1 
        1  1466 1 1  99 LYS CG   C   4.004   4.494  -7.552 1.00 . A A .  99 LYS CG   1 1 
        1  1467 1 1  99 LYS H    H   2.076   2.742 -10.806 1.00 . A A .  99 LYS H    1 1 
        1  1468 1 1  99 LYS HA   H   1.983   5.294  -9.340 1.00 . A A .  99 LYS HA   1 1 
        1  1469 1 1  99 LYS HB2  H   2.223   3.382  -7.862 1.00 . A A .  99 LYS HB2  1 1 
        1  1470 1 1  99 LYS HB3  H   3.607   2.807  -8.782 1.00 . A A .  99 LYS HB3  1 1 
        1  1471 1 1  99 LYS HD2  H   5.726   4.005  -6.395 1.00 . A A .  99 LYS HD2  1 1 
        1  1472 1 1  99 LYS HD3  H   5.239   2.757  -7.543 1.00 . A A .  99 LYS HD3  1 1 
        1  1473 1 1  99 LYS HE2  H   6.086   5.357  -8.673 1.00 . A A .  99 LYS HE2  1 1 
        1  1474 1 1  99 LYS HE3  H   7.343   4.366  -7.934 1.00 . A A .  99 LYS HE3  1 1 
        1  1475 1 1  99 LYS HG2  H   4.150   5.471  -7.988 1.00 . A A .  99 LYS HG2  1 1 
        1  1476 1 1  99 LYS HG3  H   3.547   4.598  -6.578 1.00 . A A .  99 LYS HG3  1 1 
        1  1477 1 1  99 LYS HZ1  H   6.970   2.645  -9.439 1.00 . A A .  99 LYS HZ1  1 1 
        1  1478 1 1  99 LYS HZ2  H   6.883   4.037 -10.397 1.00 . A A .  99 LYS HZ2  1 1 
        1  1479 1 1  99 LYS HZ3  H   5.465   3.246  -9.922 1.00 . A A .  99 LYS HZ3  1 1 
        1  1480 1 1  99 LYS N    N   1.732   3.607 -10.499 1.00 . A A .  99 LYS N    1 1 
        1  1481 1 1  99 LYS NZ   N   6.425   3.511  -9.624 1.00 . A A .  99 LYS NZ   1 1 
        1  1482 1 1  99 LYS O    O   4.465   4.250 -11.153 1.00 . A A .  99 LYS O    1 1 
        1  1483 1 1 100 LEU C    C   5.863   7.862 -10.073 1.00 . A A . 100 LEU C    1 1 
        1  1484 1 1 100 LEU CA   C   5.104   6.955 -11.036 1.00 . A A . 100 LEU CA   1 1 
        1  1485 1 1 100 LEU CB   C   4.589   7.766 -12.227 1.00 . A A . 100 LEU CB   1 1 
        1  1486 1 1 100 LEU CD1  C   4.626  10.220 -11.718 1.00 . A A . 100 LEU CD1  1 1 
        1  1487 1 1 100 LEU CD2  C   2.667   9.223 -12.910 1.00 . A A . 100 LEU CD2  1 1 
        1  1488 1 1 100 LEU CG   C   3.745   8.989 -11.863 1.00 . A A . 100 LEU CG   1 1 
        1  1489 1 1 100 LEU H    H   3.408   6.839  -9.777 1.00 . A A . 100 LEU H    1 1 
        1  1490 1 1 100 LEU HA   H   5.773   6.187 -11.394 1.00 . A A . 100 LEU HA   1 1 
        1  1491 1 1 100 LEU HB2  H   5.440   8.099 -12.803 1.00 . A A . 100 LEU HB2  1 1 
        1  1492 1 1 100 LEU HB3  H   3.989   7.115 -12.846 1.00 . A A . 100 LEU HB3  1 1 
        1  1493 1 1 100 LEU HD11 H   5.635   9.915 -11.487 1.00 . A A . 100 LEU HD11 1 1 
        1  1494 1 1 100 LEU HD12 H   4.246  10.842 -10.921 1.00 . A A . 100 LEU HD12 1 1 
        1  1495 1 1 100 LEU HD13 H   4.621  10.777 -12.643 1.00 . A A . 100 LEU HD13 1 1 
        1  1496 1 1 100 LEU HD21 H   2.176   8.288 -13.137 1.00 . A A . 100 LEU HD21 1 1 
        1  1497 1 1 100 LEU HD22 H   3.117   9.620 -13.808 1.00 . A A . 100 LEU HD22 1 1 
        1  1498 1 1 100 LEU HD23 H   1.942   9.927 -12.530 1.00 . A A . 100 LEU HD23 1 1 
        1  1499 1 1 100 LEU HG   H   3.259   8.813 -10.914 1.00 . A A . 100 LEU HG   1 1 
        1  1500 1 1 100 LEU N    N   3.997   6.301 -10.348 1.00 . A A . 100 LEU N    1 1 
        1  1501 1 1 100 LEU O    O   5.266   8.700  -9.397 1.00 . A A . 100 LEU O    1 1 
        1  1502 1 1 101 GLY C    C   9.441   8.574  -9.533 1.00 . A A . 101 GLY C    1 1 
        1  1503 1 1 101 GLY CA   C   7.986   8.498  -9.113 1.00 . A A . 101 GLY CA   1 1 
        1  1504 1 1 101 GLY H    H   7.604   7.000 -10.563 1.00 . A A . 101 GLY H    1 1 
        1  1505 1 1 101 GLY HA2  H   7.578   9.497  -9.089 1.00 . A A . 101 GLY HA2  1 1 
        1  1506 1 1 101 GLY HA3  H   7.932   8.076  -8.120 1.00 . A A . 101 GLY HA3  1 1 
        1  1507 1 1 101 GLY N    N   7.180   7.687 -10.007 1.00 . A A . 101 GLY N    1 1 
        1  1508 1 1 101 GLY O    O   9.809   8.118 -10.616 1.00 . A A . 101 GLY O    1 1 
        1  1509 1 1 102 TYR C    C  12.459   9.677  -7.676 1.00 . A A . 102 TYR C    1 1 
        1  1510 1 1 102 TYR CA   C  11.694   9.298  -8.945 1.00 . A A . 102 TYR CA   1 1 
        1  1511 1 1 102 TYR CB   C  11.921  10.355 -10.028 1.00 . A A . 102 TYR CB   1 1 
        1  1512 1 1 102 TYR CD1  C  12.764   8.799 -11.829 1.00 . A A . 102 TYR CD1  1 1 
        1  1513 1 1 102 TYR CD2  C  14.076  10.716 -11.293 1.00 . A A . 102 TYR CD2  1 1 
        1  1514 1 1 102 TYR CE1  C  13.692   8.426 -12.782 1.00 . A A . 102 TYR CE1  1 1 
        1  1515 1 1 102 TYR CE2  C  15.009  10.349 -12.245 1.00 . A A . 102 TYR CE2  1 1 
        1  1516 1 1 102 TYR CG   C  12.940   9.949 -11.069 1.00 . A A . 102 TYR CG   1 1 
        1  1517 1 1 102 TYR CZ   C  14.812   9.204 -12.986 1.00 . A A . 102 TYR CZ   1 1 
        1  1518 1 1 102 TYR H    H   9.909   9.496  -7.825 1.00 . A A . 102 TYR H    1 1 
        1  1519 1 1 102 TYR HA   H  12.060   8.346  -9.300 1.00 . A A . 102 TYR HA   1 1 
        1  1520 1 1 102 TYR HB2  H  10.988  10.546 -10.536 1.00 . A A . 102 TYR HB2  1 1 
        1  1521 1 1 102 TYR HB3  H  12.266  11.268  -9.564 1.00 . A A . 102 TYR HB3  1 1 
        1  1522 1 1 102 TYR HD1  H  11.886   8.192 -11.667 1.00 . A A . 102 TYR HD1  1 1 
        1  1523 1 1 102 TYR HD2  H  14.228  11.613 -10.710 1.00 . A A . 102 TYR HD2  1 1 
        1  1524 1 1 102 TYR HE1  H  13.538   7.528 -13.363 1.00 . A A . 102 TYR HE1  1 1 
        1  1525 1 1 102 TYR HE2  H  15.886  10.959 -12.404 1.00 . A A . 102 TYR HE2  1 1 
        1  1526 1 1 102 TYR HH   H  15.604   9.354 -14.732 1.00 . A A . 102 TYR HH   1 1 
        1  1527 1 1 102 TYR N    N  10.268   9.155  -8.670 1.00 . A A . 102 TYR N    1 1 
        1  1528 1 1 102 TYR O    O  11.933  10.380  -6.812 1.00 . A A . 102 TYR O    1 1 
        1  1529 1 1 102 TYR OH   O  15.738   8.835 -13.935 1.00 . A A . 102 TYR OH   1 1 
        1  1530 1 1 103 PRO C    C  15.207  10.878  -6.451 1.00 . A A . 103 PRO C    1 1 
        1  1531 1 1 103 PRO CA   C  14.549   9.503  -6.376 1.00 . A A . 103 PRO CA   1 1 
        1  1532 1 1 103 PRO CB   C  15.604   8.402  -6.434 1.00 . A A . 103 PRO CB   1 1 
        1  1533 1 1 103 PRO CD   C  14.420   8.362  -8.524 1.00 . A A . 103 PRO CD   1 1 
        1  1534 1 1 103 PRO CG   C  15.766   8.118  -7.889 1.00 . A A . 103 PRO CG   1 1 
        1  1535 1 1 103 PRO HA   H  13.989   9.421  -5.457 1.00 . A A . 103 PRO HA   1 1 
        1  1536 1 1 103 PRO HB2  H  16.525   8.758  -5.995 1.00 . A A . 103 PRO HB2  1 1 
        1  1537 1 1 103 PRO HB3  H  15.254   7.533  -5.899 1.00 . A A . 103 PRO HB3  1 1 
        1  1538 1 1 103 PRO HD2  H  14.537   8.878  -9.466 1.00 . A A . 103 PRO HD2  1 1 
        1  1539 1 1 103 PRO HD3  H  13.897   7.428  -8.668 1.00 . A A . 103 PRO HD3  1 1 
        1  1540 1 1 103 PRO HG2  H  16.504   8.782  -8.312 1.00 . A A . 103 PRO HG2  1 1 
        1  1541 1 1 103 PRO HG3  H  16.064   7.089  -8.029 1.00 . A A . 103 PRO HG3  1 1 
        1  1542 1 1 103 PRO N    N  13.715   9.213  -7.545 1.00 . A A . 103 PRO N    1 1 
        1  1543 1 1 103 PRO O    O  15.146  11.550  -7.480 1.00 . A A . 103 PRO O    1 1 
        1  1544 1 1 104 ILE C    C  18.030  12.400  -5.355 1.00 . A A . 104 ILE C    1 1 
        1  1545 1 1 104 ILE CA   C  16.516  12.579  -5.299 1.00 . A A . 104 ILE CA   1 1 
        1  1546 1 1 104 ILE CB   C  16.141  13.357  -4.018 1.00 . A A . 104 ILE CB   1 1 
        1  1547 1 1 104 ILE CD1  C  14.150  14.668  -4.933 1.00 . A A . 104 ILE CD1  1 1 
        1  1548 1 1 104 ILE CG1  C  14.629  13.603  -3.967 1.00 . A A . 104 ILE CG1  1 1 
        1  1549 1 1 104 ILE CG2  C  16.903  14.675  -3.944 1.00 . A A . 104 ILE CG2  1 1 
        1  1550 1 1 104 ILE H    H  15.859  10.703  -4.564 1.00 . A A . 104 ILE H    1 1 
        1  1551 1 1 104 ILE HA   H  16.199  13.158  -6.154 1.00 . A A . 104 ILE HA   1 1 
        1  1552 1 1 104 ILE HB   H  16.427  12.758  -3.166 1.00 . A A . 104 ILE HB   1 1 
        1  1553 1 1 104 ILE HD11 H  14.470  14.418  -5.933 1.00 . A A . 104 ILE HD11 1 1 
        1  1554 1 1 104 ILE HD12 H  14.568  15.624  -4.651 1.00 . A A . 104 ILE HD12 1 1 
        1  1555 1 1 104 ILE HD13 H  13.072  14.724  -4.902 1.00 . A A . 104 ILE HD13 1 1 
        1  1556 1 1 104 ILE HG12 H  14.114  12.685  -4.207 1.00 . A A . 104 ILE HG12 1 1 
        1  1557 1 1 104 ILE HG13 H  14.356  13.913  -2.969 1.00 . A A . 104 ILE HG13 1 1 
        1  1558 1 1 104 ILE HG21 H  16.781  15.213  -4.872 1.00 . A A . 104 ILE HG21 1 1 
        1  1559 1 1 104 ILE HG22 H  17.952  14.475  -3.778 1.00 . A A . 104 ILE HG22 1 1 
        1  1560 1 1 104 ILE HG23 H  16.517  15.269  -3.129 1.00 . A A . 104 ILE HG23 1 1 
        1  1561 1 1 104 ILE N    N  15.841  11.287  -5.354 1.00 . A A . 104 ILE N    1 1 
        1  1562 1 1 104 ILE O    O  18.749  13.256  -5.872 1.00 . A A . 104 ILE O    1 1 
        1  1563 1 1 105 THR C    C  20.169   9.479  -4.736 1.00 . A A . 105 THR C    1 1 
        1  1564 1 1 105 THR CA   C  19.933  10.983  -4.810 1.00 . A A . 105 THR CA   1 1 
        1  1565 1 1 105 THR CB   C  20.612  11.676  -3.626 1.00 . A A . 105 THR CB   1 1 
        1  1566 1 1 105 THR CG2  C  22.118  11.745  -3.757 1.00 . A A . 105 THR CG2  1 1 
        1  1567 1 1 105 THR H    H  17.882  10.637  -4.426 1.00 . A A . 105 THR H    1 1 
        1  1568 1 1 105 THR HA   H  20.358  11.358  -5.728 1.00 . A A . 105 THR HA   1 1 
        1  1569 1 1 105 THR HB   H  20.383  11.128  -2.723 1.00 . A A . 105 THR HB   1 1 
        1  1570 1 1 105 THR HG1  H  20.144  13.243  -2.549 1.00 . A A . 105 THR HG1  1 1 
        1  1571 1 1 105 THR HG21 H  22.493  12.563  -3.160 1.00 . A A . 105 THR HG21 1 1 
        1  1572 1 1 105 THR HG22 H  22.382  11.904  -4.792 1.00 . A A . 105 THR HG22 1 1 
        1  1573 1 1 105 THR HG23 H  22.552  10.819  -3.412 1.00 . A A . 105 THR HG23 1 1 
        1  1574 1 1 105 THR N    N  18.506  11.281  -4.821 1.00 . A A . 105 THR N    1 1 
        1  1575 1 1 105 THR O    O  20.746   8.885  -5.646 1.00 . A A . 105 THR O    1 1 
        1  1576 1 1 105 THR OG1  O  20.132  13.000  -3.477 1.00 . A A . 105 THR OG1  1 1 
        1  1577 1 1 106 ASP C    C  19.304   7.016  -2.088 1.00 . A A . 106 ASP C    1 1 
        1  1578 1 1 106 ASP CA   C  19.870   7.433  -3.443 1.00 . A A . 106 ASP CA   1 1 
        1  1579 1 1 106 ASP CB   C  21.347   7.037  -3.543 1.00 . A A . 106 ASP CB   1 1 
        1  1580 1 1 106 ASP CG   C  21.697   6.440  -4.892 1.00 . A A . 106 ASP CG   1 1 
        1  1581 1 1 106 ASP H    H  19.262   9.400  -2.956 1.00 . A A . 106 ASP H    1 1 
        1  1582 1 1 106 ASP HA   H  19.317   6.927  -4.221 1.00 . A A . 106 ASP HA   1 1 
        1  1583 1 1 106 ASP HB2  H  21.959   7.913  -3.390 1.00 . A A . 106 ASP HB2  1 1 
        1  1584 1 1 106 ASP HB3  H  21.573   6.308  -2.778 1.00 . A A . 106 ASP HB3  1 1 
        1  1585 1 1 106 ASP N    N  19.714   8.870  -3.644 1.00 . A A . 106 ASP N    1 1 
        1  1586 1 1 106 ASP O    O  19.931   6.260  -1.345 1.00 . A A . 106 ASP O    1 1 
        1  1587 1 1 106 ASP OD1  O  20.961   5.542  -5.353 1.00 . A A . 106 ASP OD1  1 1 
        1  1588 1 1 106 ASP OD2  O  22.706   6.870  -5.488 1.00 . A A . 106 ASP OD2  1 1 
        1  1589 1 1 107 ASP C    C  16.118   7.907  -0.366 1.00 . A A . 107 ASP C    1 1 
        1  1590 1 1 107 ASP CA   C  17.463   7.195  -0.502 1.00 . A A . 107 ASP CA   1 1 
        1  1591 1 1 107 ASP CB   C  18.370   7.574   0.672 1.00 . A A . 107 ASP CB   1 1 
        1  1592 1 1 107 ASP CG   C  18.821   9.022   0.618 1.00 . A A . 107 ASP CG   1 1 
        1  1593 1 1 107 ASP H    H  17.661   8.111  -2.404 1.00 . A A . 107 ASP H    1 1 
        1  1594 1 1 107 ASP HA   H  17.293   6.129  -0.481 1.00 . A A . 107 ASP HA   1 1 
        1  1595 1 1 107 ASP HB2  H  17.834   7.420   1.597 1.00 . A A . 107 ASP HB2  1 1 
        1  1596 1 1 107 ASP HB3  H  19.246   6.942   0.660 1.00 . A A . 107 ASP HB3  1 1 
        1  1597 1 1 107 ASP N    N  18.112   7.515  -1.771 1.00 . A A . 107 ASP N    1 1 
        1  1598 1 1 107 ASP O    O  15.204   7.400   0.285 1.00 . A A . 107 ASP O    1 1 
        1  1599 1 1 107 ASP OD1  O  18.823   9.604  -0.487 1.00 . A A . 107 ASP OD1  1 1 
        1  1600 1 1 107 ASP OD2  O  19.173   9.573   1.681 1.00 . A A . 107 ASP OD2  1 1 
        1  1601 1 1 108 LEU C    C  14.101   9.911  -2.293 1.00 . A A . 108 LEU C    1 1 
        1  1602 1 1 108 LEU CA   C  14.758   9.851  -0.918 1.00 . A A . 108 LEU CA   1 1 
        1  1603 1 1 108 LEU CB   C  15.025  11.272  -0.396 1.00 . A A . 108 LEU CB   1 1 
        1  1604 1 1 108 LEU CD1  C  16.724  13.026   0.185 1.00 . A A . 108 LEU CD1  1 1 
        1  1605 1 1 108 LEU CD2  C  16.644  10.895   1.488 1.00 . A A . 108 LEU CD2  1 1 
        1  1606 1 1 108 LEU CG   C  16.445  11.533   0.121 1.00 . A A . 108 LEU CG   1 1 
        1  1607 1 1 108 LEU H    H  16.756   9.439  -1.488 1.00 . A A . 108 LEU H    1 1 
        1  1608 1 1 108 LEU HA   H  14.090   9.346  -0.236 1.00 . A A . 108 LEU HA   1 1 
        1  1609 1 1 108 LEU HB2  H  14.825  11.970  -1.196 1.00 . A A . 108 LEU HB2  1 1 
        1  1610 1 1 108 LEU HB3  H  14.334  11.470   0.409 1.00 . A A . 108 LEU HB3  1 1 
        1  1611 1 1 108 LEU HD11 H  17.791  13.193   0.185 1.00 . A A . 108 LEU HD11 1 1 
        1  1612 1 1 108 LEU HD12 H  16.296  13.434   1.089 1.00 . A A . 108 LEU HD12 1 1 
        1  1613 1 1 108 LEU HD13 H  16.284  13.512  -0.673 1.00 . A A . 108 LEU HD13 1 1 
        1  1614 1 1 108 LEU HD21 H  15.874  11.239   2.162 1.00 . A A . 108 LEU HD21 1 1 
        1  1615 1 1 108 LEU HD22 H  17.613  11.172   1.877 1.00 . A A . 108 LEU HD22 1 1 
        1  1616 1 1 108 LEU HD23 H  16.588   9.820   1.396 1.00 . A A . 108 LEU HD23 1 1 
        1  1617 1 1 108 LEU HG   H  17.156  11.092  -0.562 1.00 . A A . 108 LEU HG   1 1 
        1  1618 1 1 108 LEU N    N  15.997   9.081  -0.980 1.00 . A A . 108 LEU N    1 1 
        1  1619 1 1 108 LEU O    O  14.712  10.363  -3.260 1.00 . A A . 108 LEU O    1 1 
        1  1620 1 1 109 ASP C    C  10.667   9.793  -3.467 1.00 . A A . 109 ASP C    1 1 
        1  1621 1 1 109 ASP CA   C  12.141   9.442  -3.650 1.00 . A A . 109 ASP CA   1 1 
        1  1622 1 1 109 ASP CB   C  12.265   8.073  -4.324 1.00 . A A . 109 ASP CB   1 1 
        1  1623 1 1 109 ASP CG   C  11.635   6.965  -3.503 1.00 . A A . 109 ASP CG   1 1 
        1  1624 1 1 109 ASP H    H  12.421   9.086  -1.579 1.00 . A A . 109 ASP H    1 1 
        1  1625 1 1 109 ASP HA   H  12.596  10.185  -4.287 1.00 . A A . 109 ASP HA   1 1 
        1  1626 1 1 109 ASP HB2  H  11.775   8.106  -5.285 1.00 . A A . 109 ASP HB2  1 1 
        1  1627 1 1 109 ASP HB3  H  13.310   7.842  -4.465 1.00 . A A . 109 ASP HB3  1 1 
        1  1628 1 1 109 ASP N    N  12.859   9.443  -2.380 1.00 . A A . 109 ASP N    1 1 
        1  1629 1 1 109 ASP O    O  10.083   9.550  -2.411 1.00 . A A . 109 ASP O    1 1 
        1  1630 1 1 109 ASP OD1  O  10.410   6.755  -3.630 1.00 . A A . 109 ASP OD1  1 1 
        1  1631 1 1 109 ASP OD2  O  12.367   6.306  -2.734 1.00 . A A . 109 ASP OD2  1 1 
        1  1632 1 1 110 ILE C    C   7.888   9.938  -5.539 1.00 . A A . 110 ILE C    1 1 
        1  1633 1 1 110 ILE CA   C   8.666  10.736  -4.496 1.00 . A A . 110 ILE CA   1 1 
        1  1634 1 1 110 ILE CB   C   8.484  12.245  -4.769 1.00 . A A . 110 ILE CB   1 1 
        1  1635 1 1 110 ILE CD1  C   7.942  13.361  -6.993 1.00 . A A . 110 ILE CD1  1 1 
        1  1636 1 1 110 ILE CG1  C   8.966  12.601  -6.180 1.00 . A A . 110 ILE CG1  1 1 
        1  1637 1 1 110 ILE CG2  C   9.230  13.067  -3.726 1.00 . A A . 110 ILE CG2  1 1 
        1  1638 1 1 110 ILE H    H  10.596  10.514  -5.329 1.00 . A A . 110 ILE H    1 1 
        1  1639 1 1 110 ILE HA   H   8.271  10.514  -3.515 1.00 . A A . 110 ILE HA   1 1 
        1  1640 1 1 110 ILE HB   H   7.433  12.477  -4.687 1.00 . A A . 110 ILE HB   1 1 
        1  1641 1 1 110 ILE HD11 H   7.814  12.880  -7.952 1.00 . A A . 110 ILE HD11 1 1 
        1  1642 1 1 110 ILE HD12 H   8.281  14.375  -7.142 1.00 . A A . 110 ILE HD12 1 1 
        1  1643 1 1 110 ILE HD13 H   6.999  13.370  -6.466 1.00 . A A . 110 ILE HD13 1 1 
        1  1644 1 1 110 ILE HG12 H   9.851  13.215  -6.107 1.00 . A A . 110 ILE HG12 1 1 
        1  1645 1 1 110 ILE HG13 H   9.207  11.693  -6.713 1.00 . A A . 110 ILE HG13 1 1 
        1  1646 1 1 110 ILE HG21 H   8.544  13.755  -3.254 1.00 . A A . 110 ILE HG21 1 1 
        1  1647 1 1 110 ILE HG22 H  10.024  13.621  -4.203 1.00 . A A . 110 ILE HG22 1 1 
        1  1648 1 1 110 ILE HG23 H   9.649  12.409  -2.979 1.00 . A A . 110 ILE HG23 1 1 
        1  1649 1 1 110 ILE N    N  10.073  10.357  -4.515 1.00 . A A . 110 ILE N    1 1 
        1  1650 1 1 110 ILE O    O   8.422   9.611  -6.598 1.00 . A A . 110 ILE O    1 1 
        1  1651 1 1 111 TYR C    C   4.327   9.135  -5.982 1.00 . A A . 111 TYR C    1 1 
        1  1652 1 1 111 TYR CA   C   5.814   8.852  -6.172 1.00 . A A . 111 TYR CA   1 1 
        1  1653 1 1 111 TYR CB   C   6.083   7.355  -6.002 1.00 . A A . 111 TYR CB   1 1 
        1  1654 1 1 111 TYR CD1  C   4.240   6.533  -4.485 1.00 . A A . 111 TYR CD1  1 1 
        1  1655 1 1 111 TYR CD2  C   6.473   6.521  -3.650 1.00 . A A . 111 TYR CD2  1 1 
        1  1656 1 1 111 TYR CE1  C   3.784   6.020  -3.286 1.00 . A A . 111 TYR CE1  1 1 
        1  1657 1 1 111 TYR CE2  C   6.025   6.007  -2.448 1.00 . A A . 111 TYR CE2  1 1 
        1  1658 1 1 111 TYR CG   C   5.590   6.792  -4.687 1.00 . A A . 111 TYR CG   1 1 
        1  1659 1 1 111 TYR CZ   C   4.680   5.759  -2.271 1.00 . A A . 111 TYR CZ   1 1 
        1  1660 1 1 111 TYR H    H   6.252   9.899  -4.380 1.00 . A A . 111 TYR H    1 1 
        1  1661 1 1 111 TYR HA   H   6.095   9.143  -7.173 1.00 . A A . 111 TYR HA   1 1 
        1  1662 1 1 111 TYR HB2  H   5.591   6.815  -6.798 1.00 . A A . 111 TYR HB2  1 1 
        1  1663 1 1 111 TYR HB3  H   7.148   7.179  -6.061 1.00 . A A . 111 TYR HB3  1 1 
        1  1664 1 1 111 TYR HD1  H   3.541   6.738  -5.282 1.00 . A A . 111 TYR HD1  1 1 
        1  1665 1 1 111 TYR HD2  H   7.526   6.717  -3.792 1.00 . A A . 111 TYR HD2  1 1 
        1  1666 1 1 111 TYR HE1  H   2.731   5.826  -3.148 1.00 . A A . 111 TYR HE1  1 1 
        1  1667 1 1 111 TYR HE2  H   6.727   5.803  -1.653 1.00 . A A . 111 TYR HE2  1 1 
        1  1668 1 1 111 TYR HH   H   3.763   4.424  -1.234 1.00 . A A . 111 TYR HH   1 1 
        1  1669 1 1 111 TYR N    N   6.632   9.619  -5.240 1.00 . A A . 111 TYR N    1 1 
        1  1670 1 1 111 TYR O    O   3.890   9.546  -4.907 1.00 . A A . 111 TYR O    1 1 
        1  1671 1 1 111 TYR OH   O   4.230   5.248  -1.075 1.00 . A A . 111 TYR OH   1 1 
        1  1672 1 1 112 THR C    C   1.393   7.945  -7.677 1.00 . A A . 112 THR C    1 1 
        1  1673 1 1 112 THR CA   C   2.114   9.111  -7.007 1.00 . A A . 112 THR CA   1 1 
        1  1674 1 1 112 THR CB   C   1.753  10.422  -7.706 1.00 . A A . 112 THR CB   1 1 
        1  1675 1 1 112 THR CG2  C   2.365  11.640  -7.048 1.00 . A A . 112 THR CG2  1 1 
        1  1676 1 1 112 THR H    H   3.969   8.564  -7.864 1.00 . A A . 112 THR H    1 1 
        1  1677 1 1 112 THR HA   H   1.808   9.164  -5.973 1.00 . A A . 112 THR HA   1 1 
        1  1678 1 1 112 THR HB   H   0.679  10.542  -7.690 1.00 . A A . 112 THR HB   1 1 
        1  1679 1 1 112 THR HG1  H   1.505  10.808  -9.610 1.00 . A A . 112 THR HG1  1 1 
        1  1680 1 1 112 THR HG21 H   2.234  11.575  -5.978 1.00 . A A . 112 THR HG21 1 1 
        1  1681 1 1 112 THR HG22 H   1.879  12.531  -7.417 1.00 . A A . 112 THR HG22 1 1 
        1  1682 1 1 112 THR HG23 H   3.419  11.683  -7.279 1.00 . A A . 112 THR HG23 1 1 
        1  1683 1 1 112 THR N    N   3.556   8.898  -7.039 1.00 . A A . 112 THR N    1 1 
        1  1684 1 1 112 THR O    O   1.807   7.478  -8.739 1.00 . A A . 112 THR O    1 1 
        1  1685 1 1 112 THR OG1  O   2.178  10.405  -9.057 1.00 . A A . 112 THR OG1  1 1 
        1  1686 1 1 113 ARG C    C  -1.865   6.766  -7.954 1.00 . A A . 113 ARG C    1 1 
        1  1687 1 1 113 ARG CA   C  -0.441   6.351  -7.593 1.00 . A A . 113 ARG CA   1 1 
        1  1688 1 1 113 ARG CB   C  -0.470   5.192  -6.593 1.00 . A A . 113 ARG CB   1 1 
        1  1689 1 1 113 ARG CD   C  -2.426   4.575  -5.127 1.00 . A A . 113 ARG CD   1 1 
        1  1690 1 1 113 ARG CG   C  -1.233   5.503  -5.312 1.00 . A A . 113 ARG CG   1 1 
        1  1691 1 1 113 ARG CZ   C  -4.100   5.746  -3.744 1.00 . A A . 113 ARG CZ   1 1 
        1  1692 1 1 113 ARG H    H   0.040   7.876  -6.203 1.00 . A A . 113 ARG H    1 1 
        1  1693 1 1 113 ARG HA   H   0.058   6.021  -8.491 1.00 . A A . 113 ARG HA   1 1 
        1  1694 1 1 113 ARG HB2  H  -0.932   4.338  -7.065 1.00 . A A . 113 ARG HB2  1 1 
        1  1695 1 1 113 ARG HB3  H   0.545   4.937  -6.327 1.00 . A A . 113 ARG HB3  1 1 
        1  1696 1 1 113 ARG HD2  H  -2.525   3.955  -6.005 1.00 . A A . 113 ARG HD2  1 1 
        1  1697 1 1 113 ARG HD3  H  -2.248   3.948  -4.266 1.00 . A A . 113 ARG HD3  1 1 
        1  1698 1 1 113 ARG HE   H  -4.218   5.497  -5.721 1.00 . A A . 113 ARG HE   1 1 
        1  1699 1 1 113 ARG HG2  H  -0.566   5.385  -4.471 1.00 . A A . 113 ARG HG2  1 1 
        1  1700 1 1 113 ARG HG3  H  -1.584   6.522  -5.353 1.00 . A A . 113 ARG HG3  1 1 
        1  1701 1 1 113 ARG HH11 H  -2.523   5.024  -2.703 1.00 . A A . 113 ARG HH11 1 1 
        1  1702 1 1 113 ARG HH12 H  -3.719   5.849  -1.762 1.00 . A A . 113 ARG HH12 1 1 
        1  1703 1 1 113 ARG HH21 H  -5.786   6.582  -4.481 1.00 . A A . 113 ARG HH21 1 1 
        1  1704 1 1 113 ARG HH22 H  -5.569   6.734  -2.770 1.00 . A A . 113 ARG HH22 1 1 
        1  1705 1 1 113 ARG N    N   0.321   7.470  -7.050 1.00 . A A . 113 ARG N    1 1 
        1  1706 1 1 113 ARG NE   N  -3.671   5.314  -4.929 1.00 . A A . 113 ARG NE   1 1 
        1  1707 1 1 113 ARG NH1  N  -3.388   5.521  -2.647 1.00 . A A . 113 ARG NH1  1 1 
        1  1708 1 1 113 ARG NH2  N  -5.245   6.409  -3.658 1.00 . A A . 113 ARG NH2  1 1 
        1  1709 1 1 113 ARG O    O  -2.584   7.344  -7.137 1.00 . A A . 113 ARG O    1 1 
        1  1710 1 1 114 LEU C    C  -4.287   5.538 -10.227 1.00 . A A . 114 LEU C    1 1 
        1  1711 1 1 114 LEU CA   C  -3.602   6.784  -9.671 1.00 . A A . 114 LEU CA   1 1 
        1  1712 1 1 114 LEU CB   C  -3.529   7.873 -10.749 1.00 . A A . 114 LEU CB   1 1 
        1  1713 1 1 114 LEU CD1  C  -4.937   9.680 -11.794 1.00 . A A . 114 LEU CD1  1 1 
        1  1714 1 1 114 LEU CD2  C  -5.030   7.344 -12.690 1.00 . A A . 114 LEU CD2  1 1 
        1  1715 1 1 114 LEU CG   C  -4.858   8.199 -11.442 1.00 . A A . 114 LEU CG   1 1 
        1  1716 1 1 114 LEU H    H  -1.641   5.991  -9.785 1.00 . A A . 114 LEU H    1 1 
        1  1717 1 1 114 LEU HA   H  -4.176   7.154  -8.834 1.00 . A A . 114 LEU HA   1 1 
        1  1718 1 1 114 LEU HB2  H  -3.155   8.777 -10.292 1.00 . A A . 114 LEU HB2  1 1 
        1  1719 1 1 114 LEU HB3  H  -2.825   7.555 -11.504 1.00 . A A . 114 LEU HB3  1 1 
        1  1720 1 1 114 LEU HD11 H  -5.787  10.124 -11.297 1.00 . A A . 114 LEU HD11 1 1 
        1  1721 1 1 114 LEU HD12 H  -5.048   9.793 -12.863 1.00 . A A . 114 LEU HD12 1 1 
        1  1722 1 1 114 LEU HD13 H  -4.033  10.178 -11.473 1.00 . A A . 114 LEU HD13 1 1 
        1  1723 1 1 114 LEU HD21 H  -6.067   7.060 -12.791 1.00 . A A . 114 LEU HD21 1 1 
        1  1724 1 1 114 LEU HD22 H  -4.420   6.457 -12.607 1.00 . A A . 114 LEU HD22 1 1 
        1  1725 1 1 114 LEU HD23 H  -4.726   7.911 -13.558 1.00 . A A . 114 LEU HD23 1 1 
        1  1726 1 1 114 LEU HG   H  -5.671   7.973 -10.767 1.00 . A A . 114 LEU HG   1 1 
        1  1727 1 1 114 LEU N    N  -2.264   6.457  -9.186 1.00 . A A . 114 LEU N    1 1 
        1  1728 1 1 114 LEU O    O  -3.751   4.865 -11.110 1.00 . A A . 114 LEU O    1 1 
        1  1729 1 1 115 GLY C    C  -7.506   3.868  -9.407 1.00 . A A . 115 GLY C    1 1 
        1  1730 1 1 115 GLY CA   C  -6.201   4.061 -10.154 1.00 . A A . 115 GLY CA   1 1 
        1  1731 1 1 115 GLY H    H  -5.846   5.797  -8.992 1.00 . A A . 115 GLY H    1 1 
        1  1732 1 1 115 GLY HA2  H  -6.415   4.172 -11.207 1.00 . A A . 115 GLY HA2  1 1 
        1  1733 1 1 115 GLY HA3  H  -5.585   3.185 -10.014 1.00 . A A . 115 GLY HA3  1 1 
        1  1734 1 1 115 GLY N    N  -5.469   5.229  -9.699 1.00 . A A . 115 GLY N    1 1 
        1  1735 1 1 115 GLY O    O  -8.268   4.817  -9.226 1.00 . A A . 115 GLY O    1 1 
        1  1736 1 1 116 GLY C    C  -8.869   1.182  -7.304 1.00 . A A . 116 GLY C    1 1 
        1  1737 1 1 116 GLY CA   C  -8.994   2.361  -8.248 1.00 . A A . 116 GLY CA   1 1 
        1  1738 1 1 116 GLY H    H  -7.126   1.915  -9.145 1.00 . A A . 116 GLY H    1 1 
        1  1739 1 1 116 GLY HA2  H  -9.263   3.235  -7.675 1.00 . A A . 116 GLY HA2  1 1 
        1  1740 1 1 116 GLY HA3  H  -9.780   2.156  -8.960 1.00 . A A . 116 GLY HA3  1 1 
        1  1741 1 1 116 GLY N    N  -7.768   2.638  -8.972 1.00 . A A . 116 GLY N    1 1 
        1  1742 1 1 116 GLY O    O  -7.891   0.437  -7.353 1.00 . A A . 116 GLY O    1 1 
        1  1743 1 1 117 MET C    C -11.081  -0.986  -5.702 1.00 . A A . 117 MET C    1 1 
        1  1744 1 1 117 MET CA   C  -9.876  -0.079  -5.479 1.00 . A A . 117 MET CA   1 1 
        1  1745 1 1 117 MET CB   C  -9.894   0.471  -4.051 1.00 . A A . 117 MET CB   1 1 
        1  1746 1 1 117 MET CE   C  -7.139   2.675  -1.937 1.00 . A A . 117 MET CE   1 1 
        1  1747 1 1 117 MET CG   C  -8.858   1.556  -3.802 1.00 . A A . 117 MET CG   1 1 
        1  1748 1 1 117 MET H    H -10.620   1.644  -6.456 1.00 . A A . 117 MET H    1 1 
        1  1749 1 1 117 MET HA   H  -8.974  -0.655  -5.623 1.00 . A A . 117 MET HA   1 1 
        1  1750 1 1 117 MET HB2  H -10.872   0.884  -3.850 1.00 . A A . 117 MET HB2  1 1 
        1  1751 1 1 117 MET HB3  H  -9.709  -0.341  -3.363 1.00 . A A . 117 MET HB3  1 1 
        1  1752 1 1 117 MET HE1  H  -7.719   3.447  -2.420 1.00 . A A . 117 MET HE1  1 1 
        1  1753 1 1 117 MET HE2  H  -6.089   2.838  -2.131 1.00 . A A . 117 MET HE2  1 1 
        1  1754 1 1 117 MET HE3  H  -7.317   2.704  -0.872 1.00 . A A . 117 MET HE3  1 1 
        1  1755 1 1 117 MET HG2  H  -8.355   1.774  -4.732 1.00 . A A . 117 MET HG2  1 1 
        1  1756 1 1 117 MET HG3  H  -9.363   2.443  -3.452 1.00 . A A . 117 MET HG3  1 1 
        1  1757 1 1 117 MET N    N  -9.868   1.015  -6.443 1.00 . A A . 117 MET N    1 1 
        1  1758 1 1 117 MET O    O -12.175  -0.515  -6.019 1.00 . A A . 117 MET O    1 1 
        1  1759 1 1 117 MET SD   S  -7.622   1.074  -2.579 1.00 . A A . 117 MET SD   1 1 
        1  1760 1 1 118 VAL C    C -11.938  -4.285  -4.583 1.00 . A A . 118 VAL C    1 1 
        1  1761 1 1 118 VAL CA   C -11.939  -3.265  -5.717 1.00 . A A . 118 VAL CA   1 1 
        1  1762 1 1 118 VAL CB   C -11.808  -4.012  -7.062 1.00 . A A . 118 VAL CB   1 1 
        1  1763 1 1 118 VAL CG1  C -13.164  -4.528  -7.519 1.00 . A A . 118 VAL CG1  1 1 
        1  1764 1 1 118 VAL CG2  C -11.187  -3.116  -8.128 1.00 . A A . 118 VAL CG2  1 1 
        1  1765 1 1 118 VAL H    H  -9.978  -2.602  -5.280 1.00 . A A . 118 VAL H    1 1 
        1  1766 1 1 118 VAL HA   H -12.881  -2.736  -5.712 1.00 . A A . 118 VAL HA   1 1 
        1  1767 1 1 118 VAL HB   H -11.158  -4.862  -6.915 1.00 . A A . 118 VAL HB   1 1 
        1  1768 1 1 118 VAL HG11 H -13.750  -4.812  -6.657 1.00 . A A . 118 VAL HG11 1 1 
        1  1769 1 1 118 VAL HG12 H -13.026  -5.387  -8.158 1.00 . A A . 118 VAL HG12 1 1 
        1  1770 1 1 118 VAL HG13 H -13.679  -3.752  -8.064 1.00 . A A . 118 VAL HG13 1 1 
        1  1771 1 1 118 VAL HG21 H -10.114  -3.246  -8.128 1.00 . A A . 118 VAL HG21 1 1 
        1  1772 1 1 118 VAL HG22 H -11.424  -2.085  -7.916 1.00 . A A . 118 VAL HG22 1 1 
        1  1773 1 1 118 VAL HG23 H -11.580  -3.384  -9.098 1.00 . A A . 118 VAL HG23 1 1 
        1  1774 1 1 118 VAL N    N -10.872  -2.289  -5.534 1.00 . A A . 118 VAL N    1 1 
        1  1775 1 1 118 VAL O    O -11.015  -5.089  -4.461 1.00 . A A . 118 VAL O    1 1 
        1  1776 1 1 119 TRP C    C -14.444  -5.852  -2.604 1.00 . A A . 119 TRP C    1 1 
        1  1777 1 1 119 TRP CA   C -13.082  -5.166  -2.624 1.00 . A A . 119 TRP CA   1 1 
        1  1778 1 1 119 TRP CB   C -12.853  -4.423  -1.307 1.00 . A A . 119 TRP CB   1 1 
        1  1779 1 1 119 TRP CD1  C -13.284  -1.897  -1.335 1.00 . A A . 119 TRP CD1  1 1 
        1  1780 1 1 119 TRP CD2  C -15.082  -3.131  -0.827 1.00 . A A . 119 TRP CD2  1 1 
        1  1781 1 1 119 TRP CE2  C -15.450  -1.772  -0.808 1.00 . A A . 119 TRP CE2  1 1 
        1  1782 1 1 119 TRP CE3  C -16.051  -4.096  -0.539 1.00 . A A . 119 TRP CE3  1 1 
        1  1783 1 1 119 TRP CG   C -13.692  -3.189  -1.167 1.00 . A A . 119 TRP CG   1 1 
        1  1784 1 1 119 TRP CH2  C -17.673  -2.322  -0.233 1.00 . A A . 119 TRP CH2  1 1 
        1  1785 1 1 119 TRP CZ2  C -16.745  -1.356  -0.511 1.00 . A A . 119 TRP CZ2  1 1 
        1  1786 1 1 119 TRP CZ3  C -17.337  -3.681  -0.244 1.00 . A A . 119 TRP CZ3  1 1 
        1  1787 1 1 119 TRP H    H -13.679  -3.579  -3.894 1.00 . A A . 119 TRP H    1 1 
        1  1788 1 1 119 TRP HA   H -12.316  -5.919  -2.739 1.00 . A A . 119 TRP HA   1 1 
        1  1789 1 1 119 TRP HB2  H -13.089  -5.081  -0.485 1.00 . A A . 119 TRP HB2  1 1 
        1  1790 1 1 119 TRP HB3  H -11.815  -4.131  -1.243 1.00 . A A . 119 TRP HB3  1 1 
        1  1791 1 1 119 TRP HD1  H -12.277  -1.607  -1.597 1.00 . A A . 119 TRP HD1  1 1 
        1  1792 1 1 119 TRP HE1  H -14.294  -0.062  -1.182 1.00 . A A . 119 TRP HE1  1 1 
        1  1793 1 1 119 TRP HE3  H -15.810  -5.149  -0.543 1.00 . A A . 119 TRP HE3  1 1 
        1  1794 1 1 119 TRP HH2  H -18.690  -2.043   0.003 1.00 . A A . 119 TRP HH2  1 1 
        1  1795 1 1 119 TRP HZ2  H -17.021  -0.312  -0.498 1.00 . A A . 119 TRP HZ2  1 1 
        1  1796 1 1 119 TRP HZ3  H -18.099  -4.412  -0.019 1.00 . A A . 119 TRP HZ3  1 1 
        1  1797 1 1 119 TRP N    N -12.974  -4.245  -3.750 1.00 . A A . 119 TRP N    1 1 
        1  1798 1 1 119 TRP NE1  N -14.335  -1.039  -1.120 1.00 . A A . 119 TRP NE1  1 1 
        1  1799 1 1 119 TRP O    O -15.399  -5.380  -3.221 1.00 . A A . 119 TRP O    1 1 
        1  1800 1 1 120 ARG C    C -16.330  -7.656  -0.366 1.00 . A A . 120 ARG C    1 1 
        1  1801 1 1 120 ARG CA   C -15.771  -7.723  -1.784 1.00 . A A . 120 ARG CA   1 1 
        1  1802 1 1 120 ARG CB   C -15.545  -9.182  -2.186 1.00 . A A . 120 ARG CB   1 1 
        1  1803 1 1 120 ARG CD   C -14.434 -11.341  -1.538 1.00 . A A . 120 ARG CD   1 1 
        1  1804 1 1 120 ARG CG   C -14.347  -9.824  -1.506 1.00 . A A . 120 ARG CG   1 1 
        1  1805 1 1 120 ARG CZ   C -15.930 -13.119  -0.713 1.00 . A A . 120 ARG CZ   1 1 
        1  1806 1 1 120 ARG H    H -13.730  -7.296  -1.417 1.00 . A A . 120 ARG H    1 1 
        1  1807 1 1 120 ARG HA   H -16.485  -7.278  -2.461 1.00 . A A . 120 ARG HA   1 1 
        1  1808 1 1 120 ARG HB2  H -16.425  -9.754  -1.931 1.00 . A A . 120 ARG HB2  1 1 
        1  1809 1 1 120 ARG HB3  H -15.394  -9.229  -3.255 1.00 . A A . 120 ARG HB3  1 1 
        1  1810 1 1 120 ARG HD2  H -14.564 -11.660  -2.562 1.00 . A A . 120 ARG HD2  1 1 
        1  1811 1 1 120 ARG HD3  H -13.514 -11.750  -1.149 1.00 . A A . 120 ARG HD3  1 1 
        1  1812 1 1 120 ARG HE   H -16.046 -11.195  -0.197 1.00 . A A . 120 ARG HE   1 1 
        1  1813 1 1 120 ARG HG2  H -13.447  -9.514  -2.017 1.00 . A A . 120 ARG HG2  1 1 
        1  1814 1 1 120 ARG HG3  H -14.310  -9.495  -0.478 1.00 . A A . 120 ARG HG3  1 1 
        1  1815 1 1 120 ARG HH11 H -14.508 -13.752  -2.005 1.00 . A A . 120 ARG HH11 1 1 
        1  1816 1 1 120 ARG HH12 H -15.571 -14.983  -1.411 1.00 . A A . 120 ARG HH12 1 1 
        1  1817 1 1 120 ARG HH21 H -17.447 -12.811   0.586 1.00 . A A . 120 ARG HH21 1 1 
        1  1818 1 1 120 ARG HH22 H -17.241 -14.449   0.060 1.00 . A A . 120 ARG HH22 1 1 
        1  1819 1 1 120 ARG N    N -14.526  -6.970  -1.888 1.00 . A A . 120 ARG N    1 1 
        1  1820 1 1 120 ARG NE   N -15.552 -11.843  -0.741 1.00 . A A . 120 ARG NE   1 1 
        1  1821 1 1 120 ARG NH1  N -15.283 -14.025  -1.436 1.00 . A A . 120 ARG NH1  1 1 
        1  1822 1 1 120 ARG NH2  N -16.957 -13.490   0.039 1.00 . A A . 120 ARG NH2  1 1 
        1  1823 1 1 120 ARG O    O -15.591  -7.438   0.594 1.00 . A A . 120 ARG O    1 1 
        1  1824 1 1 121 ALA C    C -18.331  -9.187   1.698 1.00 . A A . 121 ALA C    1 1 
        1  1825 1 1 121 ALA CA   C -18.298  -7.804   1.057 1.00 . A A . 121 ALA CA   1 1 
        1  1826 1 1 121 ALA CB   C -19.709  -7.252   0.917 1.00 . A A . 121 ALA CB   1 1 
        1  1827 1 1 121 ALA H    H -18.176  -8.012  -1.045 1.00 . A A . 121 ALA H    1 1 
        1  1828 1 1 121 ALA HA   H -17.737  -7.136   1.695 1.00 . A A . 121 ALA HA   1 1 
        1  1829 1 1 121 ALA HB1  H -20.078  -7.457  -0.077 1.00 . A A . 121 ALA HB1  1 1 
        1  1830 1 1 121 ALA HB2  H -19.696  -6.185   1.083 1.00 . A A . 121 ALA HB2  1 1 
        1  1831 1 1 121 ALA HB3  H -20.353  -7.722   1.645 1.00 . A A . 121 ALA HB3  1 1 
        1  1832 1 1 121 ALA N    N -17.640  -7.843  -0.243 1.00 . A A . 121 ALA N    1 1 
        1  1833 1 1 121 ALA O    O -18.234 -10.203   1.009 1.00 . A A . 121 ALA O    1 1 
        1  1834 1 1 122 ASP C    C -19.877 -11.145   3.605 1.00 . A A . 122 ASP C    1 1 
        1  1835 1 1 122 ASP CA   C -18.513 -10.479   3.752 1.00 . A A . 122 ASP CA   1 1 
        1  1836 1 1 122 ASP CB   C -18.203 -10.244   5.232 1.00 . A A . 122 ASP CB   1 1 
        1  1837 1 1 122 ASP CG   C -17.265 -11.292   5.799 1.00 . A A . 122 ASP CG   1 1 
        1  1838 1 1 122 ASP H    H -18.539  -8.376   3.513 1.00 . A A . 122 ASP H    1 1 
        1  1839 1 1 122 ASP HA   H -17.760 -11.131   3.336 1.00 . A A . 122 ASP HA   1 1 
        1  1840 1 1 122 ASP HB2  H -17.741  -9.275   5.348 1.00 . A A . 122 ASP HB2  1 1 
        1  1841 1 1 122 ASP HB3  H -19.124 -10.269   5.796 1.00 . A A . 122 ASP HB3  1 1 
        1  1842 1 1 122 ASP N    N -18.467  -9.219   3.019 1.00 . A A . 122 ASP N    1 1 
        1  1843 1 1 122 ASP O    O -20.911 -10.528   3.856 1.00 . A A . 122 ASP O    1 1 
        1  1844 1 1 122 ASP OD1  O -16.160 -11.463   5.243 1.00 . A A . 122 ASP OD1  1 1 
        1  1845 1 1 122 ASP OD2  O -17.637 -11.943   6.798 1.00 . A A . 122 ASP OD2  1 1 
        1  1846 1 1 123 SER C    C -21.871 -13.276   4.330 1.00 . A A . 123 SER C    1 1 
        1  1847 1 1 123 SER CA   C -21.107 -13.161   3.015 1.00 . A A . 123 SER CA   1 1 
        1  1848 1 1 123 SER CB   C -20.805 -14.556   2.464 1.00 . A A . 123 SER CB   1 1 
        1  1849 1 1 123 SER H    H -19.013 -12.848   3.011 1.00 . A A . 123 SER H    1 1 
        1  1850 1 1 123 SER HA   H -21.718 -12.627   2.303 1.00 . A A . 123 SER HA   1 1 
        1  1851 1 1 123 SER HB2  H -20.517 -14.476   1.426 1.00 . A A . 123 SER HB2  1 1 
        1  1852 1 1 123 SER HB3  H -19.996 -14.996   3.029 1.00 . A A . 123 SER HB3  1 1 
        1  1853 1 1 123 SER HG   H -21.758 -16.113   3.173 1.00 . A A . 123 SER HG   1 1 
        1  1854 1 1 123 SER N    N -19.870 -12.410   3.196 1.00 . A A . 123 SER N    1 1 
        1  1855 1 1 123 SER O    O -21.318 -13.036   5.403 1.00 . A A . 123 SER O    1 1 
        1  1856 1 1 123 SER OG   O -21.940 -15.399   2.558 1.00 . A A . 123 SER OG   1 1 
        1  1857 1 1 124 LYS C    C -23.591 -15.032   6.217 1.00 . A A . 124 LYS C    1 1 
        1  1858 1 1 124 LYS CA   C -23.984 -13.792   5.421 1.00 . A A . 124 LYS CA   1 1 
        1  1859 1 1 124 LYS CB   C -25.458 -13.877   5.018 1.00 . A A . 124 LYS CB   1 1 
        1  1860 1 1 124 LYS CD   C -27.544 -12.550   4.577 1.00 . A A . 124 LYS CD   1 1 
        1  1861 1 1 124 LYS CE   C -28.159 -13.497   3.560 1.00 . A A . 124 LYS CE   1 1 
        1  1862 1 1 124 LYS CG   C -26.026 -12.564   4.505 1.00 . A A . 124 LYS CG   1 1 
        1  1863 1 1 124 LYS H    H -23.528 -13.822   3.354 1.00 . A A . 124 LYS H    1 1 
        1  1864 1 1 124 LYS HA   H -23.840 -12.920   6.041 1.00 . A A . 124 LYS HA   1 1 
        1  1865 1 1 124 LYS HB2  H -25.564 -14.619   4.241 1.00 . A A . 124 LYS HB2  1 1 
        1  1866 1 1 124 LYS HB3  H -26.036 -14.184   5.877 1.00 . A A . 124 LYS HB3  1 1 
        1  1867 1 1 124 LYS HD2  H -27.851 -12.852   5.567 1.00 . A A . 124 LYS HD2  1 1 
        1  1868 1 1 124 LYS HD3  H -27.895 -11.547   4.380 1.00 . A A . 124 LYS HD3  1 1 
        1  1869 1 1 124 LYS HE2  H -29.136 -13.127   3.286 1.00 . A A . 124 LYS HE2  1 1 
        1  1870 1 1 124 LYS HE3  H -27.527 -13.524   2.684 1.00 . A A . 124 LYS HE3  1 1 
        1  1871 1 1 124 LYS HG2  H -25.640 -11.756   5.107 1.00 . A A . 124 LYS HG2  1 1 
        1  1872 1 1 124 LYS HG3  H -25.722 -12.429   3.478 1.00 . A A . 124 LYS HG3  1 1 
        1  1873 1 1 124 LYS HZ1  H -28.338 -14.853   5.138 1.00 . A A . 124 LYS HZ1  1 1 
        1  1874 1 1 124 LYS HZ2  H -27.488 -15.460   3.806 1.00 . A A . 124 LYS HZ2  1 1 
        1  1875 1 1 124 LYS HZ3  H -29.172 -15.315   3.742 1.00 . A A . 124 LYS HZ3  1 1 
        1  1876 1 1 124 LYS N    N -23.144 -13.645   4.238 1.00 . A A . 124 LYS N    1 1 
        1  1877 1 1 124 LYS NZ   N -28.299 -14.878   4.099 1.00 . A A . 124 LYS NZ   1 1 
        1  1878 1 1 124 LYS O    O -23.363 -16.100   5.649 1.00 . A A . 124 LYS O    1 1 
        1  1879 1 1 125 GLY C    C -23.803 -15.921   9.753 1.00 . A A . 125 GLY C    1 1 
        1  1880 1 1 125 GLY CA   C -23.148 -15.998   8.388 1.00 . A A . 125 GLY CA   1 1 
        1  1881 1 1 125 GLY H    H -23.706 -14.007   7.932 1.00 . A A . 125 GLY H    1 1 
        1  1882 1 1 125 GLY HA2  H -23.448 -16.917   7.908 1.00 . A A . 125 GLY HA2  1 1 
        1  1883 1 1 125 GLY HA3  H -22.075 -16.003   8.516 1.00 . A A . 125 GLY HA3  1 1 
        1  1884 1 1 125 GLY N    N -23.513 -14.882   7.535 1.00 . A A . 125 GLY N    1 1 
        1  1885 1 1 125 GLY O    O -24.942 -15.469   9.877 1.00 . A A . 125 GLY O    1 1 
        1  1886 1 1 126 ASN C    C -23.318 -15.003  12.813 1.00 . A A . 126 ASN C    1 1 
        1  1887 1 1 126 ASN CA   C -23.606 -16.342  12.141 1.00 . A A . 126 ASN CA   1 1 
        1  1888 1 1 126 ASN CB   C -22.997 -17.482  12.961 1.00 . A A . 126 ASN CB   1 1 
        1  1889 1 1 126 ASN CG   C -23.835 -18.744  12.905 1.00 . A A . 126 ASN CG   1 1 
        1  1890 1 1 126 ASN H    H -22.183 -16.712  10.617 1.00 . A A . 126 ASN H    1 1 
        1  1891 1 1 126 ASN HA   H -24.675 -16.481  12.088 1.00 . A A . 126 ASN HA   1 1 
        1  1892 1 1 126 ASN HB2  H -22.014 -17.708  12.578 1.00 . A A . 126 ASN HB2  1 1 
        1  1893 1 1 126 ASN HB3  H -22.915 -17.171  13.992 1.00 . A A . 126 ASN HB3  1 1 
        1  1894 1 1 126 ASN HD21 H -22.202 -19.865  13.075 1.00 . A A . 126 ASN HD21 1 1 
        1  1895 1 1 126 ASN HD22 H -23.694 -20.727  12.952 1.00 . A A . 126 ASN HD22 1 1 
        1  1896 1 1 126 ASN N    N -23.085 -16.363  10.779 1.00 . A A . 126 ASN N    1 1 
        1  1897 1 1 126 ASN ND2  N -23.177 -19.895  12.986 1.00 . A A . 126 ASN ND2  1 1 
        1  1898 1 1 126 ASN O    O -22.546 -14.928  13.770 1.00 . A A . 126 ASN O    1 1 
        1  1899 1 1 126 ASN OD1  O -25.059 -18.686  12.792 1.00 . A A . 126 ASN OD1  1 1 
        1  1900 1 1 127 TYR C    C -24.972 -12.185  13.678 1.00 . A A . 127 TYR C    1 1 
        1  1901 1 1 127 TYR CA   C -23.757 -12.609  12.859 1.00 . A A . 127 TYR CA   1 1 
        1  1902 1 1 127 TYR CB   C -23.505 -11.601  11.736 1.00 . A A . 127 TYR CB   1 1 
        1  1903 1 1 127 TYR CD1  C -21.277 -12.286  10.769 1.00 . A A . 127 TYR CD1  1 1 
        1  1904 1 1 127 TYR CD2  C -21.417 -10.190  11.897 1.00 . A A . 127 TYR CD2  1 1 
        1  1905 1 1 127 TYR CE1  C -19.936 -12.065  10.517 1.00 . A A . 127 TYR CE1  1 1 
        1  1906 1 1 127 TYR CE2  C -20.077  -9.962  11.649 1.00 . A A . 127 TYR CE2  1 1 
        1  1907 1 1 127 TYR CG   C -22.039 -11.354  11.462 1.00 . A A . 127 TYR CG   1 1 
        1  1908 1 1 127 TYR CZ   C -19.341 -10.902  10.959 1.00 . A A . 127 TYR CZ   1 1 
        1  1909 1 1 127 TYR H    H -24.548 -14.068  11.544 1.00 . A A . 127 TYR H    1 1 
        1  1910 1 1 127 TYR HA   H -22.894 -12.637  13.506 1.00 . A A . 127 TYR HA   1 1 
        1  1911 1 1 127 TYR HB2  H -23.955 -11.966  10.826 1.00 . A A . 127 TYR HB2  1 1 
        1  1912 1 1 127 TYR HB3  H -23.957 -10.656  12.002 1.00 . A A . 127 TYR HB3  1 1 
        1  1913 1 1 127 TYR HD1  H -21.746 -13.195  10.424 1.00 . A A . 127 TYR HD1  1 1 
        1  1914 1 1 127 TYR HD2  H -21.996  -9.456  12.438 1.00 . A A . 127 TYR HD2  1 1 
        1  1915 1 1 127 TYR HE1  H -19.360 -12.801   9.976 1.00 . A A . 127 TYR HE1  1 1 
        1  1916 1 1 127 TYR HE2  H -19.611  -9.051  11.995 1.00 . A A . 127 TYR HE2  1 1 
        1  1917 1 1 127 TYR HH   H -17.516 -11.494  10.840 1.00 . A A . 127 TYR HH   1 1 
        1  1918 1 1 127 TYR N    N -23.945 -13.946  12.307 1.00 . A A . 127 TYR N    1 1 
        1  1919 1 1 127 TYR O    O -26.051 -12.763  13.552 1.00 . A A . 127 TYR O    1 1 
        1  1920 1 1 127 TYR OH   O -18.006 -10.679  10.709 1.00 . A A . 127 TYR OH   1 1 
        1  1921 1 1 128 ALA C    C -25.909  -9.144  15.341 1.00 . A A . 128 ALA C    1 1 
        1  1922 1 1 128 ALA CA   C -25.867 -10.668  15.356 1.00 . A A . 128 ALA CA   1 1 
        1  1923 1 1 128 ALA CB   C -25.710 -11.180  16.780 1.00 . A A . 128 ALA CB   1 1 
        1  1924 1 1 128 ALA H    H -23.904 -10.751  14.572 1.00 . A A . 128 ALA H    1 1 
        1  1925 1 1 128 ALA HA   H -26.800 -11.048  14.964 1.00 . A A . 128 ALA HA   1 1 
        1  1926 1 1 128 ALA HB1  H -26.560 -10.870  17.370 1.00 . A A . 128 ALA HB1  1 1 
        1  1927 1 1 128 ALA HB2  H -24.806 -10.774  17.210 1.00 . A A . 128 ALA HB2  1 1 
        1  1928 1 1 128 ALA HB3  H -25.652 -12.258  16.771 1.00 . A A . 128 ALA HB3  1 1 
        1  1929 1 1 128 ALA N    N -24.787 -11.171  14.517 1.00 . A A . 128 ALA N    1 1 
        1  1930 1 1 128 ALA O    O -25.033  -8.483  15.898 1.00 . A A . 128 ALA O    1 1 
        1  1931 1 1 129 SER C    C -28.551  -6.744  14.780 1.00 . A A . 129 SER C    1 1 
        1  1932 1 1 129 SER CA   C -27.090  -7.145  14.611 1.00 . A A . 129 SER CA   1 1 
        1  1933 1 1 129 SER CB   C -26.560  -6.635  13.270 1.00 . A A . 129 SER CB   1 1 
        1  1934 1 1 129 SER H    H -27.600  -9.171  14.275 1.00 . A A . 129 SER H    1 1 
        1  1935 1 1 129 SER HA   H -26.513  -6.701  15.408 1.00 . A A . 129 SER HA   1 1 
        1  1936 1 1 129 SER HB2  H -25.789  -7.301  12.912 1.00 . A A . 129 SER HB2  1 1 
        1  1937 1 1 129 SER HB3  H -27.369  -6.604  12.555 1.00 . A A . 129 SER HB3  1 1 
        1  1938 1 1 129 SER HG   H -25.064  -5.396  13.527 1.00 . A A . 129 SER HG   1 1 
        1  1939 1 1 129 SER N    N -26.934  -8.592  14.699 1.00 . A A . 129 SER N    1 1 
        1  1940 1 1 129 SER O    O -29.456  -7.541  14.531 1.00 . A A . 129 SER O    1 1 
        1  1941 1 1 129 SER OG   O -26.014  -5.334  13.399 1.00 . A A . 129 SER OG   1 1 
        1  1942 1 1 130 THR C    C -30.259  -3.571  14.890 1.00 . A A . 130 THR C    1 1 
        1  1943 1 1 130 THR CA   C -30.128  -5.000  15.408 1.00 . A A . 130 THR CA   1 1 
        1  1944 1 1 130 THR CB   C -30.496  -5.053  16.891 1.00 . A A . 130 THR CB   1 1 
        1  1945 1 1 130 THR CG2  C -30.169  -6.380  17.541 1.00 . A A . 130 THR CG2  1 1 
        1  1946 1 1 130 THR H    H -28.013  -4.917  15.388 1.00 . A A . 130 THR H    1 1 
        1  1947 1 1 130 THR HA   H -30.804  -5.634  14.856 1.00 . A A . 130 THR HA   1 1 
        1  1948 1 1 130 THR HB   H -31.559  -4.888  16.994 1.00 . A A . 130 THR HB   1 1 
        1  1949 1 1 130 THR HG1  H -28.871  -4.130  17.476 1.00 . A A . 130 THR HG1  1 1 
        1  1950 1 1 130 THR HG21 H -29.215  -6.309  18.043 1.00 . A A . 130 THR HG21 1 1 
        1  1951 1 1 130 THR HG22 H -30.122  -7.149  16.785 1.00 . A A . 130 THR HG22 1 1 
        1  1952 1 1 130 THR HG23 H -30.936  -6.628  18.260 1.00 . A A . 130 THR HG23 1 1 
        1  1953 1 1 130 THR N    N -28.775  -5.505  15.205 1.00 . A A . 130 THR N    1 1 
        1  1954 1 1 130 THR O    O -31.045  -2.781  15.412 1.00 . A A . 130 THR O    1 1 
        1  1955 1 1 130 THR OG1  O -29.817  -4.041  17.613 1.00 . A A . 130 THR OG1  1 1 
        1  1956 1 1 131 GLY C    C -28.574  -1.752  12.123 1.00 . A A . 131 GLY C    1 1 
        1  1957 1 1 131 GLY CA   C -29.531  -1.915  13.287 1.00 . A A . 131 GLY CA   1 1 
        1  1958 1 1 131 GLY H    H -28.879  -3.920  13.483 1.00 . A A . 131 GLY H    1 1 
        1  1959 1 1 131 GLY HA2  H -30.536  -1.717  12.943 1.00 . A A . 131 GLY HA2  1 1 
        1  1960 1 1 131 GLY HA3  H -29.275  -1.198  14.053 1.00 . A A . 131 GLY HA3  1 1 
        1  1961 1 1 131 GLY N    N -29.486  -3.248  13.859 1.00 . A A . 131 GLY N    1 1 
        1  1962 1 1 131 GLY O    O -28.997  -1.661  10.970 1.00 . A A . 131 GLY O    1 1 
        1  1963 1 1 132 VAL C    C -25.612  -2.903  11.062 1.00 . A A . 132 VAL C    1 1 
        1  1964 1 1 132 VAL CA   C -26.260  -1.562  11.394 1.00 . A A . 132 VAL CA   1 1 
        1  1965 1 1 132 VAL CB   C -25.167  -0.564  11.827 1.00 . A A . 132 VAL CB   1 1 
        1  1966 1 1 132 VAL CG1  C -24.440  -1.064  13.067 1.00 . A A . 132 VAL CG1  1 1 
        1  1967 1 1 132 VAL CG2  C -24.189  -0.315  10.689 1.00 . A A . 132 VAL CG2  1 1 
        1  1968 1 1 132 VAL H    H -27.005  -1.793  13.361 1.00 . A A . 132 VAL H    1 1 
        1  1969 1 1 132 VAL HA   H -26.739  -1.176  10.506 1.00 . A A . 132 VAL HA   1 1 
        1  1970 1 1 132 VAL HB   H -25.644   0.374  12.073 1.00 . A A . 132 VAL HB   1 1 
        1  1971 1 1 132 VAL HG11 H -23.473  -1.454  12.785 1.00 . A A . 132 VAL HG11 1 1 
        1  1972 1 1 132 VAL HG12 H -25.020  -1.846  13.534 1.00 . A A . 132 VAL HG12 1 1 
        1  1973 1 1 132 VAL HG13 H -24.310  -0.248  13.762 1.00 . A A . 132 VAL HG13 1 1 
        1  1974 1 1 132 VAL HG21 H -24.655   0.312   9.944 1.00 . A A . 132 VAL HG21 1 1 
        1  1975 1 1 132 VAL HG22 H -23.909  -1.258  10.242 1.00 . A A . 132 VAL HG22 1 1 
        1  1976 1 1 132 VAL HG23 H -23.307   0.177  11.073 1.00 . A A . 132 VAL HG23 1 1 
        1  1977 1 1 132 VAL N    N -27.280  -1.715  12.424 1.00 . A A . 132 VAL N    1 1 
        1  1978 1 1 132 VAL O    O -25.030  -3.554  11.929 1.00 . A A . 132 VAL O    1 1 
        1  1979 1 1 133 SER C    C -25.204  -4.689   7.835 1.00 . A A . 133 SER C    1 1 
        1  1980 1 1 133 SER CA   C -25.143  -4.572   9.354 1.00 . A A . 133 SER CA   1 1 
        1  1981 1 1 133 SER CB   C -25.880  -5.748   9.998 1.00 . A A . 133 SER CB   1 1 
        1  1982 1 1 133 SER H    H -26.195  -2.746   9.156 1.00 . A A . 133 SER H    1 1 
        1  1983 1 1 133 SER HA   H -24.109  -4.594   9.664 1.00 . A A . 133 SER HA   1 1 
        1  1984 1 1 133 SER HB2  H -25.446  -6.675   9.654 1.00 . A A . 133 SER HB2  1 1 
        1  1985 1 1 133 SER HB3  H -25.786  -5.684  11.072 1.00 . A A . 133 SER HB3  1 1 
        1  1986 1 1 133 SER HG   H -27.782  -5.882  10.448 1.00 . A A . 133 SER HG   1 1 
        1  1987 1 1 133 SER N    N -25.718  -3.309   9.801 1.00 . A A . 133 SER N    1 1 
        1  1988 1 1 133 SER O    O -25.934  -3.950   7.174 1.00 . A A . 133 SER O    1 1 
        1  1989 1 1 133 SER OG   O -27.256  -5.736   9.658 1.00 . A A . 133 SER OG   1 1 
        1  1990 1 1 134 ARG C    C -25.023  -7.178   5.478 1.00 . A A . 134 ARG C    1 1 
        1  1991 1 1 134 ARG CA   C -24.399  -5.835   5.844 1.00 . A A . 134 ARG CA   1 1 
        1  1992 1 1 134 ARG CB   C -22.959  -5.771   5.332 1.00 . A A . 134 ARG CB   1 1 
        1  1993 1 1 134 ARG CD   C -20.896  -4.378   4.986 1.00 . A A . 134 ARG CD   1 1 
        1  1994 1 1 134 ARG CG   C -22.375  -4.368   5.338 1.00 . A A . 134 ARG CG   1 1 
        1  1995 1 1 134 ARG CZ   C -19.401  -3.164   3.449 1.00 . A A . 134 ARG CZ   1 1 
        1  1996 1 1 134 ARG H    H -23.873  -6.180   7.865 1.00 . A A . 134 ARG H    1 1 
        1  1997 1 1 134 ARG HA   H -24.972  -5.047   5.379 1.00 . A A . 134 ARG HA   1 1 
        1  1998 1 1 134 ARG HB2  H -22.339  -6.398   5.955 1.00 . A A . 134 ARG HB2  1 1 
        1  1999 1 1 134 ARG HB3  H -22.932  -6.145   4.319 1.00 . A A . 134 ARG HB3  1 1 
        1  2000 1 1 134 ARG HD2  H -20.322  -4.357   5.901 1.00 . A A . 134 ARG HD2  1 1 
        1  2001 1 1 134 ARG HD3  H -20.675  -5.285   4.444 1.00 . A A . 134 ARG HD3  1 1 
        1  2002 1 1 134 ARG HE   H -21.137  -2.467   4.145 1.00 . A A . 134 ARG HE   1 1 
        1  2003 1 1 134 ARG HG2  H -22.902  -3.765   4.613 1.00 . A A . 134 ARG HG2  1 1 
        1  2004 1 1 134 ARG HG3  H -22.499  -3.941   6.323 1.00 . A A . 134 ARG HG3  1 1 
        1  2005 1 1 134 ARG HH11 H -18.737  -4.996   3.991 1.00 . A A . 134 ARG HH11 1 1 
        1  2006 1 1 134 ARG HH12 H -17.704  -4.122   2.910 1.00 . A A . 134 ARG HH12 1 1 
        1  2007 1 1 134 ARG HH21 H -19.780  -1.316   2.723 1.00 . A A . 134 ARG HH21 1 1 
        1  2008 1 1 134 ARG HH22 H -18.296  -2.032   2.191 1.00 . A A . 134 ARG HH22 1 1 
        1  2009 1 1 134 ARG N    N -24.433  -5.622   7.286 1.00 . A A . 134 ARG N    1 1 
        1  2010 1 1 134 ARG NE   N -20.521  -3.230   4.165 1.00 . A A . 134 ARG NE   1 1 
        1  2011 1 1 134 ARG NH1  N -18.544  -4.177   3.451 1.00 . A A . 134 ARG NH1  1 1 
        1  2012 1 1 134 ARG NH2  N -19.138  -2.082   2.728 1.00 . A A . 134 ARG NH2  1 1 
        1  2013 1 1 134 ARG O    O -24.414  -8.231   5.671 1.00 . A A . 134 ARG O    1 1 
        1  2014 1 1 135 SER C    C -27.074  -8.435   3.037 1.00 . A A . 135 SER C    1 1 
        1  2015 1 1 135 SER CA   C -26.949  -8.347   4.554 1.00 . A A . 135 SER CA   1 1 
        1  2016 1 1 135 SER CB   C -28.337  -8.382   5.195 1.00 . A A . 135 SER CB   1 1 
        1  2017 1 1 135 SER H    H -26.675  -6.264   4.819 1.00 . A A . 135 SER H    1 1 
        1  2018 1 1 135 SER HA   H -26.378  -9.193   4.906 1.00 . A A . 135 SER HA   1 1 
        1  2019 1 1 135 SER HB2  H -28.932  -7.569   4.805 1.00 . A A . 135 SER HB2  1 1 
        1  2020 1 1 135 SER HB3  H -28.815  -9.322   4.961 1.00 . A A . 135 SER HB3  1 1 
        1  2021 1 1 135 SER HG   H -29.003  -7.744   6.923 1.00 . A A . 135 SER HG   1 1 
        1  2022 1 1 135 SER N    N -26.241  -7.134   4.948 1.00 . A A . 135 SER N    1 1 
        1  2023 1 1 135 SER O    O -28.048  -8.977   2.515 1.00 . A A . 135 SER O    1 1 
        1  2024 1 1 135 SER OG   O -28.253  -8.250   6.603 1.00 . A A . 135 SER OG   1 1 
        1  2025 1 1 136 GLU C    C -24.774  -8.494   0.340 1.00 . A A . 136 GLU C    1 1 
        1  2026 1 1 136 GLU CA   C -26.080  -7.918   0.875 1.00 . A A . 136 GLU CA   1 1 
        1  2027 1 1 136 GLU CB   C -26.291  -6.506   0.326 1.00 . A A . 136 GLU CB   1 1 
        1  2028 1 1 136 GLU CD   C -24.969  -4.389  -0.064 1.00 . A A . 136 GLU CD   1 1 
        1  2029 1 1 136 GLU CG   C -25.350  -5.473   0.925 1.00 . A A . 136 GLU CG   1 1 
        1  2030 1 1 136 GLU H    H -25.332  -7.481   2.807 1.00 . A A . 136 GLU H    1 1 
        1  2031 1 1 136 GLU HA   H -26.896  -8.546   0.551 1.00 . A A . 136 GLU HA   1 1 
        1  2032 1 1 136 GLU HB2  H -26.141  -6.521  -0.743 1.00 . A A . 136 GLU HB2  1 1 
        1  2033 1 1 136 GLU HB3  H -27.306  -6.199   0.533 1.00 . A A . 136 GLU HB3  1 1 
        1  2034 1 1 136 GLU HG2  H -25.835  -5.011   1.772 1.00 . A A . 136 GLU HG2  1 1 
        1  2035 1 1 136 GLU HG3  H -24.451  -5.973   1.254 1.00 . A A . 136 GLU HG3  1 1 
        1  2036 1 1 136 GLU N    N -26.081  -7.899   2.334 1.00 . A A . 136 GLU N    1 1 
        1  2037 1 1 136 GLU O    O -23.772  -8.555   1.053 1.00 . A A . 136 GLU O    1 1 
        1  2038 1 1 136 GLU OE1  O -25.808  -3.501  -0.324 1.00 . A A . 136 GLU OE1  1 1 
        1  2039 1 1 136 GLU OE2  O -23.832  -4.428  -0.579 1.00 . A A . 136 GLU OE2  1 1 
        1  2040 1 1 137 HIS C    C -23.231  -8.707  -2.809 1.00 . A A . 137 HIS C    1 1 
        1  2041 1 1 137 HIS CA   C -23.608  -9.487  -1.553 1.00 . A A . 137 HIS CA   1 1 
        1  2042 1 1 137 HIS CB   C -23.850 -10.957  -1.902 1.00 . A A . 137 HIS CB   1 1 
        1  2043 1 1 137 HIS CD2  C -26.379 -10.980  -2.483 1.00 . A A . 137 HIS CD2  1 1 
        1  2044 1 1 137 HIS CE1  C -26.230 -11.752  -4.529 1.00 . A A . 137 HIS CE1  1 1 
        1  2045 1 1 137 HIS CG   C -25.065 -11.179  -2.748 1.00 . A A . 137 HIS CG   1 1 
        1  2046 1 1 137 HIS H    H -25.620  -8.840  -1.438 1.00 . A A . 137 HIS H    1 1 
        1  2047 1 1 137 HIS HA   H -22.793  -9.424  -0.848 1.00 . A A . 137 HIS HA   1 1 
        1  2048 1 1 137 HIS HB2  H -22.996 -11.337  -2.442 1.00 . A A . 137 HIS HB2  1 1 
        1  2049 1 1 137 HIS HB3  H -23.973 -11.521  -0.988 1.00 . A A . 137 HIS HB3  1 1 
        1  2050 1 1 137 HIS HD1  H -24.190 -11.905  -4.522 1.00 . A A . 137 HIS HD1  1 1 
        1  2051 1 1 137 HIS HD2  H -26.796 -10.605  -1.559 1.00 . A A . 137 HIS HD2  1 1 
        1  2052 1 1 137 HIS HE1  H -26.490 -12.101  -5.518 1.00 . A A . 137 HIS HE1  1 1 
        1  2053 1 1 137 HIS HE2  H -28.044 -11.225  -3.738 1.00 . A A . 137 HIS HE2  1 1 
        1  2054 1 1 137 HIS N    N -24.791  -8.915  -0.921 1.00 . A A . 137 HIS N    1 1 
        1  2055 1 1 137 HIS ND1  N -25.007 -11.664  -4.038 1.00 . A A . 137 HIS ND1  1 1 
        1  2056 1 1 137 HIS NE2  N -27.080 -11.345  -3.605 1.00 . A A . 137 HIS NE2  1 1 
        1  2057 1 1 137 HIS O    O -23.423  -9.183  -3.929 1.00 . A A . 137 HIS O    1 1 
        1  2058 1 1 138 ASP C    C -20.774  -6.503  -3.774 1.00 . A A . 138 ASP C    1 1 
        1  2059 1 1 138 ASP CA   C -22.291  -6.661  -3.733 1.00 . A A . 138 ASP CA   1 1 
        1  2060 1 1 138 ASP CB   C -22.954  -5.287  -3.625 1.00 . A A . 138 ASP CB   1 1 
        1  2061 1 1 138 ASP CG   C -22.957  -4.541  -4.946 1.00 . A A . 138 ASP CG   1 1 
        1  2062 1 1 138 ASP H    H -22.567  -7.183  -1.700 1.00 . A A . 138 ASP H    1 1 
        1  2063 1 1 138 ASP HA   H -22.616  -7.138  -4.645 1.00 . A A . 138 ASP HA   1 1 
        1  2064 1 1 138 ASP HB2  H -23.977  -5.412  -3.302 1.00 . A A . 138 ASP HB2  1 1 
        1  2065 1 1 138 ASP HB3  H -22.422  -4.692  -2.898 1.00 . A A . 138 ASP HB3  1 1 
        1  2066 1 1 138 ASP N    N -22.695  -7.507  -2.616 1.00 . A A . 138 ASP N    1 1 
        1  2067 1 1 138 ASP O    O -20.079  -6.839  -2.816 1.00 . A A . 138 ASP O    1 1 
        1  2068 1 1 138 ASP OD1  O -21.951  -3.866  -5.248 1.00 . A A . 138 ASP OD1  1 1 
        1  2069 1 1 138 ASP OD2  O -23.966  -4.632  -5.677 1.00 . A A . 138 ASP OD2  1 1 
        1  2070 1 1 139 THR C    C -18.474  -4.312  -4.932 1.00 . A A . 139 THR C    1 1 
        1  2071 1 1 139 THR CA   C -18.834  -5.789  -5.057 1.00 . A A . 139 THR CA   1 1 
        1  2072 1 1 139 THR CB   C -18.376  -6.324  -6.415 1.00 . A A . 139 THR CB   1 1 
        1  2073 1 1 139 THR CG2  C -18.860  -7.730  -6.697 1.00 . A A . 139 THR CG2  1 1 
        1  2074 1 1 139 THR H    H -20.873  -5.742  -5.620 1.00 . A A . 139 THR H    1 1 
        1  2075 1 1 139 THR HA   H -18.329  -6.337  -4.276 1.00 . A A . 139 THR HA   1 1 
        1  2076 1 1 139 THR HB   H -17.296  -6.334  -6.441 1.00 . A A . 139 THR HB   1 1 
        1  2077 1 1 139 THR HG1  H -18.532  -5.836  -8.305 1.00 . A A . 139 THR HG1  1 1 
        1  2078 1 1 139 THR HG21 H -18.178  -8.441  -6.255 1.00 . A A . 139 THR HG21 1 1 
        1  2079 1 1 139 THR HG22 H -18.903  -7.888  -7.765 1.00 . A A . 139 THR HG22 1 1 
        1  2080 1 1 139 THR HG23 H -19.844  -7.863  -6.274 1.00 . A A . 139 THR HG23 1 1 
        1  2081 1 1 139 THR N    N -20.268  -5.990  -4.891 1.00 . A A . 139 THR N    1 1 
        1  2082 1 1 139 THR O    O -18.953  -3.479  -5.702 1.00 . A A . 139 THR O    1 1 
        1  2083 1 1 139 THR OG1  O -18.839  -5.491  -7.464 1.00 . A A . 139 THR OG1  1 1 
        1  2084 1 1 140 GLY C    C -16.149  -2.178  -4.730 1.00 . A A . 140 GLY C    1 1 
        1  2085 1 1 140 GLY CA   C -17.220  -2.617  -3.750 1.00 . A A . 140 GLY CA   1 1 
        1  2086 1 1 140 GLY H    H -17.279  -4.700  -3.374 1.00 . A A . 140 GLY H    1 1 
        1  2087 1 1 140 GLY HA2  H -18.081  -1.976  -3.863 1.00 . A A . 140 GLY HA2  1 1 
        1  2088 1 1 140 GLY HA3  H -16.837  -2.514  -2.745 1.00 . A A . 140 GLY HA3  1 1 
        1  2089 1 1 140 GLY N    N -17.628  -3.994  -3.957 1.00 . A A . 140 GLY N    1 1 
        1  2090 1 1 140 GLY O    O -15.121  -2.840  -4.873 1.00 . A A . 140 GLY O    1 1 
        1  2091 1 1 141 VAL C    C -15.450   0.987  -6.399 1.00 . A A . 141 VAL C    1 1 
        1  2092 1 1 141 VAL CA   C -15.438  -0.539  -6.381 1.00 . A A . 141 VAL CA   1 1 
        1  2093 1 1 141 VAL CB   C -15.741  -1.065  -7.798 1.00 . A A . 141 VAL CB   1 1 
        1  2094 1 1 141 VAL CG1  C -17.128  -0.632  -8.247 1.00 . A A . 141 VAL CG1  1 1 
        1  2095 1 1 141 VAL CG2  C -14.682  -0.594  -8.784 1.00 . A A . 141 VAL CG2  1 1 
        1  2096 1 1 141 VAL H    H -17.231  -0.577  -5.250 1.00 . A A . 141 VAL H    1 1 
        1  2097 1 1 141 VAL HA   H -14.452  -0.878  -6.097 1.00 . A A . 141 VAL HA   1 1 
        1  2098 1 1 141 VAL HB   H -15.719  -2.145  -7.770 1.00 . A A . 141 VAL HB   1 1 
        1  2099 1 1 141 VAL HG11 H -17.357  -1.087  -9.199 1.00 . A A . 141 VAL HG11 1 1 
        1  2100 1 1 141 VAL HG12 H -17.155   0.443  -8.346 1.00 . A A . 141 VAL HG12 1 1 
        1  2101 1 1 141 VAL HG13 H -17.857  -0.945  -7.514 1.00 . A A . 141 VAL HG13 1 1 
        1  2102 1 1 141 VAL HG21 H -14.990   0.344  -9.222 1.00 . A A . 141 VAL HG21 1 1 
        1  2103 1 1 141 VAL HG22 H -14.561  -1.332  -9.562 1.00 . A A . 141 VAL HG22 1 1 
        1  2104 1 1 141 VAL HG23 H -13.743  -0.458  -8.266 1.00 . A A . 141 VAL HG23 1 1 
        1  2105 1 1 141 VAL N    N -16.391  -1.061  -5.408 1.00 . A A . 141 VAL N    1 1 
        1  2106 1 1 141 VAL O    O -16.511   1.606  -6.489 1.00 . A A . 141 VAL O    1 1 
        1  2107 1 1 142 SER C    C -12.765   3.494  -6.771 1.00 . A A . 142 SER C    1 1 
        1  2108 1 1 142 SER CA   C -14.156   3.044  -6.320 1.00 . A A . 142 SER CA   1 1 
        1  2109 1 1 142 SER CB   C -14.455   3.604  -4.928 1.00 . A A . 142 SER CB   1 1 
        1  2110 1 1 142 SER H    H -13.454   1.043  -6.242 1.00 . A A . 142 SER H    1 1 
        1  2111 1 1 142 SER HA   H -14.889   3.425  -7.013 1.00 . A A . 142 SER HA   1 1 
        1  2112 1 1 142 SER HB2  H -13.879   4.504  -4.772 1.00 . A A . 142 SER HB2  1 1 
        1  2113 1 1 142 SER HB3  H -15.508   3.832  -4.853 1.00 . A A . 142 SER HB3  1 1 
        1  2114 1 1 142 SER HG   H -14.909   2.417  -3.437 1.00 . A A . 142 SER HG   1 1 
        1  2115 1 1 142 SER N    N -14.267   1.589  -6.312 1.00 . A A . 142 SER N    1 1 
        1  2116 1 1 142 SER O    O -11.755   2.955  -6.320 1.00 . A A . 142 SER O    1 1 
        1  2117 1 1 142 SER OG   O -14.118   2.668  -3.918 1.00 . A A . 142 SER OG   1 1 
        1  2118 1 1 143 PRO C    C -10.772   5.989  -7.190 1.00 . A A . 143 PRO C    1 1 
        1  2119 1 1 143 PRO CA   C -11.423   5.019  -8.171 1.00 . A A . 143 PRO CA   1 1 
        1  2120 1 1 143 PRO CB   C -11.835   5.747  -9.447 1.00 . A A . 143 PRO CB   1 1 
        1  2121 1 1 143 PRO CD   C -13.850   5.204  -8.259 1.00 . A A . 143 PRO CD   1 1 
        1  2122 1 1 143 PRO CG   C -13.220   6.225  -9.173 1.00 . A A . 143 PRO CG   1 1 
        1  2123 1 1 143 PRO HA   H -10.732   4.225  -8.410 1.00 . A A . 143 PRO HA   1 1 
        1  2124 1 1 143 PRO HB2  H -11.160   6.569  -9.631 1.00 . A A . 143 PRO HB2  1 1 
        1  2125 1 1 143 PRO HB3  H -11.814   5.061 -10.281 1.00 . A A . 143 PRO HB3  1 1 
        1  2126 1 1 143 PRO HD2  H -14.433   5.693  -7.493 1.00 . A A . 143 PRO HD2  1 1 
        1  2127 1 1 143 PRO HD3  H -14.468   4.523  -8.826 1.00 . A A . 143 PRO HD3  1 1 
        1  2128 1 1 143 PRO HG2  H -13.184   7.189  -8.687 1.00 . A A . 143 PRO HG2  1 1 
        1  2129 1 1 143 PRO HG3  H -13.774   6.291 -10.097 1.00 . A A . 143 PRO HG3  1 1 
        1  2130 1 1 143 PRO N    N -12.695   4.497  -7.668 1.00 . A A . 143 PRO N    1 1 
        1  2131 1 1 143 PRO O    O -11.459   6.774  -6.537 1.00 . A A . 143 PRO O    1 1 
        1  2132 1 1 144 VAL C    C  -7.268   6.989  -6.615 1.00 . A A . 144 VAL C    1 1 
        1  2133 1 1 144 VAL CA   C  -8.719   6.815  -6.180 1.00 . A A . 144 VAL CA   1 1 
        1  2134 1 1 144 VAL CB   C  -8.745   6.282  -4.734 1.00 . A A . 144 VAL CB   1 1 
        1  2135 1 1 144 VAL CG1  C -10.168   6.249  -4.199 1.00 . A A . 144 VAL CG1  1 1 
        1  2136 1 1 144 VAL CG2  C  -8.105   4.902  -4.660 1.00 . A A . 144 VAL CG2  1 1 
        1  2137 1 1 144 VAL H    H  -8.947   5.290  -7.633 1.00 . A A . 144 VAL H    1 1 
        1  2138 1 1 144 VAL HA   H  -9.205   7.780  -6.193 1.00 . A A . 144 VAL HA   1 1 
        1  2139 1 1 144 VAL HB   H  -8.169   6.954  -4.115 1.00 . A A . 144 VAL HB   1 1 
        1  2140 1 1 144 VAL HG11 H -10.674   7.166  -4.465 1.00 . A A . 144 VAL HG11 1 1 
        1  2141 1 1 144 VAL HG12 H -10.147   6.148  -3.124 1.00 . A A . 144 VAL HG12 1 1 
        1  2142 1 1 144 VAL HG13 H -10.695   5.410  -4.629 1.00 . A A . 144 VAL HG13 1 1 
        1  2143 1 1 144 VAL HG21 H  -8.069   4.468  -5.648 1.00 . A A . 144 VAL HG21 1 1 
        1  2144 1 1 144 VAL HG22 H  -8.690   4.268  -4.009 1.00 . A A . 144 VAL HG22 1 1 
        1  2145 1 1 144 VAL HG23 H  -7.102   4.991  -4.269 1.00 . A A . 144 VAL HG23 1 1 
        1  2146 1 1 144 VAL N    N  -9.446   5.934  -7.087 1.00 . A A . 144 VAL N    1 1 
        1  2147 1 1 144 VAL O    O  -6.721   6.160  -7.342 1.00 . A A . 144 VAL O    1 1 
        1  2148 1 1 145 PHE C    C  -4.583   9.118  -5.348 1.00 . A A . 145 PHE C    1 1 
        1  2149 1 1 145 PHE CA   C  -5.260   8.362  -6.488 1.00 . A A . 145 PHE CA   1 1 
        1  2150 1 1 145 PHE CB   C  -5.178   9.177  -7.781 1.00 . A A . 145 PHE CB   1 1 
        1  2151 1 1 145 PHE CD1  C  -7.150  10.698  -7.465 1.00 . A A . 145 PHE CD1  1 1 
        1  2152 1 1 145 PHE CD2  C  -4.999  11.680  -7.777 1.00 . A A . 145 PHE CD2  1 1 
        1  2153 1 1 145 PHE CE1  C  -7.713  11.956  -7.364 1.00 . A A . 145 PHE CE1  1 1 
        1  2154 1 1 145 PHE CE2  C  -5.556  12.940  -7.677 1.00 . A A . 145 PHE CE2  1 1 
        1  2155 1 1 145 PHE CG   C  -5.788  10.546  -7.672 1.00 . A A . 145 PHE CG   1 1 
        1  2156 1 1 145 PHE CZ   C  -6.915  13.079  -7.471 1.00 . A A . 145 PHE CZ   1 1 
        1  2157 1 1 145 PHE H    H  -7.140   8.692  -5.578 1.00 . A A . 145 PHE H    1 1 
        1  2158 1 1 145 PHE HA   H  -4.751   7.421  -6.632 1.00 . A A . 145 PHE HA   1 1 
        1  2159 1 1 145 PHE HB2  H  -4.141   9.297  -8.057 1.00 . A A . 145 PHE HB2  1 1 
        1  2160 1 1 145 PHE HB3  H  -5.694   8.644  -8.566 1.00 . A A . 145 PHE HB3  1 1 
        1  2161 1 1 145 PHE HD1  H  -7.774   9.821  -7.380 1.00 . A A . 145 PHE HD1  1 1 
        1  2162 1 1 145 PHE HD2  H  -3.936  11.573  -7.938 1.00 . A A . 145 PHE HD2  1 1 
        1  2163 1 1 145 PHE HE1  H  -8.775  12.061  -7.203 1.00 . A A . 145 PHE HE1  1 1 
        1  2164 1 1 145 PHE HE2  H  -4.930  13.816  -7.761 1.00 . A A . 145 PHE HE2  1 1 
        1  2165 1 1 145 PHE HZ   H  -7.353  14.063  -7.393 1.00 . A A . 145 PHE HZ   1 1 
        1  2166 1 1 145 PHE N    N  -6.650   8.073  -6.157 1.00 . A A . 145 PHE N    1 1 
        1  2167 1 1 145 PHE O    O  -5.056  10.174  -4.926 1.00 . A A . 145 PHE O    1 1 
        1  2168 1 1 146 ALA C    C  -1.321   9.543  -4.169 1.00 . A A . 146 ALA C    1 1 
        1  2169 1 1 146 ALA CA   C  -2.747   9.199  -3.755 1.00 . A A . 146 ALA CA   1 1 
        1  2170 1 1 146 ALA CB   C  -2.739   8.289  -2.537 1.00 . A A . 146 ALA CB   1 1 
        1  2171 1 1 146 ALA H    H  -3.150   7.726  -5.224 1.00 . A A . 146 ALA H    1 1 
        1  2172 1 1 146 ALA HA   H  -3.263  10.110  -3.489 1.00 . A A . 146 ALA HA   1 1 
        1  2173 1 1 146 ALA HB1  H  -2.420   8.850  -1.670 1.00 . A A . 146 ALA HB1  1 1 
        1  2174 1 1 146 ALA HB2  H  -2.057   7.468  -2.705 1.00 . A A . 146 ALA HB2  1 1 
        1  2175 1 1 146 ALA HB3  H  -3.733   7.902  -2.369 1.00 . A A . 146 ALA HB3  1 1 
        1  2176 1 1 146 ALA N    N  -3.478   8.571  -4.850 1.00 . A A . 146 ALA N    1 1 
        1  2177 1 1 146 ALA O    O  -0.847   9.115  -5.221 1.00 . A A . 146 ALA O    1 1 
        1  2178 1 1 147 GLY C    C   1.527  10.991  -2.370 1.00 . A A . 147 GLY C    1 1 
        1  2179 1 1 147 GLY CA   C   0.725  10.711  -3.625 1.00 . A A . 147 GLY CA   1 1 
        1  2180 1 1 147 GLY H    H  -1.072  10.632  -2.507 1.00 . A A . 147 GLY H    1 1 
        1  2181 1 1 147 GLY HA2  H   1.205   9.916  -4.176 1.00 . A A . 147 GLY HA2  1 1 
        1  2182 1 1 147 GLY HA3  H   0.711  11.601  -4.236 1.00 . A A . 147 GLY HA3  1 1 
        1  2183 1 1 147 GLY N    N  -0.641  10.321  -3.332 1.00 . A A . 147 GLY N    1 1 
        1  2184 1 1 147 GLY O    O   1.023  11.605  -1.429 1.00 . A A . 147 GLY O    1 1 
        1  2185 1 1 148 GLY C    C   5.098  10.606  -1.511 1.00 . A A . 148 GLY C    1 1 
        1  2186 1 1 148 GLY CA   C   3.623  10.757  -1.195 1.00 . A A . 148 GLY CA   1 1 
        1  2187 1 1 148 GLY H    H   3.125  10.057  -3.130 1.00 . A A . 148 GLY H    1 1 
        1  2188 1 1 148 GLY HA2  H   3.448  11.754  -0.818 1.00 . A A . 148 GLY HA2  1 1 
        1  2189 1 1 148 GLY HA3  H   3.356  10.044  -0.430 1.00 . A A . 148 GLY HA3  1 1 
        1  2190 1 1 148 GLY N    N   2.776  10.541  -2.353 1.00 . A A . 148 GLY N    1 1 
        1  2191 1 1 148 GLY O    O   5.506  10.697  -2.671 1.00 . A A . 148 GLY O    1 1 
        1  2192 1 1 149 VAL C    C   7.829   8.954   0.073 1.00 . A A . 149 VAL C    1 1 
        1  2193 1 1 149 VAL CA   C   7.337  10.206  -0.645 1.00 . A A . 149 VAL CA   1 1 
        1  2194 1 1 149 VAL CB   C   8.115  11.429  -0.119 1.00 . A A . 149 VAL CB   1 1 
        1  2195 1 1 149 VAL CG1  C   7.983  12.607  -1.077 1.00 . A A . 149 VAL CG1  1 1 
        1  2196 1 1 149 VAL CG2  C   7.635  11.808   1.274 1.00 . A A . 149 VAL CG2  1 1 
        1  2197 1 1 149 VAL H    H   5.508  10.306   0.425 1.00 . A A . 149 VAL H    1 1 
        1  2198 1 1 149 VAL HA   H   7.539  10.105  -1.702 1.00 . A A . 149 VAL HA   1 1 
        1  2199 1 1 149 VAL HB   H   9.160  11.164  -0.055 1.00 . A A . 149 VAL HB   1 1 
        1  2200 1 1 149 VAL HG11 H   7.307  13.339  -0.661 1.00 . A A . 149 VAL HG11 1 1 
        1  2201 1 1 149 VAL HG12 H   7.598  12.261  -2.025 1.00 . A A . 149 VAL HG12 1 1 
        1  2202 1 1 149 VAL HG13 H   8.952  13.059  -1.227 1.00 . A A . 149 VAL HG13 1 1 
        1  2203 1 1 149 VAL HG21 H   7.151  10.958   1.732 1.00 . A A . 149 VAL HG21 1 1 
        1  2204 1 1 149 VAL HG22 H   6.935  12.627   1.203 1.00 . A A . 149 VAL HG22 1 1 
        1  2205 1 1 149 VAL HG23 H   8.480  12.108   1.876 1.00 . A A . 149 VAL HG23 1 1 
        1  2206 1 1 149 VAL N    N   5.898  10.372  -0.476 1.00 . A A . 149 VAL N    1 1 
        1  2207 1 1 149 VAL O    O   7.107   8.367   0.879 1.00 . A A . 149 VAL O    1 1 
        1  2208 1 1 150 GLU C    C  11.077   7.605   0.829 1.00 . A A . 150 GLU C    1 1 
        1  2209 1 1 150 GLU CA   C   9.636   7.357   0.397 1.00 . A A . 150 GLU CA   1 1 
        1  2210 1 1 150 GLU CB   C   9.579   6.173  -0.569 1.00 . A A . 150 GLU CB   1 1 
        1  2211 1 1 150 GLU CD   C   9.312   3.662  -0.488 1.00 . A A . 150 GLU CD   1 1 
        1  2212 1 1 150 GLU CG   C  10.064   4.868   0.041 1.00 . A A . 150 GLU CG   1 1 
        1  2213 1 1 150 GLU H    H   9.590   9.050  -0.876 1.00 . A A . 150 GLU H    1 1 
        1  2214 1 1 150 GLU HA   H   9.047   7.124   1.271 1.00 . A A . 150 GLU HA   1 1 
        1  2215 1 1 150 GLU HB2  H   8.558   6.036  -0.893 1.00 . A A . 150 GLU HB2  1 1 
        1  2216 1 1 150 GLU HB3  H  10.194   6.394  -1.428 1.00 . A A . 150 GLU HB3  1 1 
        1  2217 1 1 150 GLU HG2  H  11.112   4.747  -0.187 1.00 . A A . 150 GLU HG2  1 1 
        1  2218 1 1 150 GLU HG3  H   9.932   4.915   1.112 1.00 . A A . 150 GLU HG3  1 1 
        1  2219 1 1 150 GLU N    N   9.060   8.545  -0.224 1.00 . A A . 150 GLU N    1 1 
        1  2220 1 1 150 GLU O    O  11.804   8.371   0.195 1.00 . A A . 150 GLU O    1 1 
        1  2221 1 1 150 GLU OE1  O   8.154   3.830  -0.927 1.00 . A A . 150 GLU OE1  1 1 
        1  2222 1 1 150 GLU OE2  O   9.881   2.551  -0.464 1.00 . A A . 150 GLU OE2  1 1 
        1  2223 1 1 151 TRP C    C  13.460   5.722   2.700 1.00 . A A . 151 TRP C    1 1 
        1  2224 1 1 151 TRP CA   C  12.837   7.089   2.431 1.00 . A A . 151 TRP CA   1 1 
        1  2225 1 1 151 TRP CB   C  12.829   7.919   3.716 1.00 . A A . 151 TRP CB   1 1 
        1  2226 1 1 151 TRP CD1  C  12.793  10.195   2.539 1.00 . A A . 151 TRP CD1  1 1 
        1  2227 1 1 151 TRP CD2  C  11.403  10.041   4.288 1.00 . A A . 151 TRP CD2  1 1 
        1  2228 1 1 151 TRP CE2  C  11.288  11.331   3.735 1.00 . A A . 151 TRP CE2  1 1 
        1  2229 1 1 151 TRP CE3  C  10.622   9.713   5.399 1.00 . A A . 151 TRP CE3  1 1 
        1  2230 1 1 151 TRP CG   C  12.371   9.330   3.508 1.00 . A A . 151 TRP CG   1 1 
        1  2231 1 1 151 TRP CH2  C   9.671  11.941   5.344 1.00 . A A . 151 TRP CH2  1 1 
        1  2232 1 1 151 TRP CZ2  C  10.423  12.290   4.256 1.00 . A A . 151 TRP CZ2  1 1 
        1  2233 1 1 151 TRP CZ3  C   9.765  10.666   5.916 1.00 . A A . 151 TRP CZ3  1 1 
        1  2234 1 1 151 TRP H    H  10.855   6.349   2.368 1.00 . A A . 151 TRP H    1 1 
        1  2235 1 1 151 TRP HA   H  13.428   7.600   1.686 1.00 . A A . 151 TRP HA   1 1 
        1  2236 1 1 151 TRP HB2  H  12.166   7.456   4.431 1.00 . A A . 151 TRP HB2  1 1 
        1  2237 1 1 151 TRP HB3  H  13.829   7.949   4.124 1.00 . A A . 151 TRP HB3  1 1 
        1  2238 1 1 151 TRP HD1  H  13.529   9.954   1.787 1.00 . A A . 151 TRP HD1  1 1 
        1  2239 1 1 151 TRP HE1  H  12.277  12.182   2.092 1.00 . A A . 151 TRP HE1  1 1 
        1  2240 1 1 151 TRP HE3  H  10.681   8.735   5.854 1.00 . A A . 151 TRP HE3  1 1 
        1  2241 1 1 151 TRP HH2  H   8.988  12.654   5.782 1.00 . A A . 151 TRP HH2  1 1 
        1  2242 1 1 151 TRP HZ2  H  10.339  13.277   3.827 1.00 . A A . 151 TRP HZ2  1 1 
        1  2243 1 1 151 TRP HZ3  H   9.154  10.430   6.775 1.00 . A A . 151 TRP HZ3  1 1 
        1  2244 1 1 151 TRP N    N  11.482   6.947   1.910 1.00 . A A . 151 TRP N    1 1 
        1  2245 1 1 151 TRP NE1  N  12.146  11.400   2.669 1.00 . A A . 151 TRP NE1  1 1 
        1  2246 1 1 151 TRP O    O  12.863   4.880   3.371 1.00 . A A . 151 TRP O    1 1 
        1  2247 1 1 152 ALA C    C  16.372   4.326   3.489 1.00 . A A . 152 ALA C    1 1 
        1  2248 1 1 152 ALA CA   C  15.359   4.242   2.352 1.00 . A A . 152 ALA CA   1 1 
        1  2249 1 1 152 ALA CB   C  16.047   3.830   1.060 1.00 . A A . 152 ALA CB   1 1 
        1  2250 1 1 152 ALA H    H  15.084   6.218   1.644 1.00 . A A . 152 ALA H    1 1 
        1  2251 1 1 152 ALA HA   H  14.624   3.489   2.595 1.00 . A A . 152 ALA HA   1 1 
        1  2252 1 1 152 ALA HB1  H  16.271   4.710   0.475 1.00 . A A . 152 ALA HB1  1 1 
        1  2253 1 1 152 ALA HB2  H  15.394   3.181   0.496 1.00 . A A . 152 ALA HB2  1 1 
        1  2254 1 1 152 ALA HB3  H  16.964   3.308   1.290 1.00 . A A . 152 ALA HB3  1 1 
        1  2255 1 1 152 ALA N    N  14.660   5.508   2.171 1.00 . A A . 152 ALA N    1 1 
        1  2256 1 1 152 ALA O    O  17.273   5.164   3.471 1.00 . A A . 152 ALA O    1 1 
        1  2257 1 1 153 VAL C    C  17.988   2.164   5.596 1.00 . A A . 153 VAL C    1 1 
        1  2258 1 1 153 VAL CA   C  17.119   3.417   5.621 1.00 . A A . 153 VAL CA   1 1 
        1  2259 1 1 153 VAL CB   C  16.342   3.464   6.951 1.00 . A A . 153 VAL CB   1 1 
        1  2260 1 1 153 VAL CG1  C  17.300   3.520   8.132 1.00 . A A . 153 VAL CG1  1 1 
        1  2261 1 1 153 VAL CG2  C  15.391   4.651   6.971 1.00 . A A . 153 VAL CG2  1 1 
        1  2262 1 1 153 VAL H    H  15.481   2.804   4.431 1.00 . A A . 153 VAL H    1 1 
        1  2263 1 1 153 VAL HA   H  17.757   4.288   5.568 1.00 . A A . 153 VAL HA   1 1 
        1  2264 1 1 153 VAL HB   H  15.757   2.560   7.034 1.00 . A A . 153 VAL HB   1 1 
        1  2265 1 1 153 VAL HG11 H  18.242   3.941   7.813 1.00 . A A . 153 VAL HG11 1 1 
        1  2266 1 1 153 VAL HG12 H  17.464   2.521   8.510 1.00 . A A . 153 VAL HG12 1 1 
        1  2267 1 1 153 VAL HG13 H  16.876   4.135   8.912 1.00 . A A . 153 VAL HG13 1 1 
        1  2268 1 1 153 VAL HG21 H  14.882   4.689   7.923 1.00 . A A . 153 VAL HG21 1 1 
        1  2269 1 1 153 VAL HG22 H  14.664   4.544   6.179 1.00 . A A . 153 VAL HG22 1 1 
        1  2270 1 1 153 VAL HG23 H  15.950   5.563   6.826 1.00 . A A . 153 VAL HG23 1 1 
        1  2271 1 1 153 VAL N    N  16.218   3.449   4.476 1.00 . A A . 153 VAL N    1 1 
        1  2272 1 1 153 VAL O    O  19.209   2.245   5.458 1.00 . A A . 153 VAL O    1 1 
        1  2273 1 1 154 THR C    C  18.352  -0.715   4.292 1.00 . A A . 154 THR C    1 1 
        1  2274 1 1 154 THR CA   C  18.063  -0.265   5.720 1.00 . A A . 154 THR CA   1 1 
        1  2275 1 1 154 THR CB   C  17.249  -1.335   6.450 1.00 . A A . 154 THR CB   1 1 
        1  2276 1 1 154 THR CG2  C  18.097  -2.465   6.993 1.00 . A A . 154 THR CG2  1 1 
        1  2277 1 1 154 THR H    H  16.376   1.007   5.835 1.00 . A A . 154 THR H    1 1 
        1  2278 1 1 154 THR HA   H  19.000  -0.123   6.237 1.00 . A A . 154 THR HA   1 1 
        1  2279 1 1 154 THR HB   H  16.533  -1.760   5.761 1.00 . A A . 154 THR HB   1 1 
        1  2280 1 1 154 THR HG1  H  15.771  -0.299   7.209 1.00 . A A . 154 THR HG1  1 1 
        1  2281 1 1 154 THR HG21 H  19.030  -2.069   7.364 1.00 . A A . 154 THR HG21 1 1 
        1  2282 1 1 154 THR HG22 H  18.295  -3.177   6.206 1.00 . A A . 154 THR HG22 1 1 
        1  2283 1 1 154 THR HG23 H  17.569  -2.956   7.798 1.00 . A A . 154 THR HG23 1 1 
        1  2284 1 1 154 THR N    N  17.350   1.006   5.729 1.00 . A A . 154 THR N    1 1 
        1  2285 1 1 154 THR O    O  17.860  -0.121   3.332 1.00 . A A . 154 THR O    1 1 
        1  2286 1 1 154 THR OG1  O  16.539  -0.771   7.538 1.00 . A A . 154 THR OG1  1 1 
        1  2287 1 1 155 ARG C    C  18.294  -2.903   2.153 1.00 . A A . 155 ARG C    1 1 
        1  2288 1 1 155 ARG CA   C  19.509  -2.295   2.848 1.00 . A A . 155 ARG CA   1 1 
        1  2289 1 1 155 ARG CB   C  20.616  -3.344   2.981 1.00 . A A . 155 ARG CB   1 1 
        1  2290 1 1 155 ARG CD   C  22.973  -3.944   2.348 1.00 . A A . 155 ARG CD   1 1 
        1  2291 1 1 155 ARG CG   C  22.000  -2.814   2.642 1.00 . A A . 155 ARG CG   1 1 
        1  2292 1 1 155 ARG CZ   C  23.904  -3.420   0.128 1.00 . A A . 155 ARG CZ   1 1 
        1  2293 1 1 155 ARG H    H  19.515  -2.196   4.962 1.00 . A A . 155 ARG H    1 1 
        1  2294 1 1 155 ARG HA   H  19.876  -1.474   2.249 1.00 . A A . 155 ARG HA   1 1 
        1  2295 1 1 155 ARG HB2  H  20.632  -3.705   3.999 1.00 . A A . 155 ARG HB2  1 1 
        1  2296 1 1 155 ARG HB3  H  20.398  -4.169   2.319 1.00 . A A . 155 ARG HB3  1 1 
        1  2297 1 1 155 ARG HD2  H  23.408  -4.278   3.278 1.00 . A A . 155 ARG HD2  1 1 
        1  2298 1 1 155 ARG HD3  H  22.430  -4.759   1.892 1.00 . A A . 155 ARG HD3  1 1 
        1  2299 1 1 155 ARG HE   H  24.912  -3.308   1.847 1.00 . A A . 155 ARG HE   1 1 
        1  2300 1 1 155 ARG HG2  H  21.928  -2.179   1.772 1.00 . A A . 155 ARG HG2  1 1 
        1  2301 1 1 155 ARG HG3  H  22.370  -2.240   3.480 1.00 . A A . 155 ARG HG3  1 1 
        1  2302 1 1 155 ARG HH11 H  21.966  -3.997   0.107 1.00 . A A . 155 ARG HH11 1 1 
        1  2303 1 1 155 ARG HH12 H  22.645  -3.623  -1.441 1.00 . A A . 155 ARG HH12 1 1 
        1  2304 1 1 155 ARG HH21 H  25.807  -2.815  -0.189 1.00 . A A . 155 ARG HH21 1 1 
        1  2305 1 1 155 ARG HH22 H  24.826  -2.952  -1.609 1.00 . A A . 155 ARG HH22 1 1 
        1  2306 1 1 155 ARG N    N  19.154  -1.766   4.159 1.00 . A A . 155 ARG N    1 1 
        1  2307 1 1 155 ARG NE   N  24.044  -3.524   1.447 1.00 . A A . 155 ARG NE   1 1 
        1  2308 1 1 155 ARG NH1  N  22.743  -3.703  -0.449 1.00 . A A . 155 ARG NH1  1 1 
        1  2309 1 1 155 ARG NH2  N  24.930  -3.030  -0.618 1.00 . A A . 155 ARG NH2  1 1 
        1  2310 1 1 155 ARG O    O  18.233  -2.957   0.925 1.00 . A A . 155 ARG O    1 1 
        1  2311 1 1 156 ASP C    C  14.897  -3.617   3.239 1.00 . A A . 156 ASP C    1 1 
        1  2312 1 1 156 ASP CA   C  16.120  -3.968   2.396 1.00 . A A . 156 ASP CA   1 1 
        1  2313 1 1 156 ASP CB   C  16.277  -5.488   2.317 1.00 . A A . 156 ASP CB   1 1 
        1  2314 1 1 156 ASP CG   C  16.771  -6.087   3.619 1.00 . A A . 156 ASP CG   1 1 
        1  2315 1 1 156 ASP H    H  17.432  -3.296   3.916 1.00 . A A . 156 ASP H    1 1 
        1  2316 1 1 156 ASP HA   H  15.977  -3.579   1.400 1.00 . A A . 156 ASP HA   1 1 
        1  2317 1 1 156 ASP HB2  H  15.322  -5.931   2.078 1.00 . A A . 156 ASP HB2  1 1 
        1  2318 1 1 156 ASP HB3  H  16.986  -5.729   1.538 1.00 . A A . 156 ASP HB3  1 1 
        1  2319 1 1 156 ASP N    N  17.328  -3.363   2.944 1.00 . A A . 156 ASP N    1 1 
        1  2320 1 1 156 ASP O    O  13.955  -4.403   3.339 1.00 . A A . 156 ASP O    1 1 
        1  2321 1 1 156 ASP OD1  O  16.065  -5.951   4.640 1.00 . A A . 156 ASP OD1  1 1 
        1  2322 1 1 156 ASP OD2  O  17.864  -6.691   3.618 1.00 . A A . 156 ASP OD2  1 1 
        1  2323 1 1 157 ILE C    C  13.692  -0.462   4.667 1.00 . A A . 157 ILE C    1 1 
        1  2324 1 1 157 ILE CA   C  13.806  -1.983   4.674 1.00 . A A . 157 ILE CA   1 1 
        1  2325 1 1 157 ILE CB   C  13.956  -2.467   6.130 1.00 . A A . 157 ILE CB   1 1 
        1  2326 1 1 157 ILE CD1  C  14.488  -4.501   7.567 1.00 . A A . 157 ILE CD1  1 1 
        1  2327 1 1 157 ILE CG1  C  14.337  -3.948   6.166 1.00 . A A . 157 ILE CG1  1 1 
        1  2328 1 1 157 ILE CG2  C  12.666  -2.227   6.901 1.00 . A A . 157 ILE CG2  1 1 
        1  2329 1 1 157 ILE H    H  15.694  -1.848   3.726 1.00 . A A . 157 ILE H    1 1 
        1  2330 1 1 157 ILE HA   H  12.896  -2.404   4.269 1.00 . A A . 157 ILE HA   1 1 
        1  2331 1 1 157 ILE HB   H  14.738  -1.889   6.598 1.00 . A A . 157 ILE HB   1 1 
        1  2332 1 1 157 ILE HD11 H  13.536  -4.879   7.908 1.00 . A A . 157 ILE HD11 1 1 
        1  2333 1 1 157 ILE HD12 H  14.822  -3.716   8.229 1.00 . A A . 157 ILE HD12 1 1 
        1  2334 1 1 157 ILE HD13 H  15.213  -5.301   7.562 1.00 . A A . 157 ILE HD13 1 1 
        1  2335 1 1 157 ILE HG12 H  13.573  -4.523   5.664 1.00 . A A . 157 ILE HG12 1 1 
        1  2336 1 1 157 ILE HG13 H  15.278  -4.083   5.652 1.00 . A A . 157 ILE HG13 1 1 
        1  2337 1 1 157 ILE HG21 H  12.534  -1.167   7.061 1.00 . A A . 157 ILE HG21 1 1 
        1  2338 1 1 157 ILE HG22 H  12.719  -2.731   7.855 1.00 . A A . 157 ILE HG22 1 1 
        1  2339 1 1 157 ILE HG23 H  11.831  -2.613   6.335 1.00 . A A . 157 ILE HG23 1 1 
        1  2340 1 1 157 ILE N    N  14.917  -2.433   3.843 1.00 . A A . 157 ILE N    1 1 
        1  2341 1 1 157 ILE O    O  14.435   0.229   5.363 1.00 . A A . 157 ILE O    1 1 
        1  2342 1 1 158 ALA C    C  11.171   1.884   4.319 1.00 . A A . 158 ALA C    1 1 
        1  2343 1 1 158 ALA CA   C  12.543   1.491   3.779 1.00 . A A . 158 ALA CA   1 1 
        1  2344 1 1 158 ALA CB   C  12.692   1.946   2.335 1.00 . A A . 158 ALA CB   1 1 
        1  2345 1 1 158 ALA H    H  12.195  -0.550   3.345 1.00 . A A . 158 ALA H    1 1 
        1  2346 1 1 158 ALA HA   H  13.305   1.982   4.366 1.00 . A A . 158 ALA HA   1 1 
        1  2347 1 1 158 ALA HB1  H  13.715   1.810   2.018 1.00 . A A . 158 ALA HB1  1 1 
        1  2348 1 1 158 ALA HB2  H  12.426   2.990   2.257 1.00 . A A . 158 ALA HB2  1 1 
        1  2349 1 1 158 ALA HB3  H  12.040   1.360   1.704 1.00 . A A . 158 ALA HB3  1 1 
        1  2350 1 1 158 ALA N    N  12.755   0.052   3.876 1.00 . A A . 158 ALA N    1 1 
        1  2351 1 1 158 ALA O    O  10.314   1.031   4.549 1.00 . A A . 158 ALA O    1 1 
        1  2352 1 1 159 THR C    C   9.149   4.763   4.080 1.00 . A A . 159 THR C    1 1 
        1  2353 1 1 159 THR CA   C   9.703   3.700   5.021 1.00 . A A . 159 THR CA   1 1 
        1  2354 1 1 159 THR CB   C   9.888   4.285   6.422 1.00 . A A . 159 THR CB   1 1 
        1  2355 1 1 159 THR CG2  C  10.642   3.367   7.360 1.00 . A A . 159 THR CG2  1 1 
        1  2356 1 1 159 THR H    H  11.692   3.814   4.307 1.00 . A A . 159 THR H    1 1 
        1  2357 1 1 159 THR HA   H   9.005   2.878   5.071 1.00 . A A . 159 THR HA   1 1 
        1  2358 1 1 159 THR HB   H   8.916   4.472   6.854 1.00 . A A . 159 THR HB   1 1 
        1  2359 1 1 159 THR HG1  H  11.379   5.405   5.824 1.00 . A A . 159 THR HG1  1 1 
        1  2360 1 1 159 THR HG21 H  11.171   2.621   6.785 1.00 . A A . 159 THR HG21 1 1 
        1  2361 1 1 159 THR HG22 H   9.945   2.881   8.026 1.00 . A A . 159 THR HG22 1 1 
        1  2362 1 1 159 THR HG23 H  11.349   3.945   7.938 1.00 . A A . 159 THR HG23 1 1 
        1  2363 1 1 159 THR N    N  10.970   3.184   4.514 1.00 . A A . 159 THR N    1 1 
        1  2364 1 1 159 THR O    O   9.907   5.528   3.483 1.00 . A A . 159 THR O    1 1 
        1  2365 1 1 159 THR OG1  O  10.593   5.513   6.364 1.00 . A A . 159 THR OG1  1 1 
        1  2366 1 1 160 ARG C    C   5.958   6.400   3.694 1.00 . A A . 160 ARG C    1 1 
        1  2367 1 1 160 ARG CA   C   7.195   5.774   3.057 1.00 . A A . 160 ARG CA   1 1 
        1  2368 1 1 160 ARG CB   C   6.813   5.109   1.732 1.00 . A A . 160 ARG CB   1 1 
        1  2369 1 1 160 ARG CD   C   4.627   4.082   2.432 1.00 . A A . 160 ARG CD   1 1 
        1  2370 1 1 160 ARG CG   C   6.027   3.818   1.902 1.00 . A A . 160 ARG CG   1 1 
        1  2371 1 1 160 ARG CZ   C   3.594   1.883   2.028 1.00 . A A . 160 ARG CZ   1 1 
        1  2372 1 1 160 ARG H    H   7.271   4.166   4.434 1.00 . A A . 160 ARG H    1 1 
        1  2373 1 1 160 ARG HA   H   7.913   6.555   2.858 1.00 . A A . 160 ARG HA   1 1 
        1  2374 1 1 160 ARG HB2  H   6.211   5.798   1.158 1.00 . A A . 160 ARG HB2  1 1 
        1  2375 1 1 160 ARG HB3  H   7.714   4.887   1.181 1.00 . A A . 160 ARG HB3  1 1 
        1  2376 1 1 160 ARG HD2  H   4.627   3.929   3.501 1.00 . A A . 160 ARG HD2  1 1 
        1  2377 1 1 160 ARG HD3  H   4.362   5.106   2.217 1.00 . A A . 160 ARG HD3  1 1 
        1  2378 1 1 160 ARG HE   H   2.958   3.605   1.248 1.00 . A A . 160 ARG HE   1 1 
        1  2379 1 1 160 ARG HG2  H   5.951   3.326   0.943 1.00 . A A . 160 ARG HG2  1 1 
        1  2380 1 1 160 ARG HG3  H   6.551   3.178   2.596 1.00 . A A . 160 ARG HG3  1 1 
        1  2381 1 1 160 ARG HH11 H   5.214   1.837   3.239 1.00 . A A . 160 ARG HH11 1 1 
        1  2382 1 1 160 ARG HH12 H   4.462   0.305   2.948 1.00 . A A . 160 ARG HH12 1 1 
        1  2383 1 1 160 ARG HH21 H   1.968   1.592   0.866 1.00 . A A . 160 ARG HH21 1 1 
        1  2384 1 1 160 ARG HH22 H   2.620   0.166   1.600 1.00 . A A . 160 ARG HH22 1 1 
        1  2385 1 1 160 ARG N    N   7.828   4.804   3.940 1.00 . A A . 160 ARG N    1 1 
        1  2386 1 1 160 ARG NE   N   3.634   3.197   1.829 1.00 . A A . 160 ARG NE   1 1 
        1  2387 1 1 160 ARG NH1  N   4.498   1.294   2.802 1.00 . A A . 160 ARG NH1  1 1 
        1  2388 1 1 160 ARG NH2  N   2.650   1.154   1.451 1.00 . A A . 160 ARG NH2  1 1 
        1  2389 1 1 160 ARG O    O   5.298   5.790   4.540 1.00 . A A . 160 ARG O    1 1 
        1  2390 1 1 161 LEU C    C   3.615   8.793   2.584 1.00 . A A . 161 LEU C    1 1 
        1  2391 1 1 161 LEU CA   C   4.481   8.341   3.755 1.00 . A A . 161 LEU CA   1 1 
        1  2392 1 1 161 LEU CB   C   4.911   9.552   4.589 1.00 . A A . 161 LEU CB   1 1 
        1  2393 1 1 161 LEU CD1  C   4.542  11.057   6.564 1.00 . A A . 161 LEU CD1  1 1 
        1  2394 1 1 161 LEU CD2  C   2.588  10.281   5.203 1.00 . A A . 161 LEU CD2  1 1 
        1  2395 1 1 161 LEU CG   C   3.966   9.915   5.739 1.00 . A A . 161 LEU CG   1 1 
        1  2396 1 1 161 LEU H    H   6.207   8.036   2.576 1.00 . A A . 161 LEU H    1 1 
        1  2397 1 1 161 LEU HA   H   3.908   7.668   4.375 1.00 . A A . 161 LEU HA   1 1 
        1  2398 1 1 161 LEU HB2  H   5.887   9.348   5.004 1.00 . A A . 161 LEU HB2  1 1 
        1  2399 1 1 161 LEU HB3  H   4.988  10.406   3.934 1.00 . A A . 161 LEU HB3  1 1 
        1  2400 1 1 161 LEU HD11 H   4.140  11.996   6.211 1.00 . A A . 161 LEU HD11 1 1 
        1  2401 1 1 161 LEU HD12 H   5.618  11.066   6.466 1.00 . A A . 161 LEU HD12 1 1 
        1  2402 1 1 161 LEU HD13 H   4.278  10.921   7.603 1.00 . A A . 161 LEU HD13 1 1 
        1  2403 1 1 161 LEU HD21 H   2.215  11.149   5.727 1.00 . A A . 161 LEU HD21 1 1 
        1  2404 1 1 161 LEU HD22 H   1.911   9.453   5.353 1.00 . A A . 161 LEU HD22 1 1 
        1  2405 1 1 161 LEU HD23 H   2.657  10.500   4.148 1.00 . A A . 161 LEU HD23 1 1 
        1  2406 1 1 161 LEU HG   H   3.856   9.059   6.388 1.00 . A A . 161 LEU HG   1 1 
        1  2407 1 1 161 LEU N    N   5.645   7.617   3.261 1.00 . A A . 161 LEU N    1 1 
        1  2408 1 1 161 LEU O    O   4.095   9.467   1.667 1.00 . A A . 161 LEU O    1 1 
        1  2409 1 1 162 GLU C    C   0.431   9.830   2.004 1.00 . A A . 162 GLU C    1 1 
        1  2410 1 1 162 GLU CA   C   1.414   8.760   1.545 1.00 . A A . 162 GLU CA   1 1 
        1  2411 1 1 162 GLU CB   C   0.651   7.520   1.075 1.00 . A A . 162 GLU CB   1 1 
        1  2412 1 1 162 GLU CD   C   0.324   6.320  -1.123 1.00 . A A . 162 GLU CD   1 1 
        1  2413 1 1 162 GLU CG   C   1.318   6.797  -0.083 1.00 . A A . 162 GLU CG   1 1 
        1  2414 1 1 162 GLU H    H   2.023   7.863   3.364 1.00 . A A . 162 GLU H    1 1 
        1  2415 1 1 162 GLU HA   H   1.991   9.149   0.720 1.00 . A A . 162 GLU HA   1 1 
        1  2416 1 1 162 GLU HB2  H   0.566   6.829   1.901 1.00 . A A . 162 GLU HB2  1 1 
        1  2417 1 1 162 GLU HB3  H  -0.340   7.817   0.763 1.00 . A A . 162 GLU HB3  1 1 
        1  2418 1 1 162 GLU HG2  H   2.015   7.472  -0.558 1.00 . A A . 162 GLU HG2  1 1 
        1  2419 1 1 162 GLU HG3  H   1.853   5.942   0.303 1.00 . A A . 162 GLU HG3  1 1 
        1  2420 1 1 162 GLU N    N   2.343   8.406   2.612 1.00 . A A . 162 GLU N    1 1 
        1  2421 1 1 162 GLU O    O   0.017   9.853   3.164 1.00 . A A . 162 GLU O    1 1 
        1  2422 1 1 162 GLU OE1  O  -0.817   5.983  -0.743 1.00 . A A . 162 GLU OE1  1 1 
        1  2423 1 1 162 GLU OE2  O   0.685   6.282  -2.318 1.00 . A A . 162 GLU OE2  1 1 
        1  2424 1 1 163 TYR C    C  -1.971  11.855   0.312 1.00 . A A . 163 TYR C    1 1 
        1  2425 1 1 163 TYR CA   C  -0.874  11.792   1.372 1.00 . A A . 163 TYR CA   1 1 
        1  2426 1 1 163 TYR CB   C  -0.135  13.131   1.445 1.00 . A A . 163 TYR CB   1 1 
        1  2427 1 1 163 TYR CD1  C   0.523  12.893   3.871 1.00 . A A . 163 TYR CD1  1 1 
        1  2428 1 1 163 TYR CD2  C  -0.401  14.970   3.154 1.00 . A A . 163 TYR CD2  1 1 
        1  2429 1 1 163 TYR CE1  C   0.646  13.387   5.156 1.00 . A A . 163 TYR CE1  1 1 
        1  2430 1 1 163 TYR CE2  C  -0.280  15.472   4.436 1.00 . A A . 163 TYR CE2  1 1 
        1  2431 1 1 163 TYR CG   C  -0.002  13.675   2.850 1.00 . A A . 163 TYR CG   1 1 
        1  2432 1 1 163 TYR CZ   C   0.244  14.676   5.433 1.00 . A A . 163 TYR CZ   1 1 
        1  2433 1 1 163 TYR H    H   0.429  10.635   0.174 1.00 . A A . 163 TYR H    1 1 
        1  2434 1 1 163 TYR HA   H  -1.327  11.587   2.331 1.00 . A A . 163 TYR HA   1 1 
        1  2435 1 1 163 TYR HB2  H   0.859  13.007   1.043 1.00 . A A . 163 TYR HB2  1 1 
        1  2436 1 1 163 TYR HB3  H  -0.668  13.862   0.855 1.00 . A A . 163 TYR HB3  1 1 
        1  2437 1 1 163 TYR HD1  H   0.837  11.884   3.651 1.00 . A A . 163 TYR HD1  1 1 
        1  2438 1 1 163 TYR HD2  H  -0.812  15.591   2.371 1.00 . A A . 163 TYR HD2  1 1 
        1  2439 1 1 163 TYR HE1  H   1.057  12.764   5.937 1.00 . A A . 163 TYR HE1  1 1 
        1  2440 1 1 163 TYR HE2  H  -0.596  16.481   4.653 1.00 . A A . 163 TYR HE2  1 1 
        1  2441 1 1 163 TYR HH   H   1.237  14.962   7.054 1.00 . A A . 163 TYR HH   1 1 
        1  2442 1 1 163 TYR N    N   0.062  10.713   1.079 1.00 . A A . 163 TYR N    1 1 
        1  2443 1 1 163 TYR O    O  -1.855  11.246  -0.753 1.00 . A A . 163 TYR O    1 1 
        1  2444 1 1 163 TYR OH   O   0.365  15.172   6.711 1.00 . A A . 163 TYR OH   1 1 
        1  2445 1 1 164 GLN C    C  -3.863  13.801  -1.368 1.00 . A A . 164 GLN C    1 1 
        1  2446 1 1 164 GLN CA   C  -4.153  12.735  -0.315 1.00 . A A . 164 GLN CA   1 1 
        1  2447 1 1 164 GLN CB   C  -5.432  13.090   0.446 1.00 . A A . 164 GLN CB   1 1 
        1  2448 1 1 164 GLN CD   C  -6.249  15.381   1.136 1.00 . A A . 164 GLN CD   1 1 
        1  2449 1 1 164 GLN CG   C  -5.267  14.257   1.406 1.00 . A A . 164 GLN CG   1 1 
        1  2450 1 1 164 GLN H    H  -3.069  13.055   1.475 1.00 . A A . 164 GLN H    1 1 
        1  2451 1 1 164 GLN HA   H  -4.292  11.786  -0.811 1.00 . A A . 164 GLN HA   1 1 
        1  2452 1 1 164 GLN HB2  H  -6.202  13.344  -0.268 1.00 . A A . 164 GLN HB2  1 1 
        1  2453 1 1 164 GLN HB3  H  -5.750  12.227   1.013 1.00 . A A . 164 GLN HB3  1 1 
        1  2454 1 1 164 GLN HE21 H  -7.379  14.793   2.663 1.00 . A A . 164 GLN HE21 1 1 
        1  2455 1 1 164 GLN HE22 H  -7.949  16.174   1.795 1.00 . A A . 164 GLN HE22 1 1 
        1  2456 1 1 164 GLN HG2  H  -5.420  13.901   2.414 1.00 . A A . 164 GLN HG2  1 1 
        1  2457 1 1 164 GLN HG3  H  -4.263  14.645   1.312 1.00 . A A . 164 GLN HG3  1 1 
        1  2458 1 1 164 GLN N    N  -3.035  12.595   0.611 1.00 . A A . 164 GLN N    1 1 
        1  2459 1 1 164 GLN NE2  N  -7.298  15.457   1.947 1.00 . A A . 164 GLN NE2  1 1 
        1  2460 1 1 164 GLN O    O  -4.285  13.681  -2.518 1.00 . A A . 164 GLN O    1 1 
        1  2461 1 1 164 GLN OE1  O  -6.066  16.171   0.211 1.00 . A A . 164 GLN OE1  1 1 
        1  2462 1 1 165 TRP C    C  -1.315  15.903  -2.225 1.00 . A A . 165 TRP C    1 1 
        1  2463 1 1 165 TRP CA   C  -2.800  15.929  -1.879 1.00 . A A . 165 TRP CA   1 1 
        1  2464 1 1 165 TRP CB   C  -3.171  17.279  -1.258 1.00 . A A . 165 TRP CB   1 1 
        1  2465 1 1 165 TRP CD1  C  -5.433  17.695  -2.387 1.00 . A A . 165 TRP CD1  1 1 
        1  2466 1 1 165 TRP CD2  C  -3.938  19.333  -2.693 1.00 . A A . 165 TRP CD2  1 1 
        1  2467 1 1 165 TRP CE2  C  -5.129  19.682  -3.359 1.00 . A A . 165 TRP CE2  1 1 
        1  2468 1 1 165 TRP CE3  C  -2.854  20.214  -2.746 1.00 . A A . 165 TRP CE3  1 1 
        1  2469 1 1 165 TRP CG   C  -4.154  18.058  -2.077 1.00 . A A . 165 TRP CG   1 1 
        1  2470 1 1 165 TRP CH2  C  -4.188  21.716  -4.102 1.00 . A A . 165 TRP CH2  1 1 
        1  2471 1 1 165 TRP CZ2  C  -5.265  20.873  -4.068 1.00 . A A . 165 TRP CZ2  1 1 
        1  2472 1 1 165 TRP CZ3  C  -2.991  21.396  -3.450 1.00 . A A . 165 TRP CZ3  1 1 
        1  2473 1 1 165 TRP H    H  -2.835  14.884  -0.038 1.00 . A A . 165 TRP H    1 1 
        1  2474 1 1 165 TRP HA   H  -3.370  15.792  -2.785 1.00 . A A . 165 TRP HA   1 1 
        1  2475 1 1 165 TRP HB2  H  -3.607  17.112  -0.285 1.00 . A A . 165 TRP HB2  1 1 
        1  2476 1 1 165 TRP HB3  H  -2.278  17.878  -1.150 1.00 . A A . 165 TRP HB3  1 1 
        1  2477 1 1 165 TRP HD1  H  -5.898  16.774  -2.066 1.00 . A A . 165 TRP HD1  1 1 
        1  2478 1 1 165 TRP HE1  H  -6.942  18.636  -3.505 1.00 . A A . 165 TRP HE1  1 1 
        1  2479 1 1 165 TRP HE3  H  -1.923  19.985  -2.249 1.00 . A A . 165 TRP HE3  1 1 
        1  2480 1 1 165 TRP HH2  H  -4.249  22.650  -4.641 1.00 . A A . 165 TRP HH2  1 1 
        1  2481 1 1 165 TRP HZ2  H  -6.181  21.134  -4.576 1.00 . A A . 165 TRP HZ2  1 1 
        1  2482 1 1 165 TRP HZ3  H  -2.164  22.089  -3.502 1.00 . A A . 165 TRP HZ3  1 1 
        1  2483 1 1 165 TRP N    N  -3.143  14.843  -0.967 1.00 . A A . 165 TRP N    1 1 
        1  2484 1 1 165 TRP NE1  N  -6.026  18.666  -3.157 1.00 . A A . 165 TRP NE1  1 1 
        1  2485 1 1 165 TRP O    O  -0.502  15.356  -1.479 1.00 . A A . 165 TRP O    1 1 
        1  2486 1 1 166 VAL C    C   0.918  17.982  -3.895 1.00 . A A . 166 VAL C    1 1 
        1  2487 1 1 166 VAL CA   C   0.419  16.544  -3.809 1.00 . A A . 166 VAL CA   1 1 
        1  2488 1 1 166 VAL CB   C   0.590  15.871  -5.184 1.00 . A A . 166 VAL CB   1 1 
        1  2489 1 1 166 VAL CG1  C   2.063  15.770  -5.551 1.00 . A A . 166 VAL CG1  1 1 
        1  2490 1 1 166 VAL CG2  C  -0.068  14.497  -5.195 1.00 . A A . 166 VAL CG2  1 1 
        1  2491 1 1 166 VAL H    H  -1.662  16.916  -3.913 1.00 . A A . 166 VAL H    1 1 
        1  2492 1 1 166 VAL HA   H   1.020  16.006  -3.090 1.00 . A A . 166 VAL HA   1 1 
        1  2493 1 1 166 VAL HB   H   0.100  16.485  -5.926 1.00 . A A . 166 VAL HB   1 1 
        1  2494 1 1 166 VAL HG11 H   2.320  16.568  -6.232 1.00 . A A . 166 VAL HG11 1 1 
        1  2495 1 1 166 VAL HG12 H   2.252  14.818  -6.025 1.00 . A A . 166 VAL HG12 1 1 
        1  2496 1 1 166 VAL HG13 H   2.663  15.852  -4.657 1.00 . A A . 166 VAL HG13 1 1 
        1  2497 1 1 166 VAL HG21 H   0.695  13.732  -5.197 1.00 . A A . 166 VAL HG21 1 1 
        1  2498 1 1 166 VAL HG22 H  -0.679  14.398  -6.079 1.00 . A A . 166 VAL HG22 1 1 
        1  2499 1 1 166 VAL HG23 H  -0.686  14.386  -4.316 1.00 . A A . 166 VAL HG23 1 1 
        1  2500 1 1 166 VAL N    N  -0.968  16.498  -3.362 1.00 . A A . 166 VAL N    1 1 
        1  2501 1 1 166 VAL O    O   0.164  18.892  -4.239 1.00 . A A . 166 VAL O    1 1 
        1  2502 1 1 167 ASN C    C   2.714  20.100  -5.024 1.00 . A A . 167 ASN C    1 1 
        1  2503 1 1 167 ASN CA   C   2.793  19.509  -3.620 1.00 . A A . 167 ASN CA   1 1 
        1  2504 1 1 167 ASN CB   C   4.251  19.448  -3.160 1.00 . A A . 167 ASN CB   1 1 
        1  2505 1 1 167 ASN CG   C   4.381  19.426  -1.650 1.00 . A A . 167 ASN CG   1 1 
        1  2506 1 1 167 ASN H    H   2.745  17.416  -3.312 1.00 . A A . 167 ASN H    1 1 
        1  2507 1 1 167 ASN HA   H   2.239  20.143  -2.944 1.00 . A A . 167 ASN HA   1 1 
        1  2508 1 1 167 ASN HB2  H   4.709  18.554  -3.555 1.00 . A A . 167 ASN HB2  1 1 
        1  2509 1 1 167 ASN HB3  H   4.777  20.313  -3.537 1.00 . A A . 167 ASN HB3  1 1 
        1  2510 1 1 167 ASN HD21 H   6.166  20.292  -1.765 1.00 . A A . 167 ASN HD21 1 1 
        1  2511 1 1 167 ASN HD22 H   5.608  19.934  -0.170 1.00 . A A . 167 ASN HD22 1 1 
        1  2512 1 1 167 ASN N    N   2.194  18.181  -3.579 1.00 . A A . 167 ASN N    1 1 
        1  2513 1 1 167 ASN ND2  N   5.498  19.936  -1.144 1.00 . A A . 167 ASN ND2  1 1 
        1  2514 1 1 167 ASN O    O   2.438  21.288  -5.194 1.00 . A A . 167 ASN O    1 1 
        1  2515 1 1 167 ASN OD1  O   3.487  18.957  -0.945 1.00 . A A . 167 ASN OD1  1 1 
        1  2516 1 1 168 ASN C    C   1.780  19.016  -8.171 1.00 . A A . 168 ASN C    1 1 
        1  2517 1 1 168 ASN CA   C   2.914  19.704  -7.418 1.00 . A A . 168 ASN CA   1 1 
        1  2518 1 1 168 ASN CB   C   4.249  19.416  -8.108 1.00 . A A . 168 ASN CB   1 1 
        1  2519 1 1 168 ASN CG   C   4.732  18.000  -7.864 1.00 . A A . 168 ASN CG   1 1 
        1  2520 1 1 168 ASN H    H   3.173  18.328  -5.829 1.00 . A A . 168 ASN H    1 1 
        1  2521 1 1 168 ASN HA   H   2.739  20.769  -7.423 1.00 . A A . 168 ASN HA   1 1 
        1  2522 1 1 168 ASN HB2  H   4.136  19.559  -9.172 1.00 . A A . 168 ASN HB2  1 1 
        1  2523 1 1 168 ASN HB3  H   4.996  20.101  -7.734 1.00 . A A . 168 ASN HB3  1 1 
        1  2524 1 1 168 ASN HD21 H   3.336  17.286  -9.086 1.00 . A A . 168 ASN HD21 1 1 
        1  2525 1 1 168 ASN HD22 H   4.373  16.109  -8.363 1.00 . A A . 168 ASN HD22 1 1 
        1  2526 1 1 168 ASN N    N   2.958  19.264  -6.028 1.00 . A A . 168 ASN N    1 1 
        1  2527 1 1 168 ASN ND2  N   4.081  17.034  -8.502 1.00 . A A . 168 ASN ND2  1 1 
        1  2528 1 1 168 ASN O    O   1.044  18.209  -7.603 1.00 . A A . 168 ASN O    1 1 
        1  2529 1 1 168 ASN OD1  O   5.681  17.776  -7.112 1.00 . A A . 168 ASN OD1  1 1 
        1  2530 1 1 169 ILE C    C   1.129  18.419 -11.677 1.00 . A A . 169 ILE C    1 1 
        1  2531 1 1 169 ILE CA   C   0.601  18.753 -10.284 1.00 . A A . 169 ILE CA   1 1 
        1  2532 1 1 169 ILE CB   C  -0.611  19.698 -10.414 1.00 . A A . 169 ILE CB   1 1 
        1  2533 1 1 169 ILE CD1  C  -3.113  19.540 -10.854 1.00 . A A . 169 ILE CD1  1 1 
        1  2534 1 1 169 ILE CG1  C  -1.735  19.022 -11.202 1.00 . A A . 169 ILE CG1  1 1 
        1  2535 1 1 169 ILE CG2  C  -0.200  21.004 -11.079 1.00 . A A . 169 ILE CG2  1 1 
        1  2536 1 1 169 ILE H    H   2.264  19.989  -9.850 1.00 . A A . 169 ILE H    1 1 
        1  2537 1 1 169 ILE HA   H   0.271  17.841  -9.808 1.00 . A A . 169 ILE HA   1 1 
        1  2538 1 1 169 ILE HB   H  -0.966  19.928  -9.420 1.00 . A A . 169 ILE HB   1 1 
        1  2539 1 1 169 ILE HD11 H  -3.047  20.192  -9.995 1.00 . A A . 169 ILE HD11 1 1 
        1  2540 1 1 169 ILE HD12 H  -3.764  18.709 -10.626 1.00 . A A . 169 ILE HD12 1 1 
        1  2541 1 1 169 ILE HD13 H  -3.513  20.091 -11.693 1.00 . A A . 169 ILE HD13 1 1 
        1  2542 1 1 169 ILE HG12 H  -1.576  19.187 -12.257 1.00 . A A . 169 ILE HG12 1 1 
        1  2543 1 1 169 ILE HG13 H  -1.718  17.961 -11.001 1.00 . A A . 169 ILE HG13 1 1 
        1  2544 1 1 169 ILE HG21 H  -0.458  20.970 -12.128 1.00 . A A . 169 ILE HG21 1 1 
        1  2545 1 1 169 ILE HG22 H   0.867  21.141 -10.975 1.00 . A A . 169 ILE HG22 1 1 
        1  2546 1 1 169 ILE HG23 H  -0.716  21.827 -10.608 1.00 . A A . 169 ILE HG23 1 1 
        1  2547 1 1 169 ILE N    N   1.646  19.340  -9.453 1.00 . A A . 169 ILE N    1 1 
        1  2548 1 1 169 ILE O    O   1.578  19.301 -12.409 1.00 . A A . 169 ILE O    1 1 
        1  2549 1 1 170 GLY C    C   0.559  17.036 -14.447 1.00 . A A . 170 GLY C    1 1 
        1  2550 1 1 170 GLY CA   C   1.543  16.715 -13.340 1.00 . A A . 170 GLY CA   1 1 
        1  2551 1 1 170 GLY H    H   0.701  16.482 -11.412 1.00 . A A . 170 GLY H    1 1 
        1  2552 1 1 170 GLY HA2  H   2.480  17.211 -13.551 1.00 . A A . 170 GLY HA2  1 1 
        1  2553 1 1 170 GLY HA3  H   1.710  15.648 -13.319 1.00 . A A . 170 GLY HA3  1 1 
        1  2554 1 1 170 GLY N    N   1.070  17.141 -12.036 1.00 . A A . 170 GLY N    1 1 
        1  2555 1 1 170 GLY O    O   0.484  18.174 -14.910 1.00 . A A . 170 GLY O    1 1 
        1  2556 1 1 171 ASP C    C  -2.551  15.688 -15.499 1.00 . A A . 171 ASP C    1 1 
        1  2557 1 1 171 ASP CA   C  -1.184  16.210 -15.933 1.00 . A A . 171 ASP CA   1 1 
        1  2558 1 1 171 ASP CB   C  -0.731  15.494 -17.207 1.00 . A A . 171 ASP CB   1 1 
        1  2559 1 1 171 ASP CG   C  -0.085  16.439 -18.202 1.00 . A A . 171 ASP CG   1 1 
        1  2560 1 1 171 ASP H    H  -0.093  15.146 -14.464 1.00 . A A . 171 ASP H    1 1 
        1  2561 1 1 171 ASP HA   H  -1.264  17.268 -16.134 1.00 . A A . 171 ASP HA   1 1 
        1  2562 1 1 171 ASP HB2  H  -0.013  14.731 -16.947 1.00 . A A . 171 ASP HB2  1 1 
        1  2563 1 1 171 ASP HB3  H  -1.586  15.033 -17.679 1.00 . A A . 171 ASP HB3  1 1 
        1  2564 1 1 171 ASP N    N  -0.199  16.030 -14.873 1.00 . A A . 171 ASP N    1 1 
        1  2565 1 1 171 ASP O    O  -2.661  14.595 -14.945 1.00 . A A . 171 ASP O    1 1 
        1  2566 1 1 171 ASP OD1  O   0.606  17.382 -17.763 1.00 . A A . 171 ASP OD1  1 1 
        1  2567 1 1 171 ASP OD2  O  -0.271  16.235 -19.420 1.00 . A A . 171 ASP OD2  1 1 
        1  2568 1 1 172 ALA C    C  -5.974  16.947 -16.132 1.00 . A A . 172 ALA C    1 1 
        1  2569 1 1 172 ALA CA   C  -4.948  16.094 -15.394 1.00 . A A . 172 ALA CA   1 1 
        1  2570 1 1 172 ALA CB   C  -5.145  16.212 -13.890 1.00 . A A . 172 ALA CB   1 1 
        1  2571 1 1 172 ALA H    H  -3.437  17.337 -16.202 1.00 . A A . 172 ALA H    1 1 
        1  2572 1 1 172 ALA HA   H  -5.088  15.060 -15.671 1.00 . A A . 172 ALA HA   1 1 
        1  2573 1 1 172 ALA HB1  H  -4.887  17.211 -13.570 1.00 . A A . 172 ALA HB1  1 1 
        1  2574 1 1 172 ALA HB2  H  -4.510  15.498 -13.387 1.00 . A A . 172 ALA HB2  1 1 
        1  2575 1 1 172 ALA HB3  H  -6.177  16.011 -13.645 1.00 . A A . 172 ALA HB3  1 1 
        1  2576 1 1 172 ALA N    N  -3.589  16.477 -15.757 1.00 . A A . 172 ALA N    1 1 
        1  2577 1 1 172 ALA O    O  -5.870  18.173 -16.164 1.00 . A A . 172 ALA O    1 1 
        1  2578 1 1 173 GLY C    C  -9.306  17.073 -16.690 1.00 . A A . 173 GLY C    1 1 
        1  2579 1 1 173 GLY CA   C  -7.997  17.003 -17.453 1.00 . A A . 173 GLY CA   1 1 
        1  2580 1 1 173 GLY H    H  -6.998  15.312 -16.664 1.00 . A A . 173 GLY H    1 1 
        1  2581 1 1 173 GLY HA2  H  -7.654  18.008 -17.649 1.00 . A A . 173 GLY HA2  1 1 
        1  2582 1 1 173 GLY HA3  H  -8.169  16.503 -18.395 1.00 . A A . 173 GLY HA3  1 1 
        1  2583 1 1 173 GLY N    N  -6.966  16.289 -16.723 1.00 . A A . 173 GLY N    1 1 
        1  2584 1 1 173 GLY O    O -10.056  18.040 -16.819 1.00 . A A . 173 GLY O    1 1 
        1  2585 1 1 174 THR C    C -10.601  15.183 -13.831 1.00 . A A . 174 THR C    1 1 
        1  2586 1 1 174 THR CA   C -10.806  15.994 -15.106 1.00 . A A . 174 THR CA   1 1 
        1  2587 1 1 174 THR CB   C -11.942  15.390 -15.932 1.00 . A A . 174 THR CB   1 1 
        1  2588 1 1 174 THR CG2  C -11.680  13.961 -16.357 1.00 . A A . 174 THR CG2  1 1 
        1  2589 1 1 174 THR H    H  -8.941  15.304 -15.832 1.00 . A A . 174 THR H    1 1 
        1  2590 1 1 174 THR HA   H -11.068  17.006 -14.836 1.00 . A A . 174 THR HA   1 1 
        1  2591 1 1 174 THR HB   H -12.077  15.981 -16.826 1.00 . A A . 174 THR HB   1 1 
        1  2592 1 1 174 THR HG1  H -13.033  14.948 -14.367 1.00 . A A . 174 THR HG1  1 1 
        1  2593 1 1 174 THR HG21 H -12.311  13.295 -15.788 1.00 . A A . 174 THR HG21 1 1 
        1  2594 1 1 174 THR HG22 H -10.643  13.716 -16.177 1.00 . A A . 174 THR HG22 1 1 
        1  2595 1 1 174 THR HG23 H -11.898  13.853 -17.409 1.00 . A A . 174 THR HG23 1 1 
        1  2596 1 1 174 THR N    N  -9.579  16.046 -15.893 1.00 . A A . 174 THR N    1 1 
        1  2597 1 1 174 THR O    O  -9.810  14.240 -13.804 1.00 . A A . 174 THR O    1 1 
        1  2598 1 1 174 THR OG1  O -13.156  15.405 -15.202 1.00 . A A . 174 THR OG1  1 1 
        1  2599 1 1 175 VAL C    C -12.596  14.556 -10.927 1.00 . A A . 175 VAL C    1 1 
        1  2600 1 1 175 VAL CA   C -11.216  14.863 -11.499 1.00 . A A . 175 VAL CA   1 1 
        1  2601 1 1 175 VAL CB   C -10.423  15.693 -10.472 1.00 . A A . 175 VAL CB   1 1 
        1  2602 1 1 175 VAL CG1  C  -8.974  15.846 -10.912 1.00 . A A . 175 VAL CG1  1 1 
        1  2603 1 1 175 VAL CG2  C -11.072  17.054 -10.270 1.00 . A A . 175 VAL CG2  1 1 
        1  2604 1 1 175 VAL H    H -11.932  16.316 -12.861 1.00 . A A . 175 VAL H    1 1 
        1  2605 1 1 175 VAL HA   H -10.690  13.934 -11.664 1.00 . A A . 175 VAL HA   1 1 
        1  2606 1 1 175 VAL HB   H -10.435  15.169  -9.528 1.00 . A A . 175 VAL HB   1 1 
        1  2607 1 1 175 VAL HG11 H  -8.870  16.743 -11.503 1.00 . A A . 175 VAL HG11 1 1 
        1  2608 1 1 175 VAL HG12 H  -8.686  14.989 -11.503 1.00 . A A . 175 VAL HG12 1 1 
        1  2609 1 1 175 VAL HG13 H  -8.339  15.913 -10.041 1.00 . A A . 175 VAL HG13 1 1 
        1  2610 1 1 175 VAL HG21 H -11.971  16.940  -9.682 1.00 . A A . 175 VAL HG21 1 1 
        1  2611 1 1 175 VAL HG22 H -11.323  17.479 -11.231 1.00 . A A . 175 VAL HG22 1 1 
        1  2612 1 1 175 VAL HG23 H -10.385  17.708  -9.755 1.00 . A A . 175 VAL HG23 1 1 
        1  2613 1 1 175 VAL N    N -11.319  15.556 -12.777 1.00 . A A . 175 VAL N    1 1 
        1  2614 1 1 175 VAL O    O -13.390  15.461 -10.674 1.00 . A A . 175 VAL O    1 1 
        1  2615 1 1 176 GLY C    C -14.024  12.088  -8.892 1.00 . A A . 176 GLY C    1 1 
        1  2616 1 1 176 GLY CA   C -14.160  12.867 -10.185 1.00 . A A . 176 GLY CA   1 1 
        1  2617 1 1 176 GLY H    H -12.203  12.593 -10.947 1.00 . A A . 176 GLY H    1 1 
        1  2618 1 1 176 GLY HA2  H -14.755  13.749 -10.001 1.00 . A A . 176 GLY HA2  1 1 
        1  2619 1 1 176 GLY HA3  H -14.666  12.250 -10.913 1.00 . A A . 176 GLY HA3  1 1 
        1  2620 1 1 176 GLY N    N -12.875  13.272 -10.726 1.00 . A A . 176 GLY N    1 1 
        1  2621 1 1 176 GLY O    O -13.906  10.863  -8.907 1.00 . A A . 176 GLY O    1 1 
        1  2622 1 1 177 THR C    C -14.888  12.786  -5.463 1.00 . A A . 177 THR C    1 1 
        1  2623 1 1 177 THR CA   C -13.915  12.168  -6.462 1.00 . A A . 177 THR CA   1 1 
        1  2624 1 1 177 THR CB   C -12.482  12.298  -5.945 1.00 . A A . 177 THR CB   1 1 
        1  2625 1 1 177 THR CG2  C -11.549  11.245  -6.502 1.00 . A A . 177 THR CG2  1 1 
        1  2626 1 1 177 THR H    H -14.135  13.774  -7.823 1.00 . A A . 177 THR H    1 1 
        1  2627 1 1 177 THR HA   H -14.153  11.121  -6.577 1.00 . A A . 177 THR HA   1 1 
        1  2628 1 1 177 THR HB   H -12.489  12.199  -4.869 1.00 . A A . 177 THR HB   1 1 
        1  2629 1 1 177 THR HG1  H -11.048  13.631  -5.935 1.00 . A A . 177 THR HG1  1 1 
        1  2630 1 1 177 THR HG21 H -12.092  10.605  -7.181 1.00 . A A . 177 THR HG21 1 1 
        1  2631 1 1 177 THR HG22 H -11.149  10.653  -5.692 1.00 . A A . 177 THR HG22 1 1 
        1  2632 1 1 177 THR HG23 H -10.739  11.726  -7.030 1.00 . A A . 177 THR HG23 1 1 
        1  2633 1 1 177 THR N    N -14.039  12.801  -7.770 1.00 . A A . 177 THR N    1 1 
        1  2634 1 1 177 THR O    O -14.670  13.894  -4.972 1.00 . A A . 177 THR O    1 1 
        1  2635 1 1 177 THR OG1  O -11.944  13.567  -6.272 1.00 . A A . 177 THR OG1  1 1 
        1  2636 1 1 178 ARG C    C -16.463  12.474  -2.789 1.00 . A A . 178 ARG C    1 1 
        1  2637 1 1 178 ARG CA   C -16.973  12.538  -4.229 1.00 . A A . 178 ARG CA   1 1 
        1  2638 1 1 178 ARG CB   C -18.256  11.714  -4.368 1.00 . A A . 178 ARG CB   1 1 
        1  2639 1 1 178 ARG CD   C -19.635  12.758  -6.194 1.00 . A A . 178 ARG CD   1 1 
        1  2640 1 1 178 ARG CG   C -19.483  12.550  -4.695 1.00 . A A . 178 ARG CG   1 1 
        1  2641 1 1 178 ARG CZ   C -21.442  11.226  -6.872 1.00 . A A . 178 ARG CZ   1 1 
        1  2642 1 1 178 ARG H    H -16.081  11.188  -5.594 1.00 . A A . 178 ARG H    1 1 
        1  2643 1 1 178 ARG HA   H -17.191  13.566  -4.474 1.00 . A A . 178 ARG HA   1 1 
        1  2644 1 1 178 ARG HB2  H -18.121  10.989  -5.157 1.00 . A A . 178 ARG HB2  1 1 
        1  2645 1 1 178 ARG HB3  H -18.441  11.192  -3.440 1.00 . A A . 178 ARG HB3  1 1 
        1  2646 1 1 178 ARG HD2  H -19.407  13.788  -6.426 1.00 . A A . 178 ARG HD2  1 1 
        1  2647 1 1 178 ARG HD3  H -18.939  12.112  -6.708 1.00 . A A . 178 ARG HD3  1 1 
        1  2648 1 1 178 ARG HE   H -21.593  13.215  -6.807 1.00 . A A . 178 ARG HE   1 1 
        1  2649 1 1 178 ARG HG2  H -20.361  12.044  -4.322 1.00 . A A . 178 ARG HG2  1 1 
        1  2650 1 1 178 ARG HG3  H -19.389  13.513  -4.215 1.00 . A A . 178 ARG HG3  1 1 
        1  2651 1 1 178 ARG HH11 H -19.714  10.308  -6.360 1.00 . A A . 178 ARG HH11 1 1 
        1  2652 1 1 178 ARG HH12 H -21.000   9.253  -6.841 1.00 . A A . 178 ARG HH12 1 1 
        1  2653 1 1 178 ARG HH21 H -23.286  11.828  -7.440 1.00 . A A . 178 ARG HH21 1 1 
        1  2654 1 1 178 ARG HH22 H -23.027  10.116  -7.454 1.00 . A A . 178 ARG HH22 1 1 
        1  2655 1 1 178 ARG N    N -15.963  12.062  -5.168 1.00 . A A . 178 ARG N    1 1 
        1  2656 1 1 178 ARG NE   N -20.989  12.458  -6.654 1.00 . A A . 178 ARG NE   1 1 
        1  2657 1 1 178 ARG NH1  N -20.653  10.176  -6.675 1.00 . A A . 178 ARG NH1  1 1 
        1  2658 1 1 178 ARG NH2  N -22.687  11.041  -7.289 1.00 . A A . 178 ARG NH2  1 1 
        1  2659 1 1 178 ARG O    O -16.372  13.498  -2.111 1.00 . A A . 178 ARG O    1 1 
        1  2660 1 1 179 PRO C    C -14.267  11.740  -0.712 1.00 . A A . 179 PRO C    1 1 
        1  2661 1 1 179 PRO CA   C -15.628  11.086  -0.930 1.00 . A A . 179 PRO CA   1 1 
        1  2662 1 1 179 PRO CB   C -15.522   9.565  -0.780 1.00 . A A . 179 PRO CB   1 1 
        1  2663 1 1 179 PRO CD   C -16.204   9.991  -3.032 1.00 . A A . 179 PRO CD   1 1 
        1  2664 1 1 179 PRO CG   C -15.414   9.046  -2.172 1.00 . A A . 179 PRO CG   1 1 
        1  2665 1 1 179 PRO HA   H -16.328  11.473  -0.204 1.00 . A A . 179 PRO HA   1 1 
        1  2666 1 1 179 PRO HB2  H -14.647   9.320  -0.197 1.00 . A A . 179 PRO HB2  1 1 
        1  2667 1 1 179 PRO HB3  H -16.406   9.188  -0.287 1.00 . A A . 179 PRO HB3  1 1 
        1  2668 1 1 179 PRO HD2  H -15.751  10.077  -4.008 1.00 . A A . 179 PRO HD2  1 1 
        1  2669 1 1 179 PRO HD3  H -17.228   9.658  -3.117 1.00 . A A . 179 PRO HD3  1 1 
        1  2670 1 1 179 PRO HG2  H -14.379   9.034  -2.480 1.00 . A A . 179 PRO HG2  1 1 
        1  2671 1 1 179 PRO HG3  H -15.833   8.052  -2.226 1.00 . A A . 179 PRO HG3  1 1 
        1  2672 1 1 179 PRO N    N -16.125  11.268  -2.299 1.00 . A A . 179 PRO N    1 1 
        1  2673 1 1 179 PRO O    O -14.085  12.517   0.225 1.00 . A A . 179 PRO O    1 1 
        1  2674 1 1 180 ASP C    C -11.121  11.581  -2.681 1.00 . A A . 180 ASP C    1 1 
        1  2675 1 1 180 ASP CA   C -11.971  11.980  -1.479 1.00 . A A . 180 ASP CA   1 1 
        1  2676 1 1 180 ASP CB   C -11.300  11.514  -0.183 1.00 . A A . 180 ASP CB   1 1 
        1  2677 1 1 180 ASP CG   C -11.002  12.663   0.760 1.00 . A A . 180 ASP CG   1 1 
        1  2678 1 1 180 ASP H    H -13.517  10.797  -2.308 1.00 . A A . 180 ASP H    1 1 
        1  2679 1 1 180 ASP HA   H -12.061  13.056  -1.459 1.00 . A A . 180 ASP HA   1 1 
        1  2680 1 1 180 ASP HB2  H -11.954  10.819   0.323 1.00 . A A . 180 ASP HB2  1 1 
        1  2681 1 1 180 ASP HB3  H -10.371  11.018  -0.422 1.00 . A A . 180 ASP HB3  1 1 
        1  2682 1 1 180 ASP N    N -13.314  11.422  -1.581 1.00 . A A . 180 ASP N    1 1 
        1  2683 1 1 180 ASP O    O -11.520  10.737  -3.483 1.00 . A A . 180 ASP O    1 1 
        1  2684 1 1 180 ASP OD1  O -11.928  13.452   1.046 1.00 . A A . 180 ASP OD1  1 1 
        1  2685 1 1 180 ASP OD2  O  -9.844  12.774   1.213 1.00 . A A . 180 ASP OD2  1 1 
        1  2686 1 1 181 ASN C    C  -7.983  10.882  -3.483 1.00 . A A . 181 ASN C    1 1 
        1  2687 1 1 181 ASN CA   C  -9.039  11.901  -3.900 1.00 . A A . 181 ASN CA   1 1 
        1  2688 1 1 181 ASN CB   C  -8.362  13.185  -4.383 1.00 . A A . 181 ASN CB   1 1 
        1  2689 1 1 181 ASN CG   C  -7.770  13.991  -3.244 1.00 . A A . 181 ASN CG   1 1 
        1  2690 1 1 181 ASN H    H  -9.684  12.855  -2.124 1.00 . A A . 181 ASN H    1 1 
        1  2691 1 1 181 ASN HA   H  -9.622  11.486  -4.708 1.00 . A A . 181 ASN HA   1 1 
        1  2692 1 1 181 ASN HB2  H  -7.567  12.929  -5.068 1.00 . A A . 181 ASN HB2  1 1 
        1  2693 1 1 181 ASN HB3  H  -9.089  13.798  -4.895 1.00 . A A . 181 ASN HB3  1 1 
        1  2694 1 1 181 ASN HD21 H  -9.173  15.383  -3.467 1.00 . A A . 181 ASN HD21 1 1 
        1  2695 1 1 181 ASN HD22 H  -8.022  15.671  -2.211 1.00 . A A . 181 ASN HD22 1 1 
        1  2696 1 1 181 ASN N    N  -9.947  12.192  -2.797 1.00 . A A . 181 ASN N    1 1 
        1  2697 1 1 181 ASN ND2  N  -8.384  15.130  -2.944 1.00 . A A . 181 ASN ND2  1 1 
        1  2698 1 1 181 ASN O    O  -7.690   9.941  -4.220 1.00 . A A . 181 ASN O    1 1 
        1  2699 1 1 181 ASN OD1  O  -6.773  13.595  -2.639 1.00 . A A . 181 ASN OD1  1 1 
        1  2700 1 1 182 GLY C    C  -6.566   9.853  -0.330 1.00 . A A . 182 GLY C    1 1 
        1  2701 1 1 182 GLY CA   C  -6.400  10.167  -1.804 1.00 . A A . 182 GLY CA   1 1 
        1  2702 1 1 182 GLY H    H  -7.690  11.844  -1.752 1.00 . A A . 182 GLY H    1 1 
        1  2703 1 1 182 GLY HA2  H  -6.454   9.245  -2.364 1.00 . A A . 182 GLY HA2  1 1 
        1  2704 1 1 182 GLY HA3  H  -5.428  10.612  -1.958 1.00 . A A . 182 GLY HA3  1 1 
        1  2705 1 1 182 GLY N    N  -7.416  11.077  -2.297 1.00 . A A . 182 GLY N    1 1 
        1  2706 1 1 182 GLY O    O  -7.575  10.210   0.278 1.00 . A A . 182 GLY O    1 1 
        1  2707 1 1 183 MET C    C  -4.230   8.951   2.291 1.00 . A A . 183 MET C    1 1 
        1  2708 1 1 183 MET CA   C  -5.612   8.820   1.657 1.00 . A A . 183 MET CA   1 1 
        1  2709 1 1 183 MET CB   C  -6.129   7.390   1.824 1.00 . A A . 183 MET CB   1 1 
        1  2710 1 1 183 MET CE   C  -9.552   8.268   0.191 1.00 . A A . 183 MET CE   1 1 
        1  2711 1 1 183 MET CG   C  -7.641   7.301   1.950 1.00 . A A . 183 MET CG   1 1 
        1  2712 1 1 183 MET H    H  -4.794   8.927  -0.292 1.00 . A A . 183 MET H    1 1 
        1  2713 1 1 183 MET HA   H  -6.288   9.499   2.155 1.00 . A A . 183 MET HA   1 1 
        1  2714 1 1 183 MET HB2  H  -5.826   6.808   0.966 1.00 . A A . 183 MET HB2  1 1 
        1  2715 1 1 183 MET HB3  H  -5.689   6.961   2.712 1.00 . A A . 183 MET HB3  1 1 
        1  2716 1 1 183 MET HE1  H  -9.471   8.919   1.049 1.00 . A A . 183 MET HE1  1 1 
        1  2717 1 1 183 MET HE2  H -10.567   7.911   0.105 1.00 . A A . 183 MET HE2  1 1 
        1  2718 1 1 183 MET HE3  H  -9.285   8.814  -0.701 1.00 . A A . 183 MET HE3  1 1 
        1  2719 1 1 183 MET HG2  H  -7.883   6.545   2.682 1.00 . A A . 183 MET HG2  1 1 
        1  2720 1 1 183 MET HG3  H  -8.017   8.257   2.284 1.00 . A A . 183 MET HG3  1 1 
        1  2721 1 1 183 MET N    N  -5.572   9.183   0.246 1.00 . A A . 183 MET N    1 1 
        1  2722 1 1 183 MET O    O  -3.237   8.474   1.741 1.00 . A A . 183 MET O    1 1 
        1  2723 1 1 183 MET SD   S  -8.444   6.875   0.393 1.00 . A A . 183 MET SD   1 1 
        1  2724 1 1 184 LEU C    C  -2.643   8.628   5.107 1.00 . A A . 184 LEU C    1 1 
        1  2725 1 1 184 LEU CA   C  -2.914   9.790   4.157 1.00 . A A . 184 LEU CA   1 1 
        1  2726 1 1 184 LEU CB   C  -2.936  11.107   4.936 1.00 . A A . 184 LEU CB   1 1 
        1  2727 1 1 184 LEU CD1  C  -5.054  12.410   4.610 1.00 . A A . 184 LEU CD1  1 1 
        1  2728 1 1 184 LEU CD2  C  -2.844  13.573   4.488 1.00 . A A . 184 LEU CD2  1 1 
        1  2729 1 1 184 LEU CG   C  -3.594  12.280   4.205 1.00 . A A . 184 LEU CG   1 1 
        1  2730 1 1 184 LEU H    H  -5.000   9.955   3.839 1.00 . A A . 184 LEU H    1 1 
        1  2731 1 1 184 LEU HA   H  -2.126   9.830   3.422 1.00 . A A . 184 LEU HA   1 1 
        1  2732 1 1 184 LEU HB2  H  -3.467  10.943   5.863 1.00 . A A . 184 LEU HB2  1 1 
        1  2733 1 1 184 LEU HB3  H  -1.918  11.381   5.168 1.00 . A A . 184 LEU HB3  1 1 
        1  2734 1 1 184 LEU HD11 H  -5.346  13.449   4.574 1.00 . A A . 184 LEU HD11 1 1 
        1  2735 1 1 184 LEU HD12 H  -5.184  12.034   5.615 1.00 . A A . 184 LEU HD12 1 1 
        1  2736 1 1 184 LEU HD13 H  -5.668  11.839   3.930 1.00 . A A . 184 LEU HD13 1 1 
        1  2737 1 1 184 LEU HD21 H  -2.815  14.176   3.592 1.00 . A A . 184 LEU HD21 1 1 
        1  2738 1 1 184 LEU HD22 H  -1.836  13.344   4.801 1.00 . A A . 184 LEU HD22 1 1 
        1  2739 1 1 184 LEU HD23 H  -3.349  14.118   5.272 1.00 . A A . 184 LEU HD23 1 1 
        1  2740 1 1 184 LEU HG   H  -3.558  12.097   3.141 1.00 . A A . 184 LEU HG   1 1 
        1  2741 1 1 184 LEU N    N  -4.174   9.598   3.450 1.00 . A A . 184 LEU N    1 1 
        1  2742 1 1 184 LEU O    O  -3.543   8.170   5.811 1.00 . A A . 184 LEU O    1 1 
        1  2743 1 1 185 SER C    C   0.481   6.814   6.001 1.00 . A A . 185 SER C    1 1 
        1  2744 1 1 185 SER CA   C  -1.029   7.039   5.993 1.00 . A A . 185 SER CA   1 1 
        1  2745 1 1 185 SER CB   C  -1.740   5.761   5.546 1.00 . A A . 185 SER CB   1 1 
        1  2746 1 1 185 SER H    H  -0.722   8.555   4.539 1.00 . A A . 185 SER H    1 1 
        1  2747 1 1 185 SER HA   H  -1.348   7.283   6.995 1.00 . A A . 185 SER HA   1 1 
        1  2748 1 1 185 SER HB2  H  -1.301   4.912   6.049 1.00 . A A . 185 SER HB2  1 1 
        1  2749 1 1 185 SER HB3  H  -2.788   5.827   5.798 1.00 . A A . 185 SER HB3  1 1 
        1  2750 1 1 185 SER HG   H  -1.921   6.360   3.689 1.00 . A A . 185 SER HG   1 1 
        1  2751 1 1 185 SER N    N  -1.401   8.152   5.123 1.00 . A A . 185 SER N    1 1 
        1  2752 1 1 185 SER O    O   1.206   7.343   5.155 1.00 . A A . 185 SER O    1 1 
        1  2753 1 1 185 SER OG   O  -1.618   5.572   4.146 1.00 . A A . 185 SER OG   1 1 
        1  2754 1 1 186 LEU C    C   2.603   4.212   6.870 1.00 . A A . 186 LEU C    1 1 
        1  2755 1 1 186 LEU CA   C   2.368   5.703   7.083 1.00 . A A . 186 LEU CA   1 1 
        1  2756 1 1 186 LEU CB   C   2.901   6.116   8.461 1.00 . A A . 186 LEU CB   1 1 
        1  2757 1 1 186 LEU CD1  C   1.246   6.959  10.152 1.00 . A A . 186 LEU CD1  1 1 
        1  2758 1 1 186 LEU CD2  C   3.310   8.285   9.660 1.00 . A A . 186 LEU CD2  1 1 
        1  2759 1 1 186 LEU CG   C   2.249   7.358   9.078 1.00 . A A . 186 LEU CG   1 1 
        1  2760 1 1 186 LEU H    H   0.310   5.615   7.599 1.00 . A A . 186 LEU H    1 1 
        1  2761 1 1 186 LEU HA   H   2.896   6.254   6.320 1.00 . A A . 186 LEU HA   1 1 
        1  2762 1 1 186 LEU HB2  H   2.758   5.286   9.139 1.00 . A A . 186 LEU HB2  1 1 
        1  2763 1 1 186 LEU HB3  H   3.961   6.301   8.369 1.00 . A A . 186 LEU HB3  1 1 
        1  2764 1 1 186 LEU HD11 H   0.388   7.614  10.106 1.00 . A A . 186 LEU HD11 1 1 
        1  2765 1 1 186 LEU HD12 H   1.709   7.040  11.125 1.00 . A A . 186 LEU HD12 1 1 
        1  2766 1 1 186 LEU HD13 H   0.930   5.939   9.989 1.00 . A A . 186 LEU HD13 1 1 
        1  2767 1 1 186 LEU HD21 H   3.647   7.895  10.610 1.00 . A A . 186 LEU HD21 1 1 
        1  2768 1 1 186 LEU HD22 H   2.889   9.269   9.805 1.00 . A A . 186 LEU HD22 1 1 
        1  2769 1 1 186 LEU HD23 H   4.147   8.347   8.980 1.00 . A A . 186 LEU HD23 1 1 
        1  2770 1 1 186 LEU HG   H   1.717   7.898   8.309 1.00 . A A . 186 LEU HG   1 1 
        1  2771 1 1 186 LEU N    N   0.945   6.014   6.961 1.00 . A A . 186 LEU N    1 1 
        1  2772 1 1 186 LEU O    O   1.818   3.384   7.331 1.00 . A A . 186 LEU O    1 1 
        1  2773 1 1 187 GLY C    C   5.438   2.181   5.691 1.00 . A A . 187 GLY C    1 1 
        1  2774 1 1 187 GLY CA   C   3.967   2.466   5.919 1.00 . A A . 187 GLY CA   1 1 
        1  2775 1 1 187 GLY H    H   4.277   4.565   5.815 1.00 . A A . 187 GLY H    1 1 
        1  2776 1 1 187 GLY HA2  H   3.631   1.889   6.767 1.00 . A A . 187 GLY HA2  1 1 
        1  2777 1 1 187 GLY HA3  H   3.415   2.152   5.046 1.00 . A A . 187 GLY HA3  1 1 
        1  2778 1 1 187 GLY N    N   3.681   3.868   6.168 1.00 . A A . 187 GLY N    1 1 
        1  2779 1 1 187 GLY O    O   6.248   3.098   5.554 1.00 . A A . 187 GLY O    1 1 
        1  2780 1 1 188 VAL C    C   7.204  -0.585   4.307 1.00 . A A . 188 VAL C    1 1 
        1  2781 1 1 188 VAL CA   C   7.151   0.463   5.415 1.00 . A A . 188 VAL CA   1 1 
        1  2782 1 1 188 VAL CB   C   7.791  -0.118   6.695 1.00 . A A . 188 VAL CB   1 1 
        1  2783 1 1 188 VAL CG1  C   8.375   0.996   7.551 1.00 . A A . 188 VAL CG1  1 1 
        1  2784 1 1 188 VAL CG2  C   6.782  -0.934   7.491 1.00 . A A . 188 VAL CG2  1 1 
        1  2785 1 1 188 VAL H    H   5.074   0.216   5.748 1.00 . A A . 188 VAL H    1 1 
        1  2786 1 1 188 VAL HA   H   7.725   1.326   5.108 1.00 . A A . 188 VAL HA   1 1 
        1  2787 1 1 188 VAL HB   H   8.599  -0.773   6.401 1.00 . A A . 188 VAL HB   1 1 
        1  2788 1 1 188 VAL HG11 H   9.303   0.662   7.991 1.00 . A A . 188 VAL HG11 1 1 
        1  2789 1 1 188 VAL HG12 H   7.677   1.252   8.334 1.00 . A A . 188 VAL HG12 1 1 
        1  2790 1 1 188 VAL HG13 H   8.560   1.863   6.935 1.00 . A A . 188 VAL HG13 1 1 
        1  2791 1 1 188 VAL HG21 H   6.242  -1.591   6.825 1.00 . A A . 188 VAL HG21 1 1 
        1  2792 1 1 188 VAL HG22 H   6.087  -0.269   7.982 1.00 . A A . 188 VAL HG22 1 1 
        1  2793 1 1 188 VAL HG23 H   7.300  -1.523   8.234 1.00 . A A . 188 VAL HG23 1 1 
        1  2794 1 1 188 VAL N    N   5.775   0.895   5.640 1.00 . A A . 188 VAL N    1 1 
        1  2795 1 1 188 VAL O    O   6.336  -1.454   4.225 1.00 . A A . 188 VAL O    1 1 
        1  2796 1 1 189 SER C    C   9.793  -1.927   2.208 1.00 . A A . 189 SER C    1 1 
        1  2797 1 1 189 SER CA   C   8.357  -1.435   2.343 1.00 . A A . 189 SER CA   1 1 
        1  2798 1 1 189 SER CB   C   7.908  -0.781   1.035 1.00 . A A . 189 SER CB   1 1 
        1  2799 1 1 189 SER H    H   8.875   0.224   3.556 1.00 . A A . 189 SER H    1 1 
        1  2800 1 1 189 SER HA   H   7.718  -2.281   2.547 1.00 . A A . 189 SER HA   1 1 
        1  2801 1 1 189 SER HB2  H   7.867  -1.529   0.257 1.00 . A A . 189 SER HB2  1 1 
        1  2802 1 1 189 SER HB3  H   6.927  -0.348   1.169 1.00 . A A . 189 SER HB3  1 1 
        1  2803 1 1 189 SER HG   H   9.671  -0.143   0.470 1.00 . A A . 189 SER HG   1 1 
        1  2804 1 1 189 SER N    N   8.216  -0.494   3.449 1.00 . A A . 189 SER N    1 1 
        1  2805 1 1 189 SER O    O  10.691  -1.466   2.913 1.00 . A A . 189 SER O    1 1 
        1  2806 1 1 189 SER OG   O   8.807   0.240   0.639 1.00 . A A . 189 SER OG   1 1 
        1  2807 1 1 190 TYR C    C  11.504  -3.761  -0.430 1.00 . A A . 190 TYR C    1 1 
        1  2808 1 1 190 TYR CA   C  11.321  -3.431   1.048 1.00 . A A . 190 TYR CA   1 1 
        1  2809 1 1 190 TYR CB   C  11.524  -4.690   1.892 1.00 . A A . 190 TYR CB   1 1 
        1  2810 1 1 190 TYR CD1  C   9.263  -5.787   2.139 1.00 . A A . 190 TYR CD1  1 1 
        1  2811 1 1 190 TYR CD2  C  10.876  -6.836   0.731 1.00 . A A . 190 TYR CD2  1 1 
        1  2812 1 1 190 TYR CE1  C   8.357  -6.792   1.857 1.00 . A A . 190 TYR CE1  1 1 
        1  2813 1 1 190 TYR CE2  C   9.975  -7.844   0.444 1.00 . A A . 190 TYR CE2  1 1 
        1  2814 1 1 190 TYR CG   C  10.536  -5.792   1.582 1.00 . A A . 190 TYR CG   1 1 
        1  2815 1 1 190 TYR CZ   C   8.718  -7.817   1.009 1.00 . A A . 190 TYR CZ   1 1 
        1  2816 1 1 190 TYR H    H   9.240  -3.189   0.761 1.00 . A A . 190 TYR H    1 1 
        1  2817 1 1 190 TYR HA   H  12.055  -2.692   1.334 1.00 . A A . 190 TYR HA   1 1 
        1  2818 1 1 190 TYR HB2  H  12.517  -5.076   1.717 1.00 . A A . 190 TYR HB2  1 1 
        1  2819 1 1 190 TYR HB3  H  11.421  -4.435   2.937 1.00 . A A . 190 TYR HB3  1 1 
        1  2820 1 1 190 TYR HD1  H   8.984  -4.981   2.801 1.00 . A A . 190 TYR HD1  1 1 
        1  2821 1 1 190 TYR HD2  H  11.861  -6.855   0.290 1.00 . A A . 190 TYR HD2  1 1 
        1  2822 1 1 190 TYR HE1  H   7.373  -6.770   2.300 1.00 . A A . 190 TYR HE1  1 1 
        1  2823 1 1 190 TYR HE2  H  10.258  -8.648  -0.220 1.00 . A A . 190 TYR HE2  1 1 
        1  2824 1 1 190 TYR HH   H   8.276  -9.663   0.697 1.00 . A A . 190 TYR HH   1 1 
        1  2825 1 1 190 TYR N    N   9.999  -2.867   1.290 1.00 . A A . 190 TYR N    1 1 
        1  2826 1 1 190 TYR O    O  10.540  -4.083  -1.128 1.00 . A A . 190 TYR O    1 1 
        1  2827 1 1 190 TYR OH   O   7.818  -8.819   0.726 1.00 . A A . 190 TYR OH   1 1 
        1  2828 1 1 191 ARG C    C  13.114  -5.476  -2.539 1.00 . A A . 191 ARG C    1 1 
        1  2829 1 1 191 ARG CA   C  13.051  -3.971  -2.297 1.00 . A A . 191 ARG CA   1 1 
        1  2830 1 1 191 ARG CB   C  14.379  -3.323  -2.694 1.00 . A A . 191 ARG CB   1 1 
        1  2831 1 1 191 ARG CD   C  15.471  -1.261  -1.752 1.00 . A A . 191 ARG CD   1 1 
        1  2832 1 1 191 ARG CG   C  14.357  -1.804  -2.635 1.00 . A A . 191 ARG CG   1 1 
        1  2833 1 1 191 ARG CZ   C  16.585   0.432  -3.153 1.00 . A A . 191 ARG CZ   1 1 
        1  2834 1 1 191 ARG H    H  13.469  -3.418  -0.297 1.00 . A A . 191 ARG H    1 1 
        1  2835 1 1 191 ARG HA   H  12.262  -3.554  -2.905 1.00 . A A . 191 ARG HA   1 1 
        1  2836 1 1 191 ARG HB2  H  15.153  -3.679  -2.029 1.00 . A A . 191 ARG HB2  1 1 
        1  2837 1 1 191 ARG HB3  H  14.623  -3.619  -3.704 1.00 . A A . 191 ARG HB3  1 1 
        1  2838 1 1 191 ARG HD2  H  15.141  -1.283  -0.724 1.00 . A A . 191 ARG HD2  1 1 
        1  2839 1 1 191 ARG HD3  H  16.340  -1.892  -1.864 1.00 . A A . 191 ARG HD3  1 1 
        1  2840 1 1 191 ARG HE   H  15.494   0.828  -1.530 1.00 . A A . 191 ARG HE   1 1 
        1  2841 1 1 191 ARG HG2  H  14.481  -1.412  -3.634 1.00 . A A . 191 ARG HG2  1 1 
        1  2842 1 1 191 ARG HG3  H  13.406  -1.483  -2.237 1.00 . A A . 191 ARG HG3  1 1 
        1  2843 1 1 191 ARG HH11 H  16.849  -1.474  -3.775 1.00 . A A . 191 ARG HH11 1 1 
        1  2844 1 1 191 ARG HH12 H  17.624  -0.264  -4.741 1.00 . A A . 191 ARG HH12 1 1 
        1  2845 1 1 191 ARG HH21 H  16.512   2.421  -2.800 1.00 . A A . 191 ARG HH21 1 1 
        1  2846 1 1 191 ARG HH22 H  17.433   1.947  -4.188 1.00 . A A . 191 ARG HH22 1 1 
        1  2847 1 1 191 ARG N    N  12.744  -3.680  -0.902 1.00 . A A . 191 ARG N    1 1 
        1  2848 1 1 191 ARG NE   N  15.831   0.110  -2.105 1.00 . A A . 191 ARG NE   1 1 
        1  2849 1 1 191 ARG NH1  N  17.058  -0.513  -3.955 1.00 . A A . 191 ARG NH1  1 1 
        1  2850 1 1 191 ARG NH2  N  16.866   1.704  -3.401 1.00 . A A . 191 ARG NH2  1 1 
        1  2851 1 1 191 ARG O    O  13.339  -6.254  -1.612 1.00 . A A . 191 ARG O    1 1 
        1  2852 1 1 192 PHE C    C  14.383  -7.790  -4.267 1.00 . A A . 192 PHE C    1 1 
        1  2853 1 1 192 PHE CA   C  12.946  -7.291  -4.151 1.00 . A A . 192 PHE CA   1 1 
        1  2854 1 1 192 PHE CB   C  12.207  -7.518  -5.471 1.00 . A A . 192 PHE CB   1 1 
        1  2855 1 1 192 PHE CD1  C  10.976  -9.651  -4.988 1.00 . A A . 192 PHE CD1  1 1 
        1  2856 1 1 192 PHE CD2  C  12.557  -9.634  -6.773 1.00 . A A . 192 PHE CD2  1 1 
        1  2857 1 1 192 PHE CE1  C  10.698 -10.981  -5.242 1.00 . A A . 192 PHE CE1  1 1 
        1  2858 1 1 192 PHE CE2  C  12.284 -10.964  -7.032 1.00 . A A . 192 PHE CE2  1 1 
        1  2859 1 1 192 PHE CG   C  11.907  -8.963  -5.750 1.00 . A A . 192 PHE CG   1 1 
        1  2860 1 1 192 PHE CZ   C  11.353 -11.638  -6.265 1.00 . A A . 192 PHE CZ   1 1 
        1  2861 1 1 192 PHE H    H  12.737  -5.211  -4.484 1.00 . A A . 192 PHE H    1 1 
        1  2862 1 1 192 PHE HA   H  12.448  -7.845  -3.370 1.00 . A A . 192 PHE HA   1 1 
        1  2863 1 1 192 PHE HB2  H  11.269  -6.984  -5.446 1.00 . A A . 192 PHE HB2  1 1 
        1  2864 1 1 192 PHE HB3  H  12.810  -7.139  -6.283 1.00 . A A . 192 PHE HB3  1 1 
        1  2865 1 1 192 PHE HD1  H  10.463  -9.138  -4.188 1.00 . A A . 192 PHE HD1  1 1 
        1  2866 1 1 192 PHE HD2  H  13.285  -9.108  -7.373 1.00 . A A . 192 PHE HD2  1 1 
        1  2867 1 1 192 PHE HE1  H   9.970 -11.505  -4.641 1.00 . A A . 192 PHE HE1  1 1 
        1  2868 1 1 192 PHE HE2  H  12.797 -11.475  -7.833 1.00 . A A . 192 PHE HE2  1 1 
        1  2869 1 1 192 PHE HZ   H  11.138 -12.677  -6.466 1.00 . A A . 192 PHE HZ   1 1 
        1  2870 1 1 192 PHE N    N  12.913  -5.879  -3.789 1.00 . A A . 192 PHE N    1 1 
        1  2871 1 1 192 PHE O    O  14.988  -7.727  -5.337 1.00 . A A . 192 PHE O    1 1 
        1  2872 1 1 193 GLY C    C  16.357 -10.260  -2.800 1.00 . A A . 193 GLY C    1 1 
        1  2873 1 1 193 GLY CA   C  16.284  -8.788  -3.155 1.00 . A A . 193 GLY CA   1 1 
        1  2874 1 1 193 GLY H    H  14.392  -8.309  -2.334 1.00 . A A . 193 GLY H    1 1 
        1  2875 1 1 193 GLY HA2  H  16.712  -8.644  -4.136 1.00 . A A . 193 GLY HA2  1 1 
        1  2876 1 1 193 GLY HA3  H  16.862  -8.227  -2.436 1.00 . A A . 193 GLY HA3  1 1 
        1  2877 1 1 193 GLY N    N  14.923  -8.285  -3.158 1.00 . A A . 193 GLY N    1 1 
        1  2878 1 1 193 GLY O    O  15.712 -10.709  -1.853 1.00 . A A . 193 GLY O    1 1 
        1  2879 1 1 194 GLN C    C  18.626 -12.947  -3.881 1.00 . A A . 194 GLN C    1 1 
        1  2880 1 1 194 GLN CA   C  17.299 -12.442  -3.323 1.00 . A A . 194 GLN CA   1 1 
        1  2881 1 1 194 GLN CB   C  16.138 -13.213  -3.955 1.00 . A A . 194 GLN CB   1 1 
        1  2882 1 1 194 GLN CD   C  15.878 -15.700  -3.589 1.00 . A A . 194 GLN CD   1 1 
        1  2883 1 1 194 GLN CG   C  15.580 -14.310  -3.062 1.00 . A A . 194 GLN CG   1 1 
        1  2884 1 1 194 GLN H    H  17.633 -10.596  -4.302 1.00 . A A . 194 GLN H    1 1 
        1  2885 1 1 194 GLN HA   H  17.287 -12.602  -2.255 1.00 . A A . 194 GLN HA   1 1 
        1  2886 1 1 194 GLN HB2  H  15.341 -12.520  -4.178 1.00 . A A . 194 GLN HB2  1 1 
        1  2887 1 1 194 GLN HB3  H  16.478 -13.665  -4.875 1.00 . A A . 194 GLN HB3  1 1 
        1  2888 1 1 194 GLN HE21 H  14.049 -16.305  -3.100 1.00 . A A . 194 GLN HE21 1 1 
        1  2889 1 1 194 GLN HE22 H  15.064 -17.498  -3.830 1.00 . A A . 194 GLN HE22 1 1 
        1  2890 1 1 194 GLN HG2  H  16.015 -14.213  -2.079 1.00 . A A . 194 GLN HG2  1 1 
        1  2891 1 1 194 GLN HG3  H  14.508 -14.189  -2.993 1.00 . A A . 194 GLN HG3  1 1 
        1  2892 1 1 194 GLN N    N  17.145 -11.012  -3.562 1.00 . A A . 194 GLN N    1 1 
        1  2893 1 1 194 GLN NE2  N  14.898 -16.591  -3.497 1.00 . A A . 194 GLN NE2  1 1 
        1  2894 1 1 194 GLN O    O  18.824 -12.991  -5.095 1.00 . A A . 194 GLN O    1 1 
        1  2895 1 1 194 GLN OE1  O  16.977 -15.970  -4.073 1.00 . A A . 194 GLN OE1  1 1 
        1  2896 1 1 195 GLU C    C  20.768 -15.304  -3.762 1.00 . A A . 195 GLU C    1 1 
        1  2897 1 1 195 GLU CA   C  20.841 -13.826  -3.389 1.00 . A A . 195 GLU CA   1 1 
        1  2898 1 1 195 GLU CB   C  21.855 -13.622  -2.263 1.00 . A A . 195 GLU CB   1 1 
        1  2899 1 1 195 GLU CD   C  20.759 -13.435   0.005 1.00 . A A . 195 GLU CD   1 1 
        1  2900 1 1 195 GLU CG   C  21.485 -14.337  -0.974 1.00 . A A . 195 GLU CG   1 1 
        1  2901 1 1 195 GLU H    H  19.316 -13.267  -2.032 1.00 . A A . 195 GLU H    1 1 
        1  2902 1 1 195 GLU HA   H  21.158 -13.264  -4.254 1.00 . A A . 195 GLU HA   1 1 
        1  2903 1 1 195 GLU HB2  H  22.817 -13.990  -2.590 1.00 . A A . 195 GLU HB2  1 1 
        1  2904 1 1 195 GLU HB3  H  21.936 -12.566  -2.053 1.00 . A A . 195 GLU HB3  1 1 
        1  2905 1 1 195 GLU HG2  H  20.845 -15.173  -1.212 1.00 . A A . 195 GLU HG2  1 1 
        1  2906 1 1 195 GLU HG3  H  22.389 -14.699  -0.506 1.00 . A A . 195 GLU HG3  1 1 
        1  2907 1 1 195 GLU N    N  19.532 -13.326  -2.986 1.00 . A A . 195 GLU N    1 1 
        1  2908 1 1 195 GLU O    O  19.873 -16.023  -3.319 1.00 . A A . 195 GLU O    1 1 
        1  2909 1 1 195 GLU OE1  O  21.431 -12.625   0.677 1.00 . A A . 195 GLU OE1  1 1 
        1  2910 1 1 195 GLU OE2  O  19.518 -13.539   0.100 1.00 . A A . 195 GLU OE2  1 1 
        1  2911 1 1 196 ASP C    C  22.374 -18.026  -3.931 1.00 . A A . 196 ASP C    1 1 
        1  2912 1 1 196 ASP CA   C  21.762 -17.141  -5.012 1.00 . A A . 196 ASP CA   1 1 
        1  2913 1 1 196 ASP CB   C  22.563 -17.266  -6.311 1.00 . A A . 196 ASP CB   1 1 
        1  2914 1 1 196 ASP CG   C  21.709 -17.729  -7.476 1.00 . A A . 196 ASP CG   1 1 
        1  2915 1 1 196 ASP H    H  22.403 -15.127  -4.898 1.00 . A A . 196 ASP H    1 1 
        1  2916 1 1 196 ASP HA   H  20.747 -17.464  -5.193 1.00 . A A . 196 ASP HA   1 1 
        1  2917 1 1 196 ASP HB2  H  22.984 -16.303  -6.561 1.00 . A A . 196 ASP HB2  1 1 
        1  2918 1 1 196 ASP HB3  H  23.363 -17.978  -6.169 1.00 . A A . 196 ASP HB3  1 1 
        1  2919 1 1 196 ASP N    N  21.717 -15.749  -4.579 1.00 . A A . 196 ASP N    1 1 
        1  2920 1 1 196 ASP O    O  23.054 -17.540  -3.028 1.00 . A A . 196 ASP O    1 1 
        1  2921 1 1 196 ASP OD1  O  20.760 -18.507  -7.243 1.00 . A A . 196 ASP OD1  1 1 
        1  2922 1 1 196 ASP OD2  O  21.989 -17.314  -8.620 1.00 . A A . 196 ASP OD2  1 1 
        1  2923 1 1 197 ALA C    C  22.924 -21.634  -3.712 1.00 . A A . 197 ALA C    1 1 
        1  2924 1 1 197 ALA CA   C  22.656 -20.281  -3.061 1.00 . A A . 197 ALA CA   1 1 
        1  2925 1 1 197 ALA CB   C  21.691 -20.435  -1.896 1.00 . A A . 197 ALA CB   1 1 
        1  2926 1 1 197 ALA H    H  21.580 -19.657  -4.773 1.00 . A A . 197 ALA H    1 1 
        1  2927 1 1 197 ALA HA   H  23.586 -19.887  -2.678 1.00 . A A . 197 ALA HA   1 1 
        1  2928 1 1 197 ALA HB1  H  21.350 -19.461  -1.579 1.00 . A A . 197 ALA HB1  1 1 
        1  2929 1 1 197 ALA HB2  H  22.194 -20.925  -1.075 1.00 . A A . 197 ALA HB2  1 1 
        1  2930 1 1 197 ALA HB3  H  20.844 -21.030  -2.205 1.00 . A A . 197 ALA HB3  1 1 
        1  2931 1 1 197 ALA N    N  22.129 -19.329  -4.031 1.00 . A A . 197 ALA N    1 1 
        1  2932 1 1 197 ALA O    O  22.070 -22.176  -4.413 1.00 . A A . 197 ALA O    1 1 
        1  2933 1 1 198 ALA C    C  25.354 -24.260  -3.057 1.00 . A A . 198 ALA C    1 1 
        1  2934 1 1 198 ALA CA   C  24.493 -23.465  -4.037 1.00 . A A . 198 ALA CA   1 1 
        1  2935 1 1 198 ALA CB   C  25.234 -23.268  -5.351 1.00 . A A . 198 ALA CB   1 1 
        1  2936 1 1 198 ALA H    H  24.753 -21.695  -2.907 1.00 . A A . 198 ALA H    1 1 
        1  2937 1 1 198 ALA HA   H  23.587 -24.016  -4.241 1.00 . A A . 198 ALA HA   1 1 
        1  2938 1 1 198 ALA HB1  H  25.806 -22.353  -5.308 1.00 . A A . 198 ALA HB1  1 1 
        1  2939 1 1 198 ALA HB2  H  24.521 -23.208  -6.161 1.00 . A A . 198 ALA HB2  1 1 
        1  2940 1 1 198 ALA HB3  H  25.899 -24.101  -5.518 1.00 . A A . 198 ALA HB3  1 1 
        1  2941 1 1 198 ALA N    N  24.114 -22.175  -3.474 1.00 . A A . 198 ALA N    1 1 
        1  2942 1 1 198 ALA O    O  26.352 -23.752  -2.546 1.00 . A A . 198 ALA O    1 1 
        1  2943 1 1 199 PRO C    C  27.209 -26.475  -2.222 1.00 . A A . 199 PRO C    1 1 
        1  2944 1 1 199 PRO CA   C  25.733 -26.379  -1.852 1.00 . A A . 199 PRO CA   1 1 
        1  2945 1 1 199 PRO CB   C  25.057 -27.745  -1.995 1.00 . A A . 199 PRO CB   1 1 
        1  2946 1 1 199 PRO CD   C  23.806 -26.217  -3.339 1.00 . A A . 199 PRO CD   1 1 
        1  2947 1 1 199 PRO CG   C  23.681 -27.441  -2.476 1.00 . A A . 199 PRO CG   1 1 
        1  2948 1 1 199 PRO HA   H  25.641 -26.034  -0.833 1.00 . A A . 199 PRO HA   1 1 
        1  2949 1 1 199 PRO HB2  H  25.602 -28.346  -2.709 1.00 . A A . 199 PRO HB2  1 1 
        1  2950 1 1 199 PRO HB3  H  25.038 -28.243  -1.037 1.00 . A A . 199 PRO HB3  1 1 
        1  2951 1 1 199 PRO HD2  H  23.978 -26.496  -4.368 1.00 . A A . 199 PRO HD2  1 1 
        1  2952 1 1 199 PRO HD3  H  22.922 -25.603  -3.254 1.00 . A A . 199 PRO HD3  1 1 
        1  2953 1 1 199 PRO HG2  H  23.302 -28.271  -3.055 1.00 . A A . 199 PRO HG2  1 1 
        1  2954 1 1 199 PRO HG3  H  23.033 -27.242  -1.635 1.00 . A A . 199 PRO HG3  1 1 
        1  2955 1 1 199 PRO N    N  24.982 -25.524  -2.778 1.00 . A A . 199 PRO N    1 1 
        1  2956 1 1 199 PRO O    O  27.603 -27.311  -3.035 1.00 . A A . 199 PRO O    1 1 
        1  2957 1 1 200 VAL C    C  30.248 -25.324  -0.611 1.00 . A A . 200 VAL C    1 1 
        1  2958 1 1 200 VAL CA   C  29.456 -25.602  -1.884 1.00 . A A . 200 VAL CA   1 1 
        1  2959 1 1 200 VAL CB   C  29.823 -24.547  -2.944 1.00 . A A . 200 VAL CB   1 1 
        1  2960 1 1 200 VAL CG1  C  31.280 -24.688  -3.357 1.00 . A A . 200 VAL CG1  1 1 
        1  2961 1 1 200 VAL CG2  C  28.906 -24.660  -4.152 1.00 . A A . 200 VAL CG2  1 1 
        1  2962 1 1 200 VAL H    H  27.649 -24.971  -0.980 1.00 . A A . 200 VAL H    1 1 
        1  2963 1 1 200 VAL HA   H  29.733 -26.575  -2.263 1.00 . A A . 200 VAL HA   1 1 
        1  2964 1 1 200 VAL HB   H  29.690 -23.567  -2.508 1.00 . A A . 200 VAL HB   1 1 
        1  2965 1 1 200 VAL HG11 H  31.360 -25.411  -4.155 1.00 . A A . 200 VAL HG11 1 1 
        1  2966 1 1 200 VAL HG12 H  31.864 -25.020  -2.511 1.00 . A A . 200 VAL HG12 1 1 
        1  2967 1 1 200 VAL HG13 H  31.652 -23.733  -3.698 1.00 . A A . 200 VAL HG13 1 1 
        1  2968 1 1 200 VAL HG21 H  29.445 -24.374  -5.042 1.00 . A A . 200 VAL HG21 1 1 
        1  2969 1 1 200 VAL HG22 H  28.056 -24.007  -4.020 1.00 . A A . 200 VAL HG22 1 1 
        1  2970 1 1 200 VAL HG23 H  28.564 -25.680  -4.250 1.00 . A A . 200 VAL HG23 1 1 
        1  2971 1 1 200 VAL N    N  28.022 -25.614  -1.619 1.00 . A A . 200 VAL N    1 1 
        1  2972 1 1 200 VAL O    O  30.451 -24.170  -0.233 1.00 . A A . 200 VAL O    1 1 
        1  2973 1 1 201 VAL C    C  32.921 -25.917   0.979 1.00 . A A . 201 VAL C    1 1 
        1  2974 1 1 201 VAL CA   C  31.465 -26.261   1.278 1.00 . A A . 201 VAL CA   1 1 
        1  2975 1 1 201 VAL CB   C  31.413 -27.555   2.112 1.00 . A A . 201 VAL CB   1 1 
        1  2976 1 1 201 VAL CG1  C  30.030 -27.750   2.713 1.00 . A A . 201 VAL CG1  1 1 
        1  2977 1 1 201 VAL CG2  C  31.807 -28.754   1.262 1.00 . A A . 201 VAL CG2  1 1 
        1  2978 1 1 201 VAL H    H  30.501 -27.284  -0.304 1.00 . A A . 201 VAL H    1 1 
        1  2979 1 1 201 VAL HA   H  31.029 -25.463   1.862 1.00 . A A . 201 VAL HA   1 1 
        1  2980 1 1 201 VAL HB   H  32.123 -27.466   2.921 1.00 . A A . 201 VAL HB   1 1 
        1  2981 1 1 201 VAL HG11 H  29.646 -26.798   3.048 1.00 . A A . 201 VAL HG11 1 1 
        1  2982 1 1 201 VAL HG12 H  30.095 -28.427   3.552 1.00 . A A . 201 VAL HG12 1 1 
        1  2983 1 1 201 VAL HG13 H  29.368 -28.163   1.967 1.00 . A A . 201 VAL HG13 1 1 
        1  2984 1 1 201 VAL HG21 H  32.404 -29.433   1.853 1.00 . A A . 201 VAL HG21 1 1 
        1  2985 1 1 201 VAL HG22 H  32.379 -28.418   0.410 1.00 . A A . 201 VAL HG22 1 1 
        1  2986 1 1 201 VAL HG23 H  30.916 -29.261   0.921 1.00 . A A . 201 VAL HG23 1 1 
        1  2987 1 1 201 VAL N    N  30.694 -26.390   0.047 1.00 . A A . 201 VAL N    1 1 
        1  2988 1 1 201 VAL O    O  33.818 -26.738   1.173 1.00 . A A . 201 VAL O    1 1 
        1  2989 1 1 202 ALA C    C  35.286 -23.909   1.440 1.00 . A A . 202 ALA C    1 1 
        1  2990 1 1 202 ALA CA   C  34.495 -24.243   0.178 1.00 . A A . 202 ALA CA   1 1 
        1  2991 1 1 202 ALA CB   C  34.435 -23.035  -0.745 1.00 . A A . 202 ALA CB   1 1 
        1  2992 1 1 202 ALA H    H  32.393 -24.087   0.369 1.00 . A A . 202 ALA H    1 1 
        1  2993 1 1 202 ALA HA   H  34.997 -25.042  -0.348 1.00 . A A . 202 ALA HA   1 1 
        1  2994 1 1 202 ALA HB1  H  33.505 -22.508  -0.589 1.00 . A A . 202 ALA HB1  1 1 
        1  2995 1 1 202 ALA HB2  H  34.495 -23.363  -1.772 1.00 . A A . 202 ALA HB2  1 1 
        1  2996 1 1 202 ALA HB3  H  35.263 -22.375  -0.529 1.00 . A A . 202 ALA HB3  1 1 
        1  2997 1 1 202 ALA N    N  33.149 -24.697   0.504 1.00 . A A . 202 ALA N    1 1 
        1  2998 1 1 202 ALA O    O  36.322 -24.517   1.712 1.00 . A A . 202 ALA O    1 1 
        1  2999 1 1 203 PRO C    C  35.313 -23.540   4.590 1.00 . A A . 203 PRO C    1 1 
        1  3000 1 1 203 PRO CA   C  35.478 -22.520   3.467 1.00 . A A . 203 PRO CA   1 1 
        1  3001 1 1 203 PRO CB   C  34.775 -21.211   3.827 1.00 . A A . 203 PRO CB   1 1 
        1  3002 1 1 203 PRO CD   C  33.579 -22.154   1.981 1.00 . A A . 203 PRO CD   1 1 
        1  3003 1 1 203 PRO CG   C  33.414 -21.342   3.238 1.00 . A A . 203 PRO CG   1 1 
        1  3004 1 1 203 PRO HA   H  36.530 -22.335   3.304 1.00 . A A . 203 PRO HA   1 1 
        1  3005 1 1 203 PRO HB2  H  34.735 -21.104   4.901 1.00 . A A . 203 PRO HB2  1 1 
        1  3006 1 1 203 PRO HB3  H  35.313 -20.380   3.396 1.00 . A A . 203 PRO HB3  1 1 
        1  3007 1 1 203 PRO HD2  H  32.731 -22.808   1.841 1.00 . A A . 203 PRO HD2  1 1 
        1  3008 1 1 203 PRO HD3  H  33.702 -21.505   1.127 1.00 . A A . 203 PRO HD3  1 1 
        1  3009 1 1 203 PRO HG2  H  32.762 -21.853   3.931 1.00 . A A . 203 PRO HG2  1 1 
        1  3010 1 1 203 PRO HG3  H  33.020 -20.365   3.003 1.00 . A A . 203 PRO HG3  1 1 
        1  3011 1 1 203 PRO N    N  34.808 -22.933   2.231 1.00 . A A . 203 PRO N    1 1 
        1  3012 1 1 203 PRO O    O  36.270 -23.863   5.292 1.00 . A A . 203 PRO O    1 1 
        1  3013 1 1 204 ALA C    C  34.433 -26.378   5.463 1.00 . A A . 204 ALA C    1 1 
        1  3014 1 1 204 ALA CA   C  33.804 -25.024   5.793 1.00 . A A . 204 ALA CA   1 1 
        1  3015 1 1 204 ALA CB   C  32.301 -25.170   5.975 1.00 . A A . 204 ALA CB   1 1 
        1  3016 1 1 204 ALA H    H  33.370 -23.745   4.163 1.00 . A A . 204 ALA H    1 1 
        1  3017 1 1 204 ALA HA   H  34.219 -24.658   6.720 1.00 . A A . 204 ALA HA   1 1 
        1  3018 1 1 204 ALA HB1  H  31.907 -25.821   5.208 1.00 . A A . 204 ALA HB1  1 1 
        1  3019 1 1 204 ALA HB2  H  31.833 -24.200   5.898 1.00 . A A . 204 ALA HB2  1 1 
        1  3020 1 1 204 ALA HB3  H  32.095 -25.593   6.947 1.00 . A A . 204 ALA HB3  1 1 
        1  3021 1 1 204 ALA N    N  34.093 -24.042   4.754 1.00 . A A . 204 ALA N    1 1 
        1  3022 1 1 204 ALA O    O  34.020 -27.044   4.514 1.00 . A A . 204 ALA O    1 1 
        1  3023 1 1 205 PRO C    C  35.299 -29.272   6.514 1.00 . A A . 205 PRO C    1 1 
        1  3024 1 1 205 PRO CA   C  36.121 -28.086   6.021 1.00 . A A . 205 PRO CA   1 1 
        1  3025 1 1 205 PRO CB   C  37.401 -27.946   6.843 1.00 . A A . 205 PRO CB   1 1 
        1  3026 1 1 205 PRO CD   C  36.006 -26.080   7.400 1.00 . A A . 205 PRO CD   1 1 
        1  3027 1 1 205 PRO CG   C  37.025 -27.037   7.961 1.00 . A A . 205 PRO CG   1 1 
        1  3028 1 1 205 PRO HA   H  36.371 -28.229   4.979 1.00 . A A . 205 PRO HA   1 1 
        1  3029 1 1 205 PRO HB2  H  37.709 -28.916   7.205 1.00 . A A . 205 PRO HB2  1 1 
        1  3030 1 1 205 PRO HB3  H  38.181 -27.517   6.232 1.00 . A A . 205 PRO HB3  1 1 
        1  3031 1 1 205 PRO HD2  H  35.240 -25.873   8.133 1.00 . A A . 205 PRO HD2  1 1 
        1  3032 1 1 205 PRO HD3  H  36.484 -25.165   7.085 1.00 . A A . 205 PRO HD3  1 1 
        1  3033 1 1 205 PRO HG2  H  36.595 -27.610   8.770 1.00 . A A . 205 PRO HG2  1 1 
        1  3034 1 1 205 PRO HG3  H  37.896 -26.498   8.304 1.00 . A A . 205 PRO HG3  1 1 
        1  3035 1 1 205 PRO N    N  35.444 -26.806   6.243 1.00 . A A . 205 PRO N    1 1 
        1  3036 1 1 205 PRO O    O  35.101 -29.444   7.717 1.00 . A A . 205 PRO O    1 1 
        1  3037 1 1 206 ALA C    C  34.890 -32.505   6.061 1.00 . A A . 206 ALA C    1 1 
        1  3038 1 1 206 ALA CA   C  34.020 -31.256   5.924 1.00 . A A . 206 ALA CA   1 1 
        1  3039 1 1 206 ALA CB   C  32.932 -31.475   4.884 1.00 . A A . 206 ALA CB   1 1 
        1  3040 1 1 206 ALA H    H  35.012 -29.898   4.637 1.00 . A A . 206 ALA H    1 1 
        1  3041 1 1 206 ALA HA   H  33.542 -31.060   6.873 1.00 . A A . 206 ALA HA   1 1 
        1  3042 1 1 206 ALA HB1  H  33.178 -30.929   3.985 1.00 . A A . 206 ALA HB1  1 1 
        1  3043 1 1 206 ALA HB2  H  31.988 -31.122   5.271 1.00 . A A . 206 ALA HB2  1 1 
        1  3044 1 1 206 ALA HB3  H  32.857 -32.528   4.656 1.00 . A A . 206 ALA HB3  1 1 
        1  3045 1 1 206 ALA N    N  34.822 -30.087   5.580 1.00 . A A . 206 ALA N    1 1 
        1  3046 1 1 206 ALA O    O  34.865 -33.176   7.093 1.00 . A A . 206 ALA O    1 1 
        1  3047 1 1 207 PRO C    C  37.456 -34.049   6.261 1.00 . A A . 207 PRO C    1 1 
        1  3048 1 1 207 PRO CA   C  36.548 -34.016   5.035 1.00 . A A . 207 PRO CA   1 1 
        1  3049 1 1 207 PRO CB   C  37.380 -33.861   3.760 1.00 . A A . 207 PRO CB   1 1 
        1  3050 1 1 207 PRO CD   C  35.768 -32.098   3.745 1.00 . A A . 207 PRO CD   1 1 
        1  3051 1 1 207 PRO CG   C  36.534 -33.035   2.854 1.00 . A A . 207 PRO CG   1 1 
        1  3052 1 1 207 PRO HA   H  35.978 -34.932   4.987 1.00 . A A . 207 PRO HA   1 1 
        1  3053 1 1 207 PRO HB2  H  38.312 -33.365   3.992 1.00 . A A . 207 PRO HB2  1 1 
        1  3054 1 1 207 PRO HB3  H  37.579 -34.833   3.335 1.00 . A A . 207 PRO HB3  1 1 
        1  3055 1 1 207 PRO HD2  H  36.311 -31.173   3.876 1.00 . A A . 207 PRO HD2  1 1 
        1  3056 1 1 207 PRO HD3  H  34.788 -31.907   3.336 1.00 . A A . 207 PRO HD3  1 1 
        1  3057 1 1 207 PRO HG2  H  37.160 -32.478   2.173 1.00 . A A . 207 PRO HG2  1 1 
        1  3058 1 1 207 PRO HG3  H  35.854 -33.671   2.306 1.00 . A A . 207 PRO HG3  1 1 
        1  3059 1 1 207 PRO N    N  35.673 -32.838   5.019 1.00 . A A . 207 PRO N    1 1 
        1  3060 1 1 207 PRO O    O  38.493 -33.387   6.295 1.00 . A A . 207 PRO O    1 1 
        1  3061 1 1 208 ALA C    C  38.951 -35.977   8.343 1.00 . A A . 208 ALA C    1 1 
        1  3062 1 1 208 ALA CA   C  37.836 -34.943   8.492 1.00 . A A . 208 ALA CA   1 1 
        1  3063 1 1 208 ALA CB   C  36.929 -35.302   9.660 1.00 . A A . 208 ALA CB   1 1 
        1  3064 1 1 208 ALA H    H  36.221 -35.326   7.178 1.00 . A A . 208 ALA H    1 1 
        1  3065 1 1 208 ALA HA   H  38.280 -33.979   8.697 1.00 . A A . 208 ALA HA   1 1 
        1  3066 1 1 208 ALA HB1  H  36.632 -34.400  10.175 1.00 . A A . 208 ALA HB1  1 1 
        1  3067 1 1 208 ALA HB2  H  37.461 -35.947  10.344 1.00 . A A . 208 ALA HB2  1 1 
        1  3068 1 1 208 ALA HB3  H  36.052 -35.812   9.292 1.00 . A A . 208 ALA HB3  1 1 
        1  3069 1 1 208 ALA N    N  37.058 -34.824   7.265 1.00 . A A . 208 ALA N    1 1 
        1  3070 1 1 208 ALA O    O  40.132 -35.642   8.434 1.00 . A A . 208 ALA O    1 1 
        1  3071 1 1 209 PRO C    C  40.283 -38.278   6.607 1.00 . A A . 209 PRO C    1 1 
        1  3072 1 1 209 PRO CA   C  39.575 -38.330   7.956 1.00 . A A . 209 PRO CA   1 1 
        1  3073 1 1 209 PRO CB   C  38.728 -39.597   8.069 1.00 . A A . 209 PRO CB   1 1 
        1  3074 1 1 209 PRO CD   C  37.206 -37.748   7.992 1.00 . A A . 209 PRO CD   1 1 
        1  3075 1 1 209 PRO CG   C  37.375 -39.192   7.599 1.00 . A A . 209 PRO CG   1 1 
        1  3076 1 1 209 PRO HA   H  40.310 -38.313   8.748 1.00 . A A . 209 PRO HA   1 1 
        1  3077 1 1 209 PRO HB2  H  39.150 -40.372   7.445 1.00 . A A . 209 PRO HB2  1 1 
        1  3078 1 1 209 PRO HB3  H  38.705 -39.928   9.097 1.00 . A A . 209 PRO HB3  1 1 
        1  3079 1 1 209 PRO HD2  H  36.673 -37.210   7.223 1.00 . A A . 209 PRO HD2  1 1 
        1  3080 1 1 209 PRO HD3  H  36.687 -37.673   8.936 1.00 . A A . 209 PRO HD3  1 1 
        1  3081 1 1 209 PRO HG2  H  37.313 -39.297   6.526 1.00 . A A . 209 PRO HG2  1 1 
        1  3082 1 1 209 PRO HG3  H  36.623 -39.800   8.079 1.00 . A A . 209 PRO HG3  1 1 
        1  3083 1 1 209 PRO N    N  38.592 -37.254   8.114 1.00 . A A . 209 PRO N    1 1 
        1  3084 1 1 209 PRO O    O  41.505 -38.405   6.531 1.00 . A A . 209 PRO O    1 1 
        1  3085 1 1 210 GLU C    C  39.268 -37.055   3.328 1.00 . A A . 210 GLU C    1 1 
        1  3086 1 1 210 GLU CA   C  40.064 -38.024   4.196 1.00 . A A . 210 GLU CA   1 1 
        1  3087 1 1 210 GLU CB   C  40.074 -39.412   3.555 1.00 . A A . 210 GLU CB   1 1 
        1  3088 1 1 210 GLU CD   C  41.472 -41.492   3.231 1.00 . A A . 210 GLU CD   1 1 
        1  3089 1 1 210 GLU CG   C  41.097 -40.357   4.164 1.00 . A A . 210 GLU CG   1 1 
        1  3090 1 1 210 GLU H    H  38.541 -37.997   5.666 1.00 . A A . 210 GLU H    1 1 
        1  3091 1 1 210 GLU HA   H  41.080 -37.666   4.275 1.00 . A A . 210 GLU HA   1 1 
        1  3092 1 1 210 GLU HB2  H  39.095 -39.855   3.667 1.00 . A A . 210 GLU HB2  1 1 
        1  3093 1 1 210 GLU HB3  H  40.293 -39.309   2.502 1.00 . A A . 210 GLU HB3  1 1 
        1  3094 1 1 210 GLU HG2  H  41.990 -39.797   4.400 1.00 . A A . 210 GLU HG2  1 1 
        1  3095 1 1 210 GLU HG3  H  40.686 -40.776   5.071 1.00 . A A . 210 GLU HG3  1 1 
        1  3096 1 1 210 GLU N    N  39.509 -38.092   5.543 1.00 . A A . 210 GLU N    1 1 
        1  3097 1 1 210 GLU O    O  39.894 -36.325   2.531 1.00 . A A . 210 GLU O    1 1 
        1  3098 1 1 210 GLU OE1  O  42.191 -41.235   2.243 1.00 . A A . 210 GLU OE1  1 1 
        1  3099 1 1 210 GLU OE2  O  41.045 -42.637   3.489 1.00 . A A . 210 GLU OE2  1 1 
        2  3100 1 1   1 ALA C    C  23.707 -16.337 -30.130 1.00 . A A .   1 ALA C    1 1 
        2  3101 1 1   1 ALA CA   C  24.507 -16.893 -28.957 1.00 . A A .   1 ALA CA   1 1 
        2  3102 1 1   1 ALA CB   C  23.568 -17.368 -27.857 1.00 . A A .   1 ALA CB   1 1 
        2  3103 1 1   1 ALA H1   H  26.199 -16.375 -27.908 1.00 . A A .   1 ALA H1   1 1 
        2  3104 1 1   1 ALA H2   H  24.911 -15.247 -27.791 1.00 . A A .   1 ALA H2   1 1 
        2  3105 1 1   1 ALA H3   H  25.837 -15.348 -29.233 1.00 . A A .   1 ALA H3   1 1 
        2  3106 1 1   1 ALA HA   H  25.082 -17.742 -29.298 1.00 . A A .   1 ALA HA   1 1 
        2  3107 1 1   1 ALA HB1  H  23.395 -18.428 -27.967 1.00 . A A .   1 ALA HB1  1 1 
        2  3108 1 1   1 ALA HB2  H  22.630 -16.839 -27.932 1.00 . A A .   1 ALA HB2  1 1 
        2  3109 1 1   1 ALA HB3  H  24.016 -17.175 -26.893 1.00 . A A .   1 ALA HB3  1 1 
        2  3110 1 1   1 ALA N    N  25.449 -15.874 -28.424 1.00 . A A .   1 ALA N    1 1 
        2  3111 1 1   1 ALA O    O  23.549 -15.124 -30.268 1.00 . A A .   1 ALA O    1 1 
        2  3112 1 1   2 ARG C    C  21.144 -17.659 -32.242 1.00 . A A .   2 ARG C    1 1 
        2  3113 1 1   2 ARG CA   C  22.421 -16.832 -32.136 1.00 . A A .   2 ARG CA   1 1 
        2  3114 1 1   2 ARG CB   C  23.250 -16.985 -33.413 1.00 . A A .   2 ARG CB   1 1 
        2  3115 1 1   2 ARG CD   C  25.204 -18.337 -34.231 1.00 . A A .   2 ARG CD   1 1 
        2  3116 1 1   2 ARG CG   C  23.820 -18.380 -33.605 1.00 . A A .   2 ARG CG   1 1 
        2  3117 1 1   2 ARG CZ   C  27.538 -17.990 -33.520 1.00 . A A .   2 ARG CZ   1 1 
        2  3118 1 1   2 ARG H    H  23.366 -18.187 -30.811 1.00 . A A .   2 ARG H    1 1 
        2  3119 1 1   2 ARG HA   H  22.154 -15.793 -32.014 1.00 . A A .   2 ARG HA   1 1 
        2  3120 1 1   2 ARG HB2  H  22.624 -16.755 -34.263 1.00 . A A .   2 ARG HB2  1 1 
        2  3121 1 1   2 ARG HB3  H  24.071 -16.285 -33.381 1.00 . A A .   2 ARG HB3  1 1 
        2  3122 1 1   2 ARG HD2  H  25.368 -19.252 -34.779 1.00 . A A .   2 ARG HD2  1 1 
        2  3123 1 1   2 ARG HD3  H  25.250 -17.498 -34.911 1.00 . A A .   2 ARG HD3  1 1 
        2  3124 1 1   2 ARG HE   H  25.991 -18.245 -32.284 1.00 . A A .   2 ARG HE   1 1 
        2  3125 1 1   2 ARG HG2  H  23.887 -18.867 -32.643 1.00 . A A .   2 ARG HG2  1 1 
        2  3126 1 1   2 ARG HG3  H  23.161 -18.942 -34.251 1.00 . A A .   2 ARG HG3  1 1 
        2  3127 1 1   2 ARG HH11 H  27.266 -18.000 -35.523 1.00 . A A .   2 ARG HH11 1 1 
        2  3128 1 1   2 ARG HH12 H  28.898 -17.759 -34.998 1.00 . A A .   2 ARG HH12 1 1 
        2  3129 1 1   2 ARG HH21 H  28.137 -17.927 -31.590 1.00 . A A .   2 ARG HH21 1 1 
        2  3130 1 1   2 ARG HH22 H  29.393 -17.718 -32.765 1.00 . A A .   2 ARG HH22 1 1 
        2  3131 1 1   2 ARG N    N  23.206 -17.232 -30.974 1.00 . A A .   2 ARG N    1 1 
        2  3132 1 1   2 ARG NE   N  26.256 -18.191 -33.226 1.00 . A A .   2 ARG NE   1 1 
        2  3133 1 1   2 ARG NH1  N  27.933 -17.911 -34.784 1.00 . A A .   2 ARG NH1  1 1 
        2  3134 1 1   2 ARG NH2  N  28.430 -17.868 -32.545 1.00 . A A .   2 ARG NH2  1 1 
        2  3135 1 1   2 ARG O    O  21.098 -18.660 -32.957 1.00 . A A .   2 ARG O    1 1 
        2  3136 1 1   3 ILE C    C  17.705 -17.014 -32.004 1.00 . A A .   3 ILE C    1 1 
        2  3137 1 1   3 ILE CA   C  18.829 -17.933 -31.542 1.00 . A A .   3 ILE CA   1 1 
        2  3138 1 1   3 ILE CB   C  18.479 -18.493 -30.149 1.00 . A A .   3 ILE CB   1 1 
        2  3139 1 1   3 ILE CD1  C  17.361 -17.463 -28.108 1.00 . A A .   3 ILE CD1  1 1 
        2  3140 1 1   3 ILE CG1  C  18.494 -17.374 -29.105 1.00 . A A .   3 ILE CG1  1 1 
        2  3141 1 1   3 ILE CG2  C  19.450 -19.598 -29.764 1.00 . A A .   3 ILE CG2  1 1 
        2  3142 1 1   3 ILE H    H  20.206 -16.427 -30.977 1.00 . A A .   3 ILE H    1 1 
        2  3143 1 1   3 ILE HA   H  18.910 -18.761 -32.229 1.00 . A A .   3 ILE HA   1 1 
        2  3144 1 1   3 ILE HB   H  17.488 -18.918 -30.196 1.00 . A A .   3 ILE HB   1 1 
        2  3145 1 1   3 ILE HD11 H  16.976 -18.473 -28.089 1.00 . A A .   3 ILE HD11 1 1 
        2  3146 1 1   3 ILE HD12 H  16.572 -16.785 -28.396 1.00 . A A .   3 ILE HD12 1 1 
        2  3147 1 1   3 ILE HD13 H  17.723 -17.198 -27.126 1.00 . A A .   3 ILE HD13 1 1 
        2  3148 1 1   3 ILE HG12 H  19.423 -17.416 -28.555 1.00 . A A .   3 ILE HG12 1 1 
        2  3149 1 1   3 ILE HG13 H  18.420 -16.420 -29.608 1.00 . A A .   3 ILE HG13 1 1 
        2  3150 1 1   3 ILE HG21 H  19.899 -20.012 -30.656 1.00 . A A .   3 ILE HG21 1 1 
        2  3151 1 1   3 ILE HG22 H  18.919 -20.376 -29.236 1.00 . A A .   3 ILE HG22 1 1 
        2  3152 1 1   3 ILE HG23 H  20.223 -19.194 -29.126 1.00 . A A .   3 ILE HG23 1 1 
        2  3153 1 1   3 ILE N    N  20.109 -17.232 -31.527 1.00 . A A .   3 ILE N    1 1 
        2  3154 1 1   3 ILE O    O  17.784 -15.794 -31.853 1.00 . A A .   3 ILE O    1 1 
        2  3155 1 1   4 MET C    C  14.204 -17.540 -32.711 1.00 . A A .   4 MET C    1 1 
        2  3156 1 1   4 MET CA   C  15.516 -16.839 -33.052 1.00 . A A .   4 MET CA   1 1 
        2  3157 1 1   4 MET CB   C  15.619 -16.631 -34.565 1.00 . A A .   4 MET CB   1 1 
        2  3158 1 1   4 MET CE   C  15.216 -15.671 -37.739 1.00 . A A .   4 MET CE   1 1 
        2  3159 1 1   4 MET CG   C  15.298 -15.213 -35.007 1.00 . A A .   4 MET CG   1 1 
        2  3160 1 1   4 MET H    H  16.652 -18.581 -32.662 1.00 . A A .   4 MET H    1 1 
        2  3161 1 1   4 MET HA   H  15.533 -15.877 -32.565 1.00 . A A .   4 MET HA   1 1 
        2  3162 1 1   4 MET HB2  H  16.626 -16.862 -34.880 1.00 . A A .   4 MET HB2  1 1 
        2  3163 1 1   4 MET HB3  H  14.934 -17.303 -35.060 1.00 . A A .   4 MET HB3  1 1 
        2  3164 1 1   4 MET HE1  H  15.736 -16.589 -37.973 1.00 . A A .   4 MET HE1  1 1 
        2  3165 1 1   4 MET HE2  H  15.107 -15.080 -38.636 1.00 . A A .   4 MET HE2  1 1 
        2  3166 1 1   4 MET HE3  H  14.240 -15.902 -37.340 1.00 . A A .   4 MET HE3  1 1 
        2  3167 1 1   4 MET HG2  H  14.234 -15.135 -35.173 1.00 . A A .   4 MET HG2  1 1 
        2  3168 1 1   4 MET HG3  H  15.590 -14.530 -34.222 1.00 . A A .   4 MET HG3  1 1 
        2  3169 1 1   4 MET N    N  16.657 -17.605 -32.569 1.00 . A A .   4 MET N    1 1 
        2  3170 1 1   4 MET O    O  13.806 -18.493 -33.381 1.00 . A A .   4 MET O    1 1 
        2  3171 1 1   4 MET SD   S  16.154 -14.747 -36.525 1.00 . A A .   4 MET SD   1 1 
        2  3172 1 1   5 LYS C    C  11.130 -16.641 -31.405 1.00 . A A .   5 LYS C    1 1 
        2  3173 1 1   5 LYS CA   C  12.271 -17.639 -31.236 1.00 . A A .   5 LYS CA   1 1 
        2  3174 1 1   5 LYS CB   C  12.361 -18.086 -29.776 1.00 . A A .   5 LYS CB   1 1 
        2  3175 1 1   5 LYS CD   C  11.214 -20.281 -29.336 1.00 . A A .   5 LYS CD   1 1 
        2  3176 1 1   5 LYS CE   C  10.096 -20.891 -30.167 1.00 . A A .   5 LYS CE   1 1 
        2  3177 1 1   5 LYS CG   C  11.099 -18.766 -29.268 1.00 . A A .   5 LYS CG   1 1 
        2  3178 1 1   5 LYS H    H  13.908 -16.298 -31.172 1.00 . A A .   5 LYS H    1 1 
        2  3179 1 1   5 LYS HA   H  12.074 -18.502 -31.854 1.00 . A A .   5 LYS HA   1 1 
        2  3180 1 1   5 LYS HB2  H  13.183 -18.779 -29.672 1.00 . A A .   5 LYS HB2  1 1 
        2  3181 1 1   5 LYS HB3  H  12.552 -17.220 -29.157 1.00 . A A .   5 LYS HB3  1 1 
        2  3182 1 1   5 LYS HD2  H  12.162 -20.543 -29.780 1.00 . A A .   5 LYS HD2  1 1 
        2  3183 1 1   5 LYS HD3  H  11.162 -20.681 -28.335 1.00 . A A .   5 LYS HD3  1 1 
        2  3184 1 1   5 LYS HE2  H   9.828 -20.198 -30.951 1.00 . A A .   5 LYS HE2  1 1 
        2  3185 1 1   5 LYS HE3  H  10.453 -21.810 -30.609 1.00 . A A .   5 LYS HE3  1 1 
        2  3186 1 1   5 LYS HG2  H  10.932 -18.474 -28.241 1.00 . A A .   5 LYS HG2  1 1 
        2  3187 1 1   5 LYS HG3  H  10.263 -18.448 -29.874 1.00 . A A .   5 LYS HG3  1 1 
        2  3188 1 1   5 LYS HZ1  H   9.155 -21.311 -28.351 1.00 . A A .   5 LYS HZ1  1 1 
        2  3189 1 1   5 LYS HZ2  H   8.429 -22.053 -29.686 1.00 . A A .   5 LYS HZ2  1 1 
        2  3190 1 1   5 LYS HZ3  H   8.211 -20.399 -29.416 1.00 . A A .   5 LYS HZ3  1 1 
        2  3191 1 1   5 LYS N    N  13.537 -17.059 -31.666 1.00 . A A .   5 LYS N    1 1 
        2  3192 1 1   5 LYS NZ   N   8.888 -21.184 -29.348 1.00 . A A .   5 LYS NZ   1 1 
        2  3193 1 1   5 LYS O    O  11.286 -15.453 -31.122 1.00 . A A .   5 LYS O    1 1 
        2  3194 1 1   6 ALA C    C   7.852 -16.384 -30.899 1.00 . A A .   6 ALA C    1 1 
        2  3195 1 1   6 ALA CA   C   8.819 -16.282 -32.074 1.00 . A A .   6 ALA CA   1 1 
        2  3196 1 1   6 ALA CB   C   8.118 -16.656 -33.371 1.00 . A A .   6 ALA CB   1 1 
        2  3197 1 1   6 ALA H    H   9.924 -18.089 -32.074 1.00 . A A .   6 ALA H    1 1 
        2  3198 1 1   6 ALA HA   H   9.161 -15.262 -32.159 1.00 . A A .   6 ALA HA   1 1 
        2  3199 1 1   6 ALA HB1  H   7.796 -15.758 -33.879 1.00 . A A .   6 ALA HB1  1 1 
        2  3200 1 1   6 ALA HB2  H   7.260 -17.274 -33.153 1.00 . A A .   6 ALA HB2  1 1 
        2  3201 1 1   6 ALA HB3  H   8.802 -17.202 -34.006 1.00 . A A .   6 ALA HB3  1 1 
        2  3202 1 1   6 ALA N    N   9.985 -17.132 -31.867 1.00 . A A .   6 ALA N    1 1 
        2  3203 1 1   6 ALA O    O   6.637 -16.295 -31.074 1.00 . A A .   6 ALA O    1 1 
        2  3204 1 1   7 ILE C    C   6.983 -15.332 -28.115 1.00 . A A .   7 ILE C    1 1 
        2  3205 1 1   7 ILE CA   C   7.585 -16.681 -28.499 1.00 . A A .   7 ILE CA   1 1 
        2  3206 1 1   7 ILE CB   C   8.406 -17.230 -27.314 1.00 . A A .   7 ILE CB   1 1 
        2  3207 1 1   7 ILE CD1  C   7.957 -18.566 -25.194 1.00 . A A .   7 ILE CD1  1 1 
        2  3208 1 1   7 ILE CG1  C   7.509 -17.431 -26.089 1.00 . A A .   7 ILE CG1  1 1 
        2  3209 1 1   7 ILE CG2  C   9.558 -16.291 -26.984 1.00 . A A .   7 ILE CG2  1 1 
        2  3210 1 1   7 ILE H    H   9.375 -16.630 -29.627 1.00 . A A .   7 ILE H    1 1 
        2  3211 1 1   7 ILE HA   H   6.782 -17.375 -28.704 1.00 . A A .   7 ILE HA   1 1 
        2  3212 1 1   7 ILE HB   H   8.823 -18.181 -27.604 1.00 . A A .   7 ILE HB   1 1 
        2  3213 1 1   7 ILE HD11 H   8.845 -19.021 -25.605 1.00 . A A .   7 ILE HD11 1 1 
        2  3214 1 1   7 ILE HD12 H   7.170 -19.304 -25.130 1.00 . A A .   7 ILE HD12 1 1 
        2  3215 1 1   7 ILE HD13 H   8.171 -18.184 -24.207 1.00 . A A .   7 ILE HD13 1 1 
        2  3216 1 1   7 ILE HG12 H   7.507 -16.526 -25.500 1.00 . A A .   7 ILE HG12 1 1 
        2  3217 1 1   7 ILE HG13 H   6.503 -17.644 -26.420 1.00 . A A .   7 ILE HG13 1 1 
        2  3218 1 1   7 ILE HG21 H   9.776 -15.674 -27.843 1.00 . A A .   7 ILE HG21 1 1 
        2  3219 1 1   7 ILE HG22 H  10.432 -16.872 -26.727 1.00 . A A .   7 ILE HG22 1 1 
        2  3220 1 1   7 ILE HG23 H   9.285 -15.664 -26.149 1.00 . A A .   7 ILE HG23 1 1 
        2  3221 1 1   7 ILE N    N   8.399 -16.568 -29.702 1.00 . A A .   7 ILE N    1 1 
        2  3222 1 1   7 ILE O    O   7.698 -14.415 -27.709 1.00 . A A .   7 ILE O    1 1 
        2  3223 1 1   8 PHE C    C   3.488 -14.250 -27.644 1.00 . A A .   8 PHE C    1 1 
        2  3224 1 1   8 PHE CA   C   4.967 -13.984 -27.908 1.00 . A A .   8 PHE CA   1 1 
        2  3225 1 1   8 PHE CB   C   5.127 -12.961 -29.037 1.00 . A A .   8 PHE CB   1 1 
        2  3226 1 1   8 PHE CD1  C   4.539 -10.741 -28.023 1.00 . A A .   8 PHE CD1  1 1 
        2  3227 1 1   8 PHE CD2  C   6.810 -11.145 -28.630 1.00 . A A .   8 PHE CD2  1 1 
        2  3228 1 1   8 PHE CE1  C   4.878  -9.478 -27.579 1.00 . A A .   8 PHE CE1  1 1 
        2  3229 1 1   8 PHE CE2  C   7.155  -9.882 -28.187 1.00 . A A .   8 PHE CE2  1 1 
        2  3230 1 1   8 PHE CG   C   5.499 -11.588 -28.553 1.00 . A A .   8 PHE CG   1 1 
        2  3231 1 1   8 PHE CZ   C   6.189  -9.047 -27.661 1.00 . A A .   8 PHE CZ   1 1 
        2  3232 1 1   8 PHE H    H   5.150 -15.987 -28.570 1.00 . A A .   8 PHE H    1 1 
        2  3233 1 1   8 PHE HA   H   5.414 -13.585 -27.009 1.00 . A A .   8 PHE HA   1 1 
        2  3234 1 1   8 PHE HB2  H   5.900 -13.297 -29.710 1.00 . A A .   8 PHE HB2  1 1 
        2  3235 1 1   8 PHE HB3  H   4.195 -12.883 -29.578 1.00 . A A .   8 PHE HB3  1 1 
        2  3236 1 1   8 PHE HD1  H   3.515 -11.076 -27.958 1.00 . A A .   8 PHE HD1  1 1 
        2  3237 1 1   8 PHE HD2  H   7.566 -11.796 -29.042 1.00 . A A .   8 PHE HD2  1 1 
        2  3238 1 1   8 PHE HE1  H   4.122  -8.827 -27.167 1.00 . A A .   8 PHE HE1  1 1 
        2  3239 1 1   8 PHE HE2  H   8.182  -9.549 -28.251 1.00 . A A .   8 PHE HE2  1 1 
        2  3240 1 1   8 PHE HZ   H   6.457  -8.061 -27.312 1.00 . A A .   8 PHE HZ   1 1 
        2  3241 1 1   8 PHE N    N   5.665 -15.220 -28.242 1.00 . A A .   8 PHE N    1 1 
        2  3242 1 1   8 PHE O    O   2.646 -14.057 -28.522 1.00 . A A .   8 PHE O    1 1 
        2  3243 1 1   9 VAL C    C   1.336 -14.059 -24.934 1.00 . A A .   9 VAL C    1 1 
        2  3244 1 1   9 VAL CA   C   1.804 -14.986 -26.050 1.00 . A A .   9 VAL CA   1 1 
        2  3245 1 1   9 VAL CB   C   1.645 -16.448 -25.589 1.00 . A A .   9 VAL CB   1 1 
        2  3246 1 1   9 VAL CG1  C   0.181 -16.778 -25.347 1.00 . A A .   9 VAL CG1  1 1 
        2  3247 1 1   9 VAL CG2  C   2.253 -17.400 -26.609 1.00 . A A .   9 VAL CG2  1 1 
        2  3248 1 1   9 VAL H    H   3.896 -14.827 -25.775 1.00 . A A .   9 VAL H    1 1 
        2  3249 1 1   9 VAL HA   H   1.178 -14.834 -26.918 1.00 . A A .   9 VAL HA   1 1 
        2  3250 1 1   9 VAL HB   H   2.177 -16.569 -24.655 1.00 . A A .   9 VAL HB   1 1 
        2  3251 1 1   9 VAL HG11 H   0.093 -17.401 -24.470 1.00 . A A .   9 VAL HG11 1 1 
        2  3252 1 1   9 VAL HG12 H  -0.215 -17.306 -26.203 1.00 . A A .   9 VAL HG12 1 1 
        2  3253 1 1   9 VAL HG13 H  -0.375 -15.865 -25.198 1.00 . A A .   9 VAL HG13 1 1 
        2  3254 1 1   9 VAL HG21 H   2.928 -16.857 -27.253 1.00 . A A .   9 VAL HG21 1 1 
        2  3255 1 1   9 VAL HG22 H   1.464 -17.840 -27.203 1.00 . A A .   9 VAL HG22 1 1 
        2  3256 1 1   9 VAL HG23 H   2.796 -18.179 -26.096 1.00 . A A .   9 VAL HG23 1 1 
        2  3257 1 1   9 VAL N    N   3.180 -14.694 -26.431 1.00 . A A .   9 VAL N    1 1 
        2  3258 1 1   9 VAL O    O   0.358 -13.327 -25.091 1.00 . A A .   9 VAL O    1 1 
        2  3259 1 1  10 LEU C    C   2.474 -11.947 -22.699 1.00 . A A .  10 LEU C    1 1 
        2  3260 1 1  10 LEU CA   C   1.696 -13.259 -22.664 1.00 . A A .  10 LEU CA   1 1 
        2  3261 1 1  10 LEU CB   C   1.977 -14.005 -21.356 1.00 . A A .  10 LEU CB   1 1 
        2  3262 1 1  10 LEU CD1  C   0.068 -12.991 -20.086 1.00 . A A .  10 LEU CD1  1 1 
        2  3263 1 1  10 LEU CD2  C  -0.230 -15.187 -21.247 1.00 . A A .  10 LEU CD2  1 1 
        2  3264 1 1  10 LEU CG   C   0.744 -14.290 -20.497 1.00 . A A .  10 LEU CG   1 1 
        2  3265 1 1  10 LEU H    H   2.807 -14.700 -23.744 1.00 . A A .  10 LEU H    1 1 
        2  3266 1 1  10 LEU HA   H   0.641 -13.038 -22.721 1.00 . A A .  10 LEU HA   1 1 
        2  3267 1 1  10 LEU HB2  H   2.447 -14.947 -21.599 1.00 . A A .  10 LEU HB2  1 1 
        2  3268 1 1  10 LEU HB3  H   2.668 -13.418 -20.770 1.00 . A A .  10 LEU HB3  1 1 
        2  3269 1 1  10 LEU HD11 H  -0.785 -13.211 -19.462 1.00 . A A .  10 LEU HD11 1 1 
        2  3270 1 1  10 LEU HD12 H  -0.259 -12.461 -20.969 1.00 . A A .  10 LEU HD12 1 1 
        2  3271 1 1  10 LEU HD13 H   0.769 -12.379 -19.537 1.00 . A A .  10 LEU HD13 1 1 
        2  3272 1 1  10 LEU HD21 H  -1.243 -14.925 -20.975 1.00 . A A .  10 LEU HD21 1 1 
        2  3273 1 1  10 LEU HD22 H  -0.043 -16.219 -20.987 1.00 . A A .  10 LEU HD22 1 1 
        2  3274 1 1  10 LEU HD23 H  -0.097 -15.054 -22.310 1.00 . A A .  10 LEU HD23 1 1 
        2  3275 1 1  10 LEU HG   H   1.051 -14.805 -19.599 1.00 . A A .  10 LEU HG   1 1 
        2  3276 1 1  10 LEU N    N   2.039 -14.096 -23.807 1.00 . A A .  10 LEU N    1 1 
        2  3277 1 1  10 LEU O    O   3.442 -11.807 -23.444 1.00 . A A .  10 LEU O    1 1 
        2  3278 1 1  11 ASN C    C   3.820  -9.692 -20.788 1.00 . A A .  11 ASN C    1 1 
        2  3279 1 1  11 ASN CA   C   2.698  -9.686 -21.823 1.00 . A A .  11 ASN CA   1 1 
        2  3280 1 1  11 ASN CB   C   1.680  -8.596 -21.488 1.00 . A A .  11 ASN CB   1 1 
        2  3281 1 1  11 ASN CG   C   0.715  -8.335 -22.627 1.00 . A A .  11 ASN CG   1 1 
        2  3282 1 1  11 ASN H    H   1.264 -11.159 -21.314 1.00 . A A .  11 ASN H    1 1 
        2  3283 1 1  11 ASN HA   H   3.123  -9.484 -22.794 1.00 . A A .  11 ASN HA   1 1 
        2  3284 1 1  11 ASN HB2  H   1.109  -8.898 -20.621 1.00 . A A .  11 ASN HB2  1 1 
        2  3285 1 1  11 ASN HB3  H   2.204  -7.678 -21.265 1.00 . A A .  11 ASN HB3  1 1 
        2  3286 1 1  11 ASN HD21 H   2.107  -7.302 -23.602 1.00 . A A .  11 ASN HD21 1 1 
        2  3287 1 1  11 ASN HD22 H   0.579  -7.434 -24.396 1.00 . A A .  11 ASN HD22 1 1 
        2  3288 1 1  11 ASN N    N   2.042 -10.988 -21.886 1.00 . A A .  11 ASN N    1 1 
        2  3289 1 1  11 ASN ND2  N   1.181  -7.618 -23.644 1.00 . A A .  11 ASN ND2  1 1 
        2  3290 1 1  11 ASN O    O   3.863  -8.842 -19.898 1.00 . A A .  11 ASN O    1 1 
        2  3291 1 1  11 ASN OD1  O  -0.435  -8.772 -22.596 1.00 . A A .  11 ASN OD1  1 1 
        2  3292 1 1  12 ALA C    C   7.085 -10.063 -20.534 1.00 . A A .  12 ALA C    1 1 
        2  3293 1 1  12 ALA CA   C   5.850 -10.770 -19.988 1.00 . A A .  12 ALA CA   1 1 
        2  3294 1 1  12 ALA CB   C   6.156 -12.233 -19.711 1.00 . A A .  12 ALA CB   1 1 
        2  3295 1 1  12 ALA H    H   4.641 -11.303 -21.641 1.00 . A A .  12 ALA H    1 1 
        2  3296 1 1  12 ALA HA   H   5.562 -10.304 -19.056 1.00 . A A .  12 ALA HA   1 1 
        2  3297 1 1  12 ALA HB1  H   7.209 -12.347 -19.498 1.00 . A A .  12 ALA HB1  1 1 
        2  3298 1 1  12 ALA HB2  H   5.898 -12.826 -20.576 1.00 . A A .  12 ALA HB2  1 1 
        2  3299 1 1  12 ALA HB3  H   5.580 -12.568 -18.861 1.00 . A A .  12 ALA HB3  1 1 
        2  3300 1 1  12 ALA N    N   4.728 -10.655 -20.912 1.00 . A A .  12 ALA N    1 1 
        2  3301 1 1  12 ALA O    O   7.644 -10.467 -21.554 1.00 . A A .  12 ALA O    1 1 
        2  3302 1 1  13 ALA C    C   9.923  -9.121 -20.303 1.00 . A A .  13 ALA C    1 1 
        2  3303 1 1  13 ALA CA   C   8.677  -8.241 -20.267 1.00 . A A .  13 ALA CA   1 1 
        2  3304 1 1  13 ALA CB   C   8.892  -7.057 -19.337 1.00 . A A .  13 ALA CB   1 1 
        2  3305 1 1  13 ALA H    H   7.019  -8.731 -19.044 1.00 . A A .  13 ALA H    1 1 
        2  3306 1 1  13 ALA HA   H   8.487  -7.860 -21.259 1.00 . A A .  13 ALA HA   1 1 
        2  3307 1 1  13 ALA HB1  H   9.605  -7.325 -18.572 1.00 . A A .  13 ALA HB1  1 1 
        2  3308 1 1  13 ALA HB2  H   7.953  -6.786 -18.875 1.00 . A A .  13 ALA HB2  1 1 
        2  3309 1 1  13 ALA HB3  H   9.267  -6.218 -19.904 1.00 . A A .  13 ALA HB3  1 1 
        2  3310 1 1  13 ALA N    N   7.506  -9.005 -19.849 1.00 . A A .  13 ALA N    1 1 
        2  3311 1 1  13 ALA O    O  10.060 -10.050 -19.506 1.00 . A A .  13 ALA O    1 1 
        2  3312 1 1  14 PRO C    C  13.071  -9.345 -20.223 1.00 . A A .  14 PRO C    1 1 
        2  3313 1 1  14 PRO CA   C  12.094  -9.611 -21.365 1.00 . A A .  14 PRO CA   1 1 
        2  3314 1 1  14 PRO CB   C  12.675  -9.118 -22.691 1.00 . A A .  14 PRO CB   1 1 
        2  3315 1 1  14 PRO CD   C  10.772  -7.748 -22.221 1.00 . A A .  14 PRO CD   1 1 
        2  3316 1 1  14 PRO CG   C  12.141  -7.738 -22.845 1.00 . A A .  14 PRO CG   1 1 
        2  3317 1 1  14 PRO HA   H  11.895 -10.671 -21.428 1.00 . A A .  14 PRO HA   1 1 
        2  3318 1 1  14 PRO HB2  H  13.755  -9.123 -22.637 1.00 . A A .  14 PRO HB2  1 1 
        2  3319 1 1  14 PRO HB3  H  12.346  -9.761 -23.493 1.00 . A A .  14 PRO HB3  1 1 
        2  3320 1 1  14 PRO HD2  H  10.570  -6.804 -21.738 1.00 . A A .  14 PRO HD2  1 1 
        2  3321 1 1  14 PRO HD3  H  10.020  -7.961 -22.967 1.00 . A A .  14 PRO HD3  1 1 
        2  3322 1 1  14 PRO HG2  H  12.783  -7.036 -22.332 1.00 . A A .  14 PRO HG2  1 1 
        2  3323 1 1  14 PRO HG3  H  12.073  -7.486 -23.894 1.00 . A A .  14 PRO HG3  1 1 
        2  3324 1 1  14 PRO N    N  10.854  -8.839 -21.230 1.00 . A A .  14 PRO N    1 1 
        2  3325 1 1  14 PRO O    O  13.715 -10.265 -19.720 1.00 . A A .  14 PRO O    1 1 
        2  3326 1 1  15 LYS C    C  13.358  -6.806 -17.730 1.00 . A A .  15 LYS C    1 1 
        2  3327 1 1  15 LYS CA   C  14.074  -7.696 -18.741 1.00 . A A .  15 LYS CA   1 1 
        2  3328 1 1  15 LYS CB   C  15.298  -6.970 -19.303 1.00 . A A .  15 LYS CB   1 1 
        2  3329 1 1  15 LYS CD   C  17.443  -5.743 -18.833 1.00 . A A .  15 LYS CD   1 1 
        2  3330 1 1  15 LYS CE   C  18.778  -6.449 -18.661 1.00 . A A .  15 LYS CE   1 1 
        2  3331 1 1  15 LYS CG   C  16.300  -6.554 -18.239 1.00 . A A .  15 LYS CG   1 1 
        2  3332 1 1  15 LYS H    H  12.634  -7.395 -20.265 1.00 . A A .  15 LYS H    1 1 
        2  3333 1 1  15 LYS HA   H  14.399  -8.598 -18.243 1.00 . A A .  15 LYS HA   1 1 
        2  3334 1 1  15 LYS HB2  H  15.797  -7.621 -20.004 1.00 . A A .  15 LYS HB2  1 1 
        2  3335 1 1  15 LYS HB3  H  14.967  -6.081 -19.821 1.00 . A A .  15 LYS HB3  1 1 
        2  3336 1 1  15 LYS HD2  H  17.257  -5.595 -19.886 1.00 . A A .  15 LYS HD2  1 1 
        2  3337 1 1  15 LYS HD3  H  17.485  -4.784 -18.335 1.00 . A A .  15 LYS HD3  1 1 
        2  3338 1 1  15 LYS HE2  H  18.752  -7.026 -17.749 1.00 . A A .  15 LYS HE2  1 1 
        2  3339 1 1  15 LYS HE3  H  18.932  -7.109 -19.502 1.00 . A A .  15 LYS HE3  1 1 
        2  3340 1 1  15 LYS HG2  H  15.795  -5.954 -17.496 1.00 . A A .  15 LYS HG2  1 1 
        2  3341 1 1  15 LYS HG3  H  16.703  -7.442 -17.773 1.00 . A A .  15 LYS HG3  1 1 
        2  3342 1 1  15 LYS HZ1  H  19.660  -4.602 -19.081 1.00 . A A .  15 LYS HZ1  1 1 
        2  3343 1 1  15 LYS HZ2  H  20.755  -5.891 -19.040 1.00 . A A .  15 LYS HZ2  1 1 
        2  3344 1 1  15 LYS HZ3  H  20.131  -5.263 -17.598 1.00 . A A .  15 LYS HZ3  1 1 
        2  3345 1 1  15 LYS N    N  13.174  -8.084 -19.823 1.00 . A A .  15 LYS N    1 1 
        2  3346 1 1  15 LYS NZ   N  19.910  -5.483 -18.590 1.00 . A A .  15 LYS NZ   1 1 
        2  3347 1 1  15 LYS O    O  13.011  -5.663 -18.031 1.00 . A A .  15 LYS O    1 1 
        2  3348 1 1  16 ASP C    C  13.307  -5.401 -15.026 1.00 . A A .  16 ASP C    1 1 
        2  3349 1 1  16 ASP CA   C  12.465  -6.590 -15.477 1.00 . A A .  16 ASP CA   1 1 
        2  3350 1 1  16 ASP CB   C  12.170  -7.503 -14.285 1.00 . A A .  16 ASP CB   1 1 
        2  3351 1 1  16 ASP CG   C  10.827  -8.195 -14.406 1.00 . A A .  16 ASP CG   1 1 
        2  3352 1 1  16 ASP H    H  13.438  -8.253 -16.353 1.00 . A A .  16 ASP H    1 1 
        2  3353 1 1  16 ASP HA   H  11.530  -6.223 -15.877 1.00 . A A .  16 ASP HA   1 1 
        2  3354 1 1  16 ASP HB2  H  12.939  -8.258 -14.219 1.00 . A A .  16 ASP HB2  1 1 
        2  3355 1 1  16 ASP HB3  H  12.171  -6.913 -13.380 1.00 . A A .  16 ASP HB3  1 1 
        2  3356 1 1  16 ASP N    N  13.138  -7.337 -16.531 1.00 . A A .  16 ASP N    1 1 
        2  3357 1 1  16 ASP O    O  14.486  -5.301 -15.364 1.00 . A A .  16 ASP O    1 1 
        2  3358 1 1  16 ASP OD1  O  10.587  -8.849 -15.442 1.00 . A A .  16 ASP OD1  1 1 
        2  3359 1 1  16 ASP OD2  O  10.015  -8.084 -13.464 1.00 . A A .  16 ASP OD2  1 1 
        2  3360 1 1  17 ASN C    C  13.658  -3.434 -12.269 1.00 . A A .  17 ASN C    1 1 
        2  3361 1 1  17 ASN CA   C  13.391  -3.321 -13.766 1.00 . A A .  17 ASN CA   1 1 
        2  3362 1 1  17 ASN CB   C  12.572  -2.062 -14.059 1.00 . A A .  17 ASN CB   1 1 
        2  3363 1 1  17 ASN CG   C  13.409  -0.957 -14.673 1.00 . A A .  17 ASN CG   1 1 
        2  3364 1 1  17 ASN H    H  11.753  -4.637 -14.027 1.00 . A A .  17 ASN H    1 1 
        2  3365 1 1  17 ASN HA   H  14.335  -3.252 -14.284 1.00 . A A .  17 ASN HA   1 1 
        2  3366 1 1  17 ASN HB2  H  11.776  -2.308 -14.747 1.00 . A A .  17 ASN HB2  1 1 
        2  3367 1 1  17 ASN HB3  H  12.143  -1.694 -13.138 1.00 . A A .  17 ASN HB3  1 1 
        2  3368 1 1  17 ASN HD21 H  13.000   0.239 -13.138 1.00 . A A .  17 ASN HD21 1 1 
        2  3369 1 1  17 ASN HD22 H  14.019   0.910 -14.362 1.00 . A A .  17 ASN HD22 1 1 
        2  3370 1 1  17 ASN N    N  12.695  -4.503 -14.262 1.00 . A A .  17 ASN N    1 1 
        2  3371 1 1  17 ASN ND2  N  13.484   0.179 -13.989 1.00 . A A .  17 ASN ND2  1 1 
        2  3372 1 1  17 ASN O    O  14.799  -3.621 -11.845 1.00 . A A .  17 ASN O    1 1 
        2  3373 1 1  17 ASN OD1  O  13.984  -1.123 -15.749 1.00 . A A .  17 ASN OD1  1 1 
        2  3374 1 1  18 THR C    C  11.398  -3.825  -9.388 1.00 . A A .  18 THR C    1 1 
        2  3375 1 1  18 THR CA   C  12.724  -3.413 -10.021 1.00 . A A .  18 THR CA   1 1 
        2  3376 1 1  18 THR CB   C  13.184  -2.075  -9.443 1.00 . A A .  18 THR CB   1 1 
        2  3377 1 1  18 THR CG2  C  12.342  -0.903  -9.901 1.00 . A A .  18 THR CG2  1 1 
        2  3378 1 1  18 THR H    H  11.717  -3.174 -11.868 1.00 . A A .  18 THR H    1 1 
        2  3379 1 1  18 THR HA   H  13.464  -4.165  -9.798 1.00 . A A .  18 THR HA   1 1 
        2  3380 1 1  18 THR HB   H  14.203  -1.891  -9.754 1.00 . A A .  18 THR HB   1 1 
        2  3381 1 1  18 THR HG1  H  13.953  -2.510  -7.695 1.00 . A A .  18 THR HG1  1 1 
        2  3382 1 1  18 THR HG21 H  11.335  -1.239 -10.095 1.00 . A A .  18 THR HG21 1 1 
        2  3383 1 1  18 THR HG22 H  12.763  -0.488 -10.804 1.00 . A A .  18 THR HG22 1 1 
        2  3384 1 1  18 THR HG23 H  12.328  -0.147  -9.130 1.00 . A A .  18 THR HG23 1 1 
        2  3385 1 1  18 THR N    N  12.600  -3.322 -11.473 1.00 . A A .  18 THR N    1 1 
        2  3386 1 1  18 THR O    O  10.329  -3.588  -9.950 1.00 . A A .  18 THR O    1 1 
        2  3387 1 1  18 THR OG1  O  13.149  -2.102  -8.027 1.00 . A A .  18 THR OG1  1 1 
        2  3388 1 1  19 TRP C    C  10.202  -4.243  -6.120 1.00 . A A .  19 TRP C    1 1 
        2  3389 1 1  19 TRP CA   C  10.284  -4.888  -7.502 1.00 . A A .  19 TRP CA   1 1 
        2  3390 1 1  19 TRP CB   C  10.287  -6.413  -7.366 1.00 . A A .  19 TRP CB   1 1 
        2  3391 1 1  19 TRP CD1  C   9.149  -6.617  -9.655 1.00 . A A .  19 TRP CD1  1 1 
        2  3392 1 1  19 TRP CD2  C   8.907  -8.415  -8.342 1.00 . A A .  19 TRP CD2  1 1 
        2  3393 1 1  19 TRP CE2  C   8.240  -8.654  -9.559 1.00 . A A .  19 TRP CE2  1 1 
        2  3394 1 1  19 TRP CE3  C   8.892  -9.408  -7.359 1.00 . A A .  19 TRP CE3  1 1 
        2  3395 1 1  19 TRP CG   C   9.482  -7.106  -8.424 1.00 . A A .  19 TRP CG   1 1 
        2  3396 1 1  19 TRP CH2  C   7.569 -10.800  -8.837 1.00 . A A .  19 TRP CH2  1 1 
        2  3397 1 1  19 TRP CZ2  C   7.566  -9.846  -9.817 1.00 . A A .  19 TRP CZ2  1 1 
        2  3398 1 1  19 TRP CZ3  C   8.223 -10.591  -7.617 1.00 . A A .  19 TRP CZ3  1 1 
        2  3399 1 1  19 TRP H    H  12.358  -4.603  -7.815 1.00 . A A .  19 TRP H    1 1 
        2  3400 1 1  19 TRP HA   H   9.422  -4.587  -8.077 1.00 . A A .  19 TRP HA   1 1 
        2  3401 1 1  19 TRP HB2  H  11.303  -6.771  -7.433 1.00 . A A .  19 TRP HB2  1 1 
        2  3402 1 1  19 TRP HB3  H   9.878  -6.683  -6.404 1.00 . A A .  19 TRP HB3  1 1 
        2  3403 1 1  19 TRP HD1  H   9.436  -5.642 -10.019 1.00 . A A .  19 TRP HD1  1 1 
        2  3404 1 1  19 TRP HE1  H   8.044  -7.425 -11.248 1.00 . A A .  19 TRP HE1  1 1 
        2  3405 1 1  19 TRP HE3  H   9.391  -9.264  -6.412 1.00 . A A .  19 TRP HE3  1 1 
        2  3406 1 1  19 TRP HH2  H   7.058 -11.738  -8.995 1.00 . A A .  19 TRP HH2  1 1 
        2  3407 1 1  19 TRP HZ2  H   7.057 -10.022 -10.753 1.00 . A A .  19 TRP HZ2  1 1 
        2  3408 1 1  19 TRP HZ3  H   8.201 -11.368  -6.869 1.00 . A A .  19 TRP HZ3  1 1 
        2  3409 1 1  19 TRP N    N  11.477  -4.443  -8.213 1.00 . A A .  19 TRP N    1 1 
        2  3410 1 1  19 TRP NE1  N   8.402  -7.541 -10.342 1.00 . A A .  19 TRP NE1  1 1 
        2  3411 1 1  19 TRP O    O  11.179  -4.228  -5.372 1.00 . A A .  19 TRP O    1 1 
        2  3412 1 1  20 TYR C    C   7.565  -3.607  -3.818 1.00 . A A .  20 TYR C    1 1 
        2  3413 1 1  20 TYR CA   C   8.819  -3.069  -4.499 1.00 . A A .  20 TYR CA   1 1 
        2  3414 1 1  20 TYR CB   C   8.705  -1.552  -4.675 1.00 . A A .  20 TYR CB   1 1 
        2  3415 1 1  20 TYR CD1  C  10.905  -0.673  -3.803 1.00 . A A .  20 TYR CD1  1 1 
        2  3416 1 1  20 TYR CD2  C  10.425  -0.402  -6.122 1.00 . A A .  20 TYR CD2  1 1 
        2  3417 1 1  20 TYR CE1  C  12.123  -0.043  -3.977 1.00 . A A .  20 TYR CE1  1 1 
        2  3418 1 1  20 TYR CE2  C  11.641   0.229  -6.304 1.00 . A A .  20 TYR CE2  1 1 
        2  3419 1 1  20 TYR CG   C  10.036  -0.864  -4.870 1.00 . A A .  20 TYR CG   1 1 
        2  3420 1 1  20 TYR CZ   C  12.486   0.406  -5.230 1.00 . A A .  20 TYR CZ   1 1 
        2  3421 1 1  20 TYR H    H   8.287  -3.756  -6.429 1.00 . A A .  20 TYR H    1 1 
        2  3422 1 1  20 TYR HA   H   9.674  -3.286  -3.876 1.00 . A A .  20 TYR HA   1 1 
        2  3423 1 1  20 TYR HB2  H   8.094  -1.343  -5.540 1.00 . A A .  20 TYR HB2  1 1 
        2  3424 1 1  20 TYR HB3  H   8.237  -1.130  -3.798 1.00 . A A .  20 TYR HB3  1 1 
        2  3425 1 1  20 TYR HD1  H  10.618  -1.027  -2.824 1.00 . A A .  20 TYR HD1  1 1 
        2  3426 1 1  20 TYR HD2  H   9.762  -0.542  -6.962 1.00 . A A .  20 TYR HD2  1 1 
        2  3427 1 1  20 TYR HE1  H  12.785   0.095  -3.134 1.00 . A A .  20 TYR HE1  1 1 
        2  3428 1 1  20 TYR HE2  H  11.925   0.581  -7.285 1.00 . A A .  20 TYR HE2  1 1 
        2  3429 1 1  20 TYR HH   H  13.555   1.902  -5.790 1.00 . A A .  20 TYR HH   1 1 
        2  3430 1 1  20 TYR N    N   9.029  -3.713  -5.789 1.00 . A A .  20 TYR N    1 1 
        2  3431 1 1  20 TYR O    O   6.523  -3.772  -4.455 1.00 . A A .  20 TYR O    1 1 
        2  3432 1 1  20 TYR OH   O  13.697   1.034  -5.407 1.00 . A A .  20 TYR OH   1 1 
        2  3433 1 1  21 ALA C    C   6.540  -3.856  -0.336 1.00 . A A .  21 ALA C    1 1 
        2  3434 1 1  21 ALA CA   C   6.542  -4.403  -1.758 1.00 . A A .  21 ALA CA   1 1 
        2  3435 1 1  21 ALA CB   C   6.574  -5.924  -1.743 1.00 . A A .  21 ALA CB   1 1 
        2  3436 1 1  21 ALA H    H   8.526  -3.731  -2.069 1.00 . A A .  21 ALA H    1 1 
        2  3437 1 1  21 ALA HA   H   5.633  -4.092  -2.254 1.00 . A A .  21 ALA HA   1 1 
        2  3438 1 1  21 ALA HB1  H   7.595  -6.264  -1.843 1.00 . A A .  21 ALA HB1  1 1 
        2  3439 1 1  21 ALA HB2  H   5.985  -6.306  -2.563 1.00 . A A .  21 ALA HB2  1 1 
        2  3440 1 1  21 ALA HB3  H   6.166  -6.283  -0.809 1.00 . A A .  21 ALA HB3  1 1 
        2  3441 1 1  21 ALA N    N   7.670  -3.882  -2.523 1.00 . A A .  21 ALA N    1 1 
        2  3442 1 1  21 ALA O    O   7.593  -3.707   0.283 1.00 . A A .  21 ALA O    1 1 
        2  3443 1 1  22 GLY C    C   3.795  -2.827   1.950 1.00 . A A .  22 GLY C    1 1 
        2  3444 1 1  22 GLY CA   C   5.236  -3.035   1.526 1.00 . A A .  22 GLY CA   1 1 
        2  3445 1 1  22 GLY H    H   4.544  -3.701  -0.362 1.00 . A A .  22 GLY H    1 1 
        2  3446 1 1  22 GLY HA2  H   5.704  -3.726   2.211 1.00 . A A .  22 GLY HA2  1 1 
        2  3447 1 1  22 GLY HA3  H   5.753  -2.089   1.577 1.00 . A A .  22 GLY HA3  1 1 
        2  3448 1 1  22 GLY N    N   5.350  -3.561   0.179 1.00 . A A .  22 GLY N    1 1 
        2  3449 1 1  22 GLY O    O   2.870  -3.227   1.243 1.00 . A A .  22 GLY O    1 1 
        2  3450 1 1  23 GLY C    C   2.167  -0.654   4.386 1.00 . A A .  23 GLY C    1 1 
        2  3451 1 1  23 GLY CA   C   2.263  -1.948   3.603 1.00 . A A .  23 GLY CA   1 1 
        2  3452 1 1  23 GLY H    H   4.381  -1.902   3.625 1.00 . A A .  23 GLY H    1 1 
        2  3453 1 1  23 GLY HA2  H   1.585  -1.900   2.764 1.00 . A A .  23 GLY HA2  1 1 
        2  3454 1 1  23 GLY HA3  H   1.970  -2.766   4.243 1.00 . A A .  23 GLY HA3  1 1 
        2  3455 1 1  23 GLY N    N   3.605  -2.198   3.106 1.00 . A A .  23 GLY N    1 1 
        2  3456 1 1  23 GLY O    O   3.129  -0.241   5.036 1.00 . A A .  23 GLY O    1 1 
        2  3457 1 1  24 LYS C    C  -0.555   1.258   5.748 1.00 . A A .  24 LYS C    1 1 
        2  3458 1 1  24 LYS CA   C   0.792   1.248   5.030 1.00 . A A .  24 LYS CA   1 1 
        2  3459 1 1  24 LYS CB   C   0.870   2.424   4.055 1.00 . A A .  24 LYS CB   1 1 
        2  3460 1 1  24 LYS CD   C  -1.359   2.797   2.960 1.00 . A A .  24 LYS CD   1 1 
        2  3461 1 1  24 LYS CE   C  -2.217   2.536   1.730 1.00 . A A .  24 LYS CE   1 1 
        2  3462 1 1  24 LYS CG   C   0.040   2.228   2.797 1.00 . A A .  24 LYS CG   1 1 
        2  3463 1 1  24 LYS H    H   0.275  -0.387   3.784 1.00 . A A .  24 LYS H    1 1 
        2  3464 1 1  24 LYS HA   H   1.576   1.349   5.764 1.00 . A A .  24 LYS HA   1 1 
        2  3465 1 1  24 LYS HB2  H   0.523   3.314   4.554 1.00 . A A .  24 LYS HB2  1 1 
        2  3466 1 1  24 LYS HB3  H   1.900   2.565   3.761 1.00 . A A .  24 LYS HB3  1 1 
        2  3467 1 1  24 LYS HD2  H  -1.828   2.337   3.816 1.00 . A A .  24 LYS HD2  1 1 
        2  3468 1 1  24 LYS HD3  H  -1.288   3.864   3.117 1.00 . A A .  24 LYS HD3  1 1 
        2  3469 1 1  24 LYS HE2  H  -2.772   3.432   1.497 1.00 . A A .  24 LYS HE2  1 1 
        2  3470 1 1  24 LYS HE3  H  -1.568   2.289   0.902 1.00 . A A .  24 LYS HE3  1 1 
        2  3471 1 1  24 LYS HG2  H   0.527   2.729   1.974 1.00 . A A .  24 LYS HG2  1 1 
        2  3472 1 1  24 LYS HG3  H  -0.032   1.171   2.585 1.00 . A A .  24 LYS HG3  1 1 
        2  3473 1 1  24 LYS HZ1  H  -2.749   0.518   1.638 1.00 . A A .  24 LYS HZ1  1 1 
        2  3474 1 1  24 LYS HZ2  H  -4.046   1.581   1.406 1.00 . A A .  24 LYS HZ2  1 1 
        2  3475 1 1  24 LYS HZ3  H  -3.414   1.343   2.958 1.00 . A A .  24 LYS HZ3  1 1 
        2  3476 1 1  24 LYS N    N   1.005  -0.009   4.322 1.00 . A A .  24 LYS N    1 1 
        2  3477 1 1  24 LYS NZ   N  -3.173   1.415   1.949 1.00 . A A .  24 LYS NZ   1 1 
        2  3478 1 1  24 LYS O    O  -1.500   0.591   5.329 1.00 . A A .  24 LYS O    1 1 
        2  3479 1 1  25 LEU C    C  -2.201   3.606   7.856 1.00 . A A .  25 LEU C    1 1 
        2  3480 1 1  25 LEU CA   C  -1.857   2.139   7.611 1.00 . A A .  25 LEU CA   1 1 
        2  3481 1 1  25 LEU CB   C  -1.708   1.405   8.948 1.00 . A A .  25 LEU CB   1 1 
        2  3482 1 1  25 LEU CD1  C  -3.434  -0.080  10.016 1.00 . A A .  25 LEU CD1  1 1 
        2  3483 1 1  25 LEU CD2  C  -2.740   2.037  11.151 1.00 . A A .  25 LEU CD2  1 1 
        2  3484 1 1  25 LEU CG   C  -2.975   1.357   9.810 1.00 . A A .  25 LEU CG   1 1 
        2  3485 1 1  25 LEU H    H   0.159   2.537   7.107 1.00 . A A .  25 LEU H    1 1 
        2  3486 1 1  25 LEU HA   H  -2.655   1.683   7.045 1.00 . A A .  25 LEU HA   1 1 
        2  3487 1 1  25 LEU HB2  H  -1.393   0.392   8.743 1.00 . A A .  25 LEU HB2  1 1 
        2  3488 1 1  25 LEU HB3  H  -0.930   1.895   9.516 1.00 . A A .  25 LEU HB3  1 1 
        2  3489 1 1  25 LEU HD11 H  -4.293  -0.278   9.391 1.00 . A A .  25 LEU HD11 1 1 
        2  3490 1 1  25 LEU HD12 H  -3.703  -0.229  11.052 1.00 . A A .  25 LEU HD12 1 1 
        2  3491 1 1  25 LEU HD13 H  -2.635  -0.757   9.753 1.00 . A A .  25 LEU HD13 1 1 
        2  3492 1 1  25 LEU HD21 H  -2.951   3.092  11.062 1.00 . A A .  25 LEU HD21 1 1 
        2  3493 1 1  25 LEU HD22 H  -1.710   1.899  11.449 1.00 . A A .  25 LEU HD22 1 1 
        2  3494 1 1  25 LEU HD23 H  -3.390   1.601  11.895 1.00 . A A .  25 LEU HD23 1 1 
        2  3495 1 1  25 LEU HG   H  -3.766   1.887   9.301 1.00 . A A .  25 LEU HG   1 1 
        2  3496 1 1  25 LEU N    N  -0.631   2.027   6.829 1.00 . A A .  25 LEU N    1 1 
        2  3497 1 1  25 LEU O    O  -1.313   4.452   7.952 1.00 . A A .  25 LEU O    1 1 
        2  3498 1 1  26 GLY C    C  -5.369   5.360   8.635 1.00 . A A .  26 GLY C    1 1 
        2  3499 1 1  26 GLY CA   C  -3.925   5.268   8.181 1.00 . A A .  26 GLY CA   1 1 
        2  3500 1 1  26 GLY H    H  -4.161   3.185   7.863 1.00 . A A .  26 GLY H    1 1 
        2  3501 1 1  26 GLY HA2  H  -3.293   5.708   8.938 1.00 . A A .  26 GLY HA2  1 1 
        2  3502 1 1  26 GLY HA3  H  -3.811   5.826   7.265 1.00 . A A .  26 GLY HA3  1 1 
        2  3503 1 1  26 GLY N    N  -3.494   3.900   7.951 1.00 . A A .  26 GLY N    1 1 
        2  3504 1 1  26 GLY O    O  -5.968   4.359   9.028 1.00 . A A .  26 GLY O    1 1 
        2  3505 1 1  27 TRP C    C  -7.992   7.816   8.086 1.00 . A A .  27 TRP C    1 1 
        2  3506 1 1  27 TRP CA   C  -7.311   6.786   8.985 1.00 . A A .  27 TRP CA   1 1 
        2  3507 1 1  27 TRP CB   C  -7.378   7.235  10.449 1.00 . A A .  27 TRP CB   1 1 
        2  3508 1 1  27 TRP CD1  C  -5.825   9.207   9.890 1.00 . A A .  27 TRP CD1  1 1 
        2  3509 1 1  27 TRP CD2  C  -6.278   8.973  12.071 1.00 . A A .  27 TRP CD2  1 1 
        2  3510 1 1  27 TRP CE2  C  -5.424  10.080  11.905 1.00 . A A .  27 TRP CE2  1 1 
        2  3511 1 1  27 TRP CE3  C  -6.696   8.633  13.361 1.00 . A A .  27 TRP CE3  1 1 
        2  3512 1 1  27 TRP CG   C  -6.523   8.426  10.769 1.00 . A A .  27 TRP CG   1 1 
        2  3513 1 1  27 TRP CH2  C  -5.410  10.493  14.230 1.00 . A A .  27 TRP CH2  1 1 
        2  3514 1 1  27 TRP CZ2  C  -4.983  10.849  12.980 1.00 . A A .  27 TRP CZ2  1 1 
        2  3515 1 1  27 TRP CZ3  C  -6.258   9.397  14.426 1.00 . A A .  27 TRP CZ3  1 1 
        2  3516 1 1  27 TRP H    H  -5.397   7.320   8.254 1.00 . A A .  27 TRP H    1 1 
        2  3517 1 1  27 TRP HA   H  -7.834   5.847   8.885 1.00 . A A .  27 TRP HA   1 1 
        2  3518 1 1  27 TRP HB2  H  -8.400   7.489  10.690 1.00 . A A .  27 TRP HB2  1 1 
        2  3519 1 1  27 TRP HB3  H  -7.061   6.418  11.081 1.00 . A A .  27 TRP HB3  1 1 
        2  3520 1 1  27 TRP HD1  H  -5.805   9.054   8.823 1.00 . A A .  27 TRP HD1  1 1 
        2  3521 1 1  27 TRP HE1  H  -4.595  10.888  10.157 1.00 . A A .  27 TRP HE1  1 1 
        2  3522 1 1  27 TRP HE3  H  -7.351   7.792  13.531 1.00 . A A .  27 TRP HE3  1 1 
        2  3523 1 1  27 TRP HH2  H  -5.092  11.062  15.093 1.00 . A A .  27 TRP HH2  1 1 
        2  3524 1 1  27 TRP HZ2  H  -4.328  11.697  12.845 1.00 . A A .  27 TRP HZ2  1 1 
        2  3525 1 1  27 TRP HZ3  H  -6.573   9.148  15.429 1.00 . A A .  27 TRP HZ3  1 1 
        2  3526 1 1  27 TRP N    N  -5.928   6.564   8.577 1.00 . A A .  27 TRP N    1 1 
        2  3527 1 1  27 TRP NE1  N  -5.162  10.203  10.566 1.00 . A A .  27 TRP NE1  1 1 
        2  3528 1 1  27 TRP O    O  -7.329   8.597   7.404 1.00 . A A .  27 TRP O    1 1 
        2  3529 1 1  28 SER C    C -11.001   9.601   8.143 1.00 . A A .  28 SER C    1 1 
        2  3530 1 1  28 SER CA   C -10.093   8.738   7.273 1.00 . A A .  28 SER CA   1 1 
        2  3531 1 1  28 SER CB   C -10.931   7.974   6.246 1.00 . A A .  28 SER CB   1 1 
        2  3532 1 1  28 SER H    H  -9.794   7.158   8.650 1.00 . A A .  28 SER H    1 1 
        2  3533 1 1  28 SER HA   H  -9.397   9.378   6.753 1.00 . A A .  28 SER HA   1 1 
        2  3534 1 1  28 SER HB2  H -10.489   7.004   6.074 1.00 . A A .  28 SER HB2  1 1 
        2  3535 1 1  28 SER HB3  H -11.935   7.851   6.622 1.00 . A A .  28 SER HB3  1 1 
        2  3536 1 1  28 SER HG   H -11.456   9.502   5.137 1.00 . A A .  28 SER HG   1 1 
        2  3537 1 1  28 SER N    N  -9.321   7.807   8.089 1.00 . A A .  28 SER N    1 1 
        2  3538 1 1  28 SER O    O -11.511   9.147   9.166 1.00 . A A .  28 SER O    1 1 
        2  3539 1 1  28 SER OG   O -10.987   8.672   5.014 1.00 . A A .  28 SER OG   1 1 
        2  3540 1 1  29 GLN C    C -12.757  12.736   7.523 1.00 . A A .  29 GLN C    1 1 
        2  3541 1 1  29 GLN CA   C -12.043  11.777   8.469 1.00 . A A .  29 GLN CA   1 1 
        2  3542 1 1  29 GLN CB   C -11.208  12.566   9.479 1.00 . A A .  29 GLN CB   1 1 
        2  3543 1 1  29 GLN CD   C  -8.949  13.585   9.959 1.00 . A A .  29 GLN CD   1 1 
        2  3544 1 1  29 GLN CG   C  -9.932  13.146   8.893 1.00 . A A .  29 GLN CG   1 1 
        2  3545 1 1  29 GLN H    H -10.763  11.153   6.904 1.00 . A A .  29 GLN H    1 1 
        2  3546 1 1  29 GLN HA   H -12.782  11.197   9.002 1.00 . A A .  29 GLN HA   1 1 
        2  3547 1 1  29 GLN HB2  H -11.805  13.381   9.862 1.00 . A A .  29 GLN HB2  1 1 
        2  3548 1 1  29 GLN HB3  H -10.939  11.913  10.296 1.00 . A A .  29 GLN HB3  1 1 
        2  3549 1 1  29 GLN HE21 H -10.322  14.769  10.774 1.00 . A A .  29 GLN HE21 1 1 
        2  3550 1 1  29 GLN HE22 H  -8.780  14.763  11.552 1.00 . A A .  29 GLN HE22 1 1 
        2  3551 1 1  29 GLN HG2  H  -9.459  12.394   8.278 1.00 . A A .  29 GLN HG2  1 1 
        2  3552 1 1  29 GLN HG3  H -10.186  13.999   8.282 1.00 . A A .  29 GLN HG3  1 1 
        2  3553 1 1  29 GLN N    N -11.197  10.849   7.728 1.00 . A A .  29 GLN N    1 1 
        2  3554 1 1  29 GLN NE2  N  -9.396  14.461  10.852 1.00 . A A .  29 GLN NE2  1 1 
        2  3555 1 1  29 GLN O    O -12.122  13.523   6.822 1.00 . A A .  29 GLN O    1 1 
        2  3556 1 1  29 GLN OE1  O  -7.798  13.146   9.980 1.00 . A A .  29 GLN OE1  1 1 
        2  3557 1 1  30 TYR C    C -15.822  14.403   7.471 1.00 . A A .  30 TYR C    1 1 
        2  3558 1 1  30 TYR CA   C -14.887  13.525   6.645 1.00 . A A .  30 TYR CA   1 1 
        2  3559 1 1  30 TYR CB   C -15.698  12.682   5.659 1.00 . A A .  30 TYR CB   1 1 
        2  3560 1 1  30 TYR CD1  C -16.001  10.447   6.794 1.00 . A A .  30 TYR CD1  1 1 
        2  3561 1 1  30 TYR CD2  C -17.925  11.822   6.486 1.00 . A A .  30 TYR CD2  1 1 
        2  3562 1 1  30 TYR CE1  C -16.783   9.483   7.403 1.00 . A A .  30 TYR CE1  1 1 
        2  3563 1 1  30 TYR CE2  C -18.712  10.863   7.094 1.00 . A A .  30 TYR CE2  1 1 
        2  3564 1 1  30 TYR CG   C -16.558  11.631   6.325 1.00 . A A .  30 TYR CG   1 1 
        2  3565 1 1  30 TYR CZ   C -18.137   9.696   7.551 1.00 . A A .  30 TYR CZ   1 1 
        2  3566 1 1  30 TYR H    H -14.536  12.016   8.087 1.00 . A A .  30 TYR H    1 1 
        2  3567 1 1  30 TYR HA   H -14.212  14.159   6.091 1.00 . A A .  30 TYR HA   1 1 
        2  3568 1 1  30 TYR HB2  H -16.351  13.330   5.094 1.00 . A A .  30 TYR HB2  1 1 
        2  3569 1 1  30 TYR HB3  H -15.022  12.181   4.984 1.00 . A A .  30 TYR HB3  1 1 
        2  3570 1 1  30 TYR HD1  H -14.940  10.284   6.676 1.00 . A A .  30 TYR HD1  1 1 
        2  3571 1 1  30 TYR HD2  H -18.372  12.737   6.127 1.00 . A A .  30 TYR HD2  1 1 
        2  3572 1 1  30 TYR HE1  H -16.331   8.569   7.761 1.00 . A A .  30 TYR HE1  1 1 
        2  3573 1 1  30 TYR HE2  H -19.773  11.030   7.209 1.00 . A A .  30 TYR HE2  1 1 
        2  3574 1 1  30 TYR HH   H -18.592   8.574   9.044 1.00 . A A .  30 TYR HH   1 1 
        2  3575 1 1  30 TYR N    N -14.086  12.664   7.506 1.00 . A A .  30 TYR N    1 1 
        2  3576 1 1  30 TYR O    O -15.963  14.213   8.679 1.00 . A A .  30 TYR O    1 1 
        2  3577 1 1  30 TYR OH   O -18.919   8.739   8.156 1.00 . A A .  30 TYR OH   1 1 
        2  3578 1 1  31 HIS C    C -18.564  16.614   6.580 1.00 . A A .  31 HIS C    1 1 
        2  3579 1 1  31 HIS CA   C -17.381  16.272   7.482 1.00 . A A .  31 HIS CA   1 1 
        2  3580 1 1  31 HIS CB   C -16.656  17.554   7.900 1.00 . A A .  31 HIS CB   1 1 
        2  3581 1 1  31 HIS CD2  C -18.619  19.156   8.460 1.00 . A A .  31 HIS CD2  1 1 
        2  3582 1 1  31 HIS CE1  C -18.102  19.577  10.549 1.00 . A A .  31 HIS CE1  1 1 
        2  3583 1 1  31 HIS CG   C -17.491  18.465   8.747 1.00 . A A .  31 HIS CG   1 1 
        2  3584 1 1  31 HIS H    H -16.306  15.467   5.848 1.00 . A A .  31 HIS H    1 1 
        2  3585 1 1  31 HIS HA   H -17.751  15.775   8.366 1.00 . A A .  31 HIS HA   1 1 
        2  3586 1 1  31 HIS HB2  H -15.775  17.293   8.463 1.00 . A A .  31 HIS HB2  1 1 
        2  3587 1 1  31 HIS HB3  H -16.365  18.098   7.013 1.00 . A A .  31 HIS HB3  1 1 
        2  3588 1 1  31 HIS HD1  H -16.429  18.401  10.566 1.00 . A A .  31 HIS HD1  1 1 
        2  3589 1 1  31 HIS HD2  H -19.141  19.166   7.513 1.00 . A A .  31 HIS HD2  1 1 
        2  3590 1 1  31 HIS HE1  H -18.125  19.974  11.552 1.00 . A A .  31 HIS HE1  1 1 
        2  3591 1 1  31 HIS HE2  H -19.703  20.495   9.660 1.00 . A A .  31 HIS HE2  1 1 
        2  3592 1 1  31 HIS N    N -16.458  15.365   6.810 1.00 . A A .  31 HIS N    1 1 
        2  3593 1 1  31 HIS ND1  N -17.193  18.751  10.062 1.00 . A A .  31 HIS ND1  1 1 
        2  3594 1 1  31 HIS NE2  N -18.979  19.838   9.596 1.00 . A A .  31 HIS NE2  1 1 
        2  3595 1 1  31 HIS O    O -18.384  17.096   5.462 1.00 . A A .  31 HIS O    1 1 
        2  3596 1 1  32 ASP C    C -22.026  17.333   7.181 1.00 . A A .  32 ASP C    1 1 
        2  3597 1 1  32 ASP CA   C -20.983  16.639   6.311 1.00 . A A .  32 ASP CA   1 1 
        2  3598 1 1  32 ASP CB   C -21.559  15.343   5.738 1.00 . A A .  32 ASP CB   1 1 
        2  3599 1 1  32 ASP CG   C -22.754  15.590   4.839 1.00 . A A .  32 ASP CG   1 1 
        2  3600 1 1  32 ASP H    H -19.849  15.973   7.971 1.00 . A A .  32 ASP H    1 1 
        2  3601 1 1  32 ASP HA   H -20.717  17.294   5.495 1.00 . A A .  32 ASP HA   1 1 
        2  3602 1 1  32 ASP HB2  H -20.797  14.840   5.162 1.00 . A A .  32 ASP HB2  1 1 
        2  3603 1 1  32 ASP HB3  H -21.871  14.704   6.552 1.00 . A A .  32 ASP HB3  1 1 
        2  3604 1 1  32 ASP N    N -19.771  16.359   7.073 1.00 . A A .  32 ASP N    1 1 
        2  3605 1 1  32 ASP O    O -22.042  17.165   8.401 1.00 . A A .  32 ASP O    1 1 
        2  3606 1 1  32 ASP OD1  O -22.546  15.935   3.656 1.00 . A A .  32 ASP OD1  1 1 
        2  3607 1 1  32 ASP OD2  O -23.899  15.437   5.315 1.00 . A A .  32 ASP OD2  1 1 
        2  3608 1 1  33 THR C    C -25.317  18.235   6.957 1.00 . A A .  33 THR C    1 1 
        2  3609 1 1  33 THR CA   C -23.944  18.829   7.260 1.00 . A A .  33 THR CA   1 1 
        2  3610 1 1  33 THR CB   C -23.924  20.312   6.884 1.00 . A A .  33 THR CB   1 1 
        2  3611 1 1  33 THR CG2  C -23.913  20.550   5.389 1.00 . A A .  33 THR CG2  1 1 
        2  3612 1 1  33 THR H    H -22.832  18.204   5.571 1.00 . A A .  33 THR H    1 1 
        2  3613 1 1  33 THR HA   H -23.749  18.734   8.317 1.00 . A A .  33 THR HA   1 1 
        2  3614 1 1  33 THR HB   H -23.034  20.765   7.297 1.00 . A A .  33 THR HB   1 1 
        2  3615 1 1  33 THR HG1  H -24.983  21.014   8.374 1.00 . A A .  33 THR HG1  1 1 
        2  3616 1 1  33 THR HG21 H -23.906  21.612   5.194 1.00 . A A .  33 THR HG21 1 1 
        2  3617 1 1  33 THR HG22 H -24.795  20.109   4.948 1.00 . A A .  33 THR HG22 1 1 
        2  3618 1 1  33 THR HG23 H -23.032  20.100   4.959 1.00 . A A .  33 THR HG23 1 1 
        2  3619 1 1  33 THR N    N -22.896  18.111   6.546 1.00 . A A .  33 THR N    1 1 
        2  3620 1 1  33 THR O    O -26.224  18.289   7.788 1.00 . A A .  33 THR O    1 1 
        2  3621 1 1  33 THR OG1  O -25.053  20.981   7.418 1.00 . A A .  33 THR OG1  1 1 
        2  3622 1 1  34 GLY C    C -27.511  17.948   4.419 1.00 . A A .  34 GLY C    1 1 
        2  3623 1 1  34 GLY CA   C -26.725  17.070   5.374 1.00 . A A .  34 GLY CA   1 1 
        2  3624 1 1  34 GLY H    H -24.703  17.654   5.143 1.00 . A A .  34 GLY H    1 1 
        2  3625 1 1  34 GLY HA2  H -26.531  16.121   4.897 1.00 . A A .  34 GLY HA2  1 1 
        2  3626 1 1  34 GLY HA3  H -27.319  16.901   6.261 1.00 . A A .  34 GLY HA3  1 1 
        2  3627 1 1  34 GLY N    N -25.461  17.667   5.764 1.00 . A A .  34 GLY N    1 1 
        2  3628 1 1  34 GLY O    O -27.536  19.170   4.565 1.00 . A A .  34 GLY O    1 1 
        2  3629 1 1  35 PHE C    C -30.416  17.664   2.543 1.00 . A A .  35 PHE C    1 1 
        2  3630 1 1  35 PHE CA   C -28.943  18.052   2.454 1.00 . A A .  35 PHE CA   1 1 
        2  3631 1 1  35 PHE CB   C -28.417  17.780   1.044 1.00 . A A .  35 PHE CB   1 1 
        2  3632 1 1  35 PHE CD1  C -27.612  20.015   0.235 1.00 . A A .  35 PHE CD1  1 1 
        2  3633 1 1  35 PHE CD2  C -29.501  19.033  -0.840 1.00 . A A .  35 PHE CD2  1 1 
        2  3634 1 1  35 PHE CE1  C -27.697  21.108  -0.607 1.00 . A A .  35 PHE CE1  1 1 
        2  3635 1 1  35 PHE CE2  C -29.591  20.124  -1.684 1.00 . A A .  35 PHE CE2  1 1 
        2  3636 1 1  35 PHE CG   C -28.512  18.967   0.128 1.00 . A A .  35 PHE CG   1 1 
        2  3637 1 1  35 PHE CZ   C -28.688  21.162  -1.569 1.00 . A A .  35 PHE CZ   1 1 
        2  3638 1 1  35 PHE H    H -28.095  16.346   3.375 1.00 . A A .  35 PHE H    1 1 
        2  3639 1 1  35 PHE HA   H -28.849  19.106   2.668 1.00 . A A .  35 PHE HA   1 1 
        2  3640 1 1  35 PHE HB2  H -27.379  17.491   1.105 1.00 . A A .  35 PHE HB2  1 1 
        2  3641 1 1  35 PHE HB3  H -28.985  16.973   0.604 1.00 . A A .  35 PHE HB3  1 1 
        2  3642 1 1  35 PHE HD1  H -26.838  19.974   0.986 1.00 . A A .  35 PHE HD1  1 1 
        2  3643 1 1  35 PHE HD2  H -30.208  18.223  -0.931 1.00 . A A .  35 PHE HD2  1 1 
        2  3644 1 1  35 PHE HE1  H -26.990  21.919  -0.514 1.00 . A A .  35 PHE HE1  1 1 
        2  3645 1 1  35 PHE HE2  H -30.368  20.163  -2.435 1.00 . A A .  35 PHE HE2  1 1 
        2  3646 1 1  35 PHE HZ   H -28.757  22.015  -2.227 1.00 . A A .  35 PHE HZ   1 1 
        2  3647 1 1  35 PHE N    N -28.154  17.322   3.439 1.00 . A A .  35 PHE N    1 1 
        2  3648 1 1  35 PHE O    O -31.259  18.471   2.929 1.00 . A A .  35 PHE O    1 1 
        2  3649 1 1  36 TYR C    C -32.164  14.593   2.958 1.00 . A A .  36 TYR C    1 1 
        2  3650 1 1  36 TYR CA   C -32.088  15.924   2.217 1.00 . A A .  36 TYR CA   1 1 
        2  3651 1 1  36 TYR CB   C -32.632  15.764   0.795 1.00 . A A .  36 TYR CB   1 1 
        2  3652 1 1  36 TYR CD1  C -33.091  18.097  -0.055 1.00 . A A .  36 TYR CD1  1 1 
        2  3653 1 1  36 TYR CD2  C -34.953  16.686   0.421 1.00 . A A .  36 TYR CD2  1 1 
        2  3654 1 1  36 TYR CE1  C -33.949  19.109  -0.435 1.00 . A A .  36 TYR CE1  1 1 
        2  3655 1 1  36 TYR CE2  C -35.819  17.694   0.043 1.00 . A A .  36 TYR CE2  1 1 
        2  3656 1 1  36 TYR CG   C -33.576  16.868   0.381 1.00 . A A .  36 TYR CG   1 1 
        2  3657 1 1  36 TYR CZ   C -35.313  18.903  -0.385 1.00 . A A .  36 TYR CZ   1 1 
        2  3658 1 1  36 TYR H    H -30.001  15.823   1.879 1.00 . A A .  36 TYR H    1 1 
        2  3659 1 1  36 TYR HA   H -32.689  16.650   2.743 1.00 . A A .  36 TYR HA   1 1 
        2  3660 1 1  36 TYR HB2  H -31.806  15.756   0.101 1.00 . A A .  36 TYR HB2  1 1 
        2  3661 1 1  36 TYR HB3  H -33.165  14.826   0.724 1.00 . A A .  36 TYR HB3  1 1 
        2  3662 1 1  36 TYR HD1  H -32.023  18.255  -0.093 1.00 . A A .  36 TYR HD1  1 1 
        2  3663 1 1  36 TYR HD2  H -35.346  15.737   0.757 1.00 . A A .  36 TYR HD2  1 1 
        2  3664 1 1  36 TYR HE1  H -33.553  20.057  -0.769 1.00 . A A .  36 TYR HE1  1 1 
        2  3665 1 1  36 TYR HE2  H -36.886  17.532   0.082 1.00 . A A .  36 TYR HE2  1 1 
        2  3666 1 1  36 TYR HH   H -35.868  20.297  -1.587 1.00 . A A .  36 TYR HH   1 1 
        2  3667 1 1  36 TYR N    N -30.718  16.420   2.179 1.00 . A A .  36 TYR N    1 1 
        2  3668 1 1  36 TYR O    O -32.966  14.427   3.878 1.00 . A A .  36 TYR O    1 1 
        2  3669 1 1  36 TYR OH   O -36.171  19.909  -0.763 1.00 . A A .  36 TYR OH   1 1 
        2  3670 1 1  37 GLY C    C -30.673  12.375   4.564 1.00 . A A .  37 GLY C    1 1 
        2  3671 1 1  37 GLY CA   C -31.310  12.343   3.189 1.00 . A A .  37 GLY CA   1 1 
        2  3672 1 1  37 GLY H    H -30.705  13.837   1.816 1.00 . A A .  37 GLY H    1 1 
        2  3673 1 1  37 GLY HA2  H -32.326  11.991   3.284 1.00 . A A .  37 GLY HA2  1 1 
        2  3674 1 1  37 GLY HA3  H -30.759  11.655   2.565 1.00 . A A .  37 GLY HA3  1 1 
        2  3675 1 1  37 GLY N    N -31.322  13.647   2.553 1.00 . A A .  37 GLY N    1 1 
        2  3676 1 1  37 GLY O    O -29.500  12.720   4.704 1.00 . A A .  37 GLY O    1 1 
        2  3677 1 1  38 ASN C    C -30.028  10.811   7.187 1.00 . A A .  38 ASN C    1 1 
        2  3678 1 1  38 ASN CA   C -30.951  12.003   6.954 1.00 . A A .  38 ASN CA   1 1 
        2  3679 1 1  38 ASN CB   C -32.118  11.960   7.941 1.00 . A A .  38 ASN CB   1 1 
        2  3680 1 1  38 ASN CG   C -31.864  12.803   9.176 1.00 . A A .  38 ASN CG   1 1 
        2  3681 1 1  38 ASN H    H -32.373  11.747   5.408 1.00 . A A .  38 ASN H    1 1 
        2  3682 1 1  38 ASN HA   H -30.391  12.913   7.110 1.00 . A A .  38 ASN HA   1 1 
        2  3683 1 1  38 ASN HB2  H -33.008  12.331   7.453 1.00 . A A .  38 ASN HB2  1 1 
        2  3684 1 1  38 ASN HB3  H -32.283  10.939   8.252 1.00 . A A .  38 ASN HB3  1 1 
        2  3685 1 1  38 ASN HD21 H -30.067  11.981   9.395 1.00 . A A .  38 ASN HD21 1 1 
        2  3686 1 1  38 ASN HD22 H -30.500  13.164  10.578 1.00 . A A .  38 ASN HD22 1 1 
        2  3687 1 1  38 ASN N    N -31.447  12.014   5.582 1.00 . A A .  38 ASN N    1 1 
        2  3688 1 1  38 ASN ND2  N -30.692  12.633   9.777 1.00 . A A .  38 ASN ND2  1 1 
        2  3689 1 1  38 ASN O    O -29.036  10.913   7.910 1.00 . A A .  38 ASN O    1 1 
        2  3690 1 1  38 ASN OD1  O -32.709  13.599   9.584 1.00 . A A .  38 ASN OD1  1 1 
        2  3691 1 1  39 GLY C    C -29.330   7.764   5.413 1.00 . A A .  39 GLY C    1 1 
        2  3692 1 1  39 GLY CA   C -29.552   8.487   6.727 1.00 . A A .  39 GLY CA   1 1 
        2  3693 1 1  39 GLY H    H -31.163   9.659   6.009 1.00 . A A .  39 GLY H    1 1 
        2  3694 1 1  39 GLY HA2  H -28.594   8.766   7.140 1.00 . A A .  39 GLY HA2  1 1 
        2  3695 1 1  39 GLY HA3  H -30.048   7.816   7.414 1.00 . A A .  39 GLY HA3  1 1 
        2  3696 1 1  39 GLY N    N -30.361   9.681   6.573 1.00 . A A .  39 GLY N    1 1 
        2  3697 1 1  39 GLY O    O -29.644   8.292   4.345 1.00 . A A .  39 GLY O    1 1 
        2  3698 1 1  40 PHE C    C -29.480   4.578   4.206 1.00 . A A .  40 PHE C    1 1 
        2  3699 1 1  40 PHE CA   C -28.519   5.759   4.296 1.00 . A A .  40 PHE CA   1 1 
        2  3700 1 1  40 PHE CB   C -27.074   5.257   4.305 1.00 . A A .  40 PHE CB   1 1 
        2  3701 1 1  40 PHE CD1  C -26.016   7.152   3.047 1.00 . A A .  40 PHE CD1  1 1 
        2  3702 1 1  40 PHE CD2  C -25.144   6.590   5.193 1.00 . A A .  40 PHE CD2  1 1 
        2  3703 1 1  40 PHE CE1  C -25.081   8.163   2.927 1.00 . A A .  40 PHE CE1  1 1 
        2  3704 1 1  40 PHE CE2  C -24.207   7.598   5.082 1.00 . A A .  40 PHE CE2  1 1 
        2  3705 1 1  40 PHE CG   C -26.058   6.355   4.180 1.00 . A A .  40 PHE CG   1 1 
        2  3706 1 1  40 PHE CZ   C -24.175   8.386   3.947 1.00 . A A .  40 PHE CZ   1 1 
        2  3707 1 1  40 PHE H    H -28.556   6.188   6.369 1.00 . A A .  40 PHE H    1 1 
        2  3708 1 1  40 PHE HA   H -28.666   6.393   3.436 1.00 . A A .  40 PHE HA   1 1 
        2  3709 1 1  40 PHE HB2  H -26.888   4.735   5.230 1.00 . A A .  40 PHE HB2  1 1 
        2  3710 1 1  40 PHE HB3  H -26.934   4.575   3.479 1.00 . A A .  40 PHE HB3  1 1 
        2  3711 1 1  40 PHE HD1  H -26.723   6.977   2.249 1.00 . A A .  40 PHE HD1  1 1 
        2  3712 1 1  40 PHE HD2  H -25.167   5.974   6.080 1.00 . A A .  40 PHE HD2  1 1 
        2  3713 1 1  40 PHE HE1  H -25.059   8.778   2.040 1.00 . A A .  40 PHE HE1  1 1 
        2  3714 1 1  40 PHE HE2  H -23.500   7.773   5.880 1.00 . A A .  40 PHE HE2  1 1 
        2  3715 1 1  40 PHE HZ   H -23.444   9.177   3.856 1.00 . A A .  40 PHE HZ   1 1 
        2  3716 1 1  40 PHE N    N -28.785   6.555   5.490 1.00 . A A .  40 PHE N    1 1 
        2  3717 1 1  40 PHE O    O -30.213   4.287   5.151 1.00 . A A .  40 PHE O    1 1 
        2  3718 1 1  41 GLN C    C -30.025   1.636   3.843 1.00 . A A .  41 GLN C    1 1 
        2  3719 1 1  41 GLN CA   C -30.340   2.750   2.848 1.00 . A A .  41 GLN CA   1 1 
        2  3720 1 1  41 GLN CB   C -30.191   2.232   1.415 1.00 . A A .  41 GLN CB   1 1 
        2  3721 1 1  41 GLN CD   C -31.743   3.893   0.316 1.00 . A A .  41 GLN CD   1 1 
        2  3722 1 1  41 GLN CG   C -31.435   2.431   0.566 1.00 . A A .  41 GLN CG   1 1 
        2  3723 1 1  41 GLN H    H -28.863   4.180   2.346 1.00 . A A .  41 GLN H    1 1 
        2  3724 1 1  41 GLN HA   H -31.359   3.073   3.001 1.00 . A A .  41 GLN HA   1 1 
        2  3725 1 1  41 GLN HB2  H -29.372   2.751   0.941 1.00 . A A .  41 GLN HB2  1 1 
        2  3726 1 1  41 GLN HB3  H -29.968   1.175   1.445 1.00 . A A .  41 GLN HB3  1 1 
        2  3727 1 1  41 GLN HE21 H -31.242   3.698  -1.599 1.00 . A A .  41 GLN HE21 1 1 
        2  3728 1 1  41 GLN HE22 H -31.753   5.276  -1.114 1.00 . A A .  41 GLN HE22 1 1 
        2  3729 1 1  41 GLN HG2  H -31.288   1.942  -0.387 1.00 . A A .  41 GLN HG2  1 1 
        2  3730 1 1  41 GLN HG3  H -32.277   1.983   1.073 1.00 . A A .  41 GLN HG3  1 1 
        2  3731 1 1  41 GLN N    N -29.470   3.900   3.063 1.00 . A A .  41 GLN N    1 1 
        2  3732 1 1  41 GLN NE2  N -31.561   4.333  -0.924 1.00 . A A .  41 GLN NE2  1 1 
        2  3733 1 1  41 GLN O    O -30.919   1.107   4.503 1.00 . A A .  41 GLN O    1 1 
        2  3734 1 1  41 GLN OE1  O -32.141   4.621   1.225 1.00 . A A .  41 GLN OE1  1 1 
        2  3735 1 1  42 ASN C    C -27.912   0.821   6.210 1.00 . A A .  42 ASN C    1 1 
        2  3736 1 1  42 ASN CA   C -28.312   0.236   4.859 1.00 . A A .  42 ASN CA   1 1 
        2  3737 1 1  42 ASN CB   C -27.140  -0.539   4.257 1.00 . A A .  42 ASN CB   1 1 
        2  3738 1 1  42 ASN CG   C -27.206  -2.021   4.571 1.00 . A A .  42 ASN CG   1 1 
        2  3739 1 1  42 ASN H    H -28.080   1.745   3.393 1.00 . A A .  42 ASN H    1 1 
        2  3740 1 1  42 ASN HA   H -29.141  -0.439   5.004 1.00 . A A .  42 ASN HA   1 1 
        2  3741 1 1  42 ASN HB2  H -27.147  -0.417   3.186 1.00 . A A .  42 ASN HB2  1 1 
        2  3742 1 1  42 ASN HB3  H -26.215  -0.146   4.655 1.00 . A A .  42 ASN HB3  1 1 
        2  3743 1 1  42 ASN HD21 H -29.026  -2.134   3.778 1.00 . A A .  42 ASN HD21 1 1 
        2  3744 1 1  42 ASN HD22 H -28.389  -3.611   4.407 1.00 . A A .  42 ASN HD22 1 1 
        2  3745 1 1  42 ASN N    N -28.747   1.286   3.946 1.00 . A A .  42 ASN N    1 1 
        2  3746 1 1  42 ASN ND2  N -28.319  -2.652   4.216 1.00 . A A .  42 ASN ND2  1 1 
        2  3747 1 1  42 ASN O    O -27.341   1.909   6.281 1.00 . A A .  42 ASN O    1 1 
        2  3748 1 1  42 ASN OD1  O -26.267  -2.592   5.125 1.00 . A A .  42 ASN OD1  1 1 
        2  3749 1 1  43 ASN C    C -26.378   0.721   8.786 1.00 . A A .  43 ASN C    1 1 
        2  3750 1 1  43 ASN CA   C -27.884   0.535   8.627 1.00 . A A .  43 ASN CA   1 1 
        2  3751 1 1  43 ASN CB   C -28.398  -0.470   9.659 1.00 . A A .  43 ASN CB   1 1 
        2  3752 1 1  43 ASN CG   C -29.778  -0.113  10.177 1.00 . A A .  43 ASN CG   1 1 
        2  3753 1 1  43 ASN H    H -28.668  -0.769   7.157 1.00 . A A .  43 ASN H    1 1 
        2  3754 1 1  43 ASN HA   H -28.371   1.486   8.790 1.00 . A A .  43 ASN HA   1 1 
        2  3755 1 1  43 ASN HB2  H -28.447  -1.448   9.205 1.00 . A A .  43 ASN HB2  1 1 
        2  3756 1 1  43 ASN HB3  H -27.715  -0.500  10.495 1.00 . A A .  43 ASN HB3  1 1 
        2  3757 1 1  43 ASN HD21 H -29.089  -0.059  12.041 1.00 . A A .  43 ASN HD21 1 1 
        2  3758 1 1  43 ASN HD22 H -30.772   0.286  11.851 1.00 . A A .  43 ASN HD22 1 1 
        2  3759 1 1  43 ASN N    N -28.214   0.090   7.277 1.00 . A A .  43 ASN N    1 1 
        2  3760 1 1  43 ASN ND2  N -29.891   0.054  11.489 1.00 . A A .  43 ASN ND2  1 1 
        2  3761 1 1  43 ASN O    O -25.646  -0.240   9.014 1.00 . A A .  43 ASN O    1 1 
        2  3762 1 1  43 ASN OD1  O -30.730   0.011   9.406 1.00 . A A .  43 ASN OD1  1 1 
        2  3763 1 1  44 ASN C    C -24.284   3.421   9.771 1.00 . A A .  44 ASN C    1 1 
        2  3764 1 1  44 ASN CA   C -24.504   2.275   8.789 1.00 . A A .  44 ASN CA   1 1 
        2  3765 1 1  44 ASN CB   C -23.915   2.637   7.425 1.00 . A A .  44 ASN CB   1 1 
        2  3766 1 1  44 ASN CG   C -24.286   1.634   6.351 1.00 . A A .  44 ASN CG   1 1 
        2  3767 1 1  44 ASN H    H -26.557   2.689   8.478 1.00 . A A .  44 ASN H    1 1 
        2  3768 1 1  44 ASN HA   H -24.006   1.395   9.165 1.00 . A A .  44 ASN HA   1 1 
        2  3769 1 1  44 ASN HB2  H -24.283   3.608   7.127 1.00 . A A .  44 ASN HB2  1 1 
        2  3770 1 1  44 ASN HB3  H -22.839   2.673   7.503 1.00 . A A .  44 ASN HB3  1 1 
        2  3771 1 1  44 ASN HD21 H -24.557   3.103   5.038 1.00 . A A .  44 ASN HD21 1 1 
        2  3772 1 1  44 ASN HD22 H -24.832   1.504   4.444 1.00 . A A .  44 ASN HD22 1 1 
        2  3773 1 1  44 ASN N    N -25.924   1.964   8.661 1.00 . A A .  44 ASN N    1 1 
        2  3774 1 1  44 ASN ND2  N -24.589   2.130   5.157 1.00 . A A .  44 ASN ND2  1 1 
        2  3775 1 1  44 ASN O    O -24.562   4.579   9.461 1.00 . A A .  44 ASN O    1 1 
        2  3776 1 1  44 ASN OD1  O -24.298   0.427   6.591 1.00 . A A .  44 ASN OD1  1 1 
        2  3777 1 1  45 GLY C    C -22.490   3.671  12.976 1.00 . A A .  45 GLY C    1 1 
        2  3778 1 1  45 GLY CA   C -23.536   4.103  11.965 1.00 . A A .  45 GLY CA   1 1 
        2  3779 1 1  45 GLY H    H -23.583   2.150  11.148 1.00 . A A .  45 GLY H    1 1 
        2  3780 1 1  45 GLY HA2  H -23.200   5.004  11.476 1.00 . A A .  45 GLY HA2  1 1 
        2  3781 1 1  45 GLY HA3  H -24.459   4.311  12.485 1.00 . A A .  45 GLY HA3  1 1 
        2  3782 1 1  45 GLY N    N -23.785   3.090  10.958 1.00 . A A .  45 GLY N    1 1 
        2  3783 1 1  45 GLY O    O -22.492   2.521  13.418 1.00 . A A .  45 GLY O    1 1 
        2  3784 1 1  46 PRO C    C -21.053   4.175  15.764 1.00 . A A .  46 PRO C    1 1 
        2  3785 1 1  46 PRO CA   C -20.520   4.258  14.338 1.00 . A A .  46 PRO CA   1 1 
        2  3786 1 1  46 PRO CB   C -19.551   5.430  14.195 1.00 . A A .  46 PRO CB   1 1 
        2  3787 1 1  46 PRO CD   C -21.488   5.970  12.896 1.00 . A A .  46 PRO CD   1 1 
        2  3788 1 1  46 PRO CG   C -20.403   6.568  13.750 1.00 . A A .  46 PRO CG   1 1 
        2  3789 1 1  46 PRO HA   H -20.015   3.336  14.088 1.00 . A A .  46 PRO HA   1 1 
        2  3790 1 1  46 PRO HB2  H -19.084   5.633  15.149 1.00 . A A .  46 PRO HB2  1 1 
        2  3791 1 1  46 PRO HB3  H -18.797   5.191  13.460 1.00 . A A .  46 PRO HB3  1 1 
        2  3792 1 1  46 PRO HD2  H -22.423   6.488  13.058 1.00 . A A .  46 PRO HD2  1 1 
        2  3793 1 1  46 PRO HD3  H -21.211   6.008  11.853 1.00 . A A .  46 PRO HD3  1 1 
        2  3794 1 1  46 PRO HG2  H -20.831   7.062  14.609 1.00 . A A .  46 PRO HG2  1 1 
        2  3795 1 1  46 PRO HG3  H -19.812   7.264  13.172 1.00 . A A .  46 PRO HG3  1 1 
        2  3796 1 1  46 PRO N    N -21.572   4.573  13.369 1.00 . A A .  46 PRO N    1 1 
        2  3797 1 1  46 PRO O    O -22.260   4.253  15.993 1.00 . A A .  46 PRO O    1 1 
        2  3798 1 1  47 THR C    C -19.474   4.587  19.015 1.00 . A A .  47 THR C    1 1 
        2  3799 1 1  47 THR CA   C -20.521   3.924  18.127 1.00 . A A .  47 THR CA   1 1 
        2  3800 1 1  47 THR CB   C -20.698   2.460  18.534 1.00 . A A .  47 THR CB   1 1 
        2  3801 1 1  47 THR CG2  C -22.022   1.873  18.096 1.00 . A A .  47 THR CG2  1 1 
        2  3802 1 1  47 THR H    H -19.196   3.961  16.476 1.00 . A A .  47 THR H    1 1 
        2  3803 1 1  47 THR HA   H -21.460   4.440  18.252 1.00 . A A .  47 THR HA   1 1 
        2  3804 1 1  47 THR HB   H -20.644   2.387  19.610 1.00 . A A .  47 THR HB   1 1 
        2  3805 1 1  47 THR HG1  H -19.691   1.721  17.024 1.00 . A A .  47 THR HG1  1 1 
        2  3806 1 1  47 THR HG21 H -22.565   2.603  17.514 1.00 . A A .  47 THR HG21 1 1 
        2  3807 1 1  47 THR HG22 H -22.603   1.604  18.966 1.00 . A A .  47 THR HG22 1 1 
        2  3808 1 1  47 THR HG23 H -21.846   0.993  17.495 1.00 . A A .  47 THR HG23 1 1 
        2  3809 1 1  47 THR N    N -20.144   4.017  16.721 1.00 . A A .  47 THR N    1 1 
        2  3810 1 1  47 THR O    O -19.699   5.670  19.557 1.00 . A A .  47 THR O    1 1 
        2  3811 1 1  47 THR OG1  O -19.668   1.657  17.982 1.00 . A A .  47 THR OG1  1 1 
        2  3812 1 1  48 ARG C    C -15.885   4.038  19.424 1.00 . A A .  48 ARG C    1 1 
        2  3813 1 1  48 ARG CA   C -17.243   4.457  19.981 1.00 . A A .  48 ARG CA   1 1 
        2  3814 1 1  48 ARG CB   C -17.392   3.972  21.427 1.00 . A A .  48 ARG CB   1 1 
        2  3815 1 1  48 ARG CD   C -16.856   6.167  22.528 1.00 . A A .  48 ARG CD   1 1 
        2  3816 1 1  48 ARG CG   C -17.879   5.051  22.381 1.00 . A A .  48 ARG CG   1 1 
        2  3817 1 1  48 ARG CZ   C -17.358   7.199  24.709 1.00 . A A .  48 ARG CZ   1 1 
        2  3818 1 1  48 ARG H    H -18.206   3.074  18.702 1.00 . A A .  48 ARG H    1 1 
        2  3819 1 1  48 ARG HA   H -17.308   5.535  19.964 1.00 . A A .  48 ARG HA   1 1 
        2  3820 1 1  48 ARG HB2  H -18.099   3.157  21.449 1.00 . A A .  48 ARG HB2  1 1 
        2  3821 1 1  48 ARG HB3  H -16.435   3.617  21.778 1.00 . A A .  48 ARG HB3  1 1 
        2  3822 1 1  48 ARG HD2  H -15.957   5.758  22.965 1.00 . A A .  48 ARG HD2  1 1 
        2  3823 1 1  48 ARG HD3  H -16.632   6.563  21.549 1.00 . A A .  48 ARG HD3  1 1 
        2  3824 1 1  48 ARG HE   H -17.683   8.055  22.935 1.00 . A A .  48 ARG HE   1 1 
        2  3825 1 1  48 ARG HG2  H -18.798   5.468  21.999 1.00 . A A .  48 ARG HG2  1 1 
        2  3826 1 1  48 ARG HG3  H -18.056   4.606  23.350 1.00 . A A .  48 ARG HG3  1 1 
        2  3827 1 1  48 ARG HH11 H -16.559   5.344  24.825 1.00 . A A .  48 ARG HH11 1 1 
        2  3828 1 1  48 ARG HH12 H -16.923   6.092  26.343 1.00 . A A .  48 ARG HH12 1 1 
        2  3829 1 1  48 ARG HH21 H -18.160   9.041  24.931 1.00 . A A .  48 ARG HH21 1 1 
        2  3830 1 1  48 ARG HH22 H -17.831   8.191  26.405 1.00 . A A .  48 ARG HH22 1 1 
        2  3831 1 1  48 ARG N    N -18.326   3.931  19.161 1.00 . A A .  48 ARG N    1 1 
        2  3832 1 1  48 ARG NE   N -17.346   7.249  23.379 1.00 . A A .  48 ARG NE   1 1 
        2  3833 1 1  48 ARG NH1  N -16.910   6.123  25.345 1.00 . A A .  48 ARG NH1  1 1 
        2  3834 1 1  48 ARG NH2  N -17.821   8.228  25.406 1.00 . A A .  48 ARG NH2  1 1 
        2  3835 1 1  48 ARG O    O -14.919   3.880  20.170 1.00 . A A .  48 ARG O    1 1 
        2  3836 1 1  49 ASN C    C -14.140   4.510  16.435 1.00 . A A .  49 ASN C    1 1 
        2  3837 1 1  49 ASN CA   C -14.581   3.462  17.451 1.00 . A A .  49 ASN CA   1 1 
        2  3838 1 1  49 ASN CB   C -14.761   2.109  16.758 1.00 . A A .  49 ASN CB   1 1 
        2  3839 1 1  49 ASN CG   C -16.008   2.062  15.896 1.00 . A A .  49 ASN CG   1 1 
        2  3840 1 1  49 ASN H    H -16.624   4.003  17.566 1.00 . A A .  49 ASN H    1 1 
        2  3841 1 1  49 ASN HA   H -13.819   3.368  18.208 1.00 . A A .  49 ASN HA   1 1 
        2  3842 1 1  49 ASN HB2  H -13.905   1.917  16.129 1.00 . A A .  49 ASN HB2  1 1 
        2  3843 1 1  49 ASN HB3  H -14.834   1.335  17.507 1.00 . A A .  49 ASN HB3  1 1 
        2  3844 1 1  49 ASN HD21 H -16.882   0.823  17.183 1.00 . A A .  49 ASN HD21 1 1 
        2  3845 1 1  49 ASN HD22 H -17.822   1.256  15.800 1.00 . A A .  49 ASN HD22 1 1 
        2  3846 1 1  49 ASN N    N -15.821   3.860  18.108 1.00 . A A .  49 ASN N    1 1 
        2  3847 1 1  49 ASN ND2  N -17.005   1.303  16.337 1.00 . A A .  49 ASN ND2  1 1 
        2  3848 1 1  49 ASN O    O -14.929   5.360  16.024 1.00 . A A .  49 ASN O    1 1 
        2  3849 1 1  49 ASN OD1  O -16.074   2.700  14.844 1.00 . A A .  49 ASN OD1  1 1 
        2  3850 1 1  50 ASP C    C -12.310   4.782  13.668 1.00 . A A .  50 ASP C    1 1 
        2  3851 1 1  50 ASP CA   C -12.328   5.387  15.068 1.00 . A A .  50 ASP CA   1 1 
        2  3852 1 1  50 ASP CB   C -10.913   5.804  15.474 1.00 . A A .  50 ASP CB   1 1 
        2  3853 1 1  50 ASP CG   C -10.893   6.607  16.759 1.00 . A A .  50 ASP CG   1 1 
        2  3854 1 1  50 ASP H    H -12.295   3.742  16.400 1.00 . A A .  50 ASP H    1 1 
        2  3855 1 1  50 ASP HA   H -12.963   6.261  15.061 1.00 . A A .  50 ASP HA   1 1 
        2  3856 1 1  50 ASP HB2  H -10.311   4.919  15.616 1.00 . A A .  50 ASP HB2  1 1 
        2  3857 1 1  50 ASP HB3  H -10.482   6.407  14.687 1.00 . A A .  50 ASP HB3  1 1 
        2  3858 1 1  50 ASP N    N -12.874   4.444  16.036 1.00 . A A .  50 ASP N    1 1 
        2  3859 1 1  50 ASP O    O -12.666   3.618  13.480 1.00 . A A .  50 ASP O    1 1 
        2  3860 1 1  50 ASP OD1  O -10.835   5.990  17.844 1.00 . A A .  50 ASP OD1  1 1 
        2  3861 1 1  50 ASP OD2  O -10.937   7.853  16.682 1.00 . A A .  50 ASP OD2  1 1 
        2  3862 1 1  51 GLN C    C -10.385   4.880  10.881 1.00 . A A .  51 GLN C    1 1 
        2  3863 1 1  51 GLN CA   C -11.829   5.118  11.307 1.00 . A A .  51 GLN CA   1 1 
        2  3864 1 1  51 GLN CB   C -12.486   6.139  10.377 1.00 . A A .  51 GLN CB   1 1 
        2  3865 1 1  51 GLN CD   C -14.418   5.180   9.063 1.00 . A A .  51 GLN CD   1 1 
        2  3866 1 1  51 GLN CG   C -12.947   5.549   9.055 1.00 . A A .  51 GLN CG   1 1 
        2  3867 1 1  51 GLN H    H -11.622   6.494  12.901 1.00 . A A .  51 GLN H    1 1 
        2  3868 1 1  51 GLN HA   H -12.370   4.186  11.242 1.00 . A A .  51 GLN HA   1 1 
        2  3869 1 1  51 GLN HB2  H -13.345   6.564  10.875 1.00 . A A .  51 GLN HB2  1 1 
        2  3870 1 1  51 GLN HB3  H -11.777   6.927  10.167 1.00 . A A .  51 GLN HB3  1 1 
        2  3871 1 1  51 GLN HE21 H -14.784   6.508   7.629 1.00 . A A .  51 GLN HE21 1 1 
        2  3872 1 1  51 GLN HE22 H -16.152   5.615   8.192 1.00 . A A .  51 GLN HE22 1 1 
        2  3873 1 1  51 GLN HG2  H -12.779   6.274   8.272 1.00 . A A .  51 GLN HG2  1 1 
        2  3874 1 1  51 GLN HG3  H -12.369   4.659   8.852 1.00 . A A .  51 GLN HG3  1 1 
        2  3875 1 1  51 GLN N    N -11.893   5.577  12.689 1.00 . A A .  51 GLN N    1 1 
        2  3876 1 1  51 GLN NE2  N -15.198   5.834   8.209 1.00 . A A .  51 GLN NE2  1 1 
        2  3877 1 1  51 GLN O    O  -9.753   5.748  10.278 1.00 . A A .  51 GLN O    1 1 
        2  3878 1 1  51 GLN OE1  O -14.849   4.317   9.827 1.00 . A A .  51 GLN OE1  1 1 
        2  3879 1 1  52 LEU C    C  -8.454   2.024  10.082 1.00 . A A .  52 LEU C    1 1 
        2  3880 1 1  52 LEU CA   C  -8.496   3.344  10.845 1.00 . A A .  52 LEU CA   1 1 
        2  3881 1 1  52 LEU CB   C  -7.635   3.244  12.106 1.00 . A A .  52 LEU CB   1 1 
        2  3882 1 1  52 LEU CD1  C  -7.340   1.406  13.790 1.00 . A A .  52 LEU CD1  1 1 
        2  3883 1 1  52 LEU CD2  C  -8.655   3.447  14.390 1.00 . A A .  52 LEU CD2  1 1 
        2  3884 1 1  52 LEU CG   C  -8.276   2.487  13.272 1.00 . A A .  52 LEU CG   1 1 
        2  3885 1 1  52 LEU H    H -10.420   3.046  11.677 1.00 . A A .  52 LEU H    1 1 
        2  3886 1 1  52 LEU HA   H  -8.104   4.125  10.213 1.00 . A A .  52 LEU HA   1 1 
        2  3887 1 1  52 LEU HB2  H  -6.709   2.750  11.845 1.00 . A A .  52 LEU HB2  1 1 
        2  3888 1 1  52 LEU HB3  H  -7.405   4.246  12.438 1.00 . A A .  52 LEU HB3  1 1 
        2  3889 1 1  52 LEU HD11 H  -7.470   1.299  14.857 1.00 . A A .  52 LEU HD11 1 1 
        2  3890 1 1  52 LEU HD12 H  -6.317   1.685  13.579 1.00 . A A .  52 LEU HD12 1 1 
        2  3891 1 1  52 LEU HD13 H  -7.566   0.469  13.304 1.00 . A A .  52 LEU HD13 1 1 
        2  3892 1 1  52 LEU HD21 H  -9.332   4.198  14.007 1.00 . A A .  52 LEU HD21 1 1 
        2  3893 1 1  52 LEU HD22 H  -7.764   3.926  14.771 1.00 . A A .  52 LEU HD22 1 1 
        2  3894 1 1  52 LEU HD23 H  -9.138   2.900  15.186 1.00 . A A .  52 LEU HD23 1 1 
        2  3895 1 1  52 LEU HG   H  -9.179   2.006  12.925 1.00 . A A .  52 LEU HG   1 1 
        2  3896 1 1  52 LEU N    N  -9.868   3.697  11.196 1.00 . A A .  52 LEU N    1 1 
        2  3897 1 1  52 LEU O    O  -9.238   1.114  10.349 1.00 . A A .  52 LEU O    1 1 
        2  3898 1 1  53 GLY C    C  -6.004   0.532   7.785 1.00 . A A .  53 GLY C    1 1 
        2  3899 1 1  53 GLY CA   C  -7.402   0.715   8.342 1.00 . A A .  53 GLY CA   1 1 
        2  3900 1 1  53 GLY H    H  -6.932   2.685   8.962 1.00 . A A .  53 GLY H    1 1 
        2  3901 1 1  53 GLY HA2  H  -7.643  -0.133   8.966 1.00 . A A .  53 GLY HA2  1 1 
        2  3902 1 1  53 GLY HA3  H  -8.101   0.757   7.521 1.00 . A A .  53 GLY HA3  1 1 
        2  3903 1 1  53 GLY N    N  -7.531   1.928   9.129 1.00 . A A .  53 GLY N    1 1 
        2  3904 1 1  53 GLY O    O  -5.240   1.493   7.675 1.00 . A A .  53 GLY O    1 1 
        2  3905 1 1  54 ALA C    C  -4.467  -1.524   5.452 1.00 . A A .  54 ALA C    1 1 
        2  3906 1 1  54 ALA CA   C  -4.353  -1.013   6.882 1.00 . A A .  54 ALA CA   1 1 
        2  3907 1 1  54 ALA CB   C  -3.640  -2.035   7.757 1.00 . A A .  54 ALA CB   1 1 
        2  3908 1 1  54 ALA H    H  -6.321  -1.430   7.542 1.00 . A A .  54 ALA H    1 1 
        2  3909 1 1  54 ALA HA   H  -3.770  -0.103   6.883 1.00 . A A .  54 ALA HA   1 1 
        2  3910 1 1  54 ALA HB1  H  -2.634  -1.700   7.955 1.00 . A A .  54 ALA HB1  1 1 
        2  3911 1 1  54 ALA HB2  H  -3.610  -2.987   7.248 1.00 . A A .  54 ALA HB2  1 1 
        2  3912 1 1  54 ALA HB3  H  -4.174  -2.143   8.690 1.00 . A A .  54 ALA HB3  1 1 
        2  3913 1 1  54 ALA N    N  -5.668  -0.706   7.432 1.00 . A A .  54 ALA N    1 1 
        2  3914 1 1  54 ALA O    O  -5.536  -1.960   5.022 1.00 . A A .  54 ALA O    1 1 
        2  3915 1 1  55 GLY C    C  -1.975  -2.161   2.795 1.00 . A A .  55 GLY C    1 1 
        2  3916 1 1  55 GLY CA   C  -3.370  -1.933   3.342 1.00 . A A .  55 GLY CA   1 1 
        2  3917 1 1  55 GLY H    H  -2.539  -1.112   5.109 1.00 . A A .  55 GLY H    1 1 
        2  3918 1 1  55 GLY HA2  H  -3.920  -2.861   3.293 1.00 . A A .  55 GLY HA2  1 1 
        2  3919 1 1  55 GLY HA3  H  -3.869  -1.198   2.729 1.00 . A A .  55 GLY HA3  1 1 
        2  3920 1 1  55 GLY N    N  -3.363  -1.470   4.716 1.00 . A A .  55 GLY N    1 1 
        2  3921 1 1  55 GLY O    O  -1.035  -1.454   3.155 1.00 . A A .  55 GLY O    1 1 
        2  3922 1 1  56 ALA C    C  -0.415  -2.812  -0.048 1.00 . A A .  56 ALA C    1 1 
        2  3923 1 1  56 ALA CA   C  -0.558  -3.476   1.317 1.00 . A A .  56 ALA CA   1 1 
        2  3924 1 1  56 ALA CB   C  -0.396  -4.984   1.197 1.00 . A A .  56 ALA CB   1 1 
        2  3925 1 1  56 ALA H    H  -2.634  -3.679   1.673 1.00 . A A .  56 ALA H    1 1 
        2  3926 1 1  56 ALA HA   H   0.218  -3.104   1.971 1.00 . A A .  56 ALA HA   1 1 
        2  3927 1 1  56 ALA HB1  H  -0.166  -5.242   0.173 1.00 . A A .  56 ALA HB1  1 1 
        2  3928 1 1  56 ALA HB2  H  -1.313  -5.470   1.493 1.00 . A A .  56 ALA HB2  1 1 
        2  3929 1 1  56 ALA HB3  H   0.409  -5.311   1.841 1.00 . A A .  56 ALA HB3  1 1 
        2  3930 1 1  56 ALA N    N  -1.845  -3.153   1.920 1.00 . A A .  56 ALA N    1 1 
        2  3931 1 1  56 ALA O    O  -1.405  -2.411  -0.659 1.00 . A A .  56 ALA O    1 1 
        2  3932 1 1  57 PHE C    C   2.357  -2.653  -2.439 1.00 . A A .  57 PHE C    1 1 
        2  3933 1 1  57 PHE CA   C   1.089  -2.081  -1.813 1.00 . A A .  57 PHE CA   1 1 
        2  3934 1 1  57 PHE CB   C   1.219  -0.565  -1.661 1.00 . A A .  57 PHE CB   1 1 
        2  3935 1 1  57 PHE CD1  C   3.641  -0.224  -1.101 1.00 . A A .  57 PHE CD1  1 1 
        2  3936 1 1  57 PHE CD2  C   2.009   0.320   0.550 1.00 . A A .  57 PHE CD2  1 1 
        2  3937 1 1  57 PHE CE1  C   4.649   0.158  -0.236 1.00 . A A .  57 PHE CE1  1 1 
        2  3938 1 1  57 PHE CE2  C   3.012   0.704   1.421 1.00 . A A .  57 PHE CE2  1 1 
        2  3939 1 1  57 PHE CG   C   2.312  -0.148  -0.718 1.00 . A A .  57 PHE CG   1 1 
        2  3940 1 1  57 PHE CZ   C   4.333   0.622   1.026 1.00 . A A .  57 PHE CZ   1 1 
        2  3941 1 1  57 PHE H    H   1.571  -3.036   0.014 1.00 . A A .  57 PHE H    1 1 
        2  3942 1 1  57 PHE HA   H   0.254  -2.297  -2.462 1.00 . A A .  57 PHE HA   1 1 
        2  3943 1 1  57 PHE HB2  H   1.431  -0.130  -2.627 1.00 . A A .  57 PHE HB2  1 1 
        2  3944 1 1  57 PHE HB3  H   0.287  -0.166  -1.288 1.00 . A A .  57 PHE HB3  1 1 
        2  3945 1 1  57 PHE HD1  H   3.888  -0.588  -2.087 1.00 . A A .  57 PHE HD1  1 1 
        2  3946 1 1  57 PHE HD2  H   0.976   0.383   0.859 1.00 . A A .  57 PHE HD2  1 1 
        2  3947 1 1  57 PHE HE1  H   5.681   0.093  -0.545 1.00 . A A .  57 PHE HE1  1 1 
        2  3948 1 1  57 PHE HE2  H   2.762   1.067   2.405 1.00 . A A .  57 PHE HE2  1 1 
        2  3949 1 1  57 PHE HZ   H   5.118   0.922   1.705 1.00 . A A .  57 PHE HZ   1 1 
        2  3950 1 1  57 PHE N    N   0.821  -2.698  -0.520 1.00 . A A .  57 PHE N    1 1 
        2  3951 1 1  57 PHE O    O   3.353  -2.881  -1.752 1.00 . A A .  57 PHE O    1 1 
        2  3952 1 1  58 GLY C    C   3.716  -2.710  -5.765 1.00 . A A .  58 GLY C    1 1 
        2  3953 1 1  58 GLY CA   C   3.460  -3.418  -4.450 1.00 . A A .  58 GLY CA   1 1 
        2  3954 1 1  58 GLY H    H   1.488  -2.675  -4.241 1.00 . A A .  58 GLY H    1 1 
        2  3955 1 1  58 GLY HA2  H   4.333  -3.317  -3.822 1.00 . A A .  58 GLY HA2  1 1 
        2  3956 1 1  58 GLY HA3  H   3.288  -4.467  -4.645 1.00 . A A .  58 GLY HA3  1 1 
        2  3957 1 1  58 GLY N    N   2.311  -2.879  -3.748 1.00 . A A .  58 GLY N    1 1 
        2  3958 1 1  58 GLY O    O   2.829  -2.623  -6.613 1.00 . A A .  58 GLY O    1 1 
        2  3959 1 1  59 GLY C    C   6.019  -2.386  -8.141 1.00 . A A .  59 GLY C    1 1 
        2  3960 1 1  59 GLY CA   C   5.278  -1.504  -7.157 1.00 . A A .  59 GLY CA   1 1 
        2  3961 1 1  59 GLY H    H   5.598  -2.301  -5.222 1.00 . A A .  59 GLY H    1 1 
        2  3962 1 1  59 GLY HA2  H   4.372  -1.145  -7.623 1.00 . A A .  59 GLY HA2  1 1 
        2  3963 1 1  59 GLY HA3  H   5.903  -0.657  -6.910 1.00 . A A .  59 GLY HA3  1 1 
        2  3964 1 1  59 GLY N    N   4.933  -2.202  -5.934 1.00 . A A .  59 GLY N    1 1 
        2  3965 1 1  59 GLY O    O   6.995  -3.047  -7.783 1.00 . A A .  59 GLY O    1 1 
        2  3966 1 1  60 TYR C    C   6.463  -2.362 -11.667 1.00 . A A .  60 TYR C    1 1 
        2  3967 1 1  60 TYR CA   C   6.175  -3.206 -10.429 1.00 . A A .  60 TYR CA   1 1 
        2  3968 1 1  60 TYR CB   C   5.272  -4.384 -10.798 1.00 . A A .  60 TYR CB   1 1 
        2  3969 1 1  60 TYR CD1  C   5.790  -5.603  -8.647 1.00 . A A .  60 TYR CD1  1 1 
        2  3970 1 1  60 TYR CD2  C   3.549  -5.657  -9.460 1.00 . A A .  60 TYR CD2  1 1 
        2  3971 1 1  60 TYR CE1  C   5.421  -6.376  -7.563 1.00 . A A .  60 TYR CE1  1 1 
        2  3972 1 1  60 TYR CE2  C   3.172  -6.430  -8.379 1.00 . A A .  60 TYR CE2  1 1 
        2  3973 1 1  60 TYR CG   C   4.862  -5.230  -9.612 1.00 . A A .  60 TYR CG   1 1 
        2  3974 1 1  60 TYR CZ   C   4.112  -6.787  -7.434 1.00 . A A .  60 TYR CZ   1 1 
        2  3975 1 1  60 TYR H    H   4.770  -1.850  -9.608 1.00 . A A .  60 TYR H    1 1 
        2  3976 1 1  60 TYR HA   H   7.107  -3.585 -10.041 1.00 . A A .  60 TYR HA   1 1 
        2  3977 1 1  60 TYR HB2  H   4.372  -4.007 -11.260 1.00 . A A .  60 TYR HB2  1 1 
        2  3978 1 1  60 TYR HB3  H   5.791  -5.021 -11.498 1.00 . A A .  60 TYR HB3  1 1 
        2  3979 1 1  60 TYR HD1  H   6.815  -5.278  -8.752 1.00 . A A .  60 TYR HD1  1 1 
        2  3980 1 1  60 TYR HD2  H   2.817  -5.377 -10.201 1.00 . A A .  60 TYR HD2  1 1 
        2  3981 1 1  60 TYR HE1  H   6.156  -6.656  -6.823 1.00 . A A .  60 TYR HE1  1 1 
        2  3982 1 1  60 TYR HE2  H   2.146  -6.752  -8.278 1.00 . A A .  60 TYR HE2  1 1 
        2  3983 1 1  60 TYR HH   H   3.217  -8.304  -6.659 1.00 . A A .  60 TYR HH   1 1 
        2  3984 1 1  60 TYR N    N   5.552  -2.398  -9.386 1.00 . A A .  60 TYR N    1 1 
        2  3985 1 1  60 TYR O    O   5.545  -1.944 -12.373 1.00 . A A .  60 TYR O    1 1 
        2  3986 1 1  60 TYR OH   O   3.739  -7.557  -6.356 1.00 . A A .  60 TYR OH   1 1 
        2  3987 1 1  61 GLN C    C   8.360  -2.207 -14.300 1.00 . A A .  61 GLN C    1 1 
        2  3988 1 1  61 GLN CA   C   8.151  -1.320 -13.077 1.00 . A A .  61 GLN CA   1 1 
        2  3989 1 1  61 GLN CB   C   9.434  -0.549 -12.763 1.00 . A A .  61 GLN CB   1 1 
        2  3990 1 1  61 GLN CD   C   9.159   1.859 -12.050 1.00 . A A .  61 GLN CD   1 1 
        2  3991 1 1  61 GLN CG   C   9.393   0.904 -13.205 1.00 . A A .  61 GLN CG   1 1 
        2  3992 1 1  61 GLN H    H   8.431  -2.474 -11.325 1.00 . A A .  61 GLN H    1 1 
        2  3993 1 1  61 GLN HA   H   7.360  -0.616 -13.289 1.00 . A A .  61 GLN HA   1 1 
        2  3994 1 1  61 GLN HB2  H   9.602  -0.575 -11.696 1.00 . A A .  61 GLN HB2  1 1 
        2  3995 1 1  61 GLN HB3  H  10.263  -1.031 -13.260 1.00 . A A .  61 GLN HB3  1 1 
        2  3996 1 1  61 GLN HE21 H   7.245   2.037 -12.554 1.00 . A A .  61 GLN HE21 1 1 
        2  3997 1 1  61 GLN HE22 H   7.744   2.948 -11.175 1.00 . A A .  61 GLN HE22 1 1 
        2  3998 1 1  61 GLN HG2  H  10.335   1.152 -13.670 1.00 . A A .  61 GLN HG2  1 1 
        2  3999 1 1  61 GLN HG3  H   8.595   1.027 -13.922 1.00 . A A .  61 GLN HG3  1 1 
        2  4000 1 1  61 GLN N    N   7.743  -2.115 -11.924 1.00 . A A .  61 GLN N    1 1 
        2  4001 1 1  61 GLN NE2  N   7.925   2.328 -11.912 1.00 . A A .  61 GLN NE2  1 1 
        2  4002 1 1  61 GLN O    O   8.949  -3.283 -14.206 1.00 . A A .  61 GLN O    1 1 
        2  4003 1 1  61 GLN OE1  O  10.076   2.170 -11.291 1.00 . A A .  61 GLN OE1  1 1 
        2  4004 1 1  62 VAL C    C   8.483  -1.594 -17.826 1.00 . A A .  62 VAL C    1 1 
        2  4005 1 1  62 VAL CA   C   8.011  -2.496 -16.691 1.00 . A A .  62 VAL CA   1 1 
        2  4006 1 1  62 VAL CB   C   6.682  -3.162 -17.096 1.00 . A A .  62 VAL CB   1 1 
        2  4007 1 1  62 VAL CG1  C   6.888  -4.084 -18.287 1.00 . A A .  62 VAL CG1  1 1 
        2  4008 1 1  62 VAL CG2  C   6.086  -3.921 -15.920 1.00 . A A .  62 VAL CG2  1 1 
        2  4009 1 1  62 VAL H    H   7.416  -0.878 -15.461 1.00 . A A .  62 VAL H    1 1 
        2  4010 1 1  62 VAL HA   H   8.745  -3.272 -16.532 1.00 . A A .  62 VAL HA   1 1 
        2  4011 1 1  62 VAL HB   H   5.989  -2.385 -17.385 1.00 . A A .  62 VAL HB   1 1 
        2  4012 1 1  62 VAL HG11 H   6.976  -5.104 -17.941 1.00 . A A .  62 VAL HG11 1 1 
        2  4013 1 1  62 VAL HG12 H   7.790  -3.801 -18.811 1.00 . A A .  62 VAL HG12 1 1 
        2  4014 1 1  62 VAL HG13 H   6.044  -4.001 -18.956 1.00 . A A .  62 VAL HG13 1 1 
        2  4015 1 1  62 VAL HG21 H   5.219  -4.473 -16.251 1.00 . A A .  62 VAL HG21 1 1 
        2  4016 1 1  62 VAL HG22 H   5.795  -3.222 -15.150 1.00 . A A .  62 VAL HG22 1 1 
        2  4017 1 1  62 VAL HG23 H   6.821  -4.607 -15.525 1.00 . A A .  62 VAL HG23 1 1 
        2  4018 1 1  62 VAL N    N   7.875  -1.744 -15.449 1.00 . A A .  62 VAL N    1 1 
        2  4019 1 1  62 VAL O    O   9.430  -1.921 -18.541 1.00 . A A .  62 VAL O    1 1 
        2  4020 1 1  63 ASN C    C   8.852   1.725 -18.428 1.00 . A A .  63 ASN C    1 1 
        2  4021 1 1  63 ASN CA   C   8.169   0.498 -19.028 1.00 . A A .  63 ASN CA   1 1 
        2  4022 1 1  63 ASN CB   C   6.918   0.919 -19.804 1.00 . A A .  63 ASN CB   1 1 
        2  4023 1 1  63 ASN CG   C   6.899   0.363 -21.215 1.00 . A A .  63 ASN CG   1 1 
        2  4024 1 1  63 ASN H    H   7.073  -0.250 -17.379 1.00 . A A .  63 ASN H    1 1 
        2  4025 1 1  63 ASN HA   H   8.855   0.009 -19.704 1.00 . A A .  63 ASN HA   1 1 
        2  4026 1 1  63 ASN HB2  H   6.042   0.559 -19.286 1.00 . A A .  63 ASN HB2  1 1 
        2  4027 1 1  63 ASN HB3  H   6.881   1.997 -19.862 1.00 . A A .  63 ASN HB3  1 1 
        2  4028 1 1  63 ASN HD21 H   5.673  -1.096 -20.651 1.00 . A A .  63 ASN HD21 1 1 
        2  4029 1 1  63 ASN HD22 H   6.129  -1.100 -22.317 1.00 . A A .  63 ASN HD22 1 1 
        2  4030 1 1  63 ASN N    N   7.817  -0.455 -17.983 1.00 . A A .  63 ASN N    1 1 
        2  4031 1 1  63 ASN ND2  N   6.158  -0.720 -21.414 1.00 . A A .  63 ASN ND2  1 1 
        2  4032 1 1  63 ASN O    O   8.498   2.170 -17.336 1.00 . A A .  63 ASN O    1 1 
        2  4033 1 1  63 ASN OD1  O   7.544   0.903 -22.115 1.00 . A A .  63 ASN OD1  1 1 
        2  4034 1 1  64 PRO C    C   9.687   4.714 -18.612 1.00 . A A .  64 PRO C    1 1 
        2  4035 1 1  64 PRO CA   C  10.572   3.474 -18.662 1.00 . A A .  64 PRO CA   1 1 
        2  4036 1 1  64 PRO CB   C  11.686   3.650 -19.698 1.00 . A A .  64 PRO CB   1 1 
        2  4037 1 1  64 PRO CD   C  10.333   1.832 -20.449 1.00 . A A .  64 PRO CD   1 1 
        2  4038 1 1  64 PRO CG   C  11.173   2.982 -20.926 1.00 . A A .  64 PRO CG   1 1 
        2  4039 1 1  64 PRO HA   H  11.007   3.304 -17.687 1.00 . A A .  64 PRO HA   1 1 
        2  4040 1 1  64 PRO HB2  H  11.863   4.703 -19.865 1.00 . A A .  64 PRO HB2  1 1 
        2  4041 1 1  64 PRO HB3  H  12.591   3.178 -19.342 1.00 . A A .  64 PRO HB3  1 1 
        2  4042 1 1  64 PRO HD2  H   9.510   1.657 -21.127 1.00 . A A .  64 PRO HD2  1 1 
        2  4043 1 1  64 PRO HD3  H  10.935   0.941 -20.345 1.00 . A A .  64 PRO HD3  1 1 
        2  4044 1 1  64 PRO HG2  H  10.571   3.675 -21.497 1.00 . A A .  64 PRO HG2  1 1 
        2  4045 1 1  64 PRO HG3  H  11.998   2.622 -21.522 1.00 . A A .  64 PRO HG3  1 1 
        2  4046 1 1  64 PRO N    N   9.845   2.292 -19.137 1.00 . A A .  64 PRO N    1 1 
        2  4047 1 1  64 PRO O    O   9.816   5.615 -19.440 1.00 . A A .  64 PRO O    1 1 
        2  4048 1 1  65 TYR C    C   6.993   5.724 -16.248 1.00 . A A .  65 TYR C    1 1 
        2  4049 1 1  65 TYR CA   C   7.878   5.886 -17.482 1.00 . A A .  65 TYR CA   1 1 
        2  4050 1 1  65 TYR CB   C   7.007   6.037 -18.731 1.00 . A A .  65 TYR CB   1 1 
        2  4051 1 1  65 TYR CD1  C   8.013   8.232 -19.473 1.00 . A A .  65 TYR CD1  1 1 
        2  4052 1 1  65 TYR CD2  C   5.636   8.043 -19.414 1.00 . A A .  65 TYR CD2  1 1 
        2  4053 1 1  65 TYR CE1  C   7.902   9.537 -19.915 1.00 . A A .  65 TYR CE1  1 1 
        2  4054 1 1  65 TYR CE2  C   5.519   9.348 -19.857 1.00 . A A .  65 TYR CE2  1 1 
        2  4055 1 1  65 TYR CG   C   6.884   7.463 -19.215 1.00 . A A .  65 TYR CG   1 1 
        2  4056 1 1  65 TYR CZ   C   6.654  10.088 -20.106 1.00 . A A .  65 TYR CZ   1 1 
        2  4057 1 1  65 TYR H    H   8.727   4.005 -17.005 1.00 . A A .  65 TYR H    1 1 
        2  4058 1 1  65 TYR HA   H   8.478   6.775 -17.365 1.00 . A A .  65 TYR HA   1 1 
        2  4059 1 1  65 TYR HB2  H   7.435   5.453 -19.532 1.00 . A A .  65 TYR HB2  1 1 
        2  4060 1 1  65 TYR HB3  H   6.013   5.670 -18.517 1.00 . A A .  65 TYR HB3  1 1 
        2  4061 1 1  65 TYR HD1  H   8.989   7.795 -19.323 1.00 . A A .  65 TYR HD1  1 1 
        2  4062 1 1  65 TYR HD2  H   4.750   7.461 -19.218 1.00 . A A .  65 TYR HD2  1 1 
        2  4063 1 1  65 TYR HE1  H   8.792  10.116 -20.110 1.00 . A A .  65 TYR HE1  1 1 
        2  4064 1 1  65 TYR HE2  H   4.541   9.779 -20.006 1.00 . A A .  65 TYR HE2  1 1 
        2  4065 1 1  65 TYR HH   H   6.869  11.450 -21.447 1.00 . A A .  65 TYR HH   1 1 
        2  4066 1 1  65 TYR N    N   8.785   4.752 -17.634 1.00 . A A .  65 TYR N    1 1 
        2  4067 1 1  65 TYR O    O   6.714   6.694 -15.544 1.00 . A A .  65 TYR O    1 1 
        2  4068 1 1  65 TYR OH   O   6.540  11.388 -20.547 1.00 . A A .  65 TYR OH   1 1 
        2  4069 1 1  66 LEU C    C   5.558   2.717 -14.610 1.00 . A A .  66 LEU C    1 1 
        2  4070 1 1  66 LEU CA   C   5.691   4.218 -14.845 1.00 . A A .  66 LEU CA   1 1 
        2  4071 1 1  66 LEU CB   C   4.308   4.835 -15.060 1.00 . A A .  66 LEU CB   1 1 
        2  4072 1 1  66 LEU CD1  C   2.329   4.021 -16.376 1.00 . A A .  66 LEU CD1  1 1 
        2  4073 1 1  66 LEU CD2  C   3.686   5.945 -17.224 1.00 . A A .  66 LEU CD2  1 1 
        2  4074 1 1  66 LEU CG   C   3.722   4.629 -16.460 1.00 . A A .  66 LEU CG   1 1 
        2  4075 1 1  66 LEU H    H   6.801   3.761 -16.591 1.00 . A A .  66 LEU H    1 1 
        2  4076 1 1  66 LEU HA   H   6.146   4.669 -13.975 1.00 . A A .  66 LEU HA   1 1 
        2  4077 1 1  66 LEU HB2  H   3.630   4.402 -14.338 1.00 . A A .  66 LEU HB2  1 1 
        2  4078 1 1  66 LEU HB3  H   4.378   5.896 -14.873 1.00 . A A .  66 LEU HB3  1 1 
        2  4079 1 1  66 LEU HD11 H   1.591   4.809 -16.423 1.00 . A A .  66 LEU HD11 1 1 
        2  4080 1 1  66 LEU HD12 H   2.226   3.487 -15.443 1.00 . A A .  66 LEU HD12 1 1 
        2  4081 1 1  66 LEU HD13 H   2.184   3.341 -17.200 1.00 . A A .  66 LEU HD13 1 1 
        2  4082 1 1  66 LEU HD21 H   2.699   6.380 -17.147 1.00 . A A .  66 LEU HD21 1 1 
        2  4083 1 1  66 LEU HD22 H   3.919   5.765 -18.263 1.00 . A A .  66 LEU HD22 1 1 
        2  4084 1 1  66 LEU HD23 H   4.412   6.625 -16.805 1.00 . A A .  66 LEU HD23 1 1 
        2  4085 1 1  66 LEU HG   H   4.351   3.942 -17.007 1.00 . A A .  66 LEU HG   1 1 
        2  4086 1 1  66 LEU N    N   6.549   4.496 -15.992 1.00 . A A .  66 LEU N    1 1 
        2  4087 1 1  66 LEU O    O   5.878   1.914 -15.486 1.00 . A A .  66 LEU O    1 1 
        2  4088 1 1  67 GLY C    C   3.535   0.634 -12.560 1.00 . A A .  67 GLY C    1 1 
        2  4089 1 1  67 GLY CA   C   4.917   0.944 -13.100 1.00 . A A .  67 GLY CA   1 1 
        2  4090 1 1  67 GLY H    H   4.846   3.033 -12.764 1.00 . A A .  67 GLY H    1 1 
        2  4091 1 1  67 GLY HA2  H   5.084   0.356 -13.991 1.00 . A A .  67 GLY HA2  1 1 
        2  4092 1 1  67 GLY HA3  H   5.651   0.667 -12.357 1.00 . A A .  67 GLY HA3  1 1 
        2  4093 1 1  67 GLY N    N   5.084   2.348 -13.424 1.00 . A A .  67 GLY N    1 1 
        2  4094 1 1  67 GLY O    O   2.792   1.539 -12.180 1.00 . A A .  67 GLY O    1 1 
        2  4095 1 1  68 PHE C    C   1.895  -1.147 -10.500 1.00 . A A .  68 PHE C    1 1 
        2  4096 1 1  68 PHE CA   C   1.887  -1.076 -12.022 1.00 . A A .  68 PHE CA   1 1 
        2  4097 1 1  68 PHE CB   C   1.512  -2.439 -12.608 1.00 . A A .  68 PHE CB   1 1 
        2  4098 1 1  68 PHE CD1  C   2.212  -2.290 -15.013 1.00 . A A .  68 PHE CD1  1 1 
        2  4099 1 1  68 PHE CD2  C  -0.115  -2.460 -14.519 1.00 . A A .  68 PHE CD2  1 1 
        2  4100 1 1  68 PHE CE1  C   1.926  -2.250 -16.364 1.00 . A A .  68 PHE CE1  1 1 
        2  4101 1 1  68 PHE CE2  C  -0.408  -2.420 -15.868 1.00 . A A .  68 PHE CE2  1 1 
        2  4102 1 1  68 PHE CG   C   1.197  -2.396 -14.076 1.00 . A A .  68 PHE CG   1 1 
        2  4103 1 1  68 PHE CZ   C   0.613  -2.315 -16.792 1.00 . A A .  68 PHE CZ   1 1 
        2  4104 1 1  68 PHE H    H   3.825  -1.326 -12.836 1.00 . A A .  68 PHE H    1 1 
        2  4105 1 1  68 PHE HA   H   1.156  -0.345 -12.333 1.00 . A A .  68 PHE HA   1 1 
        2  4106 1 1  68 PHE HB2  H   2.336  -3.122 -12.466 1.00 . A A .  68 PHE HB2  1 1 
        2  4107 1 1  68 PHE HB3  H   0.643  -2.818 -12.091 1.00 . A A .  68 PHE HB3  1 1 
        2  4108 1 1  68 PHE HD1  H   3.238  -2.239 -14.679 1.00 . A A .  68 PHE HD1  1 1 
        2  4109 1 1  68 PHE HD2  H  -0.914  -2.542 -13.797 1.00 . A A .  68 PHE HD2  1 1 
        2  4110 1 1  68 PHE HE1  H   2.726  -2.167 -17.085 1.00 . A A .  68 PHE HE1  1 1 
        2  4111 1 1  68 PHE HE2  H  -1.435  -2.470 -16.201 1.00 . A A .  68 PHE HE2  1 1 
        2  4112 1 1  68 PHE HZ   H   0.387  -2.282 -17.848 1.00 . A A .  68 PHE HZ   1 1 
        2  4113 1 1  68 PHE N    N   3.188  -0.650 -12.523 1.00 . A A .  68 PHE N    1 1 
        2  4114 1 1  68 PHE O    O   2.813  -1.708  -9.900 1.00 . A A .  68 PHE O    1 1 
        2  4115 1 1  69 GLU C    C  -0.394  -1.433  -7.954 1.00 . A A .  69 GLU C    1 1 
        2  4116 1 1  69 GLU CA   C   0.767  -0.568  -8.426 1.00 . A A .  69 GLU CA   1 1 
        2  4117 1 1  69 GLU CB   C   0.590   0.862  -7.913 1.00 . A A .  69 GLU CB   1 1 
        2  4118 1 1  69 GLU CD   C   2.348   1.051  -6.109 1.00 . A A .  69 GLU CD   1 1 
        2  4119 1 1  69 GLU CG   C   0.867   1.012  -6.426 1.00 . A A .  69 GLU CG   1 1 
        2  4120 1 1  69 GLU H    H   0.171  -0.138 -10.409 1.00 . A A .  69 GLU H    1 1 
        2  4121 1 1  69 GLU HA   H   1.686  -0.971  -8.027 1.00 . A A .  69 GLU HA   1 1 
        2  4122 1 1  69 GLU HB2  H   1.266   1.509  -8.451 1.00 . A A .  69 GLU HB2  1 1 
        2  4123 1 1  69 GLU HB3  H  -0.424   1.177  -8.102 1.00 . A A .  69 GLU HB3  1 1 
        2  4124 1 1  69 GLU HG2  H   0.416   1.930  -6.080 1.00 . A A .  69 GLU HG2  1 1 
        2  4125 1 1  69 GLU HG3  H   0.424   0.176  -5.904 1.00 . A A .  69 GLU HG3  1 1 
        2  4126 1 1  69 GLU N    N   0.870  -0.573  -9.878 1.00 . A A .  69 GLU N    1 1 
        2  4127 1 1  69 GLU O    O  -1.557  -1.138  -8.232 1.00 . A A .  69 GLU O    1 1 
        2  4128 1 1  69 GLU OE1  O   3.150   0.615  -6.961 1.00 . A A .  69 GLU OE1  1 1 
        2  4129 1 1  69 GLU OE2  O   2.708   1.519  -5.008 1.00 . A A .  69 GLU OE2  1 1 
        2  4130 1 1  70 MET C    C  -1.252  -3.187  -5.204 1.00 . A A .  70 MET C    1 1 
        2  4131 1 1  70 MET CA   C  -1.080  -3.404  -6.703 1.00 . A A .  70 MET CA   1 1 
        2  4132 1 1  70 MET CB   C  -0.692  -4.857  -6.984 1.00 . A A .  70 MET CB   1 1 
        2  4133 1 1  70 MET CE   C  -0.921  -5.602  -9.990 1.00 . A A .  70 MET CE   1 1 
        2  4134 1 1  70 MET CG   C  -1.868  -5.733  -7.388 1.00 . A A .  70 MET CG   1 1 
        2  4135 1 1  70 MET H    H   0.876  -2.671  -7.037 1.00 . A A .  70 MET H    1 1 
        2  4136 1 1  70 MET HA   H  -2.015  -3.185  -7.198 1.00 . A A .  70 MET HA   1 1 
        2  4137 1 1  70 MET HB2  H   0.034  -4.873  -7.785 1.00 . A A .  70 MET HB2  1 1 
        2  4138 1 1  70 MET HB3  H  -0.245  -5.279  -6.096 1.00 . A A .  70 MET HB3  1 1 
        2  4139 1 1  70 MET HE1  H   0.135  -5.746 -10.167 1.00 . A A .  70 MET HE1  1 1 
        2  4140 1 1  70 MET HE2  H  -1.089  -4.606  -9.610 1.00 . A A .  70 MET HE2  1 1 
        2  4141 1 1  70 MET HE3  H  -1.461  -5.732 -10.916 1.00 . A A .  70 MET HE3  1 1 
        2  4142 1 1  70 MET HG2  H  -2.144  -6.350  -6.546 1.00 . A A .  70 MET HG2  1 1 
        2  4143 1 1  70 MET HG3  H  -2.699  -5.094  -7.651 1.00 . A A .  70 MET HG3  1 1 
        2  4144 1 1  70 MET N    N  -0.069  -2.497  -7.229 1.00 . A A .  70 MET N    1 1 
        2  4145 1 1  70 MET O    O  -0.328  -3.417  -4.424 1.00 . A A .  70 MET O    1 1 
        2  4146 1 1  70 MET SD   S  -1.492  -6.803  -8.791 1.00 . A A .  70 MET SD   1 1 
        2  4147 1 1  71 GLY C    C  -3.666  -3.481  -2.799 1.00 . A A .  71 GLY C    1 1 
        2  4148 1 1  71 GLY CA   C  -2.697  -2.486  -3.401 1.00 . A A .  71 GLY CA   1 1 
        2  4149 1 1  71 GLY H    H  -3.135  -2.562  -5.474 1.00 . A A .  71 GLY H    1 1 
        2  4150 1 1  71 GLY HA2  H  -1.765  -2.537  -2.860 1.00 . A A .  71 GLY HA2  1 1 
        2  4151 1 1  71 GLY HA3  H  -3.107  -1.493  -3.295 1.00 . A A .  71 GLY HA3  1 1 
        2  4152 1 1  71 GLY N    N  -2.436  -2.735  -4.807 1.00 . A A .  71 GLY N    1 1 
        2  4153 1 1  71 GLY O    O  -4.455  -4.102  -3.511 1.00 . A A .  71 GLY O    1 1 
        2  4154 1 1  72 TYR C    C  -5.176  -3.857   0.391 1.00 . A A .  72 TYR C    1 1 
        2  4155 1 1  72 TYR CA   C  -4.484  -4.555  -0.773 1.00 . A A .  72 TYR CA   1 1 
        2  4156 1 1  72 TYR CB   C  -3.690  -5.759  -0.263 1.00 . A A .  72 TYR CB   1 1 
        2  4157 1 1  72 TYR CD1  C  -2.390  -6.764  -2.180 1.00 . A A .  72 TYR CD1  1 1 
        2  4158 1 1  72 TYR CD2  C  -4.346  -7.901  -1.426 1.00 . A A .  72 TYR CD2  1 1 
        2  4159 1 1  72 TYR CE1  C  -2.187  -7.741  -3.137 1.00 . A A .  72 TYR CE1  1 1 
        2  4160 1 1  72 TYR CE2  C  -4.149  -8.880  -2.381 1.00 . A A .  72 TYR CE2  1 1 
        2  4161 1 1  72 TYR CG   C  -3.472  -6.828  -1.309 1.00 . A A .  72 TYR CG   1 1 
        2  4162 1 1  72 TYR CZ   C  -3.070  -8.795  -3.234 1.00 . A A .  72 TYR CZ   1 1 
        2  4163 1 1  72 TYR H    H  -2.956  -3.106  -0.968 1.00 . A A .  72 TYR H    1 1 
        2  4164 1 1  72 TYR HA   H  -5.235  -4.898  -1.470 1.00 . A A .  72 TYR HA   1 1 
        2  4165 1 1  72 TYR HB2  H  -2.721  -5.424   0.075 1.00 . A A .  72 TYR HB2  1 1 
        2  4166 1 1  72 TYR HB3  H  -4.220  -6.206   0.565 1.00 . A A .  72 TYR HB3  1 1 
        2  4167 1 1  72 TYR HD1  H  -1.701  -5.937  -2.102 1.00 . A A .  72 TYR HD1  1 1 
        2  4168 1 1  72 TYR HD2  H  -5.191  -7.964  -0.757 1.00 . A A .  72 TYR HD2  1 1 
        2  4169 1 1  72 TYR HE1  H  -1.341  -7.674  -3.805 1.00 . A A .  72 TYR HE1  1 1 
        2  4170 1 1  72 TYR HE2  H  -4.841  -9.707  -2.457 1.00 . A A .  72 TYR HE2  1 1 
        2  4171 1 1  72 TYR HH   H  -3.671  -9.878  -4.704 1.00 . A A .  72 TYR HH   1 1 
        2  4172 1 1  72 TYR N    N  -3.606  -3.631  -1.480 1.00 . A A .  72 TYR N    1 1 
        2  4173 1 1  72 TYR O    O  -4.527  -3.208   1.211 1.00 . A A .  72 TYR O    1 1 
        2  4174 1 1  72 TYR OH   O  -2.870  -9.768  -4.185 1.00 . A A .  72 TYR OH   1 1 
        2  4175 1 1  73 ASP C    C  -7.527  -4.369   2.659 1.00 . A A .  73 ASP C    1 1 
        2  4176 1 1  73 ASP CA   C  -7.273  -3.377   1.529 1.00 . A A .  73 ASP CA   1 1 
        2  4177 1 1  73 ASP CB   C  -8.602  -2.849   0.986 1.00 . A A .  73 ASP CB   1 1 
        2  4178 1 1  73 ASP CG   C  -8.961  -1.492   1.555 1.00 . A A .  73 ASP CG   1 1 
        2  4179 1 1  73 ASP H    H  -6.957  -4.526  -0.219 1.00 . A A .  73 ASP H    1 1 
        2  4180 1 1  73 ASP HA   H  -6.700  -2.549   1.917 1.00 . A A .  73 ASP HA   1 1 
        2  4181 1 1  73 ASP HB2  H  -8.536  -2.763  -0.088 1.00 . A A .  73 ASP HB2  1 1 
        2  4182 1 1  73 ASP HB3  H  -9.389  -3.546   1.238 1.00 . A A .  73 ASP HB3  1 1 
        2  4183 1 1  73 ASP N    N  -6.496  -3.997   0.462 1.00 . A A .  73 ASP N    1 1 
        2  4184 1 1  73 ASP O    O  -8.123  -5.428   2.448 1.00 . A A .  73 ASP O    1 1 
        2  4185 1 1  73 ASP OD1  O  -8.097  -0.590   1.529 1.00 . A A .  73 ASP OD1  1 1 
        2  4186 1 1  73 ASP OD2  O -10.106  -1.329   2.027 1.00 . A A .  73 ASP OD2  1 1 
        2  4187 1 1  74 TRP C    C  -7.657  -4.047   6.244 1.00 . A A .  74 TRP C    1 1 
        2  4188 1 1  74 TRP CA   C  -7.240  -4.871   5.028 1.00 . A A .  74 TRP CA   1 1 
        2  4189 1 1  74 TRP CB   C  -5.942  -5.624   5.327 1.00 . A A .  74 TRP CB   1 1 
        2  4190 1 1  74 TRP CD1  C  -7.259  -7.797   5.681 1.00 . A A .  74 TRP CD1  1 1 
        2  4191 1 1  74 TRP CD2  C  -5.257  -7.758   6.686 1.00 . A A .  74 TRP CD2  1 1 
        2  4192 1 1  74 TRP CE2  C  -5.872  -8.995   6.958 1.00 . A A .  74 TRP CE2  1 1 
        2  4193 1 1  74 TRP CE3  C  -3.988  -7.506   7.214 1.00 . A A .  74 TRP CE3  1 1 
        2  4194 1 1  74 TRP CG   C  -6.161  -7.005   5.868 1.00 . A A .  74 TRP CG   1 1 
        2  4195 1 1  74 TRP CH2  C  -4.017  -9.703   8.237 1.00 . A A .  74 TRP CH2  1 1 
        2  4196 1 1  74 TRP CZ2  C  -5.259  -9.976   7.733 1.00 . A A .  74 TRP CZ2  1 1 
        2  4197 1 1  74 TRP CZ3  C  -3.381  -8.481   7.983 1.00 . A A .  74 TRP CZ3  1 1 
        2  4198 1 1  74 TRP H    H  -6.602  -3.161   3.957 1.00 . A A .  74 TRP H    1 1 
        2  4199 1 1  74 TRP HA   H  -8.018  -5.583   4.807 1.00 . A A .  74 TRP HA   1 1 
        2  4200 1 1  74 TRP HB2  H  -5.368  -5.712   4.418 1.00 . A A .  74 TRP HB2  1 1 
        2  4201 1 1  74 TRP HB3  H  -5.371  -5.068   6.055 1.00 . A A .  74 TRP HB3  1 1 
        2  4202 1 1  74 TRP HD1  H  -8.125  -7.510   5.104 1.00 . A A .  74 TRP HD1  1 1 
        2  4203 1 1  74 TRP HE1  H  -7.741  -9.729   6.348 1.00 . A A .  74 TRP HE1  1 1 
        2  4204 1 1  74 TRP HE3  H  -3.483  -6.570   7.030 1.00 . A A .  74 TRP HE3  1 1 
        2  4205 1 1  74 TRP HH2  H  -3.506 -10.435   8.843 1.00 . A A .  74 TRP HH2  1 1 
        2  4206 1 1  74 TRP HZ2  H  -5.736 -10.925   7.936 1.00 . A A .  74 TRP HZ2  1 1 
        2  4207 1 1  74 TRP HZ3  H  -2.400  -8.304   8.401 1.00 . A A .  74 TRP HZ3  1 1 
        2  4208 1 1  74 TRP N    N  -7.069  -4.017   3.858 1.00 . A A .  74 TRP N    1 1 
        2  4209 1 1  74 TRP NE1  N  -7.092  -8.995   6.334 1.00 . A A .  74 TRP NE1  1 1 
        2  4210 1 1  74 TRP O    O  -6.926  -3.158   6.687 1.00 . A A .  74 TRP O    1 1 
        2  4211 1 1  75 LEU C    C  -9.956  -4.607   8.950 1.00 . A A .  75 LEU C    1 1 
        2  4212 1 1  75 LEU CA   C  -9.351  -3.635   7.942 1.00 . A A .  75 LEU CA   1 1 
        2  4213 1 1  75 LEU CB   C -10.395  -2.601   7.513 1.00 . A A .  75 LEU CB   1 1 
        2  4214 1 1  75 LEU CD1  C -10.561  -0.108   7.294 1.00 . A A .  75 LEU CD1  1 1 
        2  4215 1 1  75 LEU CD2  C -11.337  -1.231   9.389 1.00 . A A .  75 LEU CD2  1 1 
        2  4216 1 1  75 LEU CG   C -10.326  -1.264   8.254 1.00 . A A .  75 LEU CG   1 1 
        2  4217 1 1  75 LEU H    H  -9.373  -5.062   6.381 1.00 . A A .  75 LEU H    1 1 
        2  4218 1 1  75 LEU HA   H  -8.522  -3.121   8.409 1.00 . A A .  75 LEU HA   1 1 
        2  4219 1 1  75 LEU HB2  H -10.269  -2.413   6.456 1.00 . A A .  75 LEU HB2  1 1 
        2  4220 1 1  75 LEU HB3  H -11.377  -3.024   7.670 1.00 . A A .  75 LEU HB3  1 1 
        2  4221 1 1  75 LEU HD11 H  -9.839  -0.153   6.491 1.00 . A A .  75 LEU HD11 1 1 
        2  4222 1 1  75 LEU HD12 H -10.455   0.827   7.824 1.00 . A A .  75 LEU HD12 1 1 
        2  4223 1 1  75 LEU HD13 H -11.558  -0.177   6.884 1.00 . A A .  75 LEU HD13 1 1 
        2  4224 1 1  75 LEU HD21 H -11.414  -0.224   9.773 1.00 . A A .  75 LEU HD21 1 1 
        2  4225 1 1  75 LEU HD22 H -11.015  -1.892  10.179 1.00 . A A .  75 LEU HD22 1 1 
        2  4226 1 1  75 LEU HD23 H -12.302  -1.550   9.022 1.00 . A A .  75 LEU HD23 1 1 
        2  4227 1 1  75 LEU HG   H  -9.341  -1.147   8.680 1.00 . A A .  75 LEU HG   1 1 
        2  4228 1 1  75 LEU N    N  -8.836  -4.347   6.778 1.00 . A A .  75 LEU N    1 1 
        2  4229 1 1  75 LEU O    O -11.173  -4.790   8.997 1.00 . A A .  75 LEU O    1 1 
        2  4230 1 1  76 GLY C    C  -8.504  -7.182  11.136 1.00 . A A .  76 GLY C    1 1 
        2  4231 1 1  76 GLY CA   C  -9.568  -6.172  10.750 1.00 . A A .  76 GLY CA   1 1 
        2  4232 1 1  76 GLY H    H  -8.141  -5.041   9.670 1.00 . A A .  76 GLY H    1 1 
        2  4233 1 1  76 GLY HA2  H  -9.870  -5.628  11.632 1.00 . A A .  76 GLY HA2  1 1 
        2  4234 1 1  76 GLY HA3  H -10.422  -6.701  10.355 1.00 . A A .  76 GLY HA3  1 1 
        2  4235 1 1  76 GLY N    N  -9.100  -5.227   9.754 1.00 . A A .  76 GLY N    1 1 
        2  4236 1 1  76 GLY O    O  -7.430  -7.221  10.536 1.00 . A A .  76 GLY O    1 1 
        2  4237 1 1  77 ARG C    C  -7.830 -10.203  11.655 1.00 . A A .  77 ARG C    1 1 
        2  4238 1 1  77 ARG CA   C  -7.865  -9.012  12.606 1.00 . A A .  77 ARG CA   1 1 
        2  4239 1 1  77 ARG CB   C  -8.243  -9.478  14.014 1.00 . A A .  77 ARG CB   1 1 
        2  4240 1 1  77 ARG CD   C  -7.202 -11.066  15.663 1.00 . A A .  77 ARG CD   1 1 
        2  4241 1 1  77 ARG CG   C  -7.043  -9.758  14.904 1.00 . A A .  77 ARG CG   1 1 
        2  4242 1 1  77 ARG CZ   C  -5.817 -12.583  17.026 1.00 . A A .  77 ARG CZ   1 1 
        2  4243 1 1  77 ARG H    H  -9.676  -7.918  12.579 1.00 . A A .  77 ARG H    1 1 
        2  4244 1 1  77 ARG HA   H  -6.883  -8.564  12.638 1.00 . A A .  77 ARG HA   1 1 
        2  4245 1 1  77 ARG HB2  H  -8.843  -8.713  14.484 1.00 . A A .  77 ARG HB2  1 1 
        2  4246 1 1  77 ARG HB3  H  -8.825 -10.384  13.936 1.00 . A A .  77 ARG HB3  1 1 
        2  4247 1 1  77 ARG HD2  H  -7.893 -10.914  16.478 1.00 . A A .  77 ARG HD2  1 1 
        2  4248 1 1  77 ARG HD3  H  -7.599 -11.812  14.991 1.00 . A A .  77 ARG HD3  1 1 
        2  4249 1 1  77 ARG HE   H  -5.118 -11.060  15.943 1.00 . A A .  77 ARG HE   1 1 
        2  4250 1 1  77 ARG HG2  H  -6.157  -9.815  14.291 1.00 . A A .  77 ARG HG2  1 1 
        2  4251 1 1  77 ARG HG3  H  -6.938  -8.949  15.615 1.00 . A A .  77 ARG HG3  1 1 
        2  4252 1 1  77 ARG HH11 H  -7.799 -12.990  17.071 1.00 . A A .  77 ARG HH11 1 1 
        2  4253 1 1  77 ARG HH12 H  -6.805 -14.043  18.020 1.00 . A A .  77 ARG HH12 1 1 
        2  4254 1 1  77 ARG HH21 H  -3.809 -12.444  17.191 1.00 . A A .  77 ARG HH21 1 1 
        2  4255 1 1  77 ARG HH22 H  -4.539 -13.733  18.088 1.00 . A A .  77 ARG HH22 1 1 
        2  4256 1 1  77 ARG N    N  -8.803  -7.999  12.140 1.00 . A A .  77 ARG N    1 1 
        2  4257 1 1  77 ARG NE   N  -5.931 -11.542  16.205 1.00 . A A .  77 ARG NE   1 1 
        2  4258 1 1  77 ARG NH1  N  -6.896 -13.260  17.403 1.00 . A A .  77 ARG NH1  1 1 
        2  4259 1 1  77 ARG NH2  N  -4.625 -12.951  17.471 1.00 . A A .  77 ARG NH2  1 1 
        2  4260 1 1  77 ARG O    O  -8.437 -10.173  10.585 1.00 . A A .  77 ARG O    1 1 
        2  4261 1 1  78 MET C    C  -7.969 -13.533  11.718 1.00 . A A .  78 MET C    1 1 
        2  4262 1 1  78 MET CA   C  -7.003 -12.455  11.235 1.00 . A A .  78 MET CA   1 1 
        2  4263 1 1  78 MET CB   C  -5.569 -12.983  11.268 1.00 . A A .  78 MET CB   1 1 
        2  4264 1 1  78 MET CE   C  -2.912 -14.387   9.350 1.00 . A A .  78 MET CE   1 1 
        2  4265 1 1  78 MET CG   C  -4.687 -12.421  10.165 1.00 . A A .  78 MET CG   1 1 
        2  4266 1 1  78 MET H    H  -6.656 -11.216  12.917 1.00 . A A .  78 MET H    1 1 
        2  4267 1 1  78 MET HA   H  -7.256 -12.189  10.219 1.00 . A A .  78 MET HA   1 1 
        2  4268 1 1  78 MET HB2  H  -5.124 -12.729  12.219 1.00 . A A .  78 MET HB2  1 1 
        2  4269 1 1  78 MET HB3  H  -5.591 -14.059  11.169 1.00 . A A .  78 MET HB3  1 1 
        2  4270 1 1  78 MET HE1  H  -3.034 -14.755  10.358 1.00 . A A .  78 MET HE1  1 1 
        2  4271 1 1  78 MET HE2  H  -2.101 -13.673   9.322 1.00 . A A .  78 MET HE2  1 1 
        2  4272 1 1  78 MET HE3  H  -2.687 -15.212   8.690 1.00 . A A .  78 MET HE3  1 1 
        2  4273 1 1  78 MET HG2  H  -5.156 -11.534   9.764 1.00 . A A .  78 MET HG2  1 1 
        2  4274 1 1  78 MET HG3  H  -3.727 -12.160  10.587 1.00 . A A .  78 MET HG3  1 1 
        2  4275 1 1  78 MET N    N  -7.117 -11.252  12.053 1.00 . A A .  78 MET N    1 1 
        2  4276 1 1  78 MET O    O  -7.686 -14.727  11.607 1.00 . A A .  78 MET O    1 1 
        2  4277 1 1  78 MET SD   S  -4.425 -13.591   8.817 1.00 . A A .  78 MET SD   1 1 
        2  4278 1 1  79 ALA C    C -11.326 -14.081  11.829 1.00 . A A .  79 ALA C    1 1 
        2  4279 1 1  79 ALA CA   C -10.113 -14.035  12.753 1.00 . A A .  79 ALA CA   1 1 
        2  4280 1 1  79 ALA CB   C -10.533 -13.648  14.163 1.00 . A A .  79 ALA CB   1 1 
        2  4281 1 1  79 ALA H    H  -9.275 -12.141  12.314 1.00 . A A .  79 ALA H    1 1 
        2  4282 1 1  79 ALA HA   H  -9.667 -15.018  12.793 1.00 . A A .  79 ALA HA   1 1 
        2  4283 1 1  79 ALA HB1  H -11.569 -13.912  14.316 1.00 . A A .  79 ALA HB1  1 1 
        2  4284 1 1  79 ALA HB2  H -10.409 -12.584  14.297 1.00 . A A .  79 ALA HB2  1 1 
        2  4285 1 1  79 ALA HB3  H  -9.919 -14.174  14.878 1.00 . A A .  79 ALA HB3  1 1 
        2  4286 1 1  79 ALA N    N  -9.107 -13.105  12.254 1.00 . A A .  79 ALA N    1 1 
        2  4287 1 1  79 ALA O    O -12.455 -13.835  12.255 1.00 . A A .  79 ALA O    1 1 
        2  4288 1 1  80 TYR C    C -12.363 -15.915   9.107 1.00 . A A .  80 TYR C    1 1 
        2  4289 1 1  80 TYR CA   C -12.157 -14.477   9.575 1.00 . A A .  80 TYR CA   1 1 
        2  4290 1 1  80 TYR CB   C -11.845 -13.578   8.378 1.00 . A A .  80 TYR CB   1 1 
        2  4291 1 1  80 TYR CD1  C -13.761 -11.964   8.067 1.00 . A A .  80 TYR CD1  1 1 
        2  4292 1 1  80 TYR CD2  C -11.727 -11.132   8.991 1.00 . A A .  80 TYR CD2  1 1 
        2  4293 1 1  80 TYR CE1  C -14.323 -10.704   8.158 1.00 . A A .  80 TYR CE1  1 1 
        2  4294 1 1  80 TYR CE2  C -12.282  -9.869   9.086 1.00 . A A .  80 TYR CE2  1 1 
        2  4295 1 1  80 TYR CG   C -12.455 -12.198   8.480 1.00 . A A .  80 TYR CG   1 1 
        2  4296 1 1  80 TYR CZ   C -13.580  -9.660   8.669 1.00 . A A .  80 TYR CZ   1 1 
        2  4297 1 1  80 TYR H    H -10.165 -14.583  10.281 1.00 . A A .  80 TYR H    1 1 
        2  4298 1 1  80 TYR HA   H -13.066 -14.132  10.046 1.00 . A A .  80 TYR HA   1 1 
        2  4299 1 1  80 TYR HB2  H -10.775 -13.461   8.293 1.00 . A A .  80 TYR HB2  1 1 
        2  4300 1 1  80 TYR HB3  H -12.223 -14.042   7.478 1.00 . A A .  80 TYR HB3  1 1 
        2  4301 1 1  80 TYR HD1  H -14.341 -12.782   7.668 1.00 . A A .  80 TYR HD1  1 1 
        2  4302 1 1  80 TYR HD2  H -10.711 -11.298   9.317 1.00 . A A .  80 TYR HD2  1 1 
        2  4303 1 1  80 TYR HE1  H -15.339 -10.541   7.832 1.00 . A A .  80 TYR HE1  1 1 
        2  4304 1 1  80 TYR HE2  H -11.699  -9.052   9.486 1.00 . A A .  80 TYR HE2  1 1 
        2  4305 1 1  80 TYR HH   H -14.980  -8.463   9.215 1.00 . A A .  80 TYR HH   1 1 
        2  4306 1 1  80 TYR N    N -11.085 -14.397  10.561 1.00 . A A .  80 TYR N    1 1 
        2  4307 1 1  80 TYR O    O -13.486 -16.334   8.833 1.00 . A A .  80 TYR O    1 1 
        2  4308 1 1  80 TYR OH   O -14.135  -8.405   8.763 1.00 . A A .  80 TYR OH   1 1 
        2  4309 1 1  81 LYS C    C -12.225 -18.876   9.512 1.00 . A A .  81 LYS C    1 1 
        2  4310 1 1  81 LYS CA   C -11.329 -18.057   8.588 1.00 . A A .  81 LYS CA   1 1 
        2  4311 1 1  81 LYS CB   C  -9.925 -18.663   8.549 1.00 . A A .  81 LYS CB   1 1 
        2  4312 1 1  81 LYS CD   C  -8.273 -19.683   6.954 1.00 . A A .  81 LYS CD   1 1 
        2  4313 1 1  81 LYS CE   C  -7.201 -19.299   5.946 1.00 . A A .  81 LYS CE   1 1 
        2  4314 1 1  81 LYS CG   C  -9.245 -18.540   7.195 1.00 . A A .  81 LYS CG   1 1 
        2  4315 1 1  81 LYS H    H -10.402 -16.276   9.254 1.00 . A A .  81 LYS H    1 1 
        2  4316 1 1  81 LYS HA   H -11.747 -18.076   7.592 1.00 . A A .  81 LYS HA   1 1 
        2  4317 1 1  81 LYS HB2  H  -9.309 -18.163   9.282 1.00 . A A .  81 LYS HB2  1 1 
        2  4318 1 1  81 LYS HB3  H  -9.989 -19.710   8.802 1.00 . A A .  81 LYS HB3  1 1 
        2  4319 1 1  81 LYS HD2  H  -7.797 -19.941   7.890 1.00 . A A .  81 LYS HD2  1 1 
        2  4320 1 1  81 LYS HD3  H  -8.819 -20.536   6.579 1.00 . A A .  81 LYS HD3  1 1 
        2  4321 1 1  81 LYS HE2  H  -7.604 -19.415   4.951 1.00 . A A .  81 LYS HE2  1 1 
        2  4322 1 1  81 LYS HE3  H  -6.928 -18.266   6.107 1.00 . A A .  81 LYS HE3  1 1 
        2  4323 1 1  81 LYS HG2  H -10.001 -18.555   6.423 1.00 . A A .  81 LYS HG2  1 1 
        2  4324 1 1  81 LYS HG3  H  -8.707 -17.605   7.156 1.00 . A A .  81 LYS HG3  1 1 
        2  4325 1 1  81 LYS HZ1  H  -6.237 -21.152   5.977 1.00 . A A .  81 LYS HZ1  1 1 
        2  4326 1 1  81 LYS HZ2  H  -5.548 -20.004   7.011 1.00 . A A .  81 LYS HZ2  1 1 
        2  4327 1 1  81 LYS HZ3  H  -5.294 -19.900   5.342 1.00 . A A .  81 LYS HZ3  1 1 
        2  4328 1 1  81 LYS N    N -11.269 -16.665   9.022 1.00 . A A .  81 LYS N    1 1 
        2  4329 1 1  81 LYS NZ   N  -5.985 -20.148   6.079 1.00 . A A .  81 LYS NZ   1 1 
        2  4330 1 1  81 LYS O    O -12.346 -18.578  10.700 1.00 . A A .  81 LYS O    1 1 
        2  4331 1 1  82 GLY C    C -13.006 -21.959  10.324 1.00 . A A .  82 GLY C    1 1 
        2  4332 1 1  82 GLY CA   C -13.727 -20.756   9.746 1.00 . A A .  82 GLY CA   1 1 
        2  4333 1 1  82 GLY H    H -12.715 -20.100   8.006 1.00 . A A .  82 GLY H    1 1 
        2  4334 1 1  82 GLY HA2  H -14.137 -20.173  10.558 1.00 . A A .  82 GLY HA2  1 1 
        2  4335 1 1  82 GLY HA3  H -14.535 -21.100   9.120 1.00 . A A .  82 GLY HA3  1 1 
        2  4336 1 1  82 GLY N    N -12.850 -19.910   8.958 1.00 . A A .  82 GLY N    1 1 
        2  4337 1 1  82 GLY O    O -11.813 -21.894  10.619 1.00 . A A .  82 GLY O    1 1 
        2  4338 1 1  83 SER C    C -13.937 -25.508  10.563 1.00 . A A .  83 SER C    1 1 
        2  4339 1 1  83 SER CA   C -13.157 -24.284  11.031 1.00 . A A .  83 SER CA   1 1 
        2  4340 1 1  83 SER CB   C -13.142 -24.226  12.560 1.00 . A A .  83 SER CB   1 1 
        2  4341 1 1  83 SER H    H -14.680 -23.049  10.232 1.00 . A A .  83 SER H    1 1 
        2  4342 1 1  83 SER HA   H -12.142 -24.359  10.672 1.00 . A A .  83 SER HA   1 1 
        2  4343 1 1  83 SER HB2  H -13.815 -23.452  12.896 1.00 . A A .  83 SER HB2  1 1 
        2  4344 1 1  83 SER HB3  H -13.460 -25.177  12.959 1.00 . A A .  83 SER HB3  1 1 
        2  4345 1 1  83 SER HG   H -11.800 -24.134  13.986 1.00 . A A .  83 SER HG   1 1 
        2  4346 1 1  83 SER N    N -13.733 -23.060  10.486 1.00 . A A .  83 SER N    1 1 
        2  4347 1 1  83 SER O    O -13.352 -26.500  10.128 1.00 . A A .  83 SER O    1 1 
        2  4348 1 1  83 SER OG   O -11.842 -23.940  13.046 1.00 . A A .  83 SER OG   1 1 
        2  4349 1 1  84 VAL C    C -17.300 -26.028   9.412 1.00 . A A .  84 VAL C    1 1 
        2  4350 1 1  84 VAL CA   C -16.119 -26.533  10.240 1.00 . A A .  84 VAL CA   1 1 
        2  4351 1 1  84 VAL CB   C -16.645 -27.321  11.459 1.00 . A A .  84 VAL CB   1 1 
        2  4352 1 1  84 VAL CG1  C -17.508 -26.434  12.345 1.00 . A A .  84 VAL CG1  1 1 
        2  4353 1 1  84 VAL CG2  C -17.417 -28.554  11.011 1.00 . A A .  84 VAL CG2  1 1 
        2  4354 1 1  84 VAL H    H -15.668 -24.614  11.011 1.00 . A A .  84 VAL H    1 1 
        2  4355 1 1  84 VAL HA   H -15.530 -27.204   9.633 1.00 . A A .  84 VAL HA   1 1 
        2  4356 1 1  84 VAL HB   H -15.796 -27.649  12.041 1.00 . A A .  84 VAL HB   1 1 
        2  4357 1 1  84 VAL HG11 H -18.204 -25.880  11.732 1.00 . A A .  84 VAL HG11 1 1 
        2  4358 1 1  84 VAL HG12 H -16.877 -25.744  12.887 1.00 . A A .  84 VAL HG12 1 1 
        2  4359 1 1  84 VAL HG13 H -18.054 -27.048  13.045 1.00 . A A .  84 VAL HG13 1 1 
        2  4360 1 1  84 VAL HG21 H -17.077 -28.855  10.032 1.00 . A A .  84 VAL HG21 1 1 
        2  4361 1 1  84 VAL HG22 H -18.470 -28.323  10.972 1.00 . A A .  84 VAL HG22 1 1 
        2  4362 1 1  84 VAL HG23 H -17.250 -29.357  11.713 1.00 . A A .  84 VAL HG23 1 1 
        2  4363 1 1  84 VAL N    N -15.261 -25.431  10.655 1.00 . A A .  84 VAL N    1 1 
        2  4364 1 1  84 VAL O    O -18.435 -26.469   9.593 1.00 . A A .  84 VAL O    1 1 
        2  4365 1 1  85 ASP C    C -18.263 -25.395   6.402 1.00 . A A .  85 ASP C    1 1 
        2  4366 1 1  85 ASP CA   C -18.054 -24.533   7.643 1.00 . A A .  85 ASP CA   1 1 
        2  4367 1 1  85 ASP CB   C -17.677 -23.108   7.232 1.00 . A A .  85 ASP CB   1 1 
        2  4368 1 1  85 ASP CG   C -17.819 -22.119   8.373 1.00 . A A .  85 ASP CG   1 1 
        2  4369 1 1  85 ASP H    H -16.095 -24.790   8.405 1.00 . A A .  85 ASP H    1 1 
        2  4370 1 1  85 ASP HA   H -18.975 -24.505   8.206 1.00 . A A .  85 ASP HA   1 1 
        2  4371 1 1  85 ASP HB2  H -16.650 -23.096   6.898 1.00 . A A .  85 ASP HB2  1 1 
        2  4372 1 1  85 ASP HB3  H -18.318 -22.791   6.424 1.00 . A A .  85 ASP HB3  1 1 
        2  4373 1 1  85 ASP N    N -17.020 -25.100   8.503 1.00 . A A .  85 ASP N    1 1 
        2  4374 1 1  85 ASP O    O -17.644 -26.449   6.254 1.00 . A A .  85 ASP O    1 1 
        2  4375 1 1  85 ASP OD1  O -18.883 -22.118   9.027 1.00 . A A .  85 ASP OD1  1 1 
        2  4376 1 1  85 ASP OD2  O -16.866 -21.348   8.612 1.00 . A A .  85 ASP OD2  1 1 
        2  4377 1 1  86 ASN C    C -18.943 -24.897   3.061 1.00 . A A .  86 ASN C    1 1 
        2  4378 1 1  86 ASN CA   C -19.428 -25.673   4.282 1.00 . A A .  86 ASN CA   1 1 
        2  4379 1 1  86 ASN CB   C -20.929 -25.943   4.166 1.00 . A A .  86 ASN CB   1 1 
        2  4380 1 1  86 ASN CG   C -21.226 -27.304   3.570 1.00 . A A .  86 ASN CG   1 1 
        2  4381 1 1  86 ASN H    H -19.602 -24.094   5.683 1.00 . A A .  86 ASN H    1 1 
        2  4382 1 1  86 ASN HA   H -18.903 -26.614   4.327 1.00 . A A .  86 ASN HA   1 1 
        2  4383 1 1  86 ASN HB2  H -21.374 -25.895   5.148 1.00 . A A .  86 ASN HB2  1 1 
        2  4384 1 1  86 ASN HB3  H -21.376 -25.188   3.535 1.00 . A A .  86 ASN HB3  1 1 
        2  4385 1 1  86 ASN HD21 H -22.552 -26.499   2.326 1.00 . A A .  86 ASN HD21 1 1 
        2  4386 1 1  86 ASN HD22 H -22.344 -28.210   2.196 1.00 . A A .  86 ASN HD22 1 1 
        2  4387 1 1  86 ASN N    N -19.139 -24.941   5.512 1.00 . A A .  86 ASN N    1 1 
        2  4388 1 1  86 ASN ND2  N -22.133 -27.342   2.600 1.00 . A A .  86 ASN ND2  1 1 
        2  4389 1 1  86 ASN O    O -18.080 -25.365   2.319 1.00 . A A .  86 ASN O    1 1 
        2  4390 1 1  86 ASN OD1  O -20.649 -28.314   3.977 1.00 . A A .  86 ASN OD1  1 1 
        2  4391 1 1  87 GLY C    C -17.710 -22.340   1.863 1.00 . A A .  87 GLY C    1 1 
        2  4392 1 1  87 GLY CA   C -19.117 -22.887   1.728 1.00 . A A .  87 GLY CA   1 1 
        2  4393 1 1  87 GLY H    H -20.187 -23.387   3.486 1.00 . A A .  87 GLY H    1 1 
        2  4394 1 1  87 GLY HA2  H -19.174 -23.483   0.829 1.00 . A A .  87 GLY HA2  1 1 
        2  4395 1 1  87 GLY HA3  H -19.808 -22.061   1.646 1.00 . A A .  87 GLY HA3  1 1 
        2  4396 1 1  87 GLY N    N -19.504 -23.709   2.860 1.00 . A A .  87 GLY N    1 1 
        2  4397 1 1  87 GLY O    O -16.896 -22.878   2.613 1.00 . A A .  87 GLY O    1 1 
        2  4398 1 1  88 ALA C    C -16.186 -19.228   1.745 1.00 . A A .  88 ALA C    1 1 
        2  4399 1 1  88 ALA CA   C -16.107 -20.641   1.179 1.00 . A A .  88 ALA CA   1 1 
        2  4400 1 1  88 ALA CB   C -15.490 -20.623  -0.213 1.00 . A A .  88 ALA CB   1 1 
        2  4401 1 1  88 ALA H    H -18.116 -20.879   0.560 1.00 . A A .  88 ALA H    1 1 
        2  4402 1 1  88 ALA HA   H -15.476 -21.240   1.819 1.00 . A A .  88 ALA HA   1 1 
        2  4403 1 1  88 ALA HB1  H -16.141 -21.142  -0.902 1.00 . A A .  88 ALA HB1  1 1 
        2  4404 1 1  88 ALA HB2  H -14.529 -21.113  -0.186 1.00 . A A .  88 ALA HB2  1 1 
        2  4405 1 1  88 ALA HB3  H -15.363 -19.600  -0.539 1.00 . A A .  88 ALA HB3  1 1 
        2  4406 1 1  88 ALA N    N -17.424 -21.263   1.137 1.00 . A A .  88 ALA N    1 1 
        2  4407 1 1  88 ALA O    O -17.014 -18.422   1.321 1.00 . A A .  88 ALA O    1 1 
        2  4408 1 1  89 PHE C    C -13.956 -16.920   3.074 1.00 . A A .  89 PHE C    1 1 
        2  4409 1 1  89 PHE CA   C -15.287 -17.616   3.335 1.00 . A A .  89 PHE CA   1 1 
        2  4410 1 1  89 PHE CB   C -15.526 -17.738   4.840 1.00 . A A .  89 PHE CB   1 1 
        2  4411 1 1  89 PHE CD1  C -15.648 -15.267   5.257 1.00 . A A .  89 PHE CD1  1 1 
        2  4412 1 1  89 PHE CD2  C -17.341 -16.661   6.197 1.00 . A A .  89 PHE CD2  1 1 
        2  4413 1 1  89 PHE CE1  C -16.253 -14.154   5.811 1.00 . A A .  89 PHE CE1  1 1 
        2  4414 1 1  89 PHE CE2  C -17.949 -15.551   6.752 1.00 . A A .  89 PHE CE2  1 1 
        2  4415 1 1  89 PHE CG   C -16.185 -16.531   5.444 1.00 . A A .  89 PHE CG   1 1 
        2  4416 1 1  89 PHE CZ   C -17.405 -14.296   6.559 1.00 . A A .  89 PHE CZ   1 1 
        2  4417 1 1  89 PHE H    H -14.681 -19.617   3.003 1.00 . A A .  89 PHE H    1 1 
        2  4418 1 1  89 PHE HA   H -16.081 -17.025   2.901 1.00 . A A .  89 PHE HA   1 1 
        2  4419 1 1  89 PHE HB2  H -16.160 -18.592   5.029 1.00 . A A .  89 PHE HB2  1 1 
        2  4420 1 1  89 PHE HB3  H -14.578 -17.884   5.336 1.00 . A A .  89 PHE HB3  1 1 
        2  4421 1 1  89 PHE HD1  H -14.749 -15.154   4.671 1.00 . A A .  89 PHE HD1  1 1 
        2  4422 1 1  89 PHE HD2  H -17.768 -17.641   6.348 1.00 . A A .  89 PHE HD2  1 1 
        2  4423 1 1  89 PHE HE1  H -15.824 -13.175   5.659 1.00 . A A .  89 PHE HE1  1 1 
        2  4424 1 1  89 PHE HE2  H -18.850 -15.665   7.338 1.00 . A A .  89 PHE HE2  1 1 
        2  4425 1 1  89 PHE HZ   H -17.879 -13.428   6.993 1.00 . A A .  89 PHE HZ   1 1 
        2  4426 1 1  89 PHE N    N -15.317 -18.933   2.708 1.00 . A A .  89 PHE N    1 1 
        2  4427 1 1  89 PHE O    O -12.921 -17.315   3.612 1.00 . A A .  89 PHE O    1 1 
        2  4428 1 1  90 LYS C    C -13.114 -13.666   1.633 1.00 . A A .  90 LYS C    1 1 
        2  4429 1 1  90 LYS CA   C -12.784 -15.130   1.911 1.00 . A A .  90 LYS CA   1 1 
        2  4430 1 1  90 LYS CB   C -12.093 -15.749   0.695 1.00 . A A .  90 LYS CB   1 1 
        2  4431 1 1  90 LYS CD   C -12.251 -16.165  -1.777 1.00 . A A .  90 LYS CD   1 1 
        2  4432 1 1  90 LYS CE   C -11.825 -17.611  -1.967 1.00 . A A .  90 LYS CE   1 1 
        2  4433 1 1  90 LYS CG   C -13.026 -15.977  -0.483 1.00 . A A .  90 LYS CG   1 1 
        2  4434 1 1  90 LYS H    H -14.843 -15.614   1.845 1.00 . A A .  90 LYS H    1 1 
        2  4435 1 1  90 LYS HA   H -12.117 -15.181   2.758 1.00 . A A .  90 LYS HA   1 1 
        2  4436 1 1  90 LYS HB2  H -11.296 -15.092   0.375 1.00 . A A .  90 LYS HB2  1 1 
        2  4437 1 1  90 LYS HB3  H -11.670 -16.700   0.981 1.00 . A A .  90 LYS HB3  1 1 
        2  4438 1 1  90 LYS HD2  H -12.878 -15.873  -2.607 1.00 . A A .  90 LYS HD2  1 1 
        2  4439 1 1  90 LYS HD3  H -11.371 -15.539  -1.755 1.00 . A A .  90 LYS HD3  1 1 
        2  4440 1 1  90 LYS HE2  H -12.490 -18.246  -1.400 1.00 . A A .  90 LYS HE2  1 1 
        2  4441 1 1  90 LYS HE3  H -11.896 -17.860  -3.015 1.00 . A A .  90 LYS HE3  1 1 
        2  4442 1 1  90 LYS HG2  H -13.615 -16.862  -0.297 1.00 . A A .  90 LYS HG2  1 1 
        2  4443 1 1  90 LYS HG3  H -13.678 -15.122  -0.585 1.00 . A A .  90 LYS HG3  1 1 
        2  4444 1 1  90 LYS HZ1  H -10.016 -18.654  -2.012 1.00 . A A .  90 LYS HZ1  1 1 
        2  4445 1 1  90 LYS HZ2  H -10.415 -18.042  -0.487 1.00 . A A .  90 LYS HZ2  1 1 
        2  4446 1 1  90 LYS HZ3  H  -9.844 -17.003  -1.693 1.00 . A A .  90 LYS HZ3  1 1 
        2  4447 1 1  90 LYS N    N -13.989 -15.881   2.243 1.00 . A A .  90 LYS N    1 1 
        2  4448 1 1  90 LYS NZ   N -10.427 -17.844  -1.508 1.00 . A A .  90 LYS NZ   1 1 
        2  4449 1 1  90 LYS O    O -14.083 -13.359   0.937 1.00 . A A .  90 LYS O    1 1 
        2  4450 1 1  91 ALA C    C -11.178 -10.587   2.005 1.00 . A A .  91 ALA C    1 1 
        2  4451 1 1  91 ALA CA   C -12.506 -11.337   1.992 1.00 . A A .  91 ALA CA   1 1 
        2  4452 1 1  91 ALA CB   C -13.435 -10.791   3.066 1.00 . A A .  91 ALA CB   1 1 
        2  4453 1 1  91 ALA H    H -11.548 -13.075   2.725 1.00 . A A .  91 ALA H    1 1 
        2  4454 1 1  91 ALA HA   H -12.981 -11.192   1.032 1.00 . A A .  91 ALA HA   1 1 
        2  4455 1 1  91 ALA HB1  H -14.453 -10.811   2.705 1.00 . A A .  91 ALA HB1  1 1 
        2  4456 1 1  91 ALA HB2  H -13.158  -9.775   3.300 1.00 . A A .  91 ALA HB2  1 1 
        2  4457 1 1  91 ALA HB3  H -13.355 -11.399   3.955 1.00 . A A .  91 ALA HB3  1 1 
        2  4458 1 1  91 ALA N    N -12.303 -12.768   2.180 1.00 . A A .  91 ALA N    1 1 
        2  4459 1 1  91 ALA O    O -10.336 -10.812   2.874 1.00 . A A .  91 ALA O    1 1 
        2  4460 1 1  92 GLN C    C  -9.884  -7.885  -0.185 1.00 . A A .  92 GLN C    1 1 
        2  4461 1 1  92 GLN CA   C  -9.773  -8.909   0.936 1.00 . A A .  92 GLN CA   1 1 
        2  4462 1 1  92 GLN CB   C  -8.572  -9.826   0.690 1.00 . A A .  92 GLN CB   1 1 
        2  4463 1 1  92 GLN CD   C  -6.197 -10.220   1.449 1.00 . A A .  92 GLN CD   1 1 
        2  4464 1 1  92 GLN CG   C  -7.241  -9.192   1.057 1.00 . A A .  92 GLN CG   1 1 
        2  4465 1 1  92 GLN H    H -11.709  -9.558   0.372 1.00 . A A .  92 GLN H    1 1 
        2  4466 1 1  92 GLN HA   H  -9.633  -8.390   1.871 1.00 . A A .  92 GLN HA   1 1 
        2  4467 1 1  92 GLN HB2  H  -8.694 -10.725   1.273 1.00 . A A .  92 GLN HB2  1 1 
        2  4468 1 1  92 GLN HB3  H  -8.544 -10.089  -0.358 1.00 . A A .  92 GLN HB3  1 1 
        2  4469 1 1  92 GLN HE21 H  -4.778  -8.827   1.418 1.00 . A A .  92 GLN HE21 1 1 
        2  4470 1 1  92 GLN HE22 H  -4.255 -10.421   1.832 1.00 . A A .  92 GLN HE22 1 1 
        2  4471 1 1  92 GLN HG2  H  -6.873  -8.637   0.209 1.00 . A A .  92 GLN HG2  1 1 
        2  4472 1 1  92 GLN HG3  H  -7.393  -8.521   1.889 1.00 . A A .  92 GLN HG3  1 1 
        2  4473 1 1  92 GLN N    N -11.000  -9.694   1.037 1.00 . A A .  92 GLN N    1 1 
        2  4474 1 1  92 GLN NE2  N  -4.951  -9.778   1.579 1.00 . A A .  92 GLN NE2  1 1 
        2  4475 1 1  92 GLN O    O -10.412  -8.179  -1.258 1.00 . A A .  92 GLN O    1 1 
        2  4476 1 1  92 GLN OE1  O  -6.506 -11.397   1.633 1.00 . A A .  92 GLN OE1  1 1 
        2  4477 1 1  93 GLY C    C  -8.305  -5.701  -1.928 1.00 . A A .  93 GLY C    1 1 
        2  4478 1 1  93 GLY CA   C  -9.451  -5.632  -0.937 1.00 . A A .  93 GLY CA   1 1 
        2  4479 1 1  93 GLY H    H  -8.980  -6.493   0.942 1.00 . A A .  93 GLY H    1 1 
        2  4480 1 1  93 GLY HA2  H -10.382  -5.723  -1.475 1.00 . A A .  93 GLY HA2  1 1 
        2  4481 1 1  93 GLY HA3  H  -9.426  -4.673  -0.443 1.00 . A A .  93 GLY HA3  1 1 
        2  4482 1 1  93 GLY N    N  -9.388  -6.678   0.066 1.00 . A A .  93 GLY N    1 1 
        2  4483 1 1  93 GLY O    O  -7.168  -5.988  -1.556 1.00 . A A .  93 GLY O    1 1 
        2  4484 1 1  94 VAL C    C  -7.616  -4.133  -5.021 1.00 . A A .  94 VAL C    1 1 
        2  4485 1 1  94 VAL CA   C  -7.600  -5.448  -4.249 1.00 . A A .  94 VAL CA   1 1 
        2  4486 1 1  94 VAL CB   C  -7.816  -6.620  -5.232 1.00 . A A .  94 VAL CB   1 1 
        2  4487 1 1  94 VAL CG1  C  -6.993  -7.828  -4.812 1.00 . A A .  94 VAL CG1  1 1 
        2  4488 1 1  94 VAL CG2  C  -9.291  -6.985  -5.333 1.00 . A A .  94 VAL CG2  1 1 
        2  4489 1 1  94 VAL H    H  -9.533  -5.200  -3.423 1.00 . A A .  94 VAL H    1 1 
        2  4490 1 1  94 VAL HA   H  -6.633  -5.568  -3.782 1.00 . A A .  94 VAL HA   1 1 
        2  4491 1 1  94 VAL HB   H  -7.477  -6.309  -6.209 1.00 . A A .  94 VAL HB   1 1 
        2  4492 1 1  94 VAL HG11 H  -7.344  -8.703  -5.339 1.00 . A A .  94 VAL HG11 1 1 
        2  4493 1 1  94 VAL HG12 H  -7.098  -7.983  -3.748 1.00 . A A .  94 VAL HG12 1 1 
        2  4494 1 1  94 VAL HG13 H  -5.954  -7.656  -5.050 1.00 . A A .  94 VAL HG13 1 1 
        2  4495 1 1  94 VAL HG21 H  -9.642  -7.332  -4.372 1.00 . A A .  94 VAL HG21 1 1 
        2  4496 1 1  94 VAL HG22 H  -9.419  -7.767  -6.067 1.00 . A A .  94 VAL HG22 1 1 
        2  4497 1 1  94 VAL HG23 H  -9.856  -6.116  -5.631 1.00 . A A .  94 VAL HG23 1 1 
        2  4498 1 1  94 VAL N    N  -8.608  -5.428  -3.193 1.00 . A A .  94 VAL N    1 1 
        2  4499 1 1  94 VAL O    O  -8.640  -3.747  -5.586 1.00 . A A .  94 VAL O    1 1 
        2  4500 1 1  95 GLN C    C  -5.519  -2.262  -6.977 1.00 . A A .  95 GLN C    1 1 
        2  4501 1 1  95 GLN CA   C  -6.376  -2.160  -5.720 1.00 . A A .  95 GLN CA   1 1 
        2  4502 1 1  95 GLN CB   C  -5.791  -1.102  -4.782 1.00 . A A .  95 GLN CB   1 1 
        2  4503 1 1  95 GLN CD   C  -6.606  -1.762  -2.484 1.00 . A A .  95 GLN CD   1 1 
        2  4504 1 1  95 GLN CG   C  -6.699  -0.756  -3.614 1.00 . A A .  95 GLN CG   1 1 
        2  4505 1 1  95 GLN H    H  -5.701  -3.794  -4.553 1.00 . A A .  95 GLN H    1 1 
        2  4506 1 1  95 GLN HA   H  -7.373  -1.858  -6.004 1.00 . A A .  95 GLN HA   1 1 
        2  4507 1 1  95 GLN HB2  H  -4.856  -1.468  -4.385 1.00 . A A .  95 GLN HB2  1 1 
        2  4508 1 1  95 GLN HB3  H  -5.606  -0.201  -5.345 1.00 . A A .  95 GLN HB3  1 1 
        2  4509 1 1  95 GLN HE21 H  -8.264  -2.660  -3.112 1.00 . A A .  95 GLN HE21 1 1 
        2  4510 1 1  95 GLN HE22 H  -7.526  -3.345  -1.709 1.00 . A A .  95 GLN HE22 1 1 
        2  4511 1 1  95 GLN HG2  H  -6.422   0.215  -3.234 1.00 . A A .  95 GLN HG2  1 1 
        2  4512 1 1  95 GLN HG3  H  -7.720  -0.726  -3.964 1.00 . A A .  95 GLN HG3  1 1 
        2  4513 1 1  95 GLN N    N  -6.481  -3.441  -5.030 1.00 . A A .  95 GLN N    1 1 
        2  4514 1 1  95 GLN NE2  N  -7.561  -2.681  -2.429 1.00 . A A .  95 GLN NE2  1 1 
        2  4515 1 1  95 GLN O    O  -4.447  -2.870  -6.968 1.00 . A A .  95 GLN O    1 1 
        2  4516 1 1  95 GLN OE1  O  -5.684  -1.713  -1.668 1.00 . A A .  95 GLN OE1  1 1 
        2  4517 1 1  96 LEU C    C  -5.027  -0.199  -9.756 1.00 . A A .  96 LEU C    1 1 
        2  4518 1 1  96 LEU CA   C  -5.291  -1.638  -9.326 1.00 . A A .  96 LEU CA   1 1 
        2  4519 1 1  96 LEU CB   C  -6.112  -2.374 -10.391 1.00 . A A .  96 LEU CB   1 1 
        2  4520 1 1  96 LEU CD1  C  -5.625  -3.542 -12.558 1.00 . A A .  96 LEU CD1  1 1 
        2  4521 1 1  96 LEU CD2  C  -6.493  -1.199 -12.575 1.00 . A A .  96 LEU CD2  1 1 
        2  4522 1 1  96 LEU CG   C  -5.624  -2.204 -11.833 1.00 . A A .  96 LEU CG   1 1 
        2  4523 1 1  96 LEU H    H  -6.855  -1.169  -7.985 1.00 . A A .  96 LEU H    1 1 
        2  4524 1 1  96 LEU HA   H  -4.346  -2.145  -9.190 1.00 . A A .  96 LEU HA   1 1 
        2  4525 1 1  96 LEU HB2  H  -6.106  -3.426 -10.152 1.00 . A A .  96 LEU HB2  1 1 
        2  4526 1 1  96 LEU HB3  H  -7.130  -2.017 -10.336 1.00 . A A .  96 LEU HB3  1 1 
        2  4527 1 1  96 LEU HD11 H  -5.182  -4.295 -11.925 1.00 . A A .  96 LEU HD11 1 1 
        2  4528 1 1  96 LEU HD12 H  -5.054  -3.458 -13.471 1.00 . A A .  96 LEU HD12 1 1 
        2  4529 1 1  96 LEU HD13 H  -6.641  -3.822 -12.794 1.00 . A A .  96 LEU HD13 1 1 
        2  4530 1 1  96 LEU HD21 H  -7.494  -1.221 -12.174 1.00 . A A .  96 LEU HD21 1 1 
        2  4531 1 1  96 LEU HD22 H  -6.519  -1.452 -13.626 1.00 . A A .  96 LEU HD22 1 1 
        2  4532 1 1  96 LEU HD23 H  -6.080  -0.207 -12.455 1.00 . A A .  96 LEU HD23 1 1 
        2  4533 1 1  96 LEU HG   H  -4.611  -1.831 -11.824 1.00 . A A .  96 LEU HG   1 1 
        2  4534 1 1  96 LEU N    N  -6.000  -1.645  -8.053 1.00 . A A .  96 LEU N    1 1 
        2  4535 1 1  96 LEU O    O  -5.948   0.513 -10.157 1.00 . A A .  96 LEU O    1 1 
        2  4536 1 1  97 THR C    C  -2.031   1.689 -10.625 1.00 . A A .  97 THR C    1 1 
        2  4537 1 1  97 THR CA   C  -3.424   1.607 -10.012 1.00 . A A .  97 THR CA   1 1 
        2  4538 1 1  97 THR CB   C  -3.489   2.504  -8.774 1.00 . A A .  97 THR CB   1 1 
        2  4539 1 1  97 THR CG2  C  -4.689   2.232  -7.892 1.00 . A A .  97 THR CG2  1 1 
        2  4540 1 1  97 THR H    H  -3.076  -0.364  -9.311 1.00 . A A .  97 THR H    1 1 
        2  4541 1 1  97 THR HA   H  -4.145   1.956 -10.735 1.00 . A A .  97 THR HA   1 1 
        2  4542 1 1  97 THR HB   H  -3.537   3.534  -9.090 1.00 . A A .  97 THR HB   1 1 
        2  4543 1 1  97 THR HG1  H  -2.327   1.460  -7.592 1.00 . A A .  97 THR HG1  1 1 
        2  4544 1 1  97 THR HG21 H  -4.947   3.130  -7.350 1.00 . A A .  97 THR HG21 1 1 
        2  4545 1 1  97 THR HG22 H  -4.449   1.446  -7.192 1.00 . A A .  97 THR HG22 1 1 
        2  4546 1 1  97 THR HG23 H  -5.523   1.929  -8.504 1.00 . A A .  97 THR HG23 1 1 
        2  4547 1 1  97 THR N    N  -3.773   0.238  -9.651 1.00 . A A .  97 THR N    1 1 
        2  4548 1 1  97 THR O    O  -1.256   0.736 -10.568 1.00 . A A .  97 THR O    1 1 
        2  4549 1 1  97 THR OG1  O  -2.330   2.340  -7.977 1.00 . A A .  97 THR OG1  1 1 
        2  4550 1 1  98 ALA C    C   0.421   3.987 -10.913 1.00 . A A .  98 ALA C    1 1 
        2  4551 1 1  98 ALA CA   C  -0.418   3.083 -11.805 1.00 . A A .  98 ALA CA   1 1 
        2  4552 1 1  98 ALA CB   C  -0.580   3.695 -13.188 1.00 . A A .  98 ALA CB   1 1 
        2  4553 1 1  98 ALA H    H  -2.383   3.572 -11.193 1.00 . A A .  98 ALA H    1 1 
        2  4554 1 1  98 ALA HA   H   0.080   2.130 -11.909 1.00 . A A .  98 ALA HA   1 1 
        2  4555 1 1  98 ALA HB1  H  -0.671   4.767 -13.098 1.00 . A A .  98 ALA HB1  1 1 
        2  4556 1 1  98 ALA HB2  H  -1.467   3.296 -13.657 1.00 . A A .  98 ALA HB2  1 1 
        2  4557 1 1  98 ALA HB3  H   0.284   3.456 -13.789 1.00 . A A .  98 ALA HB3  1 1 
        2  4558 1 1  98 ALA N    N  -1.720   2.849 -11.194 1.00 . A A .  98 ALA N    1 1 
        2  4559 1 1  98 ALA O    O   0.010   5.101 -10.585 1.00 . A A .  98 ALA O    1 1 
        2  4560 1 1  99 LYS C    C   3.772   4.646 -10.329 1.00 . A A .  99 LYS C    1 1 
        2  4561 1 1  99 LYS CA   C   2.467   4.267  -9.633 1.00 . A A .  99 LYS CA   1 1 
        2  4562 1 1  99 LYS CB   C   2.770   3.475  -8.360 1.00 . A A .  99 LYS CB   1 1 
        2  4563 1 1  99 LYS CD   C   5.148   3.680  -7.568 1.00 . A A .  99 LYS CD   1 1 
        2  4564 1 1  99 LYS CE   C   5.693   3.123  -6.261 1.00 . A A .  99 LYS CE   1 1 
        2  4565 1 1  99 LYS CG   C   3.722   4.186  -7.410 1.00 . A A .  99 LYS CG   1 1 
        2  4566 1 1  99 LYS H    H   1.856   2.601 -10.787 1.00 . A A .  99 LYS H    1 1 
        2  4567 1 1  99 LYS HA   H   1.949   5.173  -9.360 1.00 . A A .  99 LYS HA   1 1 
        2  4568 1 1  99 LYS HB2  H   1.843   3.292  -7.835 1.00 . A A .  99 LYS HB2  1 1 
        2  4569 1 1  99 LYS HB3  H   3.209   2.528  -8.635 1.00 . A A .  99 LYS HB3  1 1 
        2  4570 1 1  99 LYS HD2  H   5.165   2.898  -8.313 1.00 . A A .  99 LYS HD2  1 1 
        2  4571 1 1  99 LYS HD3  H   5.776   4.499  -7.889 1.00 . A A .  99 LYS HD3  1 1 
        2  4572 1 1  99 LYS HE2  H   6.321   3.872  -5.802 1.00 . A A .  99 LYS HE2  1 1 
        2  4573 1 1  99 LYS HE3  H   4.863   2.899  -5.607 1.00 . A A .  99 LYS HE3  1 1 
        2  4574 1 1  99 LYS HG2  H   3.701   5.244  -7.621 1.00 . A A .  99 LYS HG2  1 1 
        2  4575 1 1  99 LYS HG3  H   3.397   4.011  -6.395 1.00 . A A .  99 LYS HG3  1 1 
        2  4576 1 1  99 LYS HZ1  H   6.313   1.208  -5.707 1.00 . A A .  99 LYS HZ1  1 1 
        2  4577 1 1  99 LYS HZ2  H   7.506   2.113  -6.495 1.00 . A A .  99 LYS HZ2  1 1 
        2  4578 1 1  99 LYS HZ3  H   6.230   1.442  -7.380 1.00 . A A .  99 LYS HZ3  1 1 
        2  4579 1 1  99 LYS N    N   1.589   3.500 -10.506 1.00 . A A .  99 LYS N    1 1 
        2  4580 1 1  99 LYS NZ   N   6.490   1.885  -6.475 1.00 . A A .  99 LYS NZ   1 1 
        2  4581 1 1  99 LYS O    O   4.432   3.808 -10.946 1.00 . A A .  99 LYS O    1 1 
        2  4582 1 1 100 LEU C    C   6.196   7.139  -9.730 1.00 . A A . 100 LEU C    1 1 
        2  4583 1 1 100 LEU CA   C   5.368   6.430 -10.796 1.00 . A A . 100 LEU CA   1 1 
        2  4584 1 1 100 LEU CB   C   5.052   7.391 -11.944 1.00 . A A . 100 LEU CB   1 1 
        2  4585 1 1 100 LEU CD1  C   5.339   9.804 -11.326 1.00 . A A . 100 LEU CD1  1 1 
        2  4586 1 1 100 LEU CD2  C   3.301   9.072 -12.576 1.00 . A A . 100 LEU CD2  1 1 
        2  4587 1 1 100 LEU CG   C   4.337   8.679 -11.532 1.00 . A A . 100 LEU CG   1 1 
        2  4588 1 1 100 LEU H    H   3.570   6.527  -9.691 1.00 . A A . 100 LEU H    1 1 
        2  4589 1 1 100 LEU HA   H   5.931   5.590 -11.178 1.00 . A A . 100 LEU HA   1 1 
        2  4590 1 1 100 LEU HB2  H   5.981   7.657 -12.428 1.00 . A A . 100 LEU HB2  1 1 
        2  4591 1 1 100 LEU HB3  H   4.431   6.872 -12.658 1.00 . A A . 100 LEU HB3  1 1 
        2  4592 1 1 100 LEU HD11 H   4.977  10.474 -10.561 1.00 . A A . 100 LEU HD11 1 1 
        2  4593 1 1 100 LEU HD12 H   5.467  10.346 -12.250 1.00 . A A . 100 LEU HD12 1 1 
        2  4594 1 1 100 LEU HD13 H   6.289   9.388 -11.020 1.00 . A A . 100 LEU HD13 1 1 
        2  4595 1 1 100 LEU HD21 H   3.783   9.185 -13.536 1.00 . A A . 100 LEU HD21 1 1 
        2  4596 1 1 100 LEU HD22 H   2.840  10.006 -12.292 1.00 . A A . 100 LEU HD22 1 1 
        2  4597 1 1 100 LEU HD23 H   2.546   8.302 -12.640 1.00 . A A . 100 LEU HD23 1 1 
        2  4598 1 1 100 LEU HG   H   3.824   8.515 -10.596 1.00 . A A . 100 LEU HG   1 1 
        2  4599 1 1 100 LEU N    N   4.138   5.917 -10.206 1.00 . A A . 100 LEU N    1 1 
        2  4600 1 1 100 LEU O    O   5.692   8.010  -9.020 1.00 . A A . 100 LEU O    1 1 
        2  4601 1 1 101 GLY C    C   9.540   8.038  -9.193 1.00 . A A . 101 GLY C    1 1 
        2  4602 1 1 101 GLY CA   C   8.321   7.359  -8.604 1.00 . A A . 101 GLY CA   1 1 
        2  4603 1 1 101 GLY H    H   7.811   6.044 -10.186 1.00 . A A . 101 GLY H    1 1 
        2  4604 1 1 101 GLY HA2  H   7.748   8.093  -8.056 1.00 . A A . 101 GLY HA2  1 1 
        2  4605 1 1 101 GLY HA3  H   8.647   6.592  -7.917 1.00 . A A . 101 GLY HA3  1 1 
        2  4606 1 1 101 GLY N    N   7.462   6.752  -9.604 1.00 . A A . 101 GLY N    1 1 
        2  4607 1 1 101 GLY O    O   9.712   8.085 -10.411 1.00 . A A . 101 GLY O    1 1 
        2  4608 1 1 102 TYR C    C  12.553   9.454  -7.549 1.00 . A A . 102 TYR C    1 1 
        2  4609 1 1 102 TYR CA   C  11.608   9.254  -8.736 1.00 . A A . 102 TYR CA   1 1 
        2  4610 1 1 102 TYR CB   C  11.262  10.607  -9.359 1.00 . A A . 102 TYR CB   1 1 
        2  4611 1 1 102 TYR CD1  C  13.185  10.633 -10.995 1.00 . A A . 102 TYR CD1  1 1 
        2  4612 1 1 102 TYR CD2  C  12.799  12.584  -9.680 1.00 . A A . 102 TYR CD2  1 1 
        2  4613 1 1 102 TYR CE1  C  14.260  11.253 -11.605 1.00 . A A . 102 TYR CE1  1 1 
        2  4614 1 1 102 TYR CE2  C  13.873  13.208 -10.285 1.00 . A A . 102 TYR CE2  1 1 
        2  4615 1 1 102 TYR CG   C  12.438  11.287 -10.024 1.00 . A A . 102 TYR CG   1 1 
        2  4616 1 1 102 TYR CZ   C  14.600  12.540 -11.246 1.00 . A A . 102 TYR CZ   1 1 
        2  4617 1 1 102 TYR H    H  10.190   8.493  -7.359 1.00 . A A . 102 TYR H    1 1 
        2  4618 1 1 102 TYR HA   H  12.094   8.639  -9.477 1.00 . A A . 102 TYR HA   1 1 
        2  4619 1 1 102 TYR HB2  H  10.495  10.466 -10.107 1.00 . A A . 102 TYR HB2  1 1 
        2  4620 1 1 102 TYR HB3  H  10.888  11.266  -8.589 1.00 . A A . 102 TYR HB3  1 1 
        2  4621 1 1 102 TYR HD1  H  12.916   9.624 -11.275 1.00 . A A . 102 TYR HD1  1 1 
        2  4622 1 1 102 TYR HD2  H  12.228  13.106  -8.927 1.00 . A A . 102 TYR HD2  1 1 
        2  4623 1 1 102 TYR HE1  H  14.830  10.726 -12.358 1.00 . A A . 102 TYR HE1  1 1 
        2  4624 1 1 102 TYR HE2  H  14.138  14.217 -10.003 1.00 . A A . 102 TYR HE2  1 1 
        2  4625 1 1 102 TYR HH   H  16.140  13.691 -11.205 1.00 . A A . 102 TYR HH   1 1 
        2  4626 1 1 102 TYR N    N  10.390   8.567  -8.317 1.00 . A A . 102 TYR N    1 1 
        2  4627 1 1 102 TYR O    O  12.173  10.053  -6.543 1.00 . A A . 102 TYR O    1 1 
        2  4628 1 1 102 TYR OH   O  15.670  13.158 -11.851 1.00 . A A . 102 TYR OH   1 1 
        2  4629 1 1 103 PRO C    C  15.422  10.466  -6.519 1.00 . A A . 103 PRO C    1 1 
        2  4630 1 1 103 PRO CA   C  14.786   9.082  -6.569 1.00 . A A . 103 PRO CA   1 1 
        2  4631 1 1 103 PRO CB   C  15.828   8.028  -6.932 1.00 . A A . 103 PRO CB   1 1 
        2  4632 1 1 103 PRO CD   C  14.345   8.217  -8.804 1.00 . A A . 103 PRO CD   1 1 
        2  4633 1 1 103 PRO CG   C  15.775   7.947  -8.417 1.00 . A A . 103 PRO CG   1 1 
        2  4634 1 1 103 PRO HA   H  14.355   8.850  -5.608 1.00 . A A . 103 PRO HA   1 1 
        2  4635 1 1 103 PRO HB2  H  16.802   8.346  -6.585 1.00 . A A . 103 PRO HB2  1 1 
        2  4636 1 1 103 PRO HB3  H  15.567   7.085  -6.476 1.00 . A A . 103 PRO HB3  1 1 
        2  4637 1 1 103 PRO HD2  H  14.303   8.823  -9.697 1.00 . A A . 103 PRO HD2  1 1 
        2  4638 1 1 103 PRO HD3  H  13.814   7.289  -8.955 1.00 . A A . 103 PRO HD3  1 1 
        2  4639 1 1 103 PRO HG2  H  16.426   8.692  -8.849 1.00 . A A . 103 PRO HG2  1 1 
        2  4640 1 1 103 PRO HG3  H  16.069   6.959  -8.742 1.00 . A A . 103 PRO HG3  1 1 
        2  4641 1 1 103 PRO N    N  13.799   8.952  -7.646 1.00 . A A . 103 PRO N    1 1 
        2  4642 1 1 103 PRO O    O  15.388  11.213  -7.496 1.00 . A A . 103 PRO O    1 1 
        2  4643 1 1 104 ILE C    C  18.157  11.924  -4.954 1.00 . A A . 104 ILE C    1 1 
        2  4644 1 1 104 ILE CA   C  16.659  12.096  -5.195 1.00 . A A . 104 ILE CA   1 1 
        2  4645 1 1 104 ILE CB   C  16.039  12.881  -4.018 1.00 . A A . 104 ILE CB   1 1 
        2  4646 1 1 104 ILE CD1  C  14.225  14.138  -5.304 1.00 . A A . 104 ILE CD1  1 1 
        2  4647 1 1 104 ILE CG1  C  14.539  13.096  -4.251 1.00 . A A . 104 ILE CG1  1 1 
        2  4648 1 1 104 ILE CG2  C  16.750  14.217  -3.829 1.00 . A A . 104 ILE CG2  1 1 
        2  4649 1 1 104 ILE H    H  16.006  10.162  -4.626 1.00 . A A . 104 ILE H    1 1 
        2  4650 1 1 104 ILE HA   H  16.512  12.668  -6.100 1.00 . A A . 104 ILE HA   1 1 
        2  4651 1 1 104 ILE HB   H  16.176  12.301  -3.119 1.00 . A A . 104 ILE HB   1 1 
        2  4652 1 1 104 ILE HD11 H  14.609  15.097  -4.988 1.00 . A A . 104 ILE HD11 1 1 
        2  4653 1 1 104 ILE HD12 H  13.155  14.207  -5.436 1.00 . A A . 104 ILE HD12 1 1 
        2  4654 1 1 104 ILE HD13 H  14.686  13.859  -6.239 1.00 . A A . 104 ILE HD13 1 1 
        2  4655 1 1 104 ILE HG12 H  14.095  12.164  -4.567 1.00 . A A . 104 ILE HG12 1 1 
        2  4656 1 1 104 ILE HG13 H  14.082  13.409  -3.325 1.00 . A A . 104 ILE HG13 1 1 
        2  4657 1 1 104 ILE HG21 H  16.612  14.826  -4.710 1.00 . A A . 104 ILE HG21 1 1 
        2  4658 1 1 104 ILE HG22 H  17.804  14.043  -3.672 1.00 . A A . 104 ILE HG22 1 1 
        2  4659 1 1 104 ILE HG23 H  16.337  14.725  -2.971 1.00 . A A . 104 ILE HG23 1 1 
        2  4660 1 1 104 ILE N    N  16.008  10.802  -5.371 1.00 . A A . 104 ILE N    1 1 
        2  4661 1 1 104 ILE O    O  18.965  12.721  -5.430 1.00 . A A . 104 ILE O    1 1 
        2  4662 1 1 105 THR C    C  20.110   9.167  -3.451 1.00 . A A . 105 THR C    1 1 
        2  4663 1 1 105 THR CA   C  19.918  10.610  -3.909 1.00 . A A . 105 THR CA   1 1 
        2  4664 1 1 105 THR CB   C  20.423  11.571  -2.832 1.00 . A A . 105 THR CB   1 1 
        2  4665 1 1 105 THR CG2  C  21.910  11.840  -2.918 1.00 . A A . 105 THR CG2  1 1 
        2  4666 1 1 105 THR H    H  17.827  10.284  -3.859 1.00 . A A . 105 THR H    1 1 
        2  4667 1 1 105 THR HA   H  20.488  10.767  -4.813 1.00 . A A . 105 THR HA   1 1 
        2  4668 1 1 105 THR HB   H  20.221  11.142  -1.859 1.00 . A A . 105 THR HB   1 1 
        2  4669 1 1 105 THR HG1  H  19.976  13.242  -3.748 1.00 . A A . 105 THR HG1  1 1 
        2  4670 1 1 105 THR HG21 H  22.264  12.213  -1.969 1.00 . A A . 105 THR HG21 1 1 
        2  4671 1 1 105 THR HG22 H  22.099  12.574  -3.687 1.00 . A A . 105 THR HG22 1 1 
        2  4672 1 1 105 THR HG23 H  22.429  10.924  -3.160 1.00 . A A . 105 THR HG23 1 1 
        2  4673 1 1 105 THR N    N  18.518  10.882  -4.211 1.00 . A A . 105 THR N    1 1 
        2  4674 1 1 105 THR O    O  20.896   8.893  -2.543 1.00 . A A . 105 THR O    1 1 
        2  4675 1 1 105 THR OG1  O  19.756  12.817  -2.916 1.00 . A A . 105 THR OG1  1 1 
        2  4676 1 1 106 ASP C    C  19.151   6.603  -2.272 1.00 . A A . 106 ASP C    1 1 
        2  4677 1 1 106 ASP CA   C  19.485   6.831  -3.744 1.00 . A A . 106 ASP CA   1 1 
        2  4678 1 1 106 ASP CB   C  20.890   6.305  -4.053 1.00 . A A . 106 ASP CB   1 1 
        2  4679 1 1 106 ASP CG   C  20.861   4.957  -4.746 1.00 . A A . 106 ASP CG   1 1 
        2  4680 1 1 106 ASP H    H  18.783   8.526  -4.803 1.00 . A A . 106 ASP H    1 1 
        2  4681 1 1 106 ASP HA   H  18.770   6.297  -4.350 1.00 . A A . 106 ASP HA   1 1 
        2  4682 1 1 106 ASP HB2  H  21.398   7.008  -4.696 1.00 . A A . 106 ASP HB2  1 1 
        2  4683 1 1 106 ASP HB3  H  21.442   6.203  -3.130 1.00 . A A . 106 ASP HB3  1 1 
        2  4684 1 1 106 ASP N    N  19.391   8.247  -4.087 1.00 . A A . 106 ASP N    1 1 
        2  4685 1 1 106 ASP O    O  19.875   5.907  -1.559 1.00 . A A . 106 ASP O    1 1 
        2  4686 1 1 106 ASP OD1  O  19.937   4.724  -5.554 1.00 . A A . 106 ASP OD1  1 1 
        2  4687 1 1 106 ASP OD2  O  21.764   4.135  -4.484 1.00 . A A . 106 ASP OD2  1 1 
        2  4688 1 1 107 ASP C    C  16.290   7.787  -0.217 1.00 . A A . 107 ASP C    1 1 
        2  4689 1 1 107 ASP CA   C  17.612   7.058  -0.439 1.00 . A A . 107 ASP CA   1 1 
        2  4690 1 1 107 ASP CB   C  18.677   7.609   0.511 1.00 . A A . 107 ASP CB   1 1 
        2  4691 1 1 107 ASP CG   C  18.378   7.290   1.963 1.00 . A A . 107 ASP CG   1 1 
        2  4692 1 1 107 ASP H    H  17.513   7.735  -2.444 1.00 . A A . 107 ASP H    1 1 
        2  4693 1 1 107 ASP HA   H  17.470   6.008  -0.237 1.00 . A A . 107 ASP HA   1 1 
        2  4694 1 1 107 ASP HB2  H  19.634   7.177   0.258 1.00 . A A . 107 ASP HB2  1 1 
        2  4695 1 1 107 ASP HB3  H  18.729   8.681   0.400 1.00 . A A . 107 ASP HB3  1 1 
        2  4696 1 1 107 ASP N    N  18.048   7.194  -1.825 1.00 . A A . 107 ASP N    1 1 
        2  4697 1 1 107 ASP O    O  15.420   7.309   0.513 1.00 . A A . 107 ASP O    1 1 
        2  4698 1 1 107 ASP OD1  O  17.483   7.942   2.541 1.00 . A A . 107 ASP OD1  1 1 
        2  4699 1 1 107 ASP OD2  O  19.039   6.389   2.521 1.00 . A A . 107 ASP OD2  1 1 
        2  4700 1 1 108 LEU C    C  14.252   9.869  -2.098 1.00 . A A . 108 LEU C    1 1 
        2  4701 1 1 108 LEU CA   C  14.929   9.741  -0.739 1.00 . A A . 108 LEU CA   1 1 
        2  4702 1 1 108 LEU CB   C  15.243  11.132  -0.171 1.00 . A A . 108 LEU CB   1 1 
        2  4703 1 1 108 LEU CD1  C  16.922  12.977   0.105 1.00 . A A . 108 LEU CD1  1 1 
        2  4704 1 1 108 LEU CD2  C  17.368  10.727   1.099 1.00 . A A . 108 LEU CD2  1 1 
        2  4705 1 1 108 LEU CG   C  16.732  11.477  -0.061 1.00 . A A . 108 LEU CG   1 1 
        2  4706 1 1 108 LEU H    H  16.873   9.266  -1.428 1.00 . A A . 108 LEU H    1 1 
        2  4707 1 1 108 LEU HA   H  14.260   9.226  -0.064 1.00 . A A . 108 LEU HA   1 1 
        2  4708 1 1 108 LEU HB2  H  14.770  11.872  -0.800 1.00 . A A . 108 LEU HB2  1 1 
        2  4709 1 1 108 LEU HB3  H  14.811  11.198   0.817 1.00 . A A . 108 LEU HB3  1 1 
        2  4710 1 1 108 LEU HD11 H  16.245  13.343   0.863 1.00 . A A . 108 LEU HD11 1 1 
        2  4711 1 1 108 LEU HD12 H  16.714  13.471  -0.833 1.00 . A A . 108 LEU HD12 1 1 
        2  4712 1 1 108 LEU HD13 H  17.939  13.180   0.402 1.00 . A A . 108 LEU HD13 1 1 
        2  4713 1 1 108 LEU HD21 H  18.421  10.589   0.904 1.00 . A A . 108 LEU HD21 1 1 
        2  4714 1 1 108 LEU HD22 H  16.894   9.763   1.208 1.00 . A A . 108 LEU HD22 1 1 
        2  4715 1 1 108 LEU HD23 H  17.242  11.295   2.009 1.00 . A A . 108 LEU HD23 1 1 
        2  4716 1 1 108 LEU HG   H  17.230  11.176  -0.970 1.00 . A A . 108 LEU HG   1 1 
        2  4717 1 1 108 LEU N    N  16.145   8.943  -0.856 1.00 . A A . 108 LEU N    1 1 
        2  4718 1 1 108 LEU O    O  14.720  10.603  -2.968 1.00 . A A . 108 LEU O    1 1 
        2  4719 1 1 109 ASP C    C  10.960   9.498  -3.345 1.00 . A A . 109 ASP C    1 1 
        2  4720 1 1 109 ASP CA   C  12.434   9.166  -3.551 1.00 . A A . 109 ASP CA   1 1 
        2  4721 1 1 109 ASP CB   C  12.556   7.816  -4.268 1.00 . A A . 109 ASP CB   1 1 
        2  4722 1 1 109 ASP CG   C  13.850   7.090  -3.947 1.00 . A A . 109 ASP CG   1 1 
        2  4723 1 1 109 ASP H    H  12.836   8.563  -1.559 1.00 . A A . 109 ASP H    1 1 
        2  4724 1 1 109 ASP HA   H  12.879   9.930  -4.169 1.00 . A A . 109 ASP HA   1 1 
        2  4725 1 1 109 ASP HB2  H  11.731   7.184  -3.974 1.00 . A A . 109 ASP HB2  1 1 
        2  4726 1 1 109 ASP HB3  H  12.513   7.979  -5.336 1.00 . A A . 109 ASP HB3  1 1 
        2  4727 1 1 109 ASP N    N  13.157   9.139  -2.284 1.00 . A A . 109 ASP N    1 1 
        2  4728 1 1 109 ASP O    O  10.435   9.397  -2.236 1.00 . A A . 109 ASP O    1 1 
        2  4729 1 1 109 ASP OD1  O  14.875   7.770  -3.730 1.00 . A A . 109 ASP OD1  1 1 
        2  4730 1 1 109 ASP OD2  O  13.837   5.842  -3.912 1.00 . A A . 109 ASP OD2  1 1 
        2  4731 1 1 110 ILE C    C   8.078   9.225  -5.223 1.00 . A A . 110 ILE C    1 1 
        2  4732 1 1 110 ILE CA   C   8.881  10.220  -4.393 1.00 . A A . 110 ILE CA   1 1 
        2  4733 1 1 110 ILE CB   C   8.624  11.646  -4.924 1.00 . A A . 110 ILE CB   1 1 
        2  4734 1 1 110 ILE CD1  C   8.064  12.455  -7.273 1.00 . A A . 110 ILE CD1  1 1 
        2  4735 1 1 110 ILE CG1  C   9.074  11.763  -6.384 1.00 . A A . 110 ILE CG1  1 1 
        2  4736 1 1 110 ILE CG2  C   9.337  12.675  -4.058 1.00 . A A . 110 ILE CG2  1 1 
        2  4737 1 1 110 ILE H    H  10.775   9.935  -5.285 1.00 . A A . 110 ILE H    1 1 
        2  4738 1 1 110 ILE HA   H   8.551  10.173  -3.367 1.00 . A A . 110 ILE HA   1 1 
        2  4739 1 1 110 ILE HB   H   7.563  11.840  -4.868 1.00 . A A . 110 ILE HB   1 1 
        2  4740 1 1 110 ILE HD11 H   8.414  13.449  -7.508 1.00 . A A . 110 ILE HD11 1 1 
        2  4741 1 1 110 ILE HD12 H   7.116  12.519  -6.758 1.00 . A A . 110 ILE HD12 1 1 
        2  4742 1 1 110 ILE HD13 H   7.941  11.891  -8.185 1.00 . A A . 110 ILE HD13 1 1 
        2  4743 1 1 110 ILE HG12 H   9.994  12.329  -6.427 1.00 . A A . 110 ILE HG12 1 1 
        2  4744 1 1 110 ILE HG13 H   9.245  10.774  -6.783 1.00 . A A . 110 ILE HG13 1 1 
        2  4745 1 1 110 ILE HG21 H  10.005  12.170  -3.376 1.00 . A A . 110 ILE HG21 1 1 
        2  4746 1 1 110 ILE HG22 H   8.609  13.241  -3.498 1.00 . A A . 110 ILE HG22 1 1 
        2  4747 1 1 110 ILE HG23 H   9.906  13.344  -4.688 1.00 . A A . 110 ILE HG23 1 1 
        2  4748 1 1 110 ILE N    N  10.298   9.884  -4.431 1.00 . A A . 110 ILE N    1 1 
        2  4749 1 1 110 ILE O    O   8.632   8.550  -6.092 1.00 . A A . 110 ILE O    1 1 
        2  4750 1 1 111 TYR C    C   4.469   8.626  -5.663 1.00 . A A . 111 TYR C    1 1 
        2  4751 1 1 111 TYR CA   C   5.932   8.194  -5.690 1.00 . A A . 111 TYR CA   1 1 
        2  4752 1 1 111 TYR CB   C   6.069   6.785  -5.110 1.00 . A A . 111 TYR CB   1 1 
        2  4753 1 1 111 TYR CD1  C   4.209   6.344  -3.461 1.00 . A A . 111 TYR CD1  1 1 
        2  4754 1 1 111 TYR CD2  C   6.379   6.837  -2.605 1.00 . A A . 111 TYR CD2  1 1 
        2  4755 1 1 111 TYR CE1  C   3.724   6.221  -2.172 1.00 . A A . 111 TYR CE1  1 1 
        2  4756 1 1 111 TYR CE2  C   5.901   6.716  -1.314 1.00 . A A . 111 TYR CE2  1 1 
        2  4757 1 1 111 TYR CG   C   5.543   6.653  -3.699 1.00 . A A . 111 TYR CG   1 1 
        2  4758 1 1 111 TYR CZ   C   4.575   6.408  -1.102 1.00 . A A . 111 TYR CZ   1 1 
        2  4759 1 1 111 TYR H    H   6.388   9.681  -4.246 1.00 . A A . 111 TYR H    1 1 
        2  4760 1 1 111 TYR HA   H   6.270   8.182  -6.714 1.00 . A A . 111 TYR HA   1 1 
        2  4761 1 1 111 TYR HB2  H   5.521   6.093  -5.733 1.00 . A A . 111 TYR HB2  1 1 
        2  4762 1 1 111 TYR HB3  H   7.112   6.505  -5.105 1.00 . A A . 111 TYR HB3  1 1 
        2  4763 1 1 111 TYR HD1  H   3.546   6.199  -4.299 1.00 . A A . 111 TYR HD1  1 1 
        2  4764 1 1 111 TYR HD2  H   7.418   7.078  -2.773 1.00 . A A . 111 TYR HD2  1 1 
        2  4765 1 1 111 TYR HE1  H   2.685   5.982  -2.007 1.00 . A A . 111 TYR HE1  1 1 
        2  4766 1 1 111 TYR HE2  H   6.568   6.861  -0.477 1.00 . A A . 111 TYR HE2  1 1 
        2  4767 1 1 111 TYR HH   H   3.472   5.559   0.223 1.00 . A A . 111 TYR HH   1 1 
        2  4768 1 1 111 TYR N    N   6.780   9.124  -4.954 1.00 . A A . 111 TYR N    1 1 
        2  4769 1 1 111 TYR O    O   3.954   9.058  -4.632 1.00 . A A . 111 TYR O    1 1 
        2  4770 1 1 111 TYR OH   O   4.095   6.288   0.182 1.00 . A A . 111 TYR OH   1 1 
        2  4771 1 1 112 THR C    C   1.627   7.741  -7.637 1.00 . A A . 112 THR C    1 1 
        2  4772 1 1 112 THR CA   C   2.397   8.851  -6.927 1.00 . A A . 112 THR CA   1 1 
        2  4773 1 1 112 THR CB   C   2.242  10.168  -7.689 1.00 . A A . 112 THR CB   1 1 
        2  4774 1 1 112 THR CG2  C   3.051  10.223  -8.967 1.00 . A A . 112 THR CG2  1 1 
        2  4775 1 1 112 THR H    H   4.275   8.132  -7.590 1.00 . A A . 112 THR H    1 1 
        2  4776 1 1 112 THR HA   H   2.000   8.969  -5.931 1.00 . A A . 112 THR HA   1 1 
        2  4777 1 1 112 THR HB   H   2.572  10.978  -7.054 1.00 . A A . 112 THR HB   1 1 
        2  4778 1 1 112 THR HG1  H   0.335  10.259  -7.253 1.00 . A A . 112 THR HG1  1 1 
        2  4779 1 1 112 THR HG21 H   3.941   9.624  -8.855 1.00 . A A . 112 THR HG21 1 1 
        2  4780 1 1 112 THR HG22 H   3.328  11.246  -9.173 1.00 . A A . 112 THR HG22 1 1 
        2  4781 1 1 112 THR HG23 H   2.457   9.840  -9.784 1.00 . A A . 112 THR HG23 1 1 
        2  4782 1 1 112 THR N    N   3.806   8.491  -6.807 1.00 . A A . 112 THR N    1 1 
        2  4783 1 1 112 THR O    O   2.008   7.307  -8.722 1.00 . A A . 112 THR O    1 1 
        2  4784 1 1 112 THR OG1  O   0.885  10.394  -8.028 1.00 . A A . 112 THR OG1  1 1 
        2  4785 1 1 113 ARG C    C  -1.690   6.676  -7.852 1.00 . A A . 113 ARG C    1 1 
        2  4786 1 1 113 ARG CA   C  -0.264   6.209  -7.583 1.00 . A A . 113 ARG CA   1 1 
        2  4787 1 1 113 ARG CB   C  -0.282   5.002  -6.642 1.00 . A A . 113 ARG CB   1 1 
        2  4788 1 1 113 ARG CD   C  -1.040   4.255  -4.361 1.00 . A A . 113 ARG CD   1 1 
        2  4789 1 1 113 ARG CG   C  -0.412   5.375  -5.175 1.00 . A A . 113 ARG CG   1 1 
        2  4790 1 1 113 ARG CZ   C  -0.498   3.241  -2.177 1.00 . A A . 113 ARG CZ   1 1 
        2  4791 1 1 113 ARG H    H   0.299   7.658  -6.145 1.00 . A A . 113 ARG H    1 1 
        2  4792 1 1 113 ARG HA   H   0.188   5.915  -8.517 1.00 . A A . 113 ARG HA   1 1 
        2  4793 1 1 113 ARG HB2  H  -1.116   4.367  -6.906 1.00 . A A . 113 ARG HB2  1 1 
        2  4794 1 1 113 ARG HB3  H   0.635   4.446  -6.770 1.00 . A A . 113 ARG HB3  1 1 
        2  4795 1 1 113 ARG HD2  H  -1.918   4.639  -3.865 1.00 . A A . 113 ARG HD2  1 1 
        2  4796 1 1 113 ARG HD3  H  -1.325   3.455  -5.029 1.00 . A A . 113 ARG HD3  1 1 
        2  4797 1 1 113 ARG HE   H   0.839   3.743  -3.572 1.00 . A A . 113 ARG HE   1 1 
        2  4798 1 1 113 ARG HG2  H   0.570   5.585  -4.778 1.00 . A A . 113 ARG HG2  1 1 
        2  4799 1 1 113 ARG HG3  H  -1.030   6.258  -5.093 1.00 . A A . 113 ARG HG3  1 1 
        2  4800 1 1 113 ARG HH11 H  -2.477   3.523  -2.487 1.00 . A A . 113 ARG HH11 1 1 
        2  4801 1 1 113 ARG HH12 H  -2.058   2.825  -0.960 1.00 . A A . 113 ARG HH12 1 1 
        2  4802 1 1 113 ARG HH21 H   1.382   2.823  -1.564 1.00 . A A . 113 ARG HH21 1 1 
        2  4803 1 1 113 ARG HH22 H   0.129   2.427  -0.436 1.00 . A A . 113 ARG HH22 1 1 
        2  4804 1 1 113 ARG N    N   0.549   7.279  -7.012 1.00 . A A . 113 ARG N    1 1 
        2  4805 1 1 113 ARG NE   N  -0.117   3.729  -3.356 1.00 . A A . 113 ARG NE   1 1 
        2  4806 1 1 113 ARG NH1  N  -1.785   3.193  -1.848 1.00 . A A . 113 ARG NH1  1 1 
        2  4807 1 1 113 ARG NH2  N   0.412   2.793  -1.323 1.00 . A A . 113 ARG NH2  1 1 
        2  4808 1 1 113 ARG O    O  -2.342   7.252  -6.982 1.00 . A A . 113 ARG O    1 1 
        2  4809 1 1 114 LEU C    C  -4.239   5.610 -10.111 1.00 . A A . 114 LEU C    1 1 
        2  4810 1 1 114 LEU CA   C  -3.524   6.790  -9.460 1.00 . A A . 114 LEU CA   1 1 
        2  4811 1 1 114 LEU CB   C  -3.481   7.980 -10.427 1.00 . A A . 114 LEU CB   1 1 
        2  4812 1 1 114 LEU CD1  C  -4.888   9.905 -11.214 1.00 . A A . 114 LEU CD1  1 1 
        2  4813 1 1 114 LEU CD2  C  -5.105   7.671 -12.315 1.00 . A A . 114 LEU CD2  1 1 
        2  4814 1 1 114 LEU CG   C  -4.837   8.399 -11.005 1.00 . A A . 114 LEU CG   1 1 
        2  4815 1 1 114 LEU H    H  -1.599   5.941  -9.711 1.00 . A A . 114 LEU H    1 1 
        2  4816 1 1 114 LEU HA   H  -4.061   7.078  -8.569 1.00 . A A . 114 LEU HA   1 1 
        2  4817 1 1 114 LEU HB2  H  -3.060   8.826  -9.903 1.00 . A A . 114 LEU HB2  1 1 
        2  4818 1 1 114 LEU HB3  H  -2.828   7.725 -11.248 1.00 . A A . 114 LEU HB3  1 1 
        2  4819 1 1 114 LEU HD11 H  -5.425  10.126 -12.126 1.00 . A A . 114 LEU HD11 1 1 
        2  4820 1 1 114 LEU HD12 H  -3.883  10.294 -11.287 1.00 . A A . 114 LEU HD12 1 1 
        2  4821 1 1 114 LEU HD13 H  -5.393  10.369 -10.380 1.00 . A A . 114 LEU HD13 1 1 
        2  4822 1 1 114 LEU HD21 H  -4.515   6.766 -12.351 1.00 . A A . 114 LEU HD21 1 1 
        2  4823 1 1 114 LEU HD22 H  -4.833   8.309 -13.142 1.00 . A A . 114 LEU HD22 1 1 
        2  4824 1 1 114 LEU HD23 H  -6.153   7.420 -12.380 1.00 . A A . 114 LEU HD23 1 1 
        2  4825 1 1 114 LEU HG   H  -5.617   8.132 -10.308 1.00 . A A . 114 LEU HG   1 1 
        2  4826 1 1 114 LEU N    N  -2.170   6.411  -9.065 1.00 . A A . 114 LEU N    1 1 
        2  4827 1 1 114 LEU O    O  -3.759   5.050 -11.096 1.00 . A A . 114 LEU O    1 1 
        2  4828 1 1 115 GLY C    C  -7.454   3.891  -9.372 1.00 . A A . 115 GLY C    1 1 
        2  4829 1 1 115 GLY CA   C  -6.137   4.112 -10.093 1.00 . A A . 115 GLY CA   1 1 
        2  4830 1 1 115 GLY H    H  -5.720   5.707  -8.761 1.00 . A A . 115 GLY H    1 1 
        2  4831 1 1 115 GLY HA2  H  -6.340   4.303 -11.138 1.00 . A A . 115 GLY HA2  1 1 
        2  4832 1 1 115 GLY HA3  H  -5.540   3.216 -10.012 1.00 . A A . 115 GLY HA3  1 1 
        2  4833 1 1 115 GLY N    N  -5.385   5.230  -9.551 1.00 . A A . 115 GLY N    1 1 
        2  4834 1 1 115 GLY O    O  -8.144   4.848  -9.023 1.00 . A A . 115 GLY O    1 1 
        2  4835 1 1 116 GLY C    C  -8.907   1.188  -7.471 1.00 . A A . 116 GLY C    1 1 
        2  4836 1 1 116 GLY CA   C  -9.049   2.316  -8.472 1.00 . A A . 116 GLY CA   1 1 
        2  4837 1 1 116 GLY H    H  -7.218   1.900  -9.452 1.00 . A A . 116 GLY H    1 1 
        2  4838 1 1 116 GLY HA2  H  -9.390   3.199  -7.953 1.00 . A A . 116 GLY HA2  1 1 
        2  4839 1 1 116 GLY HA3  H  -9.788   2.038  -9.208 1.00 . A A . 116 GLY HA3  1 1 
        2  4840 1 1 116 GLY N    N  -7.805   2.626  -9.151 1.00 . A A . 116 GLY N    1 1 
        2  4841 1 1 116 GLY O    O  -7.934   0.434  -7.506 1.00 . A A . 116 GLY O    1 1 
        2  4842 1 1 117 MET C    C -11.125  -0.834  -5.651 1.00 . A A . 117 MET C    1 1 
        2  4843 1 1 117 MET CA   C  -9.872   0.030  -5.556 1.00 . A A . 117 MET CA   1 1 
        2  4844 1 1 117 MET CB   C  -9.770   0.651  -4.163 1.00 . A A . 117 MET CB   1 1 
        2  4845 1 1 117 MET CE   C -13.240   1.437  -2.401 1.00 . A A . 117 MET CE   1 1 
        2  4846 1 1 117 MET CG   C -10.886   1.636  -3.853 1.00 . A A . 117 MET CG   1 1 
        2  4847 1 1 117 MET H    H -10.632   1.705  -6.602 1.00 . A A . 117 MET H    1 1 
        2  4848 1 1 117 MET HA   H  -9.005  -0.592  -5.728 1.00 . A A . 117 MET HA   1 1 
        2  4849 1 1 117 MET HB2  H  -9.801  -0.137  -3.426 1.00 . A A . 117 MET HB2  1 1 
        2  4850 1 1 117 MET HB3  H  -8.828   1.173  -4.082 1.00 . A A . 117 MET HB3  1 1 
        2  4851 1 1 117 MET HE1  H -13.455   1.469  -3.459 1.00 . A A . 117 MET HE1  1 1 
        2  4852 1 1 117 MET HE2  H -13.710   2.276  -1.912 1.00 . A A . 117 MET HE2  1 1 
        2  4853 1 1 117 MET HE3  H -13.621   0.515  -1.984 1.00 . A A . 117 MET HE3  1 1 
        2  4854 1 1 117 MET HG2  H -10.522   2.639  -4.022 1.00 . A A . 117 MET HG2  1 1 
        2  4855 1 1 117 MET HG3  H -11.716   1.440  -4.516 1.00 . A A . 117 MET HG3  1 1 
        2  4856 1 1 117 MET N    N  -9.884   1.072  -6.576 1.00 . A A . 117 MET N    1 1 
        2  4857 1 1 117 MET O    O -12.235  -0.320  -5.805 1.00 . A A . 117 MET O    1 1 
        2  4858 1 1 117 MET SD   S -11.468   1.515  -2.150 1.00 . A A . 117 MET SD   1 1 
        2  4859 1 1 118 VAL C    C -12.028  -4.064  -4.462 1.00 . A A . 118 VAL C    1 1 
        2  4860 1 1 118 VAL CA   C -12.056  -3.086  -5.633 1.00 . A A . 118 VAL CA   1 1 
        2  4861 1 1 118 VAL CB   C -12.042  -3.885  -6.954 1.00 . A A . 118 VAL CB   1 1 
        2  4862 1 1 118 VAL CG1  C -13.437  -4.396  -7.281 1.00 . A A . 118 VAL CG1  1 1 
        2  4863 1 1 118 VAL CG2  C -11.494  -3.041  -8.098 1.00 . A A . 118 VAL CG2  1 1 
        2  4864 1 1 118 VAL H    H -10.033  -2.496  -5.434 1.00 . A A . 118 VAL H    1 1 
        2  4865 1 1 118 VAL HA   H -12.974  -2.516  -5.591 1.00 . A A . 118 VAL HA   1 1 
        2  4866 1 1 118 VAL HB   H -11.394  -4.740  -6.824 1.00 . A A . 118 VAL HB   1 1 
        2  4867 1 1 118 VAL HG11 H -13.964  -3.655  -7.864 1.00 . A A . 118 VAL HG11 1 1 
        2  4868 1 1 118 VAL HG12 H -13.977  -4.582  -6.364 1.00 . A A . 118 VAL HG12 1 1 
        2  4869 1 1 118 VAL HG13 H -13.363  -5.313  -7.847 1.00 . A A . 118 VAL HG13 1 1 
        2  4870 1 1 118 VAL HG21 H -11.530  -1.996  -7.825 1.00 . A A . 118 VAL HG21 1 1 
        2  4871 1 1 118 VAL HG22 H -12.092  -3.202  -8.984 1.00 . A A . 118 VAL HG22 1 1 
        2  4872 1 1 118 VAL HG23 H -10.471  -3.325  -8.298 1.00 . A A . 118 VAL HG23 1 1 
        2  4873 1 1 118 VAL N    N -10.941  -2.148  -5.557 1.00 . A A . 118 VAL N    1 1 
        2  4874 1 1 118 VAL O    O -11.064  -4.808  -4.286 1.00 . A A . 118 VAL O    1 1 
        2  4875 1 1 119 TRP C    C -14.315  -5.951  -2.682 1.00 . A A . 119 TRP C    1 1 
        2  4876 1 1 119 TRP CA   C -13.185  -4.942  -2.506 1.00 . A A . 119 TRP CA   1 1 
        2  4877 1 1 119 TRP CB   C -13.410  -4.127  -1.231 1.00 . A A . 119 TRP CB   1 1 
        2  4878 1 1 119 TRP CD1  C -12.618  -6.060   0.253 1.00 . A A . 119 TRP CD1  1 1 
        2  4879 1 1 119 TRP CD2  C -14.156  -4.741   1.206 1.00 . A A . 119 TRP CD2  1 1 
        2  4880 1 1 119 TRP CE2  C -13.808  -5.755   2.117 1.00 . A A . 119 TRP CE2  1 1 
        2  4881 1 1 119 TRP CE3  C -15.109  -3.791   1.586 1.00 . A A . 119 TRP CE3  1 1 
        2  4882 1 1 119 TRP CG   C -13.383  -4.954   0.019 1.00 . A A . 119 TRP CG   1 1 
        2  4883 1 1 119 TRP CH2  C -15.308  -4.902   3.729 1.00 . A A . 119 TRP CH2  1 1 
        2  4884 1 1 119 TRP CZ2  C -14.379  -5.846   3.385 1.00 . A A . 119 TRP CZ2  1 1 
        2  4885 1 1 119 TRP CZ3  C -15.673  -3.881   2.843 1.00 . A A . 119 TRP CZ3  1 1 
        2  4886 1 1 119 TRP H    H -13.827  -3.439  -3.851 1.00 . A A . 119 TRP H    1 1 
        2  4887 1 1 119 TRP HA   H -12.251  -5.477  -2.420 1.00 . A A . 119 TRP HA   1 1 
        2  4888 1 1 119 TRP HB2  H -12.637  -3.377  -1.149 1.00 . A A . 119 TRP HB2  1 1 
        2  4889 1 1 119 TRP HB3  H -14.373  -3.641  -1.289 1.00 . A A . 119 TRP HB3  1 1 
        2  4890 1 1 119 TRP HD1  H -11.922  -6.480  -0.457 1.00 . A A . 119 TRP HD1  1 1 
        2  4891 1 1 119 TRP HE1  H -12.442  -7.335   1.913 1.00 . A A . 119 TRP HE1  1 1 
        2  4892 1 1 119 TRP HE3  H -15.403  -2.996   0.916 1.00 . A A . 119 TRP HE3  1 1 
        2  4893 1 1 119 TRP HH2  H -15.776  -4.935   4.703 1.00 . A A . 119 TRP HH2  1 1 
        2  4894 1 1 119 TRP HZ2  H -14.107  -6.625   4.080 1.00 . A A . 119 TRP HZ2  1 1 
        2  4895 1 1 119 TRP HZ3  H -16.411  -3.156   3.155 1.00 . A A . 119 TRP HZ3  1 1 
        2  4896 1 1 119 TRP N    N -13.090  -4.056  -3.661 1.00 . A A . 119 TRP N    1 1 
        2  4897 1 1 119 TRP NE1  N -12.868  -6.548   1.513 1.00 . A A . 119 TRP NE1  1 1 
        2  4898 1 1 119 TRP O    O -15.363  -5.633  -3.245 1.00 . A A . 119 TRP O    1 1 
        2  4899 1 1 120 ARG C    C -15.157  -9.057  -1.028 1.00 . A A . 120 ARG C    1 1 
        2  4900 1 1 120 ARG CA   C -15.102  -8.225  -2.305 1.00 . A A . 120 ARG CA   1 1 
        2  4901 1 1 120 ARG CB   C -14.800  -9.127  -3.504 1.00 . A A . 120 ARG CB   1 1 
        2  4902 1 1 120 ARG CD   C -14.802  -9.329  -6.009 1.00 . A A . 120 ARG CD   1 1 
        2  4903 1 1 120 ARG CG   C -15.425  -8.644  -4.802 1.00 . A A . 120 ARG CG   1 1 
        2  4904 1 1 120 ARG CZ   C -15.259 -11.258  -7.472 1.00 . A A . 120 ARG CZ   1 1 
        2  4905 1 1 120 ARG H    H -13.243  -7.369  -1.759 1.00 . A A . 120 ARG H    1 1 
        2  4906 1 1 120 ARG HA   H -16.062  -7.753  -2.455 1.00 . A A . 120 ARG HA   1 1 
        2  4907 1 1 120 ARG HB2  H -13.729  -9.177  -3.641 1.00 . A A . 120 ARG HB2  1 1 
        2  4908 1 1 120 ARG HB3  H -15.173 -10.119  -3.295 1.00 . A A . 120 ARG HB3  1 1 
        2  4909 1 1 120 ARG HD2  H -14.662  -8.594  -6.789 1.00 . A A . 120 ARG HD2  1 1 
        2  4910 1 1 120 ARG HD3  H -13.843  -9.735  -5.722 1.00 . A A . 120 ARG HD3  1 1 
        2  4911 1 1 120 ARG HE   H -16.537 -10.506  -6.136 1.00 . A A . 120 ARG HE   1 1 
        2  4912 1 1 120 ARG HG2  H -16.482  -8.863  -4.783 1.00 . A A . 120 ARG HG2  1 1 
        2  4913 1 1 120 ARG HG3  H -15.276  -7.579  -4.886 1.00 . A A . 120 ARG HG3  1 1 
        2  4914 1 1 120 ARG HH11 H -13.426 -10.439  -7.714 1.00 . A A . 120 ARG HH11 1 1 
        2  4915 1 1 120 ARG HH12 H -13.772 -11.796  -8.730 1.00 . A A . 120 ARG HH12 1 1 
        2  4916 1 1 120 ARG HH21 H -16.995 -12.293  -7.472 1.00 . A A . 120 ARG HH21 1 1 
        2  4917 1 1 120 ARG HH22 H -15.798 -12.849  -8.594 1.00 . A A . 120 ARG HH22 1 1 
        2  4918 1 1 120 ARG N    N -14.097  -7.172  -2.199 1.00 . A A . 120 ARG N    1 1 
        2  4919 1 1 120 ARG NE   N -15.642 -10.409  -6.520 1.00 . A A . 120 ARG NE   1 1 
        2  4920 1 1 120 ARG NH1  N -14.053 -11.155  -8.016 1.00 . A A . 120 ARG NH1  1 1 
        2  4921 1 1 120 ARG NH2  N -16.085 -12.211  -7.880 1.00 . A A . 120 ARG NH2  1 1 
        2  4922 1 1 120 ARG O    O -14.166  -9.670  -0.632 1.00 . A A . 120 ARG O    1 1 
        2  4923 1 1 121 ALA C    C -17.810 -10.618   0.816 1.00 . A A . 121 ALA C    1 1 
        2  4924 1 1 121 ALA CA   C -16.507  -9.826   0.847 1.00 . A A . 121 ALA CA   1 1 
        2  4925 1 1 121 ALA CB   C -16.482  -8.892   2.046 1.00 . A A . 121 ALA CB   1 1 
        2  4926 1 1 121 ALA H    H -17.075  -8.562  -0.752 1.00 . A A . 121 ALA H    1 1 
        2  4927 1 1 121 ALA HA   H -15.680 -10.517   0.940 1.00 . A A . 121 ALA HA   1 1 
        2  4928 1 1 121 ALA HB1  H -17.494  -8.666   2.348 1.00 . A A . 121 ALA HB1  1 1 
        2  4929 1 1 121 ALA HB2  H -15.976  -7.977   1.778 1.00 . A A . 121 ALA HB2  1 1 
        2  4930 1 1 121 ALA HB3  H -15.958  -9.367   2.862 1.00 . A A . 121 ALA HB3  1 1 
        2  4931 1 1 121 ALA N    N -16.322  -9.071  -0.388 1.00 . A A . 121 ALA N    1 1 
        2  4932 1 1 121 ALA O    O -18.748 -10.258   0.105 1.00 . A A . 121 ALA O    1 1 
        2  4933 1 1 122 ASP C    C -19.068 -13.364   2.934 1.00 . A A . 122 ASP C    1 1 
        2  4934 1 1 122 ASP CA   C -19.052 -12.537   1.653 1.00 . A A . 122 ASP CA   1 1 
        2  4935 1 1 122 ASP CB   C -19.111 -13.461   0.435 1.00 . A A . 122 ASP CB   1 1 
        2  4936 1 1 122 ASP CG   C -17.896 -14.360   0.332 1.00 . A A . 122 ASP CG   1 1 
        2  4937 1 1 122 ASP H    H -17.081 -11.931   2.135 1.00 . A A . 122 ASP H    1 1 
        2  4938 1 1 122 ASP HA   H -19.914 -11.889   1.645 1.00 . A A . 122 ASP HA   1 1 
        2  4939 1 1 122 ASP HB2  H -19.991 -14.082   0.506 1.00 . A A . 122 ASP HB2  1 1 
        2  4940 1 1 122 ASP HB3  H -19.171 -12.861  -0.461 1.00 . A A . 122 ASP HB3  1 1 
        2  4941 1 1 122 ASP N    N -17.862 -11.696   1.593 1.00 . A A . 122 ASP N    1 1 
        2  4942 1 1 122 ASP O    O -18.074 -13.999   3.289 1.00 . A A . 122 ASP O    1 1 
        2  4943 1 1 122 ASP OD1  O -16.816 -13.860  -0.051 1.00 . A A . 122 ASP OD1  1 1 
        2  4944 1 1 122 ASP OD2  O -18.021 -15.565   0.634 1.00 . A A . 122 ASP OD2  1 1 
        2  4945 1 1 123 SER C    C -21.626 -14.943   4.850 1.00 . A A . 123 SER C    1 1 
        2  4946 1 1 123 SER CA   C -20.351 -14.105   4.867 1.00 . A A . 123 SER CA   1 1 
        2  4947 1 1 123 SER CB   C -20.372 -13.151   6.062 1.00 . A A . 123 SER CB   1 1 
        2  4948 1 1 123 SER H    H -20.962 -12.830   3.291 1.00 . A A . 123 SER H    1 1 
        2  4949 1 1 123 SER HA   H -19.502 -14.764   4.957 1.00 . A A . 123 SER HA   1 1 
        2  4950 1 1 123 SER HB2  H -19.482 -12.539   6.047 1.00 . A A . 123 SER HB2  1 1 
        2  4951 1 1 123 SER HB3  H -21.245 -12.519   6.001 1.00 . A A . 123 SER HB3  1 1 
        2  4952 1 1 123 SER HG   H -21.277 -14.262   7.397 1.00 . A A . 123 SER HG   1 1 
        2  4953 1 1 123 SER N    N -20.204 -13.355   3.624 1.00 . A A . 123 SER N    1 1 
        2  4954 1 1 123 SER O    O -22.710 -14.449   5.159 1.00 . A A . 123 SER O    1 1 
        2  4955 1 1 123 SER OG   O -20.411 -13.865   7.286 1.00 . A A . 123 SER OG   1 1 
        2  4956 1 1 124 LYS C    C -22.366 -18.371   5.266 1.00 . A A . 124 LYS C    1 1 
        2  4957 1 1 124 LYS CA   C -22.627 -17.121   4.431 1.00 . A A . 124 LYS CA   1 1 
        2  4958 1 1 124 LYS CB   C -22.921 -17.515   2.982 1.00 . A A . 124 LYS CB   1 1 
        2  4959 1 1 124 LYS CD   C -24.095 -16.962   0.829 1.00 . A A . 124 LYS CD   1 1 
        2  4960 1 1 124 LYS CE   C -23.289 -16.042  -0.073 1.00 . A A . 124 LYS CE   1 1 
        2  4961 1 1 124 LYS CG   C -23.922 -16.600   2.295 1.00 . A A . 124 LYS CG   1 1 
        2  4962 1 1 124 LYS H    H -20.596 -16.549   4.252 1.00 . A A . 124 LYS H    1 1 
        2  4963 1 1 124 LYS HA   H -23.483 -16.604   4.836 1.00 . A A . 124 LYS HA   1 1 
        2  4964 1 1 124 LYS HB2  H -21.999 -17.491   2.419 1.00 . A A . 124 LYS HB2  1 1 
        2  4965 1 1 124 LYS HB3  H -23.316 -18.520   2.967 1.00 . A A . 124 LYS HB3  1 1 
        2  4966 1 1 124 LYS HD2  H -23.763 -17.979   0.678 1.00 . A A . 124 LYS HD2  1 1 
        2  4967 1 1 124 LYS HD3  H -25.141 -16.882   0.571 1.00 . A A . 124 LYS HD3  1 1 
        2  4968 1 1 124 LYS HE2  H -22.892 -15.231   0.519 1.00 . A A . 124 LYS HE2  1 1 
        2  4969 1 1 124 LYS HE3  H -22.474 -16.605  -0.503 1.00 . A A . 124 LYS HE3  1 1 
        2  4970 1 1 124 LYS HG2  H -24.876 -16.688   2.792 1.00 . A A . 124 LYS HG2  1 1 
        2  4971 1 1 124 LYS HG3  H -23.570 -15.580   2.366 1.00 . A A . 124 LYS HG3  1 1 
        2  4972 1 1 124 LYS HZ1  H -24.555 -14.582  -0.868 1.00 . A A . 124 LYS HZ1  1 1 
        2  4973 1 1 124 LYS HZ2  H -24.872 -16.145  -1.433 1.00 . A A . 124 LYS HZ2  1 1 
        2  4974 1 1 124 LYS HZ3  H -23.528 -15.293  -2.010 1.00 . A A . 124 LYS HZ3  1 1 
        2  4975 1 1 124 LYS N    N -21.486 -16.214   4.488 1.00 . A A . 124 LYS N    1 1 
        2  4976 1 1 124 LYS NZ   N -24.119 -15.476  -1.173 1.00 . A A . 124 LYS NZ   1 1 
        2  4977 1 1 124 LYS O    O -21.871 -19.378   4.760 1.00 . A A . 124 LYS O    1 1 
        2  4978 1 1 125 GLY C    C -23.650 -20.421   7.383 1.00 . A A . 125 GLY C    1 1 
        2  4979 1 1 125 GLY CA   C -22.504 -19.431   7.434 1.00 . A A . 125 GLY CA   1 1 
        2  4980 1 1 125 GLY H    H -23.098 -17.471   6.898 1.00 . A A . 125 GLY H    1 1 
        2  4981 1 1 125 GLY HA2  H -21.593 -19.937   7.150 1.00 . A A . 125 GLY HA2  1 1 
        2  4982 1 1 125 GLY HA3  H -22.400 -19.069   8.445 1.00 . A A . 125 GLY HA3  1 1 
        2  4983 1 1 125 GLY N    N -22.706 -18.299   6.549 1.00 . A A . 125 GLY N    1 1 
        2  4984 1 1 125 GLY O    O -24.511 -20.430   8.264 1.00 . A A . 125 GLY O    1 1 
        2  4985 1 1 126 ASN C    C -24.154 -23.665   6.349 1.00 . A A . 126 ASN C    1 1 
        2  4986 1 1 126 ASN CA   C -24.714 -22.255   6.187 1.00 . A A . 126 ASN CA   1 1 
        2  4987 1 1 126 ASN CB   C -25.373 -22.112   4.814 1.00 . A A . 126 ASN CB   1 1 
        2  4988 1 1 126 ASN CG   C -26.029 -20.758   4.626 1.00 . A A . 126 ASN CG   1 1 
        2  4989 1 1 126 ASN H    H -22.949 -21.200   5.681 1.00 . A A . 126 ASN H    1 1 
        2  4990 1 1 126 ASN HA   H -25.455 -22.083   6.951 1.00 . A A . 126 ASN HA   1 1 
        2  4991 1 1 126 ASN HB2  H -24.624 -22.236   4.046 1.00 . A A . 126 ASN HB2  1 1 
        2  4992 1 1 126 ASN HB3  H -26.128 -22.876   4.701 1.00 . A A . 126 ASN HB3  1 1 
        2  4993 1 1 126 ASN HD21 H -25.312 -20.639   2.776 1.00 . A A . 126 ASN HD21 1 1 
        2  4994 1 1 126 ASN HD22 H -26.264 -19.295   3.300 1.00 . A A . 126 ASN HD22 1 1 
        2  4995 1 1 126 ASN N    N -23.662 -21.255   6.349 1.00 . A A . 126 ASN N    1 1 
        2  4996 1 1 126 ASN ND2  N -25.851 -20.171   3.448 1.00 . A A . 126 ASN ND2  1 1 
        2  4997 1 1 126 ASN O    O -23.023 -23.945   5.953 1.00 . A A . 126 ASN O    1 1 
        2  4998 1 1 126 ASN OD1  O -26.691 -20.246   5.530 1.00 . A A . 126 ASN OD1  1 1 
        2  4999 1 1 127 TYR C    C -24.761 -26.767   5.895 1.00 . A A . 127 TYR C    1 1 
        2  5000 1 1 127 TYR CA   C -24.541 -25.931   7.151 1.00 . A A . 127 TYR CA   1 1 
        2  5001 1 1 127 TYR CB   C -25.311 -26.539   8.324 1.00 . A A . 127 TYR CB   1 1 
        2  5002 1 1 127 TYR CD1  C -25.976 -24.725   9.949 1.00 . A A . 127 TYR CD1  1 1 
        2  5003 1 1 127 TYR CD2  C -24.132 -26.125  10.519 1.00 . A A . 127 TYR CD2  1 1 
        2  5004 1 1 127 TYR CE1  C -25.819 -24.030  11.135 1.00 . A A . 127 TYR CE1  1 1 
        2  5005 1 1 127 TYR CE2  C -23.970 -25.435  11.706 1.00 . A A . 127 TYR CE2  1 1 
        2  5006 1 1 127 TYR CG   C -25.136 -25.781   9.622 1.00 . A A . 127 TYR CG   1 1 
        2  5007 1 1 127 TYR CZ   C -24.816 -24.388  12.009 1.00 . A A . 127 TYR CZ   1 1 
        2  5008 1 1 127 TYR H    H -25.846 -24.265   7.229 1.00 . A A . 127 TYR H    1 1 
        2  5009 1 1 127 TYR HA   H -23.487 -25.927   7.387 1.00 . A A . 127 TYR HA   1 1 
        2  5010 1 1 127 TYR HB2  H -26.364 -26.550   8.087 1.00 . A A . 127 TYR HB2  1 1 
        2  5011 1 1 127 TYR HB3  H -24.971 -27.552   8.482 1.00 . A A . 127 TYR HB3  1 1 
        2  5012 1 1 127 TYR HD1  H -26.761 -24.445   9.263 1.00 . A A . 127 TYR HD1  1 1 
        2  5013 1 1 127 TYR HD2  H -23.470 -26.944  10.279 1.00 . A A . 127 TYR HD2  1 1 
        2  5014 1 1 127 TYR HE1  H -26.483 -23.210  11.371 1.00 . A A . 127 TYR HE1  1 1 
        2  5015 1 1 127 TYR HE2  H -23.184 -25.717  12.390 1.00 . A A . 127 TYR HE2  1 1 
        2  5016 1 1 127 TYR HH   H -23.845 -23.190  13.156 1.00 . A A . 127 TYR HH   1 1 
        2  5017 1 1 127 TYR N    N -24.955 -24.549   6.935 1.00 . A A . 127 TYR N    1 1 
        2  5018 1 1 127 TYR O    O -23.979 -27.669   5.591 1.00 . A A . 127 TYR O    1 1 
        2  5019 1 1 127 TYR OH   O -24.657 -23.700  13.190 1.00 . A A . 127 TYR OH   1 1 
        2  5020 1 1 128 ALA C    C -26.086 -26.266   2.727 1.00 . A A . 128 ALA C    1 1 
        2  5021 1 1 128 ALA CA   C -26.154 -27.185   3.942 1.00 . A A . 128 ALA CA   1 1 
        2  5022 1 1 128 ALA CB   C -27.532 -27.818   4.051 1.00 . A A . 128 ALA CB   1 1 
        2  5023 1 1 128 ALA H    H -26.416 -25.732   5.459 1.00 . A A . 128 ALA H    1 1 
        2  5024 1 1 128 ALA HA   H -25.428 -27.977   3.821 1.00 . A A . 128 ALA HA   1 1 
        2  5025 1 1 128 ALA HB1  H -28.142 -27.240   4.730 1.00 . A A . 128 ALA HB1  1 1 
        2  5026 1 1 128 ALA HB2  H -27.436 -28.828   4.424 1.00 . A A . 128 ALA HB2  1 1 
        2  5027 1 1 128 ALA HB3  H -27.998 -27.838   3.076 1.00 . A A . 128 ALA HB3  1 1 
        2  5028 1 1 128 ALA N    N -25.831 -26.461   5.166 1.00 . A A . 128 ALA N    1 1 
        2  5029 1 1 128 ALA O    O -25.719 -25.097   2.842 1.00 . A A . 128 ALA O    1 1 
        2  5030 1 1 129 SER C    C -27.837 -25.690  -0.127 1.00 . A A . 129 SER C    1 1 
        2  5031 1 1 129 SER CA   C -26.421 -26.031   0.327 1.00 . A A . 129 SER CA   1 1 
        2  5032 1 1 129 SER CB   C -25.692 -26.808  -0.771 1.00 . A A . 129 SER CB   1 1 
        2  5033 1 1 129 SER H    H -26.725 -27.741   1.537 1.00 . A A . 129 SER H    1 1 
        2  5034 1 1 129 SER HA   H -25.887 -25.112   0.519 1.00 . A A . 129 SER HA   1 1 
        2  5035 1 1 129 SER HB2  H -24.687 -27.029  -0.445 1.00 . A A . 129 SER HB2  1 1 
        2  5036 1 1 129 SER HB3  H -26.219 -27.731  -0.964 1.00 . A A . 129 SER HB3  1 1 
        2  5037 1 1 129 SER HG   H -26.514 -25.938  -2.321 1.00 . A A . 129 SER HG   1 1 
        2  5038 1 1 129 SER N    N -26.442 -26.802   1.565 1.00 . A A . 129 SER N    1 1 
        2  5039 1 1 129 SER O    O -28.170 -25.809  -1.306 1.00 . A A . 129 SER O    1 1 
        2  5040 1 1 129 SER OG   O -25.628 -26.058  -1.971 1.00 . A A . 129 SER OG   1 1 
        2  5041 1 1 130 THR C    C -30.113 -23.611  -0.288 1.00 . A A . 130 THR C    1 1 
        2  5042 1 1 130 THR CA   C -30.050 -24.906   0.517 1.00 . A A . 130 THR CA   1 1 
        2  5043 1 1 130 THR CB   C -30.853 -24.754   1.811 1.00 . A A . 130 THR CB   1 1 
        2  5044 1 1 130 THR CG2  C -30.268 -23.731   2.761 1.00 . A A . 130 THR CG2  1 1 
        2  5045 1 1 130 THR H    H -28.348 -25.190   1.742 1.00 . A A . 130 THR H    1 1 
        2  5046 1 1 130 THR HA   H -30.479 -25.703  -0.070 1.00 . A A . 130 THR HA   1 1 
        2  5047 1 1 130 THR HB   H -30.876 -25.706   2.322 1.00 . A A . 130 THR HB   1 1 
        2  5048 1 1 130 THR HG1  H -32.783 -24.815   2.134 1.00 . A A . 130 THR HG1  1 1 
        2  5049 1 1 130 THR HG21 H -30.221 -24.150   3.755 1.00 . A A . 130 THR HG21 1 1 
        2  5050 1 1 130 THR HG22 H -30.892 -22.851   2.770 1.00 . A A . 130 THR HG22 1 1 
        2  5051 1 1 130 THR HG23 H -29.275 -23.464   2.435 1.00 . A A . 130 THR HG23 1 1 
        2  5052 1 1 130 THR N    N -28.669 -25.264   0.820 1.00 . A A . 130 THR N    1 1 
        2  5053 1 1 130 THR O    O -29.158 -22.835  -0.312 1.00 . A A . 130 THR O    1 1 
        2  5054 1 1 130 THR OG1  O -32.187 -24.367   1.531 1.00 . A A . 130 THR OG1  1 1 
        2  5055 1 1 131 GLY C    C -32.322 -21.169  -1.082 1.00 . A A . 131 GLY C    1 1 
        2  5056 1 1 131 GLY CA   C -31.414 -22.186  -1.745 1.00 . A A . 131 GLY CA   1 1 
        2  5057 1 1 131 GLY H    H -31.974 -24.041  -0.891 1.00 . A A . 131 GLY H    1 1 
        2  5058 1 1 131 GLY HA2  H -30.446 -21.737  -1.907 1.00 . A A . 131 GLY HA2  1 1 
        2  5059 1 1 131 GLY HA3  H -31.837 -22.458  -2.702 1.00 . A A . 131 GLY HA3  1 1 
        2  5060 1 1 131 GLY N    N -31.246 -23.386  -0.948 1.00 . A A . 131 GLY N    1 1 
        2  5061 1 1 131 GLY O    O -33.143 -21.521  -0.234 1.00 . A A . 131 GLY O    1 1 
        2  5062 1 1 132 VAL C    C -33.306 -17.776  -1.954 1.00 . A A . 132 VAL C    1 1 
        2  5063 1 1 132 VAL CA   C -32.986 -18.835  -0.904 1.00 . A A . 132 VAL CA   1 1 
        2  5064 1 1 132 VAL CB   C -32.279 -18.162   0.287 1.00 . A A . 132 VAL CB   1 1 
        2  5065 1 1 132 VAL CG1  C -32.321 -19.061   1.512 1.00 . A A . 132 VAL CG1  1 1 
        2  5066 1 1 132 VAL CG2  C -30.845 -17.805  -0.074 1.00 . A A . 132 VAL CG2  1 1 
        2  5067 1 1 132 VAL H    H -31.502 -19.690  -2.147 1.00 . A A . 132 VAL H    1 1 
        2  5068 1 1 132 VAL HA   H -33.910 -19.268  -0.550 1.00 . A A . 132 VAL HA   1 1 
        2  5069 1 1 132 VAL HB   H -32.806 -17.248   0.523 1.00 . A A . 132 VAL HB   1 1 
        2  5070 1 1 132 VAL HG11 H -33.285 -18.976   1.990 1.00 . A A . 132 VAL HG11 1 1 
        2  5071 1 1 132 VAL HG12 H -31.547 -18.763   2.205 1.00 . A A . 132 VAL HG12 1 1 
        2  5072 1 1 132 VAL HG13 H -32.157 -20.086   1.212 1.00 . A A . 132 VAL HG13 1 1 
        2  5073 1 1 132 VAL HG21 H -30.365 -17.340   0.773 1.00 . A A . 132 VAL HG21 1 1 
        2  5074 1 1 132 VAL HG22 H -30.844 -17.120  -0.909 1.00 . A A . 132 VAL HG22 1 1 
        2  5075 1 1 132 VAL HG23 H -30.309 -18.703  -0.344 1.00 . A A . 132 VAL HG23 1 1 
        2  5076 1 1 132 VAL N    N -32.173 -19.907  -1.468 1.00 . A A . 132 VAL N    1 1 
        2  5077 1 1 132 VAL O    O -32.667 -17.719  -3.006 1.00 . A A . 132 VAL O    1 1 
        2  5078 1 1 133 SER C    C -33.745 -14.695  -2.494 1.00 . A A . 133 SER C    1 1 
        2  5079 1 1 133 SER CA   C -34.699 -15.882  -2.582 1.00 . A A . 133 SER CA   1 1 
        2  5080 1 1 133 SER CB   C -36.127 -15.428  -2.276 1.00 . A A . 133 SER CB   1 1 
        2  5081 1 1 133 SER H    H -34.767 -17.037  -0.808 1.00 . A A . 133 SER H    1 1 
        2  5082 1 1 133 SER HA   H -34.665 -16.283  -3.583 1.00 . A A . 133 SER HA   1 1 
        2  5083 1 1 133 SER HB2  H -36.207 -15.179  -1.228 1.00 . A A . 133 SER HB2  1 1 
        2  5084 1 1 133 SER HB3  H -36.362 -14.560  -2.873 1.00 . A A . 133 SER HB3  1 1 
        2  5085 1 1 133 SER HG   H -37.891 -16.268  -2.124 1.00 . A A . 133 SER HG   1 1 
        2  5086 1 1 133 SER N    N -34.296 -16.940  -1.663 1.00 . A A . 133 SER N    1 1 
        2  5087 1 1 133 SER O    O -33.483 -14.023  -3.491 1.00 . A A . 133 SER O    1 1 
        2  5088 1 1 133 SER OG   O -37.062 -16.452  -2.573 1.00 . A A . 133 SER OG   1 1 
        2  5089 1 1 134 ARG C    C -30.874 -13.845  -0.941 1.00 . A A . 134 ARG C    1 1 
        2  5090 1 1 134 ARG CA   C -32.306 -13.338  -1.075 1.00 . A A . 134 ARG CA   1 1 
        2  5091 1 1 134 ARG CB   C -32.703 -12.556   0.178 1.00 . A A . 134 ARG CB   1 1 
        2  5092 1 1 134 ARG CD   C -32.813 -10.314   1.305 1.00 . A A . 134 ARG CD   1 1 
        2  5093 1 1 134 ARG CG   C -32.162 -11.136   0.205 1.00 . A A . 134 ARG CG   1 1 
        2  5094 1 1 134 ARG CZ   C -31.660  -8.137   1.229 1.00 . A A . 134 ARG CZ   1 1 
        2  5095 1 1 134 ARG H    H -33.480 -15.017  -0.539 1.00 . A A . 134 ARG H    1 1 
        2  5096 1 1 134 ARG HA   H -32.365 -12.683  -1.932 1.00 . A A . 134 ARG HA   1 1 
        2  5097 1 1 134 ARG HB2  H -33.781 -12.508   0.232 1.00 . A A . 134 ARG HB2  1 1 
        2  5098 1 1 134 ARG HB3  H -32.329 -13.077   1.046 1.00 . A A . 134 ARG HB3  1 1 
        2  5099 1 1 134 ARG HD2  H -33.689  -9.828   0.903 1.00 . A A . 134 ARG HD2  1 1 
        2  5100 1 1 134 ARG HD3  H -33.105 -10.975   2.107 1.00 . A A . 134 ARG HD3  1 1 
        2  5101 1 1 134 ARG HE   H -31.465  -9.485   2.689 1.00 . A A . 134 ARG HE   1 1 
        2  5102 1 1 134 ARG HG2  H -31.096 -11.171   0.378 1.00 . A A . 134 ARG HG2  1 1 
        2  5103 1 1 134 ARG HG3  H -32.359 -10.668  -0.748 1.00 . A A . 134 ARG HG3  1 1 
        2  5104 1 1 134 ARG HH11 H -32.872  -8.499  -0.349 1.00 . A A . 134 ARG HH11 1 1 
        2  5105 1 1 134 ARG HH12 H -32.051  -6.975  -0.378 1.00 . A A . 134 ARG HH12 1 1 
        2  5106 1 1 134 ARG HH21 H -30.383  -7.480   2.652 1.00 . A A . 134 ARG HH21 1 1 
        2  5107 1 1 134 ARG HH22 H -30.637  -6.396   1.325 1.00 . A A . 134 ARG HH22 1 1 
        2  5108 1 1 134 ARG N    N -33.231 -14.444  -1.295 1.00 . A A . 134 ARG N    1 1 
        2  5109 1 1 134 ARG NE   N -31.909  -9.296   1.835 1.00 . A A . 134 ARG NE   1 1 
        2  5110 1 1 134 ARG NH1  N -32.242  -7.846   0.073 1.00 . A A . 134 ARG NH1  1 1 
        2  5111 1 1 134 ARG NH2  N -30.825  -7.267   1.781 1.00 . A A . 134 ARG NH2  1 1 
        2  5112 1 1 134 ARG O    O -30.634 -14.918  -0.388 1.00 . A A . 134 ARG O    1 1 
        2  5113 1 1 135 SER C    C -27.696 -12.338  -0.713 1.00 . A A . 135 SER C    1 1 
        2  5114 1 1 135 SER CA   C -28.516 -13.434  -1.385 1.00 . A A . 135 SER CA   1 1 
        2  5115 1 1 135 SER CB   C -27.973 -13.702  -2.791 1.00 . A A . 135 SER CB   1 1 
        2  5116 1 1 135 SER H    H -30.180 -12.220  -1.878 1.00 . A A . 135 SER H    1 1 
        2  5117 1 1 135 SER HA   H -28.437 -14.338  -0.800 1.00 . A A . 135 SER HA   1 1 
        2  5118 1 1 135 SER HB2  H -27.505 -12.807  -3.170 1.00 . A A . 135 SER HB2  1 1 
        2  5119 1 1 135 SER HB3  H -27.246 -14.498  -2.748 1.00 . A A . 135 SER HB3  1 1 
        2  5120 1 1 135 SER HG   H -29.543 -13.312  -3.898 1.00 . A A . 135 SER HG   1 1 
        2  5121 1 1 135 SER N    N -29.926 -13.066  -1.450 1.00 . A A . 135 SER N    1 1 
        2  5122 1 1 135 SER O    O -28.081 -11.168  -0.722 1.00 . A A . 135 SER O    1 1 
        2  5123 1 1 135 SER OG   O -29.014 -14.081  -3.676 1.00 . A A . 135 SER OG   1 1 
        2  5124 1 1 136 GLU C    C -24.368 -11.629  -0.197 1.00 . A A . 136 GLU C    1 1 
        2  5125 1 1 136 GLU CA   C -25.692 -11.774   0.548 1.00 . A A . 136 GLU CA   1 1 
        2  5126 1 1 136 GLU CB   C -25.438 -12.221   1.989 1.00 . A A . 136 GLU CB   1 1 
        2  5127 1 1 136 GLU CD   C -25.233 -10.324   3.645 1.00 . A A . 136 GLU CD   1 1 
        2  5128 1 1 136 GLU CG   C -26.148 -11.364   3.024 1.00 . A A . 136 GLU CG   1 1 
        2  5129 1 1 136 GLU H    H -26.313 -13.670  -0.158 1.00 . A A . 136 GLU H    1 1 
        2  5130 1 1 136 GLU HA   H -26.189 -10.815   0.559 1.00 . A A . 136 GLU HA   1 1 
        2  5131 1 1 136 GLU HB2  H -25.780 -13.239   2.104 1.00 . A A . 136 GLU HB2  1 1 
        2  5132 1 1 136 GLU HB3  H -24.378 -12.182   2.187 1.00 . A A . 136 GLU HB3  1 1 
        2  5133 1 1 136 GLU HG2  H -26.973 -10.855   2.548 1.00 . A A . 136 GLU HG2  1 1 
        2  5134 1 1 136 GLU HG3  H -26.524 -12.005   3.808 1.00 . A A . 136 GLU HG3  1 1 
        2  5135 1 1 136 GLU N    N -26.566 -12.724  -0.130 1.00 . A A . 136 GLU N    1 1 
        2  5136 1 1 136 GLU O    O -23.382 -12.290   0.135 1.00 . A A . 136 GLU O    1 1 
        2  5137 1 1 136 GLU OE1  O -24.840  -9.378   2.932 1.00 . A A . 136 GLU OE1  1 1 
        2  5138 1 1 136 GLU OE2  O -24.911 -10.458   4.844 1.00 . A A . 136 GLU OE2  1 1 
        2  5139 1 1 137 HIS C    C -23.004  -9.054  -2.348 1.00 . A A . 137 HIS C    1 1 
        2  5140 1 1 137 HIS CA   C -23.146 -10.530  -1.991 1.00 . A A . 137 HIS CA   1 1 
        2  5141 1 1 137 HIS CB   C -23.176 -11.372  -3.267 1.00 . A A . 137 HIS CB   1 1 
        2  5142 1 1 137 HIS CD2  C -20.600 -11.312  -3.563 1.00 . A A . 137 HIS CD2  1 1 
        2  5143 1 1 137 HIS CE1  C -20.525 -11.440  -5.750 1.00 . A A . 137 HIS CE1  1 1 
        2  5144 1 1 137 HIS CG   C -21.876 -11.378  -4.011 1.00 . A A . 137 HIS CG   1 1 
        2  5145 1 1 137 HIS H    H -25.166 -10.263  -1.418 1.00 . A A . 137 HIS H    1 1 
        2  5146 1 1 137 HIS HA   H -22.296 -10.826  -1.394 1.00 . A A . 137 HIS HA   1 1 
        2  5147 1 1 137 HIS HB2  H -23.416 -12.394  -3.010 1.00 . A A . 137 HIS HB2  1 1 
        2  5148 1 1 137 HIS HB3  H -23.937 -10.984  -3.928 1.00 . A A . 137 HIS HB3  1 1 
        2  5149 1 1 137 HIS HD1  H -22.555 -11.517  -6.001 1.00 . A A . 137 HIS HD1  1 1 
        2  5150 1 1 137 HIS HD2  H -20.285 -11.242  -2.531 1.00 . A A . 137 HIS HD2  1 1 
        2  5151 1 1 137 HIS HE1  H -20.160 -11.488  -6.766 1.00 . A A . 137 HIS HE1  1 1 
        2  5152 1 1 137 HIS HE2  H -18.802 -11.410  -4.645 1.00 . A A . 137 HIS HE2  1 1 
        2  5153 1 1 137 HIS N    N -24.350 -10.761  -1.202 1.00 . A A . 137 HIS N    1 1 
        2  5154 1 1 137 HIS ND1  N -21.796 -11.457  -5.385 1.00 . A A . 137 HIS ND1  1 1 
        2  5155 1 1 137 HIS NE2  N -19.781 -11.352  -4.664 1.00 . A A . 137 HIS NE2  1 1 
        2  5156 1 1 137 HIS O    O -23.882  -8.470  -2.982 1.00 . A A . 137 HIS O    1 1 
        2  5157 1 1 138 ASP C    C -20.224  -6.849  -2.757 1.00 . A A . 138 ASP C    1 1 
        2  5158 1 1 138 ASP CA   C -21.633  -7.046  -2.207 1.00 . A A . 138 ASP CA   1 1 
        2  5159 1 1 138 ASP CB   C -21.824  -6.214  -0.937 1.00 . A A . 138 ASP CB   1 1 
        2  5160 1 1 138 ASP CG   C -23.161  -5.498  -0.910 1.00 . A A . 138 ASP CG   1 1 
        2  5161 1 1 138 ASP H    H -21.228  -8.973  -1.430 1.00 . A A . 138 ASP H    1 1 
        2  5162 1 1 138 ASP HA   H -22.345  -6.719  -2.951 1.00 . A A . 138 ASP HA   1 1 
        2  5163 1 1 138 ASP HB2  H -21.768  -6.864  -0.077 1.00 . A A . 138 ASP HB2  1 1 
        2  5164 1 1 138 ASP HB3  H -21.039  -5.474  -0.877 1.00 . A A . 138 ASP HB3  1 1 
        2  5165 1 1 138 ASP N    N -21.892  -8.455  -1.932 1.00 . A A . 138 ASP N    1 1 
        2  5166 1 1 138 ASP O    O -19.303  -7.586  -2.408 1.00 . A A . 138 ASP O    1 1 
        2  5167 1 1 138 ASP OD1  O -23.267  -4.417  -1.524 1.00 . A A . 138 ASP OD1  1 1 
        2  5168 1 1 138 ASP OD2  O -24.100  -6.022  -0.274 1.00 . A A . 138 ASP OD2  1 1 
        2  5169 1 1 139 THR C    C -18.466  -4.058  -4.145 1.00 . A A . 139 THR C    1 1 
        2  5170 1 1 139 THR CA   C -18.766  -5.551  -4.212 1.00 . A A . 139 THR CA   1 1 
        2  5171 1 1 139 THR CB   C -18.731  -6.026  -5.665 1.00 . A A . 139 THR CB   1 1 
        2  5172 1 1 139 THR CG2  C -19.853  -5.460  -6.509 1.00 . A A . 139 THR CG2  1 1 
        2  5173 1 1 139 THR H    H -20.838  -5.293  -3.854 1.00 . A A . 139 THR H    1 1 
        2  5174 1 1 139 THR HA   H -18.014  -6.083  -3.650 1.00 . A A . 139 THR HA   1 1 
        2  5175 1 1 139 THR HB   H -18.814  -7.103  -5.684 1.00 . A A . 139 THR HB   1 1 
        2  5176 1 1 139 THR HG1  H -16.828  -6.300  -6.043 1.00 . A A . 139 THR HG1  1 1 
        2  5177 1 1 139 THR HG21 H -19.700  -4.400  -6.647 1.00 . A A . 139 THR HG21 1 1 
        2  5178 1 1 139 THR HG22 H -20.797  -5.626  -6.009 1.00 . A A . 139 THR HG22 1 1 
        2  5179 1 1 139 THR HG23 H -19.864  -5.951  -7.470 1.00 . A A . 139 THR HG23 1 1 
        2  5180 1 1 139 THR N    N -20.065  -5.847  -3.616 1.00 . A A . 139 THR N    1 1 
        2  5181 1 1 139 THR O    O -19.162  -3.246  -4.754 1.00 . A A . 139 THR O    1 1 
        2  5182 1 1 139 THR OG1  O -17.506  -5.664  -6.281 1.00 . A A . 139 THR OG1  1 1 
        2  5183 1 1 140 GLY C    C -16.053  -1.872  -4.324 1.00 . A A . 140 GLY C    1 1 
        2  5184 1 1 140 GLY CA   C -17.049  -2.306  -3.268 1.00 . A A . 140 GLY CA   1 1 
        2  5185 1 1 140 GLY H    H -16.905  -4.393  -2.937 1.00 . A A . 140 GLY H    1 1 
        2  5186 1 1 140 GLY HA2  H -17.936  -1.697  -3.353 1.00 . A A . 140 GLY HA2  1 1 
        2  5187 1 1 140 GLY HA3  H -16.612  -2.153  -2.292 1.00 . A A . 140 GLY HA3  1 1 
        2  5188 1 1 140 GLY N    N -17.424  -3.702  -3.399 1.00 . A A . 140 GLY N    1 1 
        2  5189 1 1 140 GLY O    O -15.056  -2.553  -4.564 1.00 . A A . 140 GLY O    1 1 
        2  5190 1 1 141 VAL C    C -15.418   1.310  -5.985 1.00 . A A . 141 VAL C    1 1 
        2  5191 1 1 141 VAL CA   C -15.440  -0.215  -5.996 1.00 . A A . 141 VAL CA   1 1 
        2  5192 1 1 141 VAL CB   C -15.868  -0.706  -7.394 1.00 . A A . 141 VAL CB   1 1 
        2  5193 1 1 141 VAL CG1  C -17.270  -0.222  -7.728 1.00 . A A . 141 VAL CG1  1 1 
        2  5194 1 1 141 VAL CG2  C -14.872  -0.250  -8.451 1.00 . A A . 141 VAL CG2  1 1 
        2  5195 1 1 141 VAL H    H -17.133  -0.236  -4.723 1.00 . A A . 141 VAL H    1 1 
        2  5196 1 1 141 VAL HA   H -14.443  -0.579  -5.799 1.00 . A A . 141 VAL HA   1 1 
        2  5197 1 1 141 VAL HB   H -15.878  -1.787  -7.385 1.00 . A A . 141 VAL HB   1 1 
        2  5198 1 1 141 VAL HG11 H -17.259   0.849  -7.863 1.00 . A A . 141 VAL HG11 1 1 
        2  5199 1 1 141 VAL HG12 H -17.941  -0.477  -6.921 1.00 . A A . 141 VAL HG12 1 1 
        2  5200 1 1 141 VAL HG13 H -17.607  -0.695  -8.640 1.00 . A A . 141 VAL HG13 1 1 
        2  5201 1 1 141 VAL HG21 H -13.889  -0.624  -8.204 1.00 . A A . 141 VAL HG21 1 1 
        2  5202 1 1 141 VAL HG22 H -14.849   0.829  -8.484 1.00 . A A . 141 VAL HG22 1 1 
        2  5203 1 1 141 VAL HG23 H -15.170  -0.632  -9.416 1.00 . A A . 141 VAL HG23 1 1 
        2  5204 1 1 141 VAL N    N -16.323  -0.736  -4.959 1.00 . A A . 141 VAL N    1 1 
        2  5205 1 1 141 VAL O    O -16.465   1.955  -6.051 1.00 . A A . 141 VAL O    1 1 
        2  5206 1 1 142 SER C    C -12.680   3.761  -6.336 1.00 . A A . 142 SER C    1 1 
        2  5207 1 1 142 SER CA   C -14.076   3.337  -5.879 1.00 . A A . 142 SER CA   1 1 
        2  5208 1 1 142 SER CB   C -14.346   3.875  -4.474 1.00 . A A . 142 SER CB   1 1 
        2  5209 1 1 142 SER H    H -13.420   1.318  -5.848 1.00 . A A . 142 SER H    1 1 
        2  5210 1 1 142 SER HA   H -14.805   3.750  -6.558 1.00 . A A . 142 SER HA   1 1 
        2  5211 1 1 142 SER HB2  H -15.325   3.553  -4.149 1.00 . A A . 142 SER HB2  1 1 
        2  5212 1 1 142 SER HB3  H -13.599   3.493  -3.793 1.00 . A A . 142 SER HB3  1 1 
        2  5213 1 1 142 SER HG   H -15.093   5.643  -4.869 1.00 . A A . 142 SER HG   1 1 
        2  5214 1 1 142 SER N    N -14.222   1.884  -5.899 1.00 . A A . 142 SER N    1 1 
        2  5215 1 1 142 SER O    O -11.690   3.096  -6.032 1.00 . A A . 142 SER O    1 1 
        2  5216 1 1 142 SER OG   O -14.301   5.291  -4.452 1.00 . A A . 142 SER OG   1 1 
        2  5217 1 1 143 PRO C    C -10.534   6.153  -6.488 1.00 . A A . 143 PRO C    1 1 
        2  5218 1 1 143 PRO CA   C -11.305   5.398  -7.567 1.00 . A A . 143 PRO CA   1 1 
        2  5219 1 1 143 PRO CB   C -11.729   6.348  -8.682 1.00 . A A . 143 PRO CB   1 1 
        2  5220 1 1 143 PRO CD   C -13.715   5.741  -7.479 1.00 . A A . 143 PRO CD   1 1 
        2  5221 1 1 143 PRO CG   C -13.060   6.860  -8.251 1.00 . A A . 143 PRO CG   1 1 
        2  5222 1 1 143 PRO HA   H -10.688   4.611  -7.971 1.00 . A A . 143 PRO HA   1 1 
        2  5223 1 1 143 PRO HB2  H -11.007   7.147  -8.776 1.00 . A A . 143 PRO HB2  1 1 
        2  5224 1 1 143 PRO HB3  H -11.799   5.807  -9.614 1.00 . A A . 143 PRO HB3  1 1 
        2  5225 1 1 143 PRO HD2  H -14.231   6.133  -6.615 1.00 . A A . 143 PRO HD2  1 1 
        2  5226 1 1 143 PRO HD3  H -14.400   5.198  -8.114 1.00 . A A . 143 PRO HD3  1 1 
        2  5227 1 1 143 PRO HG2  H -12.931   7.726  -7.616 1.00 . A A . 143 PRO HG2  1 1 
        2  5228 1 1 143 PRO HG3  H -13.654   7.114  -9.115 1.00 . A A . 143 PRO HG3  1 1 
        2  5229 1 1 143 PRO N    N -12.584   4.884  -7.073 1.00 . A A . 143 PRO N    1 1 
        2  5230 1 1 143 PRO O    O -11.131   6.789  -5.619 1.00 . A A . 143 PRO O    1 1 
        2  5231 1 1 144 VAL C    C  -6.966   7.018  -6.117 1.00 . A A . 144 VAL C    1 1 
        2  5232 1 1 144 VAL CA   C  -8.365   6.762  -5.568 1.00 . A A . 144 VAL CA   1 1 
        2  5233 1 1 144 VAL CB   C  -8.247   5.947  -4.265 1.00 . A A . 144 VAL CB   1 1 
        2  5234 1 1 144 VAL CG1  C  -9.600   5.830  -3.580 1.00 . A A . 144 VAL CG1  1 1 
        2  5235 1 1 144 VAL CG2  C  -7.664   4.572  -4.546 1.00 . A A . 144 VAL CG2  1 1 
        2  5236 1 1 144 VAL H    H  -8.784   5.559  -7.262 1.00 . A A . 144 VAL H    1 1 
        2  5237 1 1 144 VAL HA   H  -8.829   7.709  -5.333 1.00 . A A . 144 VAL HA   1 1 
        2  5238 1 1 144 VAL HB   H  -7.576   6.469  -3.598 1.00 . A A . 144 VAL HB   1 1 
        2  5239 1 1 144 VAL HG11 H -10.034   6.813  -3.470 1.00 . A A . 144 VAL HG11 1 1 
        2  5240 1 1 144 VAL HG12 H  -9.472   5.381  -2.605 1.00 . A A . 144 VAL HG12 1 1 
        2  5241 1 1 144 VAL HG13 H -10.255   5.212  -4.177 1.00 . A A . 144 VAL HG13 1 1 
        2  5242 1 1 144 VAL HG21 H  -8.079   3.854  -3.853 1.00 . A A . 144 VAL HG21 1 1 
        2  5243 1 1 144 VAL HG22 H  -6.590   4.604  -4.429 1.00 . A A . 144 VAL HG22 1 1 
        2  5244 1 1 144 VAL HG23 H  -7.907   4.278  -5.558 1.00 . A A . 144 VAL HG23 1 1 
        2  5245 1 1 144 VAL N    N  -9.207   6.081  -6.545 1.00 . A A . 144 VAL N    1 1 
        2  5246 1 1 144 VAL O    O  -6.544   6.394  -7.090 1.00 . A A . 144 VAL O    1 1 
        2  5247 1 1 145 PHE C    C  -4.058   8.712  -4.694 1.00 . A A . 145 PHE C    1 1 
        2  5248 1 1 145 PHE CA   C  -4.895   8.283  -5.895 1.00 . A A . 145 PHE CA   1 1 
        2  5249 1 1 145 PHE CB   C  -4.923   9.400  -6.939 1.00 . A A . 145 PHE CB   1 1 
        2  5250 1 1 145 PHE CD1  C  -7.190  10.473  -6.964 1.00 . A A . 145 PHE CD1  1 1 
        2  5251 1 1 145 PHE CD2  C  -5.400  11.632  -5.896 1.00 . A A . 145 PHE CD2  1 1 
        2  5252 1 1 145 PHE CE1  C  -8.052  11.505  -6.648 1.00 . A A . 145 PHE CE1  1 1 
        2  5253 1 1 145 PHE CE2  C  -6.257  12.668  -5.577 1.00 . A A . 145 PHE CE2  1 1 
        2  5254 1 1 145 PHE CG   C  -5.857  10.525  -6.592 1.00 . A A . 145 PHE CG   1 1 
        2  5255 1 1 145 PHE CZ   C  -7.585  12.605  -5.952 1.00 . A A . 145 PHE CZ   1 1 
        2  5256 1 1 145 PHE H    H  -6.643   8.400  -4.708 1.00 . A A . 145 PHE H    1 1 
        2  5257 1 1 145 PHE HA   H  -4.451   7.401  -6.332 1.00 . A A . 145 PHE HA   1 1 
        2  5258 1 1 145 PHE HB2  H  -3.930   9.813  -7.040 1.00 . A A . 145 PHE HB2  1 1 
        2  5259 1 1 145 PHE HB3  H  -5.233   8.988  -7.888 1.00 . A A . 145 PHE HB3  1 1 
        2  5260 1 1 145 PHE HD1  H  -7.557   9.614  -7.506 1.00 . A A . 145 PHE HD1  1 1 
        2  5261 1 1 145 PHE HD2  H  -4.363  11.683  -5.602 1.00 . A A . 145 PHE HD2  1 1 
        2  5262 1 1 145 PHE HE1  H  -9.090  11.454  -6.942 1.00 . A A . 145 PHE HE1  1 1 
        2  5263 1 1 145 PHE HE2  H  -5.890  13.526  -5.034 1.00 . A A . 145 PHE HE2  1 1 
        2  5264 1 1 145 PHE HZ   H  -8.257  13.413  -5.705 1.00 . A A . 145 PHE HZ   1 1 
        2  5265 1 1 145 PHE N    N  -6.251   7.941  -5.479 1.00 . A A . 145 PHE N    1 1 
        2  5266 1 1 145 PHE O    O  -4.386   9.684  -4.013 1.00 . A A . 145 PHE O    1 1 
        2  5267 1 1 146 ALA C    C  -0.757   8.824  -3.786 1.00 . A A . 146 ALA C    1 1 
        2  5268 1 1 146 ALA CA   C  -2.103   8.285  -3.309 1.00 . A A . 146 ALA CA   1 1 
        2  5269 1 1 146 ALA CB   C  -1.903   7.047  -2.446 1.00 . A A . 146 ALA CB   1 1 
        2  5270 1 1 146 ALA H    H  -2.770   7.213  -5.009 1.00 . A A . 146 ALA H    1 1 
        2  5271 1 1 146 ALA HA   H  -2.587   9.039  -2.707 1.00 . A A . 146 ALA HA   1 1 
        2  5272 1 1 146 ALA HB1  H  -0.865   6.751  -2.474 1.00 . A A . 146 ALA HB1  1 1 
        2  5273 1 1 146 ALA HB2  H  -2.517   6.243  -2.824 1.00 . A A . 146 ALA HB2  1 1 
        2  5274 1 1 146 ALA HB3  H  -2.188   7.270  -1.428 1.00 . A A . 146 ALA HB3  1 1 
        2  5275 1 1 146 ALA N    N  -2.980   7.979  -4.433 1.00 . A A . 146 ALA N    1 1 
        2  5276 1 1 146 ALA O    O  -0.101   8.224  -4.635 1.00 . A A . 146 ALA O    1 1 
        2  5277 1 1 147 GLY C    C   1.735  10.966  -2.389 1.00 . A A . 147 GLY C    1 1 
        2  5278 1 1 147 GLY CA   C   0.917  10.559  -3.598 1.00 . A A . 147 GLY CA   1 1 
        2  5279 1 1 147 GLY H    H  -0.915  10.392  -2.550 1.00 . A A . 147 GLY H    1 1 
        2  5280 1 1 147 GLY HA2  H   1.483   9.848  -4.182 1.00 . A A . 147 GLY HA2  1 1 
        2  5281 1 1 147 GLY HA3  H   0.726  11.434  -4.203 1.00 . A A . 147 GLY HA3  1 1 
        2  5282 1 1 147 GLY N    N  -0.352   9.960  -3.226 1.00 . A A . 147 GLY N    1 1 
        2  5283 1 1 147 GLY O    O   1.256  11.710  -1.533 1.00 . A A . 147 GLY O    1 1 
        2  5284 1 1 148 GLY C    C   5.295  10.617  -1.485 1.00 . A A . 148 GLY C    1 1 
        2  5285 1 1 148 GLY CA   C   3.819  10.805  -1.188 1.00 . A A . 148 GLY CA   1 1 
        2  5286 1 1 148 GLY H    H   3.297   9.884  -3.022 1.00 . A A . 148 GLY H    1 1 
        2  5287 1 1 148 GLY HA2  H   3.650  11.837  -0.914 1.00 . A A . 148 GLY HA2  1 1 
        2  5288 1 1 148 GLY HA3  H   3.551  10.177  -0.355 1.00 . A A . 148 GLY HA3  1 1 
        2  5289 1 1 148 GLY N    N   2.967  10.475  -2.314 1.00 . A A . 148 GLY N    1 1 
        2  5290 1 1 148 GLY O    O   5.724  10.726  -2.636 1.00 . A A . 148 GLY O    1 1 
        2  5291 1 1 149 VAL C    C   7.987   8.918   0.192 1.00 . A A . 149 VAL C    1 1 
        2  5292 1 1 149 VAL CA   C   7.510  10.135  -0.594 1.00 . A A . 149 VAL CA   1 1 
        2  5293 1 1 149 VAL CB   C   8.302  11.376  -0.134 1.00 . A A . 149 VAL CB   1 1 
        2  5294 1 1 149 VAL CG1  C   8.189  12.504  -1.153 1.00 . A A . 149 VAL CG1  1 1 
        2  5295 1 1 149 VAL CG2  C   7.826  11.833   1.237 1.00 . A A . 149 VAL CG2  1 1 
        2  5296 1 1 149 VAL H    H   5.665  10.259   0.450 1.00 . A A . 149 VAL H    1 1 
        2  5297 1 1 149 VAL HA   H   7.712   9.974  -1.643 1.00 . A A . 149 VAL HA   1 1 
        2  5298 1 1 149 VAL HB   H   9.343  11.100  -0.054 1.00 . A A . 149 VAL HB   1 1 
        2  5299 1 1 149 VAL HG11 H   7.845  13.403  -0.663 1.00 . A A . 149 VAL HG11 1 1 
        2  5300 1 1 149 VAL HG12 H   7.487  12.228  -1.926 1.00 . A A . 149 VAL HG12 1 1 
        2  5301 1 1 149 VAL HG13 H   9.156  12.687  -1.597 1.00 . A A . 149 VAL HG13 1 1 
        2  5302 1 1 149 VAL HG21 H   8.032  11.062   1.964 1.00 . A A . 149 VAL HG21 1 1 
        2  5303 1 1 149 VAL HG22 H   6.764  12.022   1.204 1.00 . A A . 149 VAL HG22 1 1 
        2  5304 1 1 149 VAL HG23 H   8.345  12.738   1.515 1.00 . A A . 149 VAL HG23 1 1 
        2  5305 1 1 149 VAL N    N   6.070  10.334  -0.443 1.00 . A A . 149 VAL N    1 1 
        2  5306 1 1 149 VAL O    O   7.256   8.379   1.024 1.00 . A A . 149 VAL O    1 1 
        2  5307 1 1 150 GLU C    C  11.239   7.597   1.009 1.00 . A A . 150 GLU C    1 1 
        2  5308 1 1 150 GLU CA   C   9.791   7.331   0.605 1.00 . A A . 150 GLU CA   1 1 
        2  5309 1 1 150 GLU CB   C   9.719   6.097  -0.297 1.00 . A A . 150 GLU CB   1 1 
        2  5310 1 1 150 GLU CD   C  10.375   3.681  -0.646 1.00 . A A . 150 GLU CD   1 1 
        2  5311 1 1 150 GLU CG   C  10.352   4.856   0.313 1.00 . A A . 150 GLU CG   1 1 
        2  5312 1 1 150 GLU H    H   9.753   8.956  -0.751 1.00 . A A . 150 GLU H    1 1 
        2  5313 1 1 150 GLU HA   H   9.208   7.151   1.496 1.00 . A A . 150 GLU HA   1 1 
        2  5314 1 1 150 GLU HB2  H   8.683   5.880  -0.507 1.00 . A A . 150 GLU HB2  1 1 
        2  5315 1 1 150 GLU HB3  H  10.228   6.313  -1.225 1.00 . A A . 150 GLU HB3  1 1 
        2  5316 1 1 150 GLU HG2  H  11.367   5.087   0.599 1.00 . A A . 150 GLU HG2  1 1 
        2  5317 1 1 150 GLU HG3  H   9.788   4.574   1.191 1.00 . A A . 150 GLU HG3  1 1 
        2  5318 1 1 150 GLU N    N   9.218   8.488  -0.077 1.00 . A A . 150 GLU N    1 1 
        2  5319 1 1 150 GLU O    O  12.019   8.157   0.237 1.00 . A A . 150 GLU O    1 1 
        2  5320 1 1 150 GLU OE1  O  11.020   3.797  -1.709 1.00 . A A . 150 GLU OE1  1 1 
        2  5321 1 1 150 GLU OE2  O   9.749   2.646  -0.335 1.00 . A A . 150 GLU OE2  1 1 
        2  5322 1 1 151 TRP C    C  13.583   6.027   3.074 1.00 . A A . 151 TRP C    1 1 
        2  5323 1 1 151 TRP CA   C  12.944   7.372   2.738 1.00 . A A . 151 TRP CA   1 1 
        2  5324 1 1 151 TRP CB   C  12.923   8.269   3.979 1.00 . A A . 151 TRP CB   1 1 
        2  5325 1 1 151 TRP CD1  C  14.595  10.175   3.607 1.00 . A A . 151 TRP CD1  1 1 
        2  5326 1 1 151 TRP CD2  C  12.449  10.794   3.461 1.00 . A A . 151 TRP CD2  1 1 
        2  5327 1 1 151 TRP CE2  C  13.257  11.924   3.239 1.00 . A A . 151 TRP CE2  1 1 
        2  5328 1 1 151 TRP CE3  C  11.058  10.941   3.417 1.00 . A A . 151 TRP CE3  1 1 
        2  5329 1 1 151 TRP CG   C  13.323   9.684   3.694 1.00 . A A . 151 TRP CG   1 1 
        2  5330 1 1 151 TRP CH2  C  11.357  13.297   2.943 1.00 . A A . 151 TRP CH2  1 1 
        2  5331 1 1 151 TRP CZ2  C  12.721  13.183   2.978 1.00 . A A . 151 TRP CZ2  1 1 
        2  5332 1 1 151 TRP CZ3  C  10.529  12.190   3.159 1.00 . A A . 151 TRP CZ3  1 1 
        2  5333 1 1 151 TRP H    H  10.925   6.743   2.790 1.00 . A A . 151 TRP H    1 1 
        2  5334 1 1 151 TRP HA   H  13.529   7.851   1.967 1.00 . A A . 151 TRP HA   1 1 
        2  5335 1 1 151 TRP HB2  H  11.925   8.281   4.387 1.00 . A A . 151 TRP HB2  1 1 
        2  5336 1 1 151 TRP HB3  H  13.606   7.870   4.715 1.00 . A A . 151 TRP HB3  1 1 
        2  5337 1 1 151 TRP HD1  H  15.486   9.580   3.737 1.00 . A A . 151 TRP HD1  1 1 
        2  5338 1 1 151 TRP HE1  H  15.348  12.099   3.224 1.00 . A A . 151 TRP HE1  1 1 
        2  5339 1 1 151 TRP HE3  H  10.402  10.098   3.582 1.00 . A A . 151 TRP HE3  1 1 
        2  5340 1 1 151 TRP HH2  H  10.901  14.255   2.745 1.00 . A A . 151 TRP HH2  1 1 
        2  5341 1 1 151 TRP HZ2  H  13.347  14.047   2.809 1.00 . A A . 151 TRP HZ2  1 1 
        2  5342 1 1 151 TRP HZ3  H   9.457  12.323   3.122 1.00 . A A . 151 TRP HZ3  1 1 
        2  5343 1 1 151 TRP N    N  11.590   7.187   2.225 1.00 . A A . 151 TRP N    1 1 
        2  5344 1 1 151 TRP NE1  N  14.563  11.520   3.333 1.00 . A A . 151 TRP NE1  1 1 
        2  5345 1 1 151 TRP O    O  13.007   5.222   3.807 1.00 . A A . 151 TRP O    1 1 
        2  5346 1 1 152 ALA C    C  16.358   4.621   4.017 1.00 . A A . 152 ALA C    1 1 
        2  5347 1 1 152 ALA CA   C  15.484   4.537   2.771 1.00 . A A . 152 ALA CA   1 1 
        2  5348 1 1 152 ALA CB   C  16.327   4.173   1.558 1.00 . A A . 152 ALA CB   1 1 
        2  5349 1 1 152 ALA H    H  15.179   6.466   1.953 1.00 . A A . 152 ALA H    1 1 
        2  5350 1 1 152 ALA HA   H  14.750   3.759   2.913 1.00 . A A . 152 ALA HA   1 1 
        2  5351 1 1 152 ALA HB1  H  16.806   3.218   1.727 1.00 . A A . 152 ALA HB1  1 1 
        2  5352 1 1 152 ALA HB2  H  17.081   4.929   1.402 1.00 . A A . 152 ALA HB2  1 1 
        2  5353 1 1 152 ALA HB3  H  15.693   4.109   0.686 1.00 . A A . 152 ALA HB3  1 1 
        2  5354 1 1 152 ALA N    N  14.773   5.788   2.532 1.00 . A A . 152 ALA N    1 1 
        2  5355 1 1 152 ALA O    O  17.213   5.500   4.132 1.00 . A A . 152 ALA O    1 1 
        2  5356 1 1 153 VAL C    C  17.735   2.371   6.270 1.00 . A A . 153 VAL C    1 1 
        2  5357 1 1 153 VAL CA   C  16.912   3.654   6.185 1.00 . A A . 153 VAL CA   1 1 
        2  5358 1 1 153 VAL CB   C  15.997   3.754   7.423 1.00 . A A . 153 VAL CB   1 1 
        2  5359 1 1 153 VAL CG1  C  16.821   3.764   8.702 1.00 . A A . 153 VAL CG1  1 1 
        2  5360 1 1 153 VAL CG2  C  15.118   4.992   7.336 1.00 . A A . 153 VAL CG2  1 1 
        2  5361 1 1 153 VAL H    H  15.449   3.019   4.794 1.00 . A A . 153 VAL H    1 1 
        2  5362 1 1 153 VAL HA   H  17.583   4.502   6.187 1.00 . A A . 153 VAL HA   1 1 
        2  5363 1 1 153 VAL HB   H  15.356   2.885   7.441 1.00 . A A . 153 VAL HB   1 1 
        2  5364 1 1 153 VAL HG11 H  17.817   4.122   8.486 1.00 . A A . 153 VAL HG11 1 1 
        2  5365 1 1 153 VAL HG12 H  16.878   2.762   9.102 1.00 . A A . 153 VAL HG12 1 1 
        2  5366 1 1 153 VAL HG13 H  16.354   4.413   9.427 1.00 . A A . 153 VAL HG13 1 1 
        2  5367 1 1 153 VAL HG21 H  15.598   5.733   6.714 1.00 . A A . 153 VAL HG21 1 1 
        2  5368 1 1 153 VAL HG22 H  14.967   5.398   8.326 1.00 . A A . 153 VAL HG22 1 1 
        2  5369 1 1 153 VAL HG23 H  14.163   4.727   6.907 1.00 . A A . 153 VAL HG23 1 1 
        2  5370 1 1 153 VAL N    N  16.142   3.695   4.947 1.00 . A A . 153 VAL N    1 1 
        2  5371 1 1 153 VAL O    O  17.565   1.572   7.191 1.00 . A A . 153 VAL O    1 1 
        2  5372 1 1 154 THR C    C  18.682  -0.279   5.512 1.00 . A A . 154 THR C    1 1 
        2  5373 1 1 154 THR CA   C  19.481   0.997   5.249 1.00 . A A . 154 THR CA   1 1 
        2  5374 1 1 154 THR CB   C  20.624   1.121   6.264 1.00 . A A . 154 THR CB   1 1 
        2  5375 1 1 154 THR CG2  C  20.162   1.065   7.704 1.00 . A A . 154 THR CG2  1 1 
        2  5376 1 1 154 THR H    H  18.709   2.856   4.592 1.00 . A A . 154 THR H    1 1 
        2  5377 1 1 154 THR HA   H  19.903   0.939   4.257 1.00 . A A . 154 THR HA   1 1 
        2  5378 1 1 154 THR HB   H  21.121   2.068   6.112 1.00 . A A . 154 THR HB   1 1 
        2  5379 1 1 154 THR HG1  H  22.282   0.184   6.718 1.00 . A A . 154 THR HG1  1 1 
        2  5380 1 1 154 THR HG21 H  21.017   0.930   8.351 1.00 . A A . 154 THR HG21 1 1 
        2  5381 1 1 154 THR HG22 H  19.480   0.238   7.833 1.00 . A A . 154 THR HG22 1 1 
        2  5382 1 1 154 THR HG23 H  19.661   1.987   7.958 1.00 . A A . 154 THR HG23 1 1 
        2  5383 1 1 154 THR N    N  18.625   2.181   5.298 1.00 . A A . 154 THR N    1 1 
        2  5384 1 1 154 THR O    O  17.450  -0.261   5.523 1.00 . A A . 154 THR O    1 1 
        2  5385 1 1 154 THR OG1  O  21.571   0.086   6.077 1.00 . A A . 154 THR OG1  1 1 
        2  5386 1 1 155 ARG C    C  17.808  -3.060   4.854 1.00 . A A . 155 ARG C    1 1 
        2  5387 1 1 155 ARG CA   C  18.751  -2.667   5.989 1.00 . A A . 155 ARG CA   1 1 
        2  5388 1 1 155 ARG CB   C  17.981  -2.612   7.309 1.00 . A A . 155 ARG CB   1 1 
        2  5389 1 1 155 ARG CD   C  18.669  -4.498   8.820 1.00 . A A . 155 ARG CD   1 1 
        2  5390 1 1 155 ARG CG   C  17.612  -3.982   7.857 1.00 . A A . 155 ARG CG   1 1 
        2  5391 1 1 155 ARG CZ   C  19.415  -4.001  11.114 1.00 . A A . 155 ARG CZ   1 1 
        2  5392 1 1 155 ARG H    H  20.369  -1.333   5.703 1.00 . A A . 155 ARG H    1 1 
        2  5393 1 1 155 ARG HA   H  19.528  -3.412   6.067 1.00 . A A . 155 ARG HA   1 1 
        2  5394 1 1 155 ARG HB2  H  18.587  -2.105   8.046 1.00 . A A . 155 ARG HB2  1 1 
        2  5395 1 1 155 ARG HB3  H  17.071  -2.052   7.158 1.00 . A A . 155 ARG HB3  1 1 
        2  5396 1 1 155 ARG HD2  H  18.618  -5.576   8.844 1.00 . A A . 155 ARG HD2  1 1 
        2  5397 1 1 155 ARG HD3  H  19.642  -4.192   8.465 1.00 . A A . 155 ARG HD3  1 1 
        2  5398 1 1 155 ARG HE   H  17.596  -3.610  10.394 1.00 . A A . 155 ARG HE   1 1 
        2  5399 1 1 155 ARG HG2  H  16.670  -3.908   8.377 1.00 . A A . 155 ARG HG2  1 1 
        2  5400 1 1 155 ARG HG3  H  17.518  -4.674   7.034 1.00 . A A . 155 ARG HG3  1 1 
        2  5401 1 1 155 ARG HH11 H  20.819  -4.867   9.945 1.00 . A A . 155 ARG HH11 1 1 
        2  5402 1 1 155 ARG HH12 H  21.320  -4.508  11.563 1.00 . A A . 155 ARG HH12 1 1 
        2  5403 1 1 155 ARG HH21 H  18.251  -3.137  12.524 1.00 . A A . 155 ARG HH21 1 1 
        2  5404 1 1 155 ARG HH22 H  19.862  -3.524  13.027 1.00 . A A . 155 ARG HH22 1 1 
        2  5405 1 1 155 ARG N    N  19.392  -1.383   5.724 1.00 . A A . 155 ARG N    1 1 
        2  5406 1 1 155 ARG NE   N  18.474  -3.985  10.175 1.00 . A A . 155 ARG NE   1 1 
        2  5407 1 1 155 ARG NH1  N  20.617  -4.499  10.853 1.00 . A A . 155 ARG NH1  1 1 
        2  5408 1 1 155 ARG NH2  N  19.155  -3.513  12.322 1.00 . A A . 155 ARG NH2  1 1 
        2  5409 1 1 155 ARG O    O  16.897  -3.865   5.043 1.00 . A A . 155 ARG O    1 1 
        2  5410 1 1 156 ASP C    C  15.727  -2.503   2.799 1.00 . A A . 156 ASP C    1 1 
        2  5411 1 1 156 ASP CA   C  17.200  -2.783   2.510 1.00 . A A . 156 ASP CA   1 1 
        2  5412 1 1 156 ASP CB   C  17.381  -4.243   2.086 1.00 . A A . 156 ASP CB   1 1 
        2  5413 1 1 156 ASP CG   C  18.292  -4.388   0.884 1.00 . A A . 156 ASP CG   1 1 
        2  5414 1 1 156 ASP H    H  18.774  -1.855   3.580 1.00 . A A . 156 ASP H    1 1 
        2  5415 1 1 156 ASP HA   H  17.522  -2.143   1.703 1.00 . A A . 156 ASP HA   1 1 
        2  5416 1 1 156 ASP HB2  H  17.808  -4.799   2.907 1.00 . A A . 156 ASP HB2  1 1 
        2  5417 1 1 156 ASP HB3  H  16.415  -4.661   1.836 1.00 . A A . 156 ASP HB3  1 1 
        2  5418 1 1 156 ASP N    N  18.031  -2.488   3.672 1.00 . A A . 156 ASP N    1 1 
        2  5419 1 1 156 ASP O    O  14.842  -3.074   2.162 1.00 . A A . 156 ASP O    1 1 
        2  5420 1 1 156 ASP OD1  O  19.510  -4.158   1.031 1.00 . A A . 156 ASP OD1  1 1 
        2  5421 1 1 156 ASP OD2  O  17.786  -4.729  -0.207 1.00 . A A . 156 ASP OD2  1 1 
        2  5422 1 1 157 ILE C    C  13.914   0.244   4.147 1.00 . A A . 157 ILE C    1 1 
        2  5423 1 1 157 ILE CA   C  14.102  -1.270   4.127 1.00 . A A . 157 ILE CA   1 1 
        2  5424 1 1 157 ILE CB   C  13.721  -1.846   5.505 1.00 . A A . 157 ILE CB   1 1 
        2  5425 1 1 157 ILE CD1  C  14.500  -3.854   6.864 1.00 . A A . 157 ILE CD1  1 1 
        2  5426 1 1 157 ILE CG1  C  13.972  -3.356   5.536 1.00 . A A . 157 ILE CG1  1 1 
        2  5427 1 1 157 ILE CG2  C  12.267  -1.540   5.830 1.00 . A A . 157 ILE CG2  1 1 
        2  5428 1 1 157 ILE H    H  16.214  -1.196   4.234 1.00 . A A . 157 ILE H    1 1 
        2  5429 1 1 157 ILE HA   H  13.439  -1.695   3.386 1.00 . A A . 157 ILE HA   1 1 
        2  5430 1 1 157 ILE HB   H  14.340  -1.371   6.252 1.00 . A A . 157 ILE HB   1 1 
        2  5431 1 1 157 ILE HD11 H  13.779  -4.522   7.310 1.00 . A A . 157 ILE HD11 1 1 
        2  5432 1 1 157 ILE HD12 H  14.668  -3.015   7.522 1.00 . A A . 157 ILE HD12 1 1 
        2  5433 1 1 157 ILE HD13 H  15.429  -4.379   6.706 1.00 . A A . 157 ILE HD13 1 1 
        2  5434 1 1 157 ILE HG12 H  13.045  -3.871   5.335 1.00 . A A . 157 ILE HG12 1 1 
        2  5435 1 1 157 ILE HG13 H  14.693  -3.610   4.774 1.00 . A A . 157 ILE HG13 1 1 
        2  5436 1 1 157 ILE HG21 H  11.839  -2.364   6.381 1.00 . A A . 157 ILE HG21 1 1 
        2  5437 1 1 157 ILE HG22 H  11.715  -1.396   4.912 1.00 . A A . 157 ILE HG22 1 1 
        2  5438 1 1 157 ILE HG23 H  12.212  -0.642   6.427 1.00 . A A . 157 ILE HG23 1 1 
        2  5439 1 1 157 ILE N    N  15.469  -1.621   3.761 1.00 . A A . 157 ILE N    1 1 
        2  5440 1 1 157 ILE O    O  14.771   0.980   4.635 1.00 . A A . 157 ILE O    1 1 
        2  5441 1 1 158 ALA C    C  11.076   2.415   4.057 1.00 . A A . 158 ALA C    1 1 
        2  5442 1 1 158 ALA CA   C  12.489   2.128   3.561 1.00 . A A . 158 ALA CA   1 1 
        2  5443 1 1 158 ALA CB   C  12.670   2.654   2.145 1.00 . A A . 158 ALA CB   1 1 
        2  5444 1 1 158 ALA H    H  12.145   0.067   3.232 1.00 . A A . 158 ALA H    1 1 
        2  5445 1 1 158 ALA HA   H  13.195   2.637   4.201 1.00 . A A . 158 ALA HA   1 1 
        2  5446 1 1 158 ALA HB1  H  12.713   3.732   2.163 1.00 . A A . 158 ALA HB1  1 1 
        2  5447 1 1 158 ALA HB2  H  11.836   2.337   1.535 1.00 . A A . 158 ALA HB2  1 1 
        2  5448 1 1 158 ALA HB3  H  13.587   2.264   1.730 1.00 . A A . 158 ALA HB3  1 1 
        2  5449 1 1 158 ALA N    N  12.788   0.702   3.609 1.00 . A A . 158 ALA N    1 1 
        2  5450 1 1 158 ALA O    O  10.216   1.534   4.059 1.00 . A A . 158 ALA O    1 1 
        2  5451 1 1 159 THR C    C   8.784   4.835   3.873 1.00 . A A . 159 THR C    1 1 
        2  5452 1 1 159 THR CA   C   9.535   4.072   4.958 1.00 . A A . 159 THR CA   1 1 
        2  5453 1 1 159 THR CB   C   9.685   4.945   6.206 1.00 . A A . 159 THR CB   1 1 
        2  5454 1 1 159 THR CG2  C   9.563   4.166   7.498 1.00 . A A . 159 THR CG2  1 1 
        2  5455 1 1 159 THR H    H  11.569   4.315   4.434 1.00 . A A . 159 THR H    1 1 
        2  5456 1 1 159 THR HA   H   8.978   3.183   5.212 1.00 . A A . 159 THR HA   1 1 
        2  5457 1 1 159 THR HB   H   8.913   5.700   6.201 1.00 . A A . 159 THR HB   1 1 
        2  5458 1 1 159 THR HG1  H  10.966   6.242   6.924 1.00 . A A . 159 THR HG1  1 1 
        2  5459 1 1 159 THR HG21 H   8.567   3.759   7.580 1.00 . A A . 159 THR HG21 1 1 
        2  5460 1 1 159 THR HG22 H   9.755   4.822   8.333 1.00 . A A . 159 THR HG22 1 1 
        2  5461 1 1 159 THR HG23 H  10.283   3.360   7.501 1.00 . A A . 159 THR HG23 1 1 
        2  5462 1 1 159 THR N    N  10.844   3.658   4.468 1.00 . A A . 159 THR N    1 1 
        2  5463 1 1 159 THR O    O   9.380   5.605   3.122 1.00 . A A . 159 THR O    1 1 
        2  5464 1 1 159 THR OG1  O  10.943   5.597   6.213 1.00 . A A . 159 THR OG1  1 1 
        2  5465 1 1 160 ARG C    C   5.501   6.035   3.395 1.00 . A A . 160 ARG C    1 1 
        2  5466 1 1 160 ARG CA   C   6.666   5.273   2.776 1.00 . A A . 160 ARG CA   1 1 
        2  5467 1 1 160 ARG CB   C   6.138   4.248   1.771 1.00 . A A . 160 ARG CB   1 1 
        2  5468 1 1 160 ARG CD   C   6.638   3.009  -0.361 1.00 . A A . 160 ARG CD   1 1 
        2  5469 1 1 160 ARG CG   C   7.222   3.647   0.891 1.00 . A A . 160 ARG CG   1 1 
        2  5470 1 1 160 ARG CZ   C   7.255   2.839  -2.740 1.00 . A A . 160 ARG CZ   1 1 
        2  5471 1 1 160 ARG H    H   7.056   3.978   4.405 1.00 . A A . 160 ARG H    1 1 
        2  5472 1 1 160 ARG HA   H   7.300   5.975   2.254 1.00 . A A . 160 ARG HA   1 1 
        2  5473 1 1 160 ARG HB2  H   5.656   3.447   2.311 1.00 . A A . 160 ARG HB2  1 1 
        2  5474 1 1 160 ARG HB3  H   5.411   4.727   1.132 1.00 . A A . 160 ARG HB3  1 1 
        2  5475 1 1 160 ARG HD2  H   6.756   1.938  -0.291 1.00 . A A . 160 ARG HD2  1 1 
        2  5476 1 1 160 ARG HD3  H   5.588   3.253  -0.419 1.00 . A A . 160 ARG HD3  1 1 
        2  5477 1 1 160 ARG HE   H   7.811   4.314  -1.517 1.00 . A A . 160 ARG HE   1 1 
        2  5478 1 1 160 ARG HG2  H   7.906   4.427   0.597 1.00 . A A . 160 ARG HG2  1 1 
        2  5479 1 1 160 ARG HG3  H   7.752   2.893   1.454 1.00 . A A . 160 ARG HG3  1 1 
        2  5480 1 1 160 ARG HH11 H   6.097   1.324  -2.065 1.00 . A A . 160 ARG HH11 1 1 
        2  5481 1 1 160 ARG HH12 H   6.547   1.228  -3.735 1.00 . A A . 160 ARG HH12 1 1 
        2  5482 1 1 160 ARG HH21 H   8.402   4.191  -3.713 1.00 . A A . 160 ARG HH21 1 1 
        2  5483 1 1 160 ARG HH22 H   7.853   2.857  -4.670 1.00 . A A . 160 ARG HH22 1 1 
        2  5484 1 1 160 ARG N    N   7.478   4.609   3.786 1.00 . A A . 160 ARG N    1 1 
        2  5485 1 1 160 ARG NE   N   7.304   3.478  -1.574 1.00 . A A . 160 ARG NE   1 1 
        2  5486 1 1 160 ARG NH1  N   6.577   1.704  -2.856 1.00 . A A . 160 ARG NH1  1 1 
        2  5487 1 1 160 ARG NH2  N   7.889   3.336  -3.795 1.00 . A A . 160 ARG NH2  1 1 
        2  5488 1 1 160 ARG O    O   4.664   5.461   4.092 1.00 . A A . 160 ARG O    1 1 
        2  5489 1 1 161 LEU C    C   3.580   8.748   2.437 1.00 . A A . 161 LEU C    1 1 
        2  5490 1 1 161 LEU CA   C   4.375   8.187   3.611 1.00 . A A . 161 LEU CA   1 1 
        2  5491 1 1 161 LEU CB   C   4.941   9.329   4.460 1.00 . A A . 161 LEU CB   1 1 
        2  5492 1 1 161 LEU CD1  C   4.722  10.871   6.431 1.00 . A A . 161 LEU CD1  1 1 
        2  5493 1 1 161 LEU CD2  C   2.703  10.287   5.069 1.00 . A A . 161 LEU CD2  1 1 
        2  5494 1 1 161 LEU CG   C   4.036   9.788   5.608 1.00 . A A . 161 LEU CG   1 1 
        2  5495 1 1 161 LEU H    H   6.136   7.724   2.535 1.00 . A A . 161 LEU H    1 1 
        2  5496 1 1 161 LEU HA   H   3.719   7.580   4.218 1.00 . A A . 161 LEU HA   1 1 
        2  5497 1 1 161 LEU HB2  H   5.882   9.005   4.878 1.00 . A A . 161 LEU HB2  1 1 
        2  5498 1 1 161 LEU HB3  H   5.123  10.175   3.815 1.00 . A A . 161 LEU HB3  1 1 
        2  5499 1 1 161 LEU HD11 H   4.414  10.786   7.463 1.00 . A A . 161 LEU HD11 1 1 
        2  5500 1 1 161 LEU HD12 H   4.443  11.842   6.052 1.00 . A A . 161 LEU HD12 1 1 
        2  5501 1 1 161 LEU HD13 H   5.792  10.750   6.363 1.00 . A A . 161 LEU HD13 1 1 
        2  5502 1 1 161 LEU HD21 H   1.964   9.503   5.151 1.00 . A A . 161 LEU HD21 1 1 
        2  5503 1 1 161 LEU HD22 H   2.815  10.568   4.032 1.00 . A A . 161 LEU HD22 1 1 
        2  5504 1 1 161 LEU HD23 H   2.381  11.145   5.640 1.00 . A A . 161 LEU HD23 1 1 
        2  5505 1 1 161 LEU HG   H   3.840   8.949   6.260 1.00 . A A . 161 LEU HG   1 1 
        2  5506 1 1 161 LEU N    N   5.446   7.333   3.111 1.00 . A A . 161 LEU N    1 1 
        2  5507 1 1 161 LEU O    O   4.124   9.476   1.601 1.00 . A A . 161 LEU O    1 1 
        2  5508 1 1 162 GLU C    C   0.400   9.839   1.760 1.00 . A A . 162 GLU C    1 1 
        2  5509 1 1 162 GLU CA   C   1.439   8.834   1.279 1.00 . A A . 162 GLU CA   1 1 
        2  5510 1 1 162 GLU CB   C   0.740   7.636   0.634 1.00 . A A . 162 GLU CB   1 1 
        2  5511 1 1 162 GLU CD   C   0.465   5.343   1.664 1.00 . A A . 162 GLU CD   1 1 
        2  5512 1 1 162 GLU CG   C  -0.031   6.776   1.624 1.00 . A A . 162 GLU CG   1 1 
        2  5513 1 1 162 GLU H    H   1.934   7.789   3.056 1.00 . A A . 162 GLU H    1 1 
        2  5514 1 1 162 GLU HA   H   2.064   9.310   0.539 1.00 . A A . 162 GLU HA   1 1 
        2  5515 1 1 162 GLU HB2  H   0.047   7.996  -0.112 1.00 . A A . 162 GLU HB2  1 1 
        2  5516 1 1 162 GLU HB3  H   1.483   7.016   0.152 1.00 . A A . 162 GLU HB3  1 1 
        2  5517 1 1 162 GLU HG2  H   0.075   7.204   2.610 1.00 . A A . 162 GLU HG2  1 1 
        2  5518 1 1 162 GLU HG3  H  -1.074   6.773   1.344 1.00 . A A . 162 GLU HG3  1 1 
        2  5519 1 1 162 GLU N    N   2.302   8.385   2.366 1.00 . A A . 162 GLU N    1 1 
        2  5520 1 1 162 GLU O    O  -0.104   9.743   2.879 1.00 . A A . 162 GLU O    1 1 
        2  5521 1 1 162 GLU OE1  O   0.099   4.563   0.761 1.00 . A A . 162 GLU OE1  1 1 
        2  5522 1 1 162 GLU OE2  O   1.220   5.002   2.599 1.00 . A A . 162 GLU OE2  1 1 
        2  5523 1 1 163 TYR C    C  -1.867  12.021   0.050 1.00 . A A . 163 TYR C    1 1 
        2  5524 1 1 163 TYR CA   C  -0.900  11.827   1.215 1.00 . A A . 163 TYR CA   1 1 
        2  5525 1 1 163 TYR CB   C  -0.205  13.151   1.540 1.00 . A A . 163 TYR CB   1 1 
        2  5526 1 1 163 TYR CD1  C   0.096  14.159  -0.755 1.00 . A A . 163 TYR CD1  1 1 
        2  5527 1 1 163 TYR CD2  C   2.046  13.682   0.530 1.00 . A A . 163 TYR CD2  1 1 
        2  5528 1 1 163 TYR CE1  C   0.886  14.638  -1.784 1.00 . A A . 163 TYR CE1  1 1 
        2  5529 1 1 163 TYR CE2  C   2.843  14.160  -0.493 1.00 . A A . 163 TYR CE2  1 1 
        2  5530 1 1 163 TYR CG   C   0.662  13.674   0.417 1.00 . A A . 163 TYR CG   1 1 
        2  5531 1 1 163 TYR CZ   C   2.258  14.636  -1.647 1.00 . A A . 163 TYR CZ   1 1 
        2  5532 1 1 163 TYR H    H   0.519  10.815   0.020 1.00 . A A . 163 TYR H    1 1 
        2  5533 1 1 163 TYR HA   H  -1.458  11.499   2.080 1.00 . A A . 163 TYR HA   1 1 
        2  5534 1 1 163 TYR HB2  H  -0.953  13.899   1.756 1.00 . A A . 163 TYR HB2  1 1 
        2  5535 1 1 163 TYR HB3  H   0.422  13.017   2.410 1.00 . A A . 163 TYR HB3  1 1 
        2  5536 1 1 163 TYR HD1  H  -0.979  14.161  -0.860 1.00 . A A . 163 TYR HD1  1 1 
        2  5537 1 1 163 TYR HD2  H   2.501  13.308   1.435 1.00 . A A . 163 TYR HD2  1 1 
        2  5538 1 1 163 TYR HE1  H   0.428  15.011  -2.689 1.00 . A A . 163 TYR HE1  1 1 
        2  5539 1 1 163 TYR HE2  H   3.917  14.158  -0.387 1.00 . A A . 163 TYR HE2  1 1 
        2  5540 1 1 163 TYR HH   H   3.188  14.417  -3.315 1.00 . A A . 163 TYR HH   1 1 
        2  5541 1 1 163 TYR N    N   0.083  10.801   0.898 1.00 . A A . 163 TYR N    1 1 
        2  5542 1 1 163 TYR O    O  -1.612  11.559  -1.063 1.00 . A A . 163 TYR O    1 1 
        2  5543 1 1 163 TYR OH   O   3.049  15.111  -2.669 1.00 . A A . 163 TYR OH   1 1 
        2  5544 1 1 164 GLN C    C  -5.123  13.801  -0.168 1.00 . A A . 164 GLN C    1 1 
        2  5545 1 1 164 GLN CA   C  -3.977  12.957  -0.719 1.00 . A A . 164 GLN CA   1 1 
        2  5546 1 1 164 GLN CB   C  -4.520  11.637  -1.269 1.00 . A A . 164 GLN CB   1 1 
        2  5547 1 1 164 GLN CD   C  -5.540   9.386  -0.745 1.00 . A A . 164 GLN CD   1 1 
        2  5548 1 1 164 GLN CG   C  -4.840  10.613  -0.193 1.00 . A A . 164 GLN CG   1 1 
        2  5549 1 1 164 GLN H    H  -3.123  13.048   1.218 1.00 . A A . 164 GLN H    1 1 
        2  5550 1 1 164 GLN HA   H  -3.498  13.501  -1.519 1.00 . A A . 164 GLN HA   1 1 
        2  5551 1 1 164 GLN HB2  H  -5.423  11.837  -1.826 1.00 . A A . 164 GLN HB2  1 1 
        2  5552 1 1 164 GLN HB3  H  -3.786  11.209  -1.936 1.00 . A A . 164 GLN HB3  1 1 
        2  5553 1 1 164 GLN HE21 H  -4.928   8.308   0.810 1.00 . A A . 164 GLN HE21 1 1 
        2  5554 1 1 164 GLN HE22 H  -5.882   7.466  -0.359 1.00 . A A . 164 GLN HE22 1 1 
        2  5555 1 1 164 GLN HG2  H  -3.918  10.303   0.276 1.00 . A A . 164 GLN HG2  1 1 
        2  5556 1 1 164 GLN HG3  H  -5.480  11.075   0.545 1.00 . A A . 164 GLN HG3  1 1 
        2  5557 1 1 164 GLN N    N  -2.975  12.705   0.311 1.00 . A A . 164 GLN N    1 1 
        2  5558 1 1 164 GLN NE2  N  -5.439   8.274  -0.025 1.00 . A A . 164 GLN NE2  1 1 
        2  5559 1 1 164 GLN O    O  -5.935  13.322   0.623 1.00 . A A . 164 GLN O    1 1 
        2  5560 1 1 164 GLN OE1  O  -6.162   9.437  -1.805 1.00 . A A . 164 GLN OE1  1 1 
        2  5561 1 1 165 TRP C    C  -6.328  17.181  -1.065 1.00 . A A . 165 TRP C    1 1 
        2  5562 1 1 165 TRP CA   C  -6.228  15.970  -0.143 1.00 . A A . 165 TRP CA   1 1 
        2  5563 1 1 165 TRP CB   C  -5.952  16.427   1.291 1.00 . A A . 165 TRP CB   1 1 
        2  5564 1 1 165 TRP CD1  C  -8.291  16.604   2.319 1.00 . A A . 165 TRP CD1  1 1 
        2  5565 1 1 165 TRP CD2  C  -7.187  18.547   2.212 1.00 . A A . 165 TRP CD2  1 1 
        2  5566 1 1 165 TRP CE2  C  -8.448  18.780   2.791 1.00 . A A . 165 TRP CE2  1 1 
        2  5567 1 1 165 TRP CE3  C  -6.313  19.626   2.043 1.00 . A A . 165 TRP CE3  1 1 
        2  5568 1 1 165 TRP CG   C  -7.106  17.148   1.917 1.00 . A A . 165 TRP CG   1 1 
        2  5569 1 1 165 TRP CH2  C  -7.981  21.084   3.025 1.00 . A A . 165 TRP CH2  1 1 
        2  5570 1 1 165 TRP CZ2  C  -8.856  20.046   3.201 1.00 . A A . 165 TRP CZ2  1 1 
        2  5571 1 1 165 TRP CZ3  C  -6.720  20.883   2.451 1.00 . A A . 165 TRP CZ3  1 1 
        2  5572 1 1 165 TRP H    H  -4.505  15.383  -1.223 1.00 . A A . 165 TRP H    1 1 
        2  5573 1 1 165 TRP HA   H  -7.165  15.435  -0.165 1.00 . A A . 165 TRP HA   1 1 
        2  5574 1 1 165 TRP HB2  H  -5.727  15.566   1.900 1.00 . A A . 165 TRP HB2  1 1 
        2  5575 1 1 165 TRP HB3  H  -5.102  17.095   1.291 1.00 . A A . 165 TRP HB3  1 1 
        2  5576 1 1 165 TRP HD1  H  -8.542  15.556   2.229 1.00 . A A . 165 TRP HD1  1 1 
        2  5577 1 1 165 TRP HE1  H -10.006  17.436   3.202 1.00 . A A . 165 TRP HE1  1 1 
        2  5578 1 1 165 TRP HE3  H  -5.336  19.490   1.603 1.00 . A A . 165 TRP HE3  1 1 
        2  5579 1 1 165 TRP HH2  H  -8.258  22.081   3.328 1.00 . A A . 165 TRP HH2  1 1 
        2  5580 1 1 165 TRP HZ2  H  -9.826  20.218   3.646 1.00 . A A . 165 TRP HZ2  1 1 
        2  5581 1 1 165 TRP HZ3  H  -6.060  21.727   2.328 1.00 . A A . 165 TRP HZ3  1 1 
        2  5582 1 1 165 TRP N    N  -5.181  15.060  -0.592 1.00 . A A . 165 TRP N    1 1 
        2  5583 1 1 165 TRP NE1  N  -9.104  17.577   2.846 1.00 . A A . 165 TRP NE1  1 1 
        2  5584 1 1 165 TRP O    O  -5.375  17.944  -1.210 1.00 . A A . 165 TRP O    1 1 
        2  5585 1 1 166 VAL C    C  -8.934  19.282  -2.172 1.00 . A A . 166 VAL C    1 1 
        2  5586 1 1 166 VAL CA   C  -7.716  18.467  -2.596 1.00 . A A . 166 VAL CA   1 1 
        2  5587 1 1 166 VAL CB   C  -7.912  17.980  -4.046 1.00 . A A . 166 VAL CB   1 1 
        2  5588 1 1 166 VAL CG1  C  -9.129  17.075  -4.151 1.00 . A A . 166 VAL CG1  1 1 
        2  5589 1 1 166 VAL CG2  C  -8.031  19.162  -4.997 1.00 . A A . 166 VAL CG2  1 1 
        2  5590 1 1 166 VAL H    H  -8.214  16.705  -1.531 1.00 . A A . 166 VAL H    1 1 
        2  5591 1 1 166 VAL HA   H  -6.843  19.102  -2.567 1.00 . A A . 166 VAL HA   1 1 
        2  5592 1 1 166 VAL HB   H  -7.042  17.406  -4.330 1.00 . A A . 166 VAL HB   1 1 
        2  5593 1 1 166 VAL HG11 H  -9.104  16.343  -3.357 1.00 . A A . 166 VAL HG11 1 1 
        2  5594 1 1 166 VAL HG12 H  -9.124  16.572  -5.106 1.00 . A A . 166 VAL HG12 1 1 
        2  5595 1 1 166 VAL HG13 H -10.028  17.669  -4.062 1.00 . A A . 166 VAL HG13 1 1 
        2  5596 1 1 166 VAL HG21 H  -9.073  19.338  -5.222 1.00 . A A . 166 VAL HG21 1 1 
        2  5597 1 1 166 VAL HG22 H  -7.499  18.944  -5.911 1.00 . A A . 166 VAL HG22 1 1 
        2  5598 1 1 166 VAL HG23 H  -7.610  20.041  -4.534 1.00 . A A . 166 VAL HG23 1 1 
        2  5599 1 1 166 VAL N    N  -7.491  17.348  -1.687 1.00 . A A . 166 VAL N    1 1 
        2  5600 1 1 166 VAL O    O -10.048  18.762  -2.103 1.00 . A A . 166 VAL O    1 1 
        2  5601 1 1 167 ASN C    C -10.045  22.530  -2.521 1.00 . A A . 167 ASN C    1 1 
        2  5602 1 1 167 ASN CA   C  -9.795  21.450  -1.474 1.00 . A A . 167 ASN CA   1 1 
        2  5603 1 1 167 ASN CB   C  -9.462  22.096  -0.128 1.00 . A A . 167 ASN CB   1 1 
        2  5604 1 1 167 ASN CG   C -10.702  22.391   0.693 1.00 . A A . 167 ASN CG   1 1 
        2  5605 1 1 167 ASN H    H  -7.805  20.918  -1.967 1.00 . A A . 167 ASN H    1 1 
        2  5606 1 1 167 ASN HA   H -10.689  20.855  -1.367 1.00 . A A . 167 ASN HA   1 1 
        2  5607 1 1 167 ASN HB2  H  -8.829  21.427   0.438 1.00 . A A . 167 ASN HB2  1 1 
        2  5608 1 1 167 ASN HB3  H  -8.937  23.023  -0.301 1.00 . A A . 167 ASN HB3  1 1 
        2  5609 1 1 167 ASN HD21 H -11.044  24.036  -0.371 1.00 . A A . 167 ASN HD21 1 1 
        2  5610 1 1 167 ASN HD22 H -12.184  23.703   0.884 1.00 . A A . 167 ASN HD22 1 1 
        2  5611 1 1 167 ASN N    N  -8.715  20.561  -1.890 1.00 . A A . 167 ASN N    1 1 
        2  5612 1 1 167 ASN ND2  N -11.379  23.488   0.369 1.00 . A A . 167 ASN ND2  1 1 
        2  5613 1 1 167 ASN O    O -11.189  22.912  -2.772 1.00 . A A . 167 ASN O    1 1 
        2  5614 1 1 167 ASN OD1  O -11.048  21.644   1.606 1.00 . A A . 167 ASN OD1  1 1 
        2  5615 1 1 168 ASN C    C  -9.697  23.502  -5.425 1.00 . A A . 168 ASN C    1 1 
        2  5616 1 1 168 ASN CA   C  -9.072  24.056  -4.149 1.00 . A A . 168 ASN CA   1 1 
        2  5617 1 1 168 ASN CB   C  -7.690  24.641  -4.450 1.00 . A A . 168 ASN CB   1 1 
        2  5618 1 1 168 ASN CG   C  -7.749  26.118  -4.783 1.00 . A A . 168 ASN CG   1 1 
        2  5619 1 1 168 ASN H    H  -8.086  22.674  -2.884 1.00 . A A . 168 ASN H    1 1 
        2  5620 1 1 168 ASN HA   H  -9.707  24.839  -3.761 1.00 . A A . 168 ASN HA   1 1 
        2  5621 1 1 168 ASN HB2  H  -7.055  24.511  -3.587 1.00 . A A . 168 ASN HB2  1 1 
        2  5622 1 1 168 ASN HB3  H  -7.262  24.117  -5.291 1.00 . A A . 168 ASN HB3  1 1 
        2  5623 1 1 168 ASN HD21 H  -5.780  26.161  -5.055 1.00 . A A . 168 ASN HD21 1 1 
        2  5624 1 1 168 ASN HD22 H  -6.603  27.662  -5.291 1.00 . A A . 168 ASN HD22 1 1 
        2  5625 1 1 168 ASN N    N  -8.970  23.019  -3.128 1.00 . A A . 168 ASN N    1 1 
        2  5626 1 1 168 ASN ND2  N  -6.594  26.706  -5.073 1.00 . A A . 168 ASN ND2  1 1 
        2  5627 1 1 168 ASN O    O  -9.036  23.400  -6.460 1.00 . A A . 168 ASN O    1 1 
        2  5628 1 1 168 ASN OD1  O  -8.820  26.725  -4.782 1.00 . A A . 168 ASN OD1  1 1 
        2  5629 1 1 169 ILE C    C -13.185  22.878  -6.394 1.00 . A A . 169 ILE C    1 1 
        2  5630 1 1 169 ILE CA   C -11.688  22.601  -6.495 1.00 . A A . 169 ILE CA   1 1 
        2  5631 1 1 169 ILE CB   C -11.467  21.083  -6.628 1.00 . A A . 169 ILE CB   1 1 
        2  5632 1 1 169 ILE CD1  C -13.194  20.010  -5.094 1.00 . A A . 169 ILE CD1  1 1 
        2  5633 1 1 169 ILE CG1  C -11.741  20.382  -5.294 1.00 . A A . 169 ILE CG1  1 1 
        2  5634 1 1 169 ILE CG2  C -10.051  20.794  -7.102 1.00 . A A . 169 ILE CG2  1 1 
        2  5635 1 1 169 ILE H    H -11.448  23.249  -4.493 1.00 . A A . 169 ILE H    1 1 
        2  5636 1 1 169 ILE HA   H -11.303  23.080  -7.384 1.00 . A A . 169 ILE HA   1 1 
        2  5637 1 1 169 ILE HB   H -12.152  20.705  -7.372 1.00 . A A . 169 ILE HB   1 1 
        2  5638 1 1 169 ILE HD11 H -13.291  19.404  -4.206 1.00 . A A . 169 ILE HD11 1 1 
        2  5639 1 1 169 ILE HD12 H -13.542  19.450  -5.950 1.00 . A A . 169 ILE HD12 1 1 
        2  5640 1 1 169 ILE HD13 H -13.785  20.906  -4.986 1.00 . A A . 169 ILE HD13 1 1 
        2  5641 1 1 169 ILE HG12 H -11.157  19.476  -5.245 1.00 . A A . 169 ILE HG12 1 1 
        2  5642 1 1 169 ILE HG13 H -11.451  21.036  -4.485 1.00 . A A . 169 ILE HG13 1 1 
        2  5643 1 1 169 ILE HG21 H  -9.345  21.180  -6.382 1.00 . A A . 169 ILE HG21 1 1 
        2  5644 1 1 169 ILE HG22 H  -9.888  21.268  -8.058 1.00 . A A . 169 ILE HG22 1 1 
        2  5645 1 1 169 ILE HG23 H  -9.916  19.726  -7.203 1.00 . A A . 169 ILE HG23 1 1 
        2  5646 1 1 169 ILE N    N -10.974  23.145  -5.345 1.00 . A A . 169 ILE N    1 1 
        2  5647 1 1 169 ILE O    O -14.004  22.099  -6.882 1.00 . A A . 169 ILE O    1 1 
        2  5648 1 1 170 GLY C    C -15.397  25.328  -6.672 1.00 . A A . 170 GLY C    1 1 
        2  5649 1 1 170 GLY CA   C -14.933  24.352  -5.609 1.00 . A A . 170 GLY CA   1 1 
        2  5650 1 1 170 GLY H    H -12.838  24.576  -5.394 1.00 . A A . 170 GLY H    1 1 
        2  5651 1 1 170 GLY HA2  H -15.533  23.455  -5.673 1.00 . A A . 170 GLY HA2  1 1 
        2  5652 1 1 170 GLY HA3  H -15.076  24.800  -4.637 1.00 . A A . 170 GLY HA3  1 1 
        2  5653 1 1 170 GLY N    N -13.535  23.992  -5.760 1.00 . A A . 170 GLY N    1 1 
        2  5654 1 1 170 GLY O    O -15.840  26.434  -6.360 1.00 . A A . 170 GLY O    1 1 
        2  5655 1 1 171 ASP C    C -17.118  25.408  -9.509 1.00 . A A . 171 ASP C    1 1 
        2  5656 1 1 171 ASP CA   C -15.709  25.765  -9.047 1.00 . A A . 171 ASP CA   1 1 
        2  5657 1 1 171 ASP CB   C -14.726  25.626 -10.211 1.00 . A A . 171 ASP CB   1 1 
        2  5658 1 1 171 ASP CG   C -13.608  26.648 -10.148 1.00 . A A . 171 ASP CG   1 1 
        2  5659 1 1 171 ASP H    H -14.935  24.027  -8.118 1.00 . A A . 171 ASP H    1 1 
        2  5660 1 1 171 ASP HA   H -15.704  26.789  -8.704 1.00 . A A . 171 ASP HA   1 1 
        2  5661 1 1 171 ASP HB2  H -14.288  24.639 -10.187 1.00 . A A . 171 ASP HB2  1 1 
        2  5662 1 1 171 ASP HB3  H -15.259  25.758 -11.141 1.00 . A A . 171 ASP HB3  1 1 
        2  5663 1 1 171 ASP N    N -15.296  24.919  -7.933 1.00 . A A . 171 ASP N    1 1 
        2  5664 1 1 171 ASP O    O -17.409  24.249  -9.806 1.00 . A A . 171 ASP O    1 1 
        2  5665 1 1 171 ASP OD1  O -13.092  26.895  -9.039 1.00 . A A . 171 ASP OD1  1 1 
        2  5666 1 1 171 ASP OD2  O -13.250  27.202 -11.209 1.00 . A A . 171 ASP OD2  1 1 
        2  5667 1 1 172 ALA C    C -19.773  27.229 -11.051 1.00 . A A . 172 ALA C    1 1 
        2  5668 1 1 172 ALA CA   C -19.365  26.204  -9.999 1.00 . A A . 172 ALA CA   1 1 
        2  5669 1 1 172 ALA CB   C -20.303  26.267  -8.804 1.00 . A A . 172 ALA CB   1 1 
        2  5670 1 1 172 ALA H    H -17.694  27.313  -9.324 1.00 . A A . 172 ALA H    1 1 
        2  5671 1 1 172 ALA HA   H -19.435  25.215 -10.430 1.00 . A A . 172 ALA HA   1 1 
        2  5672 1 1 172 ALA HB1  H -20.519  25.265  -8.461 1.00 . A A . 172 ALA HB1  1 1 
        2  5673 1 1 172 ALA HB2  H -21.224  26.752  -9.093 1.00 . A A . 172 ALA HB2  1 1 
        2  5674 1 1 172 ALA HB3  H -19.837  26.828  -8.009 1.00 . A A . 172 ALA HB3  1 1 
        2  5675 1 1 172 ALA N    N -17.987  26.411  -9.571 1.00 . A A . 172 ALA N    1 1 
        2  5676 1 1 172 ALA O    O -19.650  28.436 -10.837 1.00 . A A . 172 ALA O    1 1 
        2  5677 1 1 173 GLY C    C -21.989  27.204 -13.887 1.00 . A A . 173 GLY C    1 1 
        2  5678 1 1 173 GLY CA   C -20.680  27.632 -13.255 1.00 . A A . 173 GLY CA   1 1 
        2  5679 1 1 173 GLY H    H -20.336  25.772 -12.302 1.00 . A A . 173 GLY H    1 1 
        2  5680 1 1 173 GLY HA2  H -20.793  28.628 -12.854 1.00 . A A . 173 GLY HA2  1 1 
        2  5681 1 1 173 GLY HA3  H -19.913  27.647 -14.017 1.00 . A A . 173 GLY HA3  1 1 
        2  5682 1 1 173 GLY N    N -20.260  26.743 -12.188 1.00 . A A . 173 GLY N    1 1 
        2  5683 1 1 173 GLY O    O -22.987  27.921 -13.808 1.00 . A A . 173 GLY O    1 1 
        2  5684 1 1 174 THR C    C -23.683  24.256 -14.455 1.00 . A A . 174 THR C    1 1 
        2  5685 1 1 174 THR CA   C -23.184  25.511 -15.164 1.00 . A A . 174 THR CA   1 1 
        2  5686 1 1 174 THR CB   C -22.899  25.200 -16.634 1.00 . A A . 174 THR CB   1 1 
        2  5687 1 1 174 THR CG2  C -22.219  26.337 -17.365 1.00 . A A . 174 THR CG2  1 1 
        2  5688 1 1 174 THR H    H -21.161  25.509 -14.545 1.00 . A A . 174 THR H    1 1 
        2  5689 1 1 174 THR HA   H -23.950  26.270 -15.109 1.00 . A A . 174 THR HA   1 1 
        2  5690 1 1 174 THR HB   H -23.834  24.996 -17.136 1.00 . A A . 174 THR HB   1 1 
        2  5691 1 1 174 THR HG1  H -22.613  23.287 -16.949 1.00 . A A . 174 THR HG1  1 1 
        2  5692 1 1 174 THR HG21 H -22.690  26.479 -18.326 1.00 . A A . 174 THR HG21 1 1 
        2  5693 1 1 174 THR HG22 H -21.175  26.100 -17.508 1.00 . A A . 174 THR HG22 1 1 
        2  5694 1 1 174 THR HG23 H -22.306  27.243 -16.783 1.00 . A A . 174 THR HG23 1 1 
        2  5695 1 1 174 THR N    N -21.987  26.033 -14.516 1.00 . A A . 174 THR N    1 1 
        2  5696 1 1 174 THR O    O -24.884  24.086 -14.244 1.00 . A A . 174 THR O    1 1 
        2  5697 1 1 174 THR OG1  O -22.072  24.056 -16.753 1.00 . A A . 174 THR OG1  1 1 
        2  5698 1 1 175 VAL C    C -22.242  21.946 -12.158 1.00 . A A . 175 VAL C    1 1 
        2  5699 1 1 175 VAL CA   C -23.099  22.139 -13.404 1.00 . A A . 175 VAL CA   1 1 
        2  5700 1 1 175 VAL CB   C -22.926  20.920 -14.327 1.00 . A A . 175 VAL CB   1 1 
        2  5701 1 1 175 VAL CG1  C -23.987  20.919 -15.416 1.00 . A A . 175 VAL CG1  1 1 
        2  5702 1 1 175 VAL CG2  C -21.530  20.902 -14.932 1.00 . A A . 175 VAL CG2  1 1 
        2  5703 1 1 175 VAL H    H -21.813  23.571 -14.286 1.00 . A A . 175 VAL H    1 1 
        2  5704 1 1 175 VAL HA   H -24.136  22.199 -13.110 1.00 . A A . 175 VAL HA   1 1 
        2  5705 1 1 175 VAL HB   H -23.049  20.025 -13.736 1.00 . A A . 175 VAL HB   1 1 
        2  5706 1 1 175 VAL HG11 H -23.817  20.086 -16.082 1.00 . A A . 175 VAL HG11 1 1 
        2  5707 1 1 175 VAL HG12 H -23.932  21.842 -15.974 1.00 . A A . 175 VAL HG12 1 1 
        2  5708 1 1 175 VAL HG13 H -24.964  20.827 -14.967 1.00 . A A . 175 VAL HG13 1 1 
        2  5709 1 1 175 VAL HG21 H -21.301  21.875 -15.341 1.00 . A A . 175 VAL HG21 1 1 
        2  5710 1 1 175 VAL HG22 H -21.489  20.163 -15.718 1.00 . A A . 175 VAL HG22 1 1 
        2  5711 1 1 175 VAL HG23 H -20.808  20.656 -14.167 1.00 . A A . 175 VAL HG23 1 1 
        2  5712 1 1 175 VAL N    N -22.754  23.380 -14.089 1.00 . A A . 175 VAL N    1 1 
        2  5713 1 1 175 VAL O    O -21.232  22.625 -11.974 1.00 . A A . 175 VAL O    1 1 
        2  5714 1 1 176 GLY C    C -21.243  19.381 -10.101 1.00 . A A . 176 GLY C    1 1 
        2  5715 1 1 176 GLY CA   C -21.908  20.743 -10.086 1.00 . A A . 176 GLY CA   1 1 
        2  5716 1 1 176 GLY H    H -23.463  20.499 -11.504 1.00 . A A . 176 GLY H    1 1 
        2  5717 1 1 176 GLY HA2  H -21.148  21.501  -9.966 1.00 . A A . 176 GLY HA2  1 1 
        2  5718 1 1 176 GLY HA3  H -22.585  20.792  -9.247 1.00 . A A . 176 GLY HA3  1 1 
        2  5719 1 1 176 GLY N    N -22.650  21.012 -11.304 1.00 . A A . 176 GLY N    1 1 
        2  5720 1 1 176 GLY O    O -21.584  18.526 -10.918 1.00 . A A . 176 GLY O    1 1 
        2  5721 1 1 177 THR C    C -19.422  17.469  -7.656 1.00 . A A . 177 THR C    1 1 
        2  5722 1 1 177 THR CA   C -19.580  17.908  -9.107 1.00 . A A . 177 THR CA   1 1 
        2  5723 1 1 177 THR CB   C -18.206  18.025  -9.770 1.00 . A A . 177 THR CB   1 1 
        2  5724 1 1 177 THR CG2  C -17.655  16.697 -10.242 1.00 . A A . 177 THR CG2  1 1 
        2  5725 1 1 177 THR H    H -20.065  19.897  -8.570 1.00 . A A . 177 THR H    1 1 
        2  5726 1 1 177 THR HA   H -20.161  17.166  -9.634 1.00 . A A . 177 THR HA   1 1 
        2  5727 1 1 177 THR HB   H -17.508  18.438  -9.056 1.00 . A A . 177 THR HB   1 1 
        2  5728 1 1 177 THR HG1  H -18.417  19.789 -10.593 1.00 . A A . 177 THR HG1  1 1 
        2  5729 1 1 177 THR HG21 H -18.379  16.214 -10.882 1.00 . A A . 177 THR HG21 1 1 
        2  5730 1 1 177 THR HG22 H -17.451  16.067  -9.390 1.00 . A A . 177 THR HG22 1 1 
        2  5731 1 1 177 THR HG23 H -16.742  16.862 -10.795 1.00 . A A . 177 THR HG23 1 1 
        2  5732 1 1 177 THR N    N -20.293  19.178  -9.195 1.00 . A A . 177 THR N    1 1 
        2  5733 1 1 177 THR O    O -19.490  18.287  -6.738 1.00 . A A . 177 THR O    1 1 
        2  5734 1 1 177 THR OG1  O -18.262  18.891 -10.891 1.00 . A A . 177 THR OG1  1 1 
        2  5735 1 1 178 ARG C    C -17.557  15.442  -5.786 1.00 . A A . 178 ARG C    1 1 
        2  5736 1 1 178 ARG CA   C -19.038  15.622  -6.116 1.00 . A A . 178 ARG CA   1 1 
        2  5737 1 1 178 ARG CB   C -19.763  14.281  -5.999 1.00 . A A . 178 ARG CB   1 1 
        2  5738 1 1 178 ARG CD   C -20.020  12.579  -4.165 1.00 . A A . 178 ARG CD   1 1 
        2  5739 1 1 178 ARG CG   C -20.310  14.004  -4.607 1.00 . A A . 178 ARG CG   1 1 
        2  5740 1 1 178 ARG CZ   C -20.846  12.586  -1.842 1.00 . A A . 178 ARG CZ   1 1 
        2  5741 1 1 178 ARG H    H -19.164  15.571  -8.228 1.00 . A A . 178 ARG H    1 1 
        2  5742 1 1 178 ARG HA   H -19.474  16.318  -5.415 1.00 . A A . 178 ARG HA   1 1 
        2  5743 1 1 178 ARG HB2  H -20.589  14.269  -6.695 1.00 . A A . 178 ARG HB2  1 1 
        2  5744 1 1 178 ARG HB3  H -19.076  13.490  -6.256 1.00 . A A . 178 ARG HB3  1 1 
        2  5745 1 1 178 ARG HD2  H -20.844  11.949  -4.462 1.00 . A A . 178 ARG HD2  1 1 
        2  5746 1 1 178 ARG HD3  H -19.115  12.243  -4.649 1.00 . A A . 178 ARG HD3  1 1 
        2  5747 1 1 178 ARG HE   H -18.941  12.326  -2.377 1.00 . A A . 178 ARG HE   1 1 
        2  5748 1 1 178 ARG HG2  H -19.850  14.688  -3.908 1.00 . A A . 178 ARG HG2  1 1 
        2  5749 1 1 178 ARG HG3  H -21.379  14.160  -4.614 1.00 . A A . 178 ARG HG3  1 1 
        2  5750 1 1 178 ARG HH11 H -22.277  12.875  -3.243 1.00 . A A . 178 ARG HH11 1 1 
        2  5751 1 1 178 ARG HH12 H -22.833  12.874  -1.604 1.00 . A A . 178 ARG HH12 1 1 
        2  5752 1 1 178 ARG HH21 H -19.671  12.325  -0.221 1.00 . A A . 178 ARG HH21 1 1 
        2  5753 1 1 178 ARG HH22 H -21.353  12.563   0.114 1.00 . A A . 178 ARG HH22 1 1 
        2  5754 1 1 178 ARG N    N -19.207  16.173  -7.455 1.00 . A A . 178 ARG N    1 1 
        2  5755 1 1 178 ARG NE   N -19.848  12.480  -2.717 1.00 . A A . 178 ARG NE   1 1 
        2  5756 1 1 178 ARG NH1  N -22.087  12.796  -2.265 1.00 . A A . 178 ARG NH1  1 1 
        2  5757 1 1 178 ARG NH2  N -20.603  12.483  -0.544 1.00 . A A . 178 ARG NH2  1 1 
        2  5758 1 1 178 ARG O    O -16.919  14.505  -6.263 1.00 . A A . 178 ARG O    1 1 
        2  5759 1 1 179 PRO C    C -15.280  15.074  -3.671 1.00 . A A . 179 PRO C    1 1 
        2  5760 1 1 179 PRO CA   C -15.572  16.266  -4.576 1.00 . A A . 179 PRO CA   1 1 
        2  5761 1 1 179 PRO CB   C -15.336  17.578  -3.826 1.00 . A A . 179 PRO CB   1 1 
        2  5762 1 1 179 PRO CD   C -17.668  17.493  -4.343 1.00 . A A . 179 PRO CD   1 1 
        2  5763 1 1 179 PRO CG   C -16.680  17.971  -3.315 1.00 . A A . 179 PRO CG   1 1 
        2  5764 1 1 179 PRO HA   H -14.929  16.223  -5.444 1.00 . A A . 179 PRO HA   1 1 
        2  5765 1 1 179 PRO HB2  H -14.638  17.412  -3.017 1.00 . A A . 179 PRO HB2  1 1 
        2  5766 1 1 179 PRO HB3  H -14.941  18.318  -4.504 1.00 . A A . 179 PRO HB3  1 1 
        2  5767 1 1 179 PRO HD2  H -18.588  17.188  -3.866 1.00 . A A . 179 PRO HD2  1 1 
        2  5768 1 1 179 PRO HD3  H -17.857  18.267  -5.071 1.00 . A A . 179 PRO HD3  1 1 
        2  5769 1 1 179 PRO HG2  H -16.865  17.492  -2.365 1.00 . A A . 179 PRO HG2  1 1 
        2  5770 1 1 179 PRO HG3  H -16.735  19.043  -3.211 1.00 . A A . 179 PRO HG3  1 1 
        2  5771 1 1 179 PRO N    N -16.986  16.340  -4.961 1.00 . A A . 179 PRO N    1 1 
        2  5772 1 1 179 PRO O    O -16.045  14.776  -2.754 1.00 . A A . 179 PRO O    1 1 
        2  5773 1 1 180 ASP C    C -12.416  13.464  -2.490 1.00 . A A . 180 ASP C    1 1 
        2  5774 1 1 180 ASP CA   C -13.772  13.235  -3.148 1.00 . A A . 180 ASP CA   1 1 
        2  5775 1 1 180 ASP CB   C -13.720  11.987  -4.030 1.00 . A A . 180 ASP CB   1 1 
        2  5776 1 1 180 ASP CG   C -13.860  10.706  -3.230 1.00 . A A . 180 ASP CG   1 1 
        2  5777 1 1 180 ASP H    H -13.601  14.683  -4.683 1.00 . A A . 180 ASP H    1 1 
        2  5778 1 1 180 ASP HA   H -14.513  13.089  -2.376 1.00 . A A . 180 ASP HA   1 1 
        2  5779 1 1 180 ASP HB2  H -14.522  12.028  -4.750 1.00 . A A . 180 ASP HB2  1 1 
        2  5780 1 1 180 ASP HB3  H -12.774  11.962  -4.552 1.00 . A A . 180 ASP HB3  1 1 
        2  5781 1 1 180 ASP N    N -14.168  14.396  -3.937 1.00 . A A . 180 ASP N    1 1 
        2  5782 1 1 180 ASP O    O -11.389  13.528  -3.166 1.00 . A A . 180 ASP O    1 1 
        2  5783 1 1 180 ASP OD1  O -12.905  10.349  -2.509 1.00 . A A . 180 ASP OD1  1 1 
        2  5784 1 1 180 ASP OD2  O -14.926  10.062  -3.324 1.00 . A A . 180 ASP OD2  1 1 
        2  5785 1 1 181 ASN C    C -10.636  12.495   0.126 1.00 . A A . 181 ASN C    1 1 
        2  5786 1 1 181 ASN CA   C -11.188  13.809  -0.416 1.00 . A A . 181 ASN CA   1 1 
        2  5787 1 1 181 ASN CB   C -11.436  14.785   0.735 1.00 . A A . 181 ASN CB   1 1 
        2  5788 1 1 181 ASN CG   C -12.602  14.365   1.608 1.00 . A A . 181 ASN CG   1 1 
        2  5789 1 1 181 ASN H    H -13.269  13.527  -0.682 1.00 . A A . 181 ASN H    1 1 
        2  5790 1 1 181 ASN HA   H -10.462  14.239  -1.090 1.00 . A A . 181 ASN HA   1 1 
        2  5791 1 1 181 ASN HB2  H -10.551  14.839   1.352 1.00 . A A . 181 ASN HB2  1 1 
        2  5792 1 1 181 ASN HB3  H -11.649  15.763   0.330 1.00 . A A . 181 ASN HB3  1 1 
        2  5793 1 1 181 ASN HD21 H -11.410  14.264   3.195 1.00 . A A . 181 ASN HD21 1 1 
        2  5794 1 1 181 ASN HD22 H -13.069  13.871   3.477 1.00 . A A . 181 ASN HD22 1 1 
        2  5795 1 1 181 ASN N    N -12.418  13.586  -1.166 1.00 . A A . 181 ASN N    1 1 
        2  5796 1 1 181 ASN ND2  N -12.332  14.144   2.890 1.00 . A A . 181 ASN ND2  1 1 
        2  5797 1 1 181 ASN O    O -11.388  11.563   0.407 1.00 . A A . 181 ASN O    1 1 
        2  5798 1 1 181 ASN OD1  O -13.733  14.239   1.136 1.00 . A A . 181 ASN OD1  1 1 
        2  5799 1 1 182 GLY C    C  -8.094  11.418   2.162 1.00 . A A . 182 GLY C    1 1 
        2  5800 1 1 182 GLY CA   C  -8.685  11.223   0.780 1.00 . A A . 182 GLY CA   1 1 
        2  5801 1 1 182 GLY H    H  -8.766  13.202   0.031 1.00 . A A . 182 GLY H    1 1 
        2  5802 1 1 182 GLY HA2  H  -9.422  10.434   0.824 1.00 . A A . 182 GLY HA2  1 1 
        2  5803 1 1 182 GLY HA3  H  -7.899  10.928   0.102 1.00 . A A . 182 GLY HA3  1 1 
        2  5804 1 1 182 GLY N    N  -9.316  12.426   0.271 1.00 . A A . 182 GLY N    1 1 
        2  5805 1 1 182 GLY O    O  -8.599  12.214   2.954 1.00 . A A . 182 GLY O    1 1 
        2  5806 1 1 183 MET C    C  -4.897  10.371   3.651 1.00 . A A . 183 MET C    1 1 
        2  5807 1 1 183 MET CA   C  -6.361  10.788   3.750 1.00 . A A . 183 MET CA   1 1 
        2  5808 1 1 183 MET CB   C  -7.082   9.915   4.778 1.00 . A A . 183 MET CB   1 1 
        2  5809 1 1 183 MET CE   C  -6.068   6.213   3.409 1.00 . A A . 183 MET CE   1 1 
        2  5810 1 1 183 MET CG   C  -7.359   8.502   4.291 1.00 . A A . 183 MET CG   1 1 
        2  5811 1 1 183 MET H    H  -6.664  10.073   1.780 1.00 . A A . 183 MET H    1 1 
        2  5812 1 1 183 MET HA   H  -6.408  11.818   4.069 1.00 . A A . 183 MET HA   1 1 
        2  5813 1 1 183 MET HB2  H  -6.475   9.852   5.670 1.00 . A A . 183 MET HB2  1 1 
        2  5814 1 1 183 MET HB3  H  -8.026  10.378   5.027 1.00 . A A . 183 MET HB3  1 1 
        2  5815 1 1 183 MET HE1  H  -5.056   6.107   3.049 1.00 . A A . 183 MET HE1  1 1 
        2  5816 1 1 183 MET HE2  H  -6.690   6.611   2.621 1.00 . A A . 183 MET HE2  1 1 
        2  5817 1 1 183 MET HE3  H  -6.446   5.247   3.710 1.00 . A A . 183 MET HE3  1 1 
        2  5818 1 1 183 MET HG2  H  -8.311   8.179   4.686 1.00 . A A . 183 MET HG2  1 1 
        2  5819 1 1 183 MET HG3  H  -7.404   8.509   3.211 1.00 . A A . 183 MET HG3  1 1 
        2  5820 1 1 183 MET N    N  -7.020  10.690   2.453 1.00 . A A . 183 MET N    1 1 
        2  5821 1 1 183 MET O    O  -4.472   9.790   2.651 1.00 . A A . 183 MET O    1 1 
        2  5822 1 1 183 MET SD   S  -6.092   7.328   4.810 1.00 . A A . 183 MET SD   1 1 
        2  5823 1 1 184 LEU C    C  -2.499   8.994   5.443 1.00 . A A . 184 LEU C    1 1 
        2  5824 1 1 184 LEU CA   C  -2.714  10.324   4.730 1.00 . A A . 184 LEU CA   1 1 
        2  5825 1 1 184 LEU CB   C  -1.917  11.428   5.429 1.00 . A A . 184 LEU CB   1 1 
        2  5826 1 1 184 LEU CD1  C  -2.863  13.165   3.882 1.00 . A A . 184 LEU CD1  1 1 
        2  5827 1 1 184 LEU CD2  C  -0.961  13.746   5.400 1.00 . A A . 184 LEU CD2  1 1 
        2  5828 1 1 184 LEU CG   C  -1.602  12.650   4.562 1.00 . A A . 184 LEU CG   1 1 
        2  5829 1 1 184 LEU H    H  -4.529  11.130   5.463 1.00 . A A . 184 LEU H    1 1 
        2  5830 1 1 184 LEU HA   H  -2.369  10.233   3.710 1.00 . A A . 184 LEU HA   1 1 
        2  5831 1 1 184 LEU HB2  H  -2.479  11.759   6.290 1.00 . A A . 184 LEU HB2  1 1 
        2  5832 1 1 184 LEU HB3  H  -0.983  11.009   5.769 1.00 . A A . 184 LEU HB3  1 1 
        2  5833 1 1 184 LEU HD11 H  -2.615  14.011   3.257 1.00 . A A . 184 LEU HD11 1 1 
        2  5834 1 1 184 LEU HD12 H  -3.577  13.469   4.633 1.00 . A A . 184 LEU HD12 1 1 
        2  5835 1 1 184 LEU HD13 H  -3.290  12.381   3.277 1.00 . A A . 184 LEU HD13 1 1 
        2  5836 1 1 184 LEU HD21 H  -1.024  14.687   4.871 1.00 . A A . 184 LEU HD21 1 1 
        2  5837 1 1 184 LEU HD22 H   0.075  13.504   5.580 1.00 . A A . 184 LEU HD22 1 1 
        2  5838 1 1 184 LEU HD23 H  -1.481  13.829   6.344 1.00 . A A . 184 LEU HD23 1 1 
        2  5839 1 1 184 LEU HG   H  -0.901  12.365   3.792 1.00 . A A . 184 LEU HG   1 1 
        2  5840 1 1 184 LEU N    N  -4.130  10.669   4.695 1.00 . A A . 184 LEU N    1 1 
        2  5841 1 1 184 LEU O    O  -3.305   8.595   6.283 1.00 . A A . 184 LEU O    1 1 
        2  5842 1 1 185 SER C    C   0.398   6.756   5.721 1.00 . A A . 185 SER C    1 1 
        2  5843 1 1 185 SER CA   C  -1.104   7.022   5.716 1.00 . A A . 185 SER CA   1 1 
        2  5844 1 1 185 SER CB   C  -1.827   5.897   4.972 1.00 . A A . 185 SER CB   1 1 
        2  5845 1 1 185 SER H    H  -0.807   8.675   4.424 1.00 . A A . 185 SER H    1 1 
        2  5846 1 1 185 SER HA   H  -1.456   7.049   6.735 1.00 . A A . 185 SER HA   1 1 
        2  5847 1 1 185 SER HB2  H  -1.527   5.902   3.935 1.00 . A A . 185 SER HB2  1 1 
        2  5848 1 1 185 SER HB3  H  -1.566   4.948   5.418 1.00 . A A . 185 SER HB3  1 1 
        2  5849 1 1 185 SER HG   H  -3.511   6.718   4.400 1.00 . A A . 185 SER HG   1 1 
        2  5850 1 1 185 SER N    N  -1.412   8.309   5.103 1.00 . A A . 185 SER N    1 1 
        2  5851 1 1 185 SER O    O   1.129   7.227   4.845 1.00 . A A . 185 SER O    1 1 
        2  5852 1 1 185 SER OG   O  -3.234   6.061   5.042 1.00 . A A . 185 SER OG   1 1 
        2  5853 1 1 186 LEU C    C   2.471   4.151   6.687 1.00 . A A . 186 LEU C    1 1 
        2  5854 1 1 186 LEU CA   C   2.268   5.654   6.837 1.00 . A A . 186 LEU CA   1 1 
        2  5855 1 1 186 LEU CB   C   2.828   6.117   8.189 1.00 . A A . 186 LEU CB   1 1 
        2  5856 1 1 186 LEU CD1  C   1.052   6.695   9.863 1.00 . A A . 186 LEU CD1  1 1 
        2  5857 1 1 186 LEU CD2  C   3.025   8.204   9.571 1.00 . A A . 186 LEU CD2  1 1 
        2  5858 1 1 186 LEU CG   C   2.061   7.254   8.872 1.00 . A A . 186 LEU CG   1 1 
        2  5859 1 1 186 LEU H    H   0.217   5.644   7.376 1.00 . A A . 186 LEU H    1 1 
        2  5860 1 1 186 LEU HA   H   2.798   6.158   6.044 1.00 . A A . 186 LEU HA   1 1 
        2  5861 1 1 186 LEU HB2  H   2.838   5.271   8.858 1.00 . A A . 186 LEU HB2  1 1 
        2  5862 1 1 186 LEU HB3  H   3.846   6.443   8.035 1.00 . A A . 186 LEU HB3  1 1 
        2  5863 1 1 186 LEU HD11 H   0.951   7.373  10.697 1.00 . A A . 186 LEU HD11 1 1 
        2  5864 1 1 186 LEU HD12 H   1.394   5.734  10.220 1.00 . A A . 186 LEU HD12 1 1 
        2  5865 1 1 186 LEU HD13 H   0.095   6.578   9.377 1.00 . A A . 186 LEU HD13 1 1 
        2  5866 1 1 186 LEU HD21 H   2.549   9.163   9.709 1.00 . A A . 186 LEU HD21 1 1 
        2  5867 1 1 186 LEU HD22 H   3.913   8.326   8.966 1.00 . A A . 186 LEU HD22 1 1 
        2  5868 1 1 186 LEU HD23 H   3.299   7.795  10.531 1.00 . A A . 186 LEU HD23 1 1 
        2  5869 1 1 186 LEU HG   H   1.519   7.815   8.124 1.00 . A A . 186 LEU HG   1 1 
        2  5870 1 1 186 LEU N    N   0.851   5.993   6.714 1.00 . A A . 186 LEU N    1 1 
        2  5871 1 1 186 LEU O    O   1.630   3.357   7.109 1.00 . A A . 186 LEU O    1 1 
        2  5872 1 1 187 GLY C    C   5.336   2.076   5.628 1.00 . A A . 187 GLY C    1 1 
        2  5873 1 1 187 GLY CA   C   3.871   2.353   5.891 1.00 . A A . 187 GLY CA   1 1 
        2  5874 1 1 187 GLY H    H   4.225   4.437   5.763 1.00 . A A . 187 GLY H    1 1 
        2  5875 1 1 187 GLY HA2  H   3.568   1.814   6.777 1.00 . A A . 187 GLY HA2  1 1 
        2  5876 1 1 187 GLY HA3  H   3.293   1.993   5.052 1.00 . A A . 187 GLY HA3  1 1 
        2  5877 1 1 187 GLY N    N   3.588   3.763   6.082 1.00 . A A . 187 GLY N    1 1 
        2  5878 1 1 187 GLY O    O   6.133   3.002   5.470 1.00 . A A . 187 GLY O    1 1 
        2  5879 1 1 188 VAL C    C   7.134  -0.602   4.164 1.00 . A A . 188 VAL C    1 1 
        2  5880 1 1 188 VAL CA   C   7.069   0.391   5.319 1.00 . A A . 188 VAL CA   1 1 
        2  5881 1 1 188 VAL CB   C   7.721  -0.238   6.568 1.00 . A A . 188 VAL CB   1 1 
        2  5882 1 1 188 VAL CG1  C   8.204   0.845   7.521 1.00 . A A . 188 VAL CG1  1 1 
        2  5883 1 1 188 VAL CG2  C   6.756  -1.183   7.270 1.00 . A A . 188 VAL CG2  1 1 
        2  5884 1 1 188 VAL H    H   5.005   0.106   5.702 1.00 . A A . 188 VAL H    1 1 
        2  5885 1 1 188 VAL HA   H   7.630   1.275   5.051 1.00 . A A . 188 VAL HA   1 1 
        2  5886 1 1 188 VAL HB   H   8.582  -0.810   6.248 1.00 . A A . 188 VAL HB   1 1 
        2  5887 1 1 188 VAL HG11 H   7.460   1.007   8.287 1.00 . A A . 188 VAL HG11 1 1 
        2  5888 1 1 188 VAL HG12 H   8.362   1.762   6.974 1.00 . A A . 188 VAL HG12 1 1 
        2  5889 1 1 188 VAL HG13 H   9.131   0.534   7.979 1.00 . A A . 188 VAL HG13 1 1 
        2  5890 1 1 188 VAL HG21 H   6.369  -1.897   6.557 1.00 . A A . 188 VAL HG21 1 1 
        2  5891 1 1 188 VAL HG22 H   5.940  -0.616   7.691 1.00 . A A . 188 VAL HG22 1 1 
        2  5892 1 1 188 VAL HG23 H   7.275  -1.708   8.058 1.00 . A A . 188 VAL HG23 1 1 
        2  5893 1 1 188 VAL N    N   5.691   0.795   5.573 1.00 . A A . 188 VAL N    1 1 
        2  5894 1 1 188 VAL O    O   6.302  -1.503   4.061 1.00 . A A . 188 VAL O    1 1 
        2  5895 1 1 189 SER C    C   9.753  -1.632   1.893 1.00 . A A . 189 SER C    1 1 
        2  5896 1 1 189 SER CA   C   8.284  -1.311   2.143 1.00 . A A . 189 SER CA   1 1 
        2  5897 1 1 189 SER CB   C   7.673  -0.671   0.896 1.00 . A A . 189 SER CB   1 1 
        2  5898 1 1 189 SER H    H   8.755   0.310   3.423 1.00 . A A . 189 SER H    1 1 
        2  5899 1 1 189 SER HA   H   7.760  -2.231   2.357 1.00 . A A . 189 SER HA   1 1 
        2  5900 1 1 189 SER HB2  H   7.597  -1.412   0.113 1.00 . A A . 189 SER HB2  1 1 
        2  5901 1 1 189 SER HB3  H   6.687  -0.297   1.132 1.00 . A A . 189 SER HB3  1 1 
        2  5902 1 1 189 SER HG   H   8.522   1.081   1.108 1.00 . A A . 189 SER HG   1 1 
        2  5903 1 1 189 SER N    N   8.124  -0.429   3.292 1.00 . A A . 189 SER N    1 1 
        2  5904 1 1 189 SER O    O  10.643  -1.036   2.500 1.00 . A A . 189 SER O    1 1 
        2  5905 1 1 189 SER OG   O   8.470   0.403   0.431 1.00 . A A . 189 SER OG   1 1 
        2  5906 1 1 190 TYR C    C  11.439  -3.416  -0.806 1.00 . A A . 190 TYR C    1 1 
        2  5907 1 1 190 TYR CA   C  11.354  -2.985   0.653 1.00 . A A . 190 TYR CA   1 1 
        2  5908 1 1 190 TYR CB   C  11.810  -4.127   1.565 1.00 . A A . 190 TYR CB   1 1 
        2  5909 1 1 190 TYR CD1  C  10.332  -5.972   0.676 1.00 . A A . 190 TYR CD1  1 1 
        2  5910 1 1 190 TYR CD2  C  10.220  -5.460   3.003 1.00 . A A . 190 TYR CD2  1 1 
        2  5911 1 1 190 TYR CE1  C   9.379  -6.959   0.844 1.00 . A A . 190 TYR CE1  1 1 
        2  5912 1 1 190 TYR CE2  C   9.266  -6.446   3.178 1.00 . A A . 190 TYR CE2  1 1 
        2  5913 1 1 190 TYR CG   C  10.769  -5.207   1.752 1.00 . A A . 190 TYR CG   1 1 
        2  5914 1 1 190 TYR CZ   C   8.850  -7.192   2.095 1.00 . A A . 190 TYR CZ   1 1 
        2  5915 1 1 190 TYR H    H   9.242  -3.014   0.544 1.00 . A A . 190 TYR H    1 1 
        2  5916 1 1 190 TYR HA   H  12.002  -2.134   0.804 1.00 . A A . 190 TYR HA   1 1 
        2  5917 1 1 190 TYR HB2  H  12.691  -4.586   1.141 1.00 . A A . 190 TYR HB2  1 1 
        2  5918 1 1 190 TYR HB3  H  12.052  -3.726   2.538 1.00 . A A . 190 TYR HB3  1 1 
        2  5919 1 1 190 TYR HD1  H  10.749  -5.787  -0.302 1.00 . A A . 190 TYR HD1  1 1 
        2  5920 1 1 190 TYR HD2  H  10.548  -4.874   3.849 1.00 . A A . 190 TYR HD2  1 1 
        2  5921 1 1 190 TYR HE1  H   9.055  -7.543  -0.004 1.00 . A A . 190 TYR HE1  1 1 
        2  5922 1 1 190 TYR HE2  H   8.851  -6.628   4.158 1.00 . A A . 190 TYR HE2  1 1 
        2  5923 1 1 190 TYR HH   H   7.280  -8.149   1.534 1.00 . A A . 190 TYR HH   1 1 
        2  5924 1 1 190 TYR N    N   9.996  -2.579   0.993 1.00 . A A . 190 TYR N    1 1 
        2  5925 1 1 190 TYR O    O  10.428  -3.745  -1.427 1.00 . A A . 190 TYR O    1 1 
        2  5926 1 1 190 TYR OH   O   7.901  -8.175   2.265 1.00 . A A . 190 TYR OH   1 1 
        2  5927 1 1 191 ARG C    C  13.261  -5.276  -2.834 1.00 . A A . 191 ARG C    1 1 
        2  5928 1 1 191 ARG CA   C  12.868  -3.805  -2.738 1.00 . A A . 191 ARG CA   1 1 
        2  5929 1 1 191 ARG CB   C  13.951  -2.933  -3.375 1.00 . A A . 191 ARG CB   1 1 
        2  5930 1 1 191 ARG CD   C  14.870  -1.871  -5.462 1.00 . A A . 191 ARG CD   1 1 
        2  5931 1 1 191 ARG CG   C  13.823  -2.811  -4.884 1.00 . A A . 191 ARG CG   1 1 
        2  5932 1 1 191 ARG CZ   C  16.627  -1.983  -7.184 1.00 . A A . 191 ARG CZ   1 1 
        2  5933 1 1 191 ARG H    H  13.420  -3.141  -0.805 1.00 . A A . 191 ARG H    1 1 
        2  5934 1 1 191 ARG HA   H  11.940  -3.658  -3.271 1.00 . A A . 191 ARG HA   1 1 
        2  5935 1 1 191 ARG HB2  H  13.896  -1.942  -2.948 1.00 . A A . 191 ARG HB2  1 1 
        2  5936 1 1 191 ARG HB3  H  14.917  -3.359  -3.151 1.00 . A A . 191 ARG HB3  1 1 
        2  5937 1 1 191 ARG HD2  H  14.372  -1.126  -6.064 1.00 . A A . 191 ARG HD2  1 1 
        2  5938 1 1 191 ARG HD3  H  15.389  -1.387  -4.648 1.00 . A A . 191 ARG HD3  1 1 
        2  5939 1 1 191 ARG HE   H  15.914  -3.549  -6.176 1.00 . A A . 191 ARG HE   1 1 
        2  5940 1 1 191 ARG HG2  H  13.948  -3.787  -5.327 1.00 . A A . 191 ARG HG2  1 1 
        2  5941 1 1 191 ARG HG3  H  12.840  -2.430  -5.121 1.00 . A A . 191 ARG HG3  1 1 
        2  5942 1 1 191 ARG HH11 H  15.915  -0.122  -6.833 1.00 . A A . 191 ARG HH11 1 1 
        2  5943 1 1 191 ARG HH12 H  17.152  -0.227  -8.041 1.00 . A A . 191 ARG HH12 1 1 
        2  5944 1 1 191 ARG HH21 H  17.540  -3.690  -7.764 1.00 . A A . 191 ARG HH21 1 1 
        2  5945 1 1 191 ARG HH22 H  18.075  -2.252  -8.570 1.00 . A A . 191 ARG HH22 1 1 
        2  5946 1 1 191 ARG N    N  12.652  -3.413  -1.350 1.00 . A A . 191 ARG N    1 1 
        2  5947 1 1 191 ARG NE   N  15.842  -2.579  -6.291 1.00 . A A . 191 ARG NE   1 1 
        2  5948 1 1 191 ARG NH1  N  16.559  -0.669  -7.368 1.00 . A A . 191 ARG NH1  1 1 
        2  5949 1 1 191 ARG NH2  N  17.485  -2.700  -7.898 1.00 . A A . 191 ARG NH2  1 1 
        2  5950 1 1 191 ARG O    O  13.876  -5.825  -1.921 1.00 . A A . 191 ARG O    1 1 
        2  5951 1 1 192 PHE C    C  14.720  -7.517  -4.319 1.00 . A A . 192 PHE C    1 1 
        2  5952 1 1 192 PHE CA   C  13.217  -7.316  -4.161 1.00 . A A . 192 PHE CA   1 1 
        2  5953 1 1 192 PHE CB   C  12.486  -7.840  -5.398 1.00 . A A . 192 PHE CB   1 1 
        2  5954 1 1 192 PHE CD1  C  11.705 -10.006  -4.403 1.00 . A A . 192 PHE CD1  1 1 
        2  5955 1 1 192 PHE CD2  C  12.883 -10.071  -6.475 1.00 . A A . 192 PHE CD2  1 1 
        2  5956 1 1 192 PHE CE1  C  11.582 -11.383  -4.426 1.00 . A A . 192 PHE CE1  1 1 
        2  5957 1 1 192 PHE CE2  C  12.763 -11.448  -6.504 1.00 . A A . 192 PHE CE2  1 1 
        2  5958 1 1 192 PHE CG   C  12.355  -9.336  -5.425 1.00 . A A . 192 PHE CG   1 1 
        2  5959 1 1 192 PHE CZ   C  12.113 -12.105  -5.478 1.00 . A A . 192 PHE CZ   1 1 
        2  5960 1 1 192 PHE H    H  12.411  -5.417  -4.639 1.00 . A A . 192 PHE H    1 1 
        2  5961 1 1 192 PHE HA   H  12.882  -7.865  -3.294 1.00 . A A . 192 PHE HA   1 1 
        2  5962 1 1 192 PHE HB2  H  11.494  -7.420  -5.427 1.00 . A A . 192 PHE HB2  1 1 
        2  5963 1 1 192 PHE HB3  H  13.028  -7.536  -6.281 1.00 . A A . 192 PHE HB3  1 1 
        2  5964 1 1 192 PHE HD1  H  11.290  -9.444  -3.579 1.00 . A A . 192 PHE HD1  1 1 
        2  5965 1 1 192 PHE HD2  H  13.392  -9.558  -7.278 1.00 . A A . 192 PHE HD2  1 1 
        2  5966 1 1 192 PHE HE1  H  11.073 -11.896  -3.622 1.00 . A A . 192 PHE HE1  1 1 
        2  5967 1 1 192 PHE HE2  H  13.180 -12.009  -7.328 1.00 . A A . 192 PHE HE2  1 1 
        2  5968 1 1 192 PHE HZ   H  12.019 -13.180  -5.498 1.00 . A A . 192 PHE HZ   1 1 
        2  5969 1 1 192 PHE N    N  12.902  -5.907  -3.946 1.00 . A A . 192 PHE N    1 1 
        2  5970 1 1 192 PHE O    O  15.306  -7.128  -5.329 1.00 . A A . 192 PHE O    1 1 
        2  5971 1 1 193 GLY C    C  17.149  -9.720  -2.787 1.00 . A A . 193 GLY C    1 1 
        2  5972 1 1 193 GLY CA   C  16.769  -8.370  -3.361 1.00 . A A . 193 GLY CA   1 1 
        2  5973 1 1 193 GLY H    H  14.821  -8.415  -2.532 1.00 . A A . 193 GLY H    1 1 
        2  5974 1 1 193 GLY HA2  H  17.095  -8.323  -4.389 1.00 . A A . 193 GLY HA2  1 1 
        2  5975 1 1 193 GLY HA3  H  17.271  -7.598  -2.800 1.00 . A A . 193 GLY HA3  1 1 
        2  5976 1 1 193 GLY N    N  15.339  -8.128  -3.313 1.00 . A A . 193 GLY N    1 1 
        2  5977 1 1 193 GLY O    O  16.282 -10.545  -2.497 1.00 . A A . 193 GLY O    1 1 
        2  5978 1 1 194 GLN C    C  19.862 -10.960  -0.887 1.00 . A A . 194 GLN C    1 1 
        2  5979 1 1 194 GLN CA   C  18.943 -11.205  -2.080 1.00 . A A . 194 GLN CA   1 1 
        2  5980 1 1 194 GLN CB   C  19.690 -11.991  -3.161 1.00 . A A . 194 GLN CB   1 1 
        2  5981 1 1 194 GLN CD   C  19.860 -14.219  -4.338 1.00 . A A . 194 GLN CD   1 1 
        2  5982 1 1 194 GLN CG   C  19.512 -13.497  -3.051 1.00 . A A . 194 GLN CG   1 1 
        2  5983 1 1 194 GLN H    H  19.089  -9.249  -2.874 1.00 . A A . 194 GLN H    1 1 
        2  5984 1 1 194 GLN HA   H  18.093 -11.783  -1.751 1.00 . A A . 194 GLN HA   1 1 
        2  5985 1 1 194 GLN HB2  H  19.332 -11.676  -4.129 1.00 . A A . 194 GLN HB2  1 1 
        2  5986 1 1 194 GLN HB3  H  20.745 -11.767  -3.087 1.00 . A A . 194 GLN HB3  1 1 
        2  5987 1 1 194 GLN HE21 H  18.505 -13.155  -5.331 1.00 . A A . 194 GLN HE21 1 1 
        2  5988 1 1 194 GLN HE22 H  19.387 -14.308  -6.267 1.00 . A A . 194 GLN HE22 1 1 
        2  5989 1 1 194 GLN HG2  H  20.154 -13.866  -2.265 1.00 . A A . 194 GLN HG2  1 1 
        2  5990 1 1 194 GLN HG3  H  18.482 -13.707  -2.803 1.00 . A A . 194 GLN HG3  1 1 
        2  5991 1 1 194 GLN N    N  18.448  -9.945  -2.623 1.00 . A A . 194 GLN N    1 1 
        2  5992 1 1 194 GLN NE2  N  19.182 -13.858  -5.421 1.00 . A A . 194 GLN NE2  1 1 
        2  5993 1 1 194 GLN O    O  21.085 -10.956  -1.023 1.00 . A A . 194 GLN O    1 1 
        2  5994 1 1 194 GLN OE1  O  20.727 -15.092  -4.359 1.00 . A A . 194 GLN OE1  1 1 
        2  5995 1 1 195 GLU C    C  20.271 -11.807   2.263 1.00 . A A . 195 GLU C    1 1 
        2  5996 1 1 195 GLU CA   C  20.028 -10.509   1.498 1.00 . A A . 195 GLU CA   1 1 
        2  5997 1 1 195 GLU CB   C  19.295  -9.505   2.392 1.00 . A A . 195 GLU CB   1 1 
        2  5998 1 1 195 GLU CD   C  19.641  -7.116   3.132 1.00 . A A . 195 GLU CD   1 1 
        2  5999 1 1 195 GLU CG   C  20.219  -8.516   3.083 1.00 . A A . 195 GLU CG   1 1 
        2  6000 1 1 195 GLU H    H  18.284 -10.770   0.327 1.00 . A A . 195 GLU H    1 1 
        2  6001 1 1 195 GLU HA   H  20.981 -10.090   1.211 1.00 . A A . 195 GLU HA   1 1 
        2  6002 1 1 195 GLU HB2  H  18.594  -8.949   1.787 1.00 . A A . 195 GLU HB2  1 1 
        2  6003 1 1 195 GLU HB3  H  18.751 -10.048   3.152 1.00 . A A . 195 GLU HB3  1 1 
        2  6004 1 1 195 GLU HG2  H  20.396  -8.852   4.093 1.00 . A A . 195 GLU HG2  1 1 
        2  6005 1 1 195 GLU HG3  H  21.156  -8.484   2.546 1.00 . A A . 195 GLU HG3  1 1 
        2  6006 1 1 195 GLU N    N  19.264 -10.755   0.281 1.00 . A A . 195 GLU N    1 1 
        2  6007 1 1 195 GLU O    O  19.714 -12.850   1.924 1.00 . A A . 195 GLU O    1 1 
        2  6008 1 1 195 GLU OE1  O  19.717  -6.405   2.109 1.00 . A A . 195 GLU OE1  1 1 
        2  6009 1 1 195 GLU OE2  O  19.112  -6.729   4.195 1.00 . A A . 195 GLU OE2  1 1 
        2  6010 1 1 196 ASP C    C  21.202 -12.614   5.587 1.00 . A A . 196 ASP C    1 1 
        2  6011 1 1 196 ASP CA   C  21.423 -12.903   4.106 1.00 . A A . 196 ASP CA   1 1 
        2  6012 1 1 196 ASP CB   C  22.872 -13.337   3.870 1.00 . A A . 196 ASP CB   1 1 
        2  6013 1 1 196 ASP CG   C  23.051 -14.838   3.979 1.00 . A A . 196 ASP CG   1 1 
        2  6014 1 1 196 ASP H    H  21.519 -10.872   3.514 1.00 . A A . 196 ASP H    1 1 
        2  6015 1 1 196 ASP HA   H  20.764 -13.704   3.804 1.00 . A A . 196 ASP HA   1 1 
        2  6016 1 1 196 ASP HB2  H  23.177 -13.027   2.881 1.00 . A A . 196 ASP HB2  1 1 
        2  6017 1 1 196 ASP HB3  H  23.507 -12.862   4.603 1.00 . A A . 196 ASP HB3  1 1 
        2  6018 1 1 196 ASP N    N  21.106 -11.733   3.293 1.00 . A A . 196 ASP N    1 1 
        2  6019 1 1 196 ASP O    O  21.082 -11.459   5.992 1.00 . A A . 196 ASP O    1 1 
        2  6020 1 1 196 ASP OD1  O  22.114 -15.576   3.607 1.00 . A A . 196 ASP OD1  1 1 
        2  6021 1 1 196 ASP OD2  O  24.127 -15.276   4.437 1.00 . A A . 196 ASP OD2  1 1 
        2  6022 1 1 197 ALA C    C  21.938 -14.376   8.608 1.00 . A A . 197 ALA C    1 1 
        2  6023 1 1 197 ALA CA   C  20.940 -13.533   7.824 1.00 . A A . 197 ALA CA   1 1 
        2  6024 1 1 197 ALA CB   C  19.515 -13.921   8.190 1.00 . A A . 197 ALA CB   1 1 
        2  6025 1 1 197 ALA H    H  21.249 -14.569   6.006 1.00 . A A . 197 ALA H    1 1 
        2  6026 1 1 197 ALA HA   H  21.081 -12.493   8.082 1.00 . A A . 197 ALA HA   1 1 
        2  6027 1 1 197 ALA HB1  H  18.855 -13.086   8.003 1.00 . A A . 197 ALA HB1  1 1 
        2  6028 1 1 197 ALA HB2  H  19.470 -14.187   9.235 1.00 . A A . 197 ALA HB2  1 1 
        2  6029 1 1 197 ALA HB3  H  19.206 -14.764   7.589 1.00 . A A . 197 ALA HB3  1 1 
        2  6030 1 1 197 ALA N    N  21.147 -13.672   6.389 1.00 . A A . 197 ALA N    1 1 
        2  6031 1 1 197 ALA O    O  21.622 -14.895   9.678 1.00 . A A . 197 ALA O    1 1 
        2  6032 1 1 198 ALA C    C  25.579 -14.765   8.346 1.00 . A A . 198 ALA C    1 1 
        2  6033 1 1 198 ALA CA   C  24.193 -15.288   8.717 1.00 . A A . 198 ALA CA   1 1 
        2  6034 1 1 198 ALA CB   C  24.064 -16.756   8.342 1.00 . A A . 198 ALA CB   1 1 
        2  6035 1 1 198 ALA H    H  23.338 -14.069   7.213 1.00 . A A . 198 ALA H    1 1 
        2  6036 1 1 198 ALA HA   H  24.061 -15.200   9.785 1.00 . A A . 198 ALA HA   1 1 
        2  6037 1 1 198 ALA HB1  H  24.705 -16.971   7.501 1.00 . A A . 198 ALA HB1  1 1 
        2  6038 1 1 198 ALA HB2  H  23.039 -16.972   8.079 1.00 . A A . 198 ALA HB2  1 1 
        2  6039 1 1 198 ALA HB3  H  24.356 -17.369   9.182 1.00 . A A . 198 ALA HB3  1 1 
        2  6040 1 1 198 ALA N    N  23.146 -14.508   8.068 1.00 . A A . 198 ALA N    1 1 
        2  6041 1 1 198 ALA O    O  26.296 -15.384   7.561 1.00 . A A . 198 ALA O    1 1 
        2  6042 1 1 199 PRO C    C  28.409 -13.674   9.402 1.00 . A A . 199 PRO C    1 1 
        2  6043 1 1 199 PRO CA   C  27.277 -13.000   8.632 1.00 . A A . 199 PRO CA   1 1 
        2  6044 1 1 199 PRO CB   C  27.090 -11.562   9.106 1.00 . A A . 199 PRO CB   1 1 
        2  6045 1 1 199 PRO CD   C  25.177 -12.802   9.854 1.00 . A A . 199 PRO CD   1 1 
        2  6046 1 1 199 PRO CG   C  26.095 -11.659  10.212 1.00 . A A . 199 PRO CG   1 1 
        2  6047 1 1 199 PRO HA   H  27.505 -13.009   7.576 1.00 . A A . 199 PRO HA   1 1 
        2  6048 1 1 199 PRO HB2  H  28.033 -11.168   9.455 1.00 . A A . 199 PRO HB2  1 1 
        2  6049 1 1 199 PRO HB3  H  26.717 -10.955   8.293 1.00 . A A . 199 PRO HB3  1 1 
        2  6050 1 1 199 PRO HD2  H  24.930 -13.375  10.735 1.00 . A A . 199 PRO HD2  1 1 
        2  6051 1 1 199 PRO HD3  H  24.281 -12.429   9.383 1.00 . A A . 199 PRO HD3  1 1 
        2  6052 1 1 199 PRO HG2  H  26.601 -11.864  11.143 1.00 . A A . 199 PRO HG2  1 1 
        2  6053 1 1 199 PRO HG3  H  25.535 -10.739  10.284 1.00 . A A . 199 PRO HG3  1 1 
        2  6054 1 1 199 PRO N    N  25.974 -13.608   8.908 1.00 . A A . 199 PRO N    1 1 
        2  6055 1 1 199 PRO O    O  29.148 -13.019  10.140 1.00 . A A . 199 PRO O    1 1 
        2  6056 1 1 200 VAL C    C  30.539 -16.395   8.907 1.00 . A A . 200 VAL C    1 1 
        2  6057 1 1 200 VAL CA   C  29.585 -15.745   9.906 1.00 . A A . 200 VAL CA   1 1 
        2  6058 1 1 200 VAL CB   C  28.983 -16.834  10.817 1.00 . A A . 200 VAL CB   1 1 
        2  6059 1 1 200 VAL CG1  C  28.171 -17.831  10.001 1.00 . A A . 200 VAL CG1  1 1 
        2  6060 1 1 200 VAL CG2  C  30.077 -17.540  11.605 1.00 . A A . 200 VAL CG2  1 1 
        2  6061 1 1 200 VAL H    H  27.925 -15.452   8.628 1.00 . A A . 200 VAL H    1 1 
        2  6062 1 1 200 VAL HA   H  30.145 -15.059  10.526 1.00 . A A . 200 VAL HA   1 1 
        2  6063 1 1 200 VAL HB   H  28.317 -16.356  11.520 1.00 . A A . 200 VAL HB   1 1 
        2  6064 1 1 200 VAL HG11 H  28.105 -17.493   8.978 1.00 . A A . 200 VAL HG11 1 1 
        2  6065 1 1 200 VAL HG12 H  27.177 -17.911  10.417 1.00 . A A . 200 VAL HG12 1 1 
        2  6066 1 1 200 VAL HG13 H  28.651 -18.797  10.030 1.00 . A A . 200 VAL HG13 1 1 
        2  6067 1 1 200 VAL HG21 H  29.663 -17.933  12.523 1.00 . A A . 200 VAL HG21 1 1 
        2  6068 1 1 200 VAL HG22 H  30.865 -16.839  11.836 1.00 . A A . 200 VAL HG22 1 1 
        2  6069 1 1 200 VAL HG23 H  30.478 -18.353  11.015 1.00 . A A . 200 VAL HG23 1 1 
        2  6070 1 1 200 VAL N    N  28.542 -14.985   9.227 1.00 . A A . 200 VAL N    1 1 
        2  6071 1 1 200 VAL O    O  31.716 -16.605   9.204 1.00 . A A . 200 VAL O    1 1 
        2  6072 1 1 201 VAL C    C  30.932 -16.440   5.448 1.00 . A A . 201 VAL C    1 1 
        2  6073 1 1 201 VAL CA   C  30.835 -17.333   6.681 1.00 . A A . 201 VAL CA   1 1 
        2  6074 1 1 201 VAL CB   C  30.260 -18.701   6.266 1.00 . A A . 201 VAL CB   1 1 
        2  6075 1 1 201 VAL CG1  C  31.203 -19.411   5.306 1.00 . A A . 201 VAL CG1  1 1 
        2  6076 1 1 201 VAL CG2  C  29.989 -19.561   7.491 1.00 . A A . 201 VAL CG2  1 1 
        2  6077 1 1 201 VAL H    H  29.084 -16.517   7.539 1.00 . A A . 201 VAL H    1 1 
        2  6078 1 1 201 VAL HA   H  31.828 -17.490   7.078 1.00 . A A . 201 VAL HA   1 1 
        2  6079 1 1 201 VAL HB   H  29.323 -18.534   5.755 1.00 . A A . 201 VAL HB   1 1 
        2  6080 1 1 201 VAL HG11 H  32.216 -19.079   5.487 1.00 . A A . 201 VAL HG11 1 1 
        2  6081 1 1 201 VAL HG12 H  30.924 -19.178   4.289 1.00 . A A . 201 VAL HG12 1 1 
        2  6082 1 1 201 VAL HG13 H  31.141 -20.478   5.463 1.00 . A A . 201 VAL HG13 1 1 
        2  6083 1 1 201 VAL HG21 H  29.260 -20.320   7.244 1.00 . A A . 201 VAL HG21 1 1 
        2  6084 1 1 201 VAL HG22 H  29.606 -18.940   8.287 1.00 . A A . 201 VAL HG22 1 1 
        2  6085 1 1 201 VAL HG23 H  30.906 -20.032   7.810 1.00 . A A . 201 VAL HG23 1 1 
        2  6086 1 1 201 VAL N    N  30.026 -16.710   7.721 1.00 . A A . 201 VAL N    1 1 
        2  6087 1 1 201 VAL O    O  30.005 -15.692   5.138 1.00 . A A . 201 VAL O    1 1 
        2  6088 1 1 202 ALA C    C  32.363 -16.607   2.309 1.00 . A A . 202 ALA C    1 1 
        2  6089 1 1 202 ALA CA   C  32.278 -15.722   3.552 1.00 . A A . 202 ALA CA   1 1 
        2  6090 1 1 202 ALA CB   C  33.546 -14.895   3.697 1.00 . A A . 202 ALA CB   1 1 
        2  6091 1 1 202 ALA H    H  32.762 -17.138   5.048 1.00 . A A . 202 ALA H    1 1 
        2  6092 1 1 202 ALA HA   H  31.445 -15.045   3.448 1.00 . A A . 202 ALA HA   1 1 
        2  6093 1 1 202 ALA HB1  H  33.482 -14.292   4.591 1.00 . A A . 202 ALA HB1  1 1 
        2  6094 1 1 202 ALA HB2  H  33.657 -14.251   2.836 1.00 . A A . 202 ALA HB2  1 1 
        2  6095 1 1 202 ALA HB3  H  34.400 -15.553   3.766 1.00 . A A . 202 ALA HB3  1 1 
        2  6096 1 1 202 ALA N    N  32.059 -16.524   4.750 1.00 . A A . 202 ALA N    1 1 
        2  6097 1 1 202 ALA O    O  33.310 -17.378   2.153 1.00 . A A . 202 ALA O    1 1 
        2  6098 1 1 203 PRO C    C  32.475 -16.926  -0.786 1.00 . A A . 203 PRO C    1 1 
        2  6099 1 1 203 PRO CA   C  31.352 -17.312   0.172 1.00 . A A . 203 PRO CA   1 1 
        2  6100 1 1 203 PRO CB   C  29.987 -16.992  -0.444 1.00 . A A . 203 PRO CB   1 1 
        2  6101 1 1 203 PRO CD   C  30.202 -15.621   1.498 1.00 . A A . 203 PRO CD   1 1 
        2  6102 1 1 203 PRO CG   C  29.620 -15.661   0.113 1.00 . A A . 203 PRO CG   1 1 
        2  6103 1 1 203 PRO HA   H  31.415 -18.368   0.389 1.00 . A A . 203 PRO HA   1 1 
        2  6104 1 1 203 PRO HB2  H  30.076 -16.959  -1.521 1.00 . A A . 203 PRO HB2  1 1 
        2  6105 1 1 203 PRO HB3  H  29.275 -17.750  -0.160 1.00 . A A . 203 PRO HB3  1 1 
        2  6106 1 1 203 PRO HD2  H  30.502 -14.613   1.752 1.00 . A A . 203 PRO HD2  1 1 
        2  6107 1 1 203 PRO HD3  H  29.489 -15.997   2.219 1.00 . A A . 203 PRO HD3  1 1 
        2  6108 1 1 203 PRO HG2  H  30.043 -14.876  -0.495 1.00 . A A . 203 PRO HG2  1 1 
        2  6109 1 1 203 PRO HG3  H  28.544 -15.566   0.156 1.00 . A A . 203 PRO HG3  1 1 
        2  6110 1 1 203 PRO N    N  31.373 -16.512   1.402 1.00 . A A . 203 PRO N    1 1 
        2  6111 1 1 203 PRO O    O  32.466 -15.838  -1.363 1.00 . A A . 203 PRO O    1 1 
        2  6112 1 1 204 ALA C    C  34.533 -18.509  -3.048 1.00 . A A . 204 ALA C    1 1 
        2  6113 1 1 204 ALA CA   C  34.569 -17.578  -1.839 1.00 . A A . 204 ALA CA   1 1 
        2  6114 1 1 204 ALA CB   C  35.879 -17.744  -1.082 1.00 . A A . 204 ALA CB   1 1 
        2  6115 1 1 204 ALA H    H  33.393 -18.673  -0.463 1.00 . A A . 204 ALA H    1 1 
        2  6116 1 1 204 ALA HA   H  34.508 -16.554  -2.181 1.00 . A A . 204 ALA HA   1 1 
        2  6117 1 1 204 ALA HB1  H  35.833 -18.634  -0.471 1.00 . A A . 204 ALA HB1  1 1 
        2  6118 1 1 204 ALA HB2  H  36.043 -16.883  -0.453 1.00 . A A . 204 ALA HB2  1 1 
        2  6119 1 1 204 ALA HB3  H  36.694 -17.835  -1.787 1.00 . A A . 204 ALA HB3  1 1 
        2  6120 1 1 204 ALA N    N  33.440 -17.824  -0.951 1.00 . A A . 204 ALA N    1 1 
        2  6121 1 1 204 ALA O    O  35.069 -19.617  -3.005 1.00 . A A . 204 ALA O    1 1 
        2  6122 1 1 205 PRO C    C  35.148 -19.404  -5.835 1.00 . A A . 205 PRO C    1 1 
        2  6123 1 1 205 PRO CA   C  33.796 -18.872  -5.374 1.00 . A A . 205 PRO CA   1 1 
        2  6124 1 1 205 PRO CB   C  33.234 -17.884  -6.398 1.00 . A A . 205 PRO CB   1 1 
        2  6125 1 1 205 PRO CD   C  33.232 -16.760  -4.288 1.00 . A A . 205 PRO CD   1 1 
        2  6126 1 1 205 PRO CG   C  32.487 -16.882  -5.588 1.00 . A A . 205 PRO CG   1 1 
        2  6127 1 1 205 PRO HA   H  33.110 -19.696  -5.250 1.00 . A A . 205 PRO HA   1 1 
        2  6128 1 1 205 PRO HB2  H  34.046 -17.427  -6.944 1.00 . A A . 205 PRO HB2  1 1 
        2  6129 1 1 205 PRO HB3  H  32.580 -18.405  -7.083 1.00 . A A . 205 PRO HB3  1 1 
        2  6130 1 1 205 PRO HD2  H  33.957 -15.963  -4.343 1.00 . A A . 205 PRO HD2  1 1 
        2  6131 1 1 205 PRO HD3  H  32.544 -16.592  -3.473 1.00 . A A . 205 PRO HD3  1 1 
        2  6132 1 1 205 PRO HG2  H  32.472 -15.934  -6.103 1.00 . A A . 205 PRO HG2  1 1 
        2  6133 1 1 205 PRO HG3  H  31.479 -17.231  -5.411 1.00 . A A . 205 PRO HG3  1 1 
        2  6134 1 1 205 PRO N    N  33.898 -18.070  -4.149 1.00 . A A . 205 PRO N    1 1 
        2  6135 1 1 205 PRO O    O  36.064 -18.635  -6.125 1.00 . A A . 205 PRO O    1 1 
        2  6136 1 1 206 ALA C    C  36.664 -21.298  -7.845 1.00 . A A . 206 ALA C    1 1 
        2  6137 1 1 206 ALA CA   C  36.507 -21.363  -6.327 1.00 . A A . 206 ALA CA   1 1 
        2  6138 1 1 206 ALA CB   C  36.551 -22.806  -5.847 1.00 . A A . 206 ALA CB   1 1 
        2  6139 1 1 206 ALA H    H  34.500 -21.287  -5.655 1.00 . A A . 206 ALA H    1 1 
        2  6140 1 1 206 ALA HA   H  37.329 -20.831  -5.867 1.00 . A A . 206 ALA HA   1 1 
        2  6141 1 1 206 ALA HB1  H  37.197 -22.878  -4.984 1.00 . A A . 206 ALA HB1  1 1 
        2  6142 1 1 206 ALA HB2  H  36.935 -23.437  -6.635 1.00 . A A . 206 ALA HB2  1 1 
        2  6143 1 1 206 ALA HB3  H  35.556 -23.128  -5.581 1.00 . A A . 206 ALA HB3  1 1 
        2  6144 1 1 206 ALA N    N  35.267 -20.727  -5.900 1.00 . A A . 206 ALA N    1 1 
        2  6145 1 1 206 ALA O    O  37.687 -20.839  -8.351 1.00 . A A . 206 ALA O    1 1 
        2  6146 1 1 207 PRO C    C  35.999 -20.371 -10.623 1.00 . A A . 207 PRO C    1 1 
        2  6147 1 1 207 PRO CA   C  35.681 -21.751 -10.059 1.00 . A A . 207 PRO CA   1 1 
        2  6148 1 1 207 PRO CB   C  34.263 -22.175 -10.454 1.00 . A A . 207 PRO CB   1 1 
        2  6149 1 1 207 PRO CD   C  34.389 -22.325  -8.073 1.00 . A A . 207 PRO CD   1 1 
        2  6150 1 1 207 PRO CG   C  33.760 -22.950  -9.287 1.00 . A A . 207 PRO CG   1 1 
        2  6151 1 1 207 PRO HA   H  36.393 -22.468 -10.443 1.00 . A A . 207 PRO HA   1 1 
        2  6152 1 1 207 PRO HB2  H  33.661 -21.298 -10.637 1.00 . A A . 207 PRO HB2  1 1 
        2  6153 1 1 207 PRO HB3  H  34.302 -22.785 -11.344 1.00 . A A . 207 PRO HB3  1 1 
        2  6154 1 1 207 PRO HD2  H  33.752 -21.549  -7.674 1.00 . A A . 207 PRO HD2  1 1 
        2  6155 1 1 207 PRO HD3  H  34.584 -23.077  -7.322 1.00 . A A . 207 PRO HD3  1 1 
        2  6156 1 1 207 PRO HG2  H  32.684 -22.872  -9.233 1.00 . A A . 207 PRO HG2  1 1 
        2  6157 1 1 207 PRO HG3  H  34.060 -23.983  -9.374 1.00 . A A . 207 PRO HG3  1 1 
        2  6158 1 1 207 PRO N    N  35.648 -21.761  -8.593 1.00 . A A . 207 PRO N    1 1 
        2  6159 1 1 207 PRO O    O  35.200 -19.442 -10.503 1.00 . A A . 207 PRO O    1 1 
        2  6160 1 1 208 ALA C    C  36.766 -18.634 -13.053 1.00 . A A . 208 ALA C    1 1 
        2  6161 1 1 208 ALA CA   C  37.594 -18.974 -11.817 1.00 . A A . 208 ALA CA   1 1 
        2  6162 1 1 208 ALA CB   C  39.075 -19.021 -12.165 1.00 . A A . 208 ALA CB   1 1 
        2  6163 1 1 208 ALA H    H  37.765 -21.019 -11.299 1.00 . A A . 208 ALA H    1 1 
        2  6164 1 1 208 ALA HA   H  37.447 -18.202 -11.075 1.00 . A A . 208 ALA HA   1 1 
        2  6165 1 1 208 ALA HB1  H  39.249 -18.469 -13.077 1.00 . A A . 208 ALA HB1  1 1 
        2  6166 1 1 208 ALA HB2  H  39.380 -20.048 -12.304 1.00 . A A . 208 ALA HB2  1 1 
        2  6167 1 1 208 ALA HB3  H  39.647 -18.581 -11.363 1.00 . A A . 208 ALA HB3  1 1 
        2  6168 1 1 208 ALA N    N  37.172 -20.242 -11.236 1.00 . A A . 208 ALA N    1 1 
        2  6169 1 1 208 ALA O    O  36.078 -17.614 -13.088 1.00 . A A . 208 ALA O    1 1 
        2  6170 1 1 209 PRO C    C  34.573 -19.511 -15.151 1.00 . A A . 209 PRO C    1 1 
        2  6171 1 1 209 PRO CA   C  36.067 -19.271 -15.330 1.00 . A A . 209 PRO CA   1 1 
        2  6172 1 1 209 PRO CB   C  36.665 -20.303 -16.288 1.00 . A A . 209 PRO CB   1 1 
        2  6173 1 1 209 PRO CD   C  37.613 -20.733 -14.135 1.00 . A A . 209 PRO CD   1 1 
        2  6174 1 1 209 PRO CG   C  37.156 -21.397 -15.405 1.00 . A A . 209 PRO CG   1 1 
        2  6175 1 1 209 PRO HA   H  36.228 -18.277 -15.720 1.00 . A A . 209 PRO HA   1 1 
        2  6176 1 1 209 PRO HB2  H  35.898 -20.654 -16.965 1.00 . A A . 209 PRO HB2  1 1 
        2  6177 1 1 209 PRO HB3  H  37.470 -19.856 -16.849 1.00 . A A . 209 PRO HB3  1 1 
        2  6178 1 1 209 PRO HD2  H  37.395 -21.358 -13.283 1.00 . A A . 209 PRO HD2  1 1 
        2  6179 1 1 209 PRO HD3  H  38.669 -20.512 -14.183 1.00 . A A . 209 PRO HD3  1 1 
        2  6180 1 1 209 PRO HG2  H  36.355 -22.091 -15.199 1.00 . A A . 209 PRO HG2  1 1 
        2  6181 1 1 209 PRO HG3  H  37.982 -21.907 -15.879 1.00 . A A . 209 PRO HG3  1 1 
        2  6182 1 1 209 PRO N    N  36.818 -19.489 -14.090 1.00 . A A . 209 PRO N    1 1 
        2  6183 1 1 209 PRO O    O  34.161 -20.395 -14.398 1.00 . A A . 209 PRO O    1 1 
        2  6184 1 1 210 GLU C    C  31.686 -18.842 -17.155 1.00 . A A . 210 GLU C    1 1 
        2  6185 1 1 210 GLU CA   C  32.314 -18.845 -15.765 1.00 . A A . 210 GLU CA   1 1 
        2  6186 1 1 210 GLU CB   C  31.728 -17.708 -14.927 1.00 . A A . 210 GLU CB   1 1 
        2  6187 1 1 210 GLU CD   C  31.011 -15.692 -16.270 1.00 . A A . 210 GLU CD   1 1 
        2  6188 1 1 210 GLU CG   C  32.105 -16.324 -15.433 1.00 . A A . 210 GLU CG   1 1 
        2  6189 1 1 210 GLU H    H  34.152 -18.033 -16.430 1.00 . A A . 210 GLU H    1 1 
        2  6190 1 1 210 GLU HA   H  32.089 -19.786 -15.284 1.00 . A A . 210 GLU HA   1 1 
        2  6191 1 1 210 GLU HB2  H  30.652 -17.789 -14.933 1.00 . A A . 210 GLU HB2  1 1 
        2  6192 1 1 210 GLU HB3  H  32.082 -17.804 -13.910 1.00 . A A . 210 GLU HB3  1 1 
        2  6193 1 1 210 GLU HG2  H  32.302 -15.686 -14.584 1.00 . A A . 210 GLU HG2  1 1 
        2  6194 1 1 210 GLU HG3  H  32.998 -16.407 -16.036 1.00 . A A . 210 GLU HG3  1 1 
        2  6195 1 1 210 GLU N    N  33.764 -18.720 -15.847 1.00 . A A . 210 GLU N    1 1 
        2  6196 1 1 210 GLU O    O  32.447 -18.802 -18.145 1.00 . A A . 210 GLU O    1 1 
        2  6197 1 1 210 GLU OE1  O  29.966 -15.319 -15.698 1.00 . A A . 210 GLU OE1  1 1 
        2  6198 1 1 210 GLU OE2  O  31.199 -15.571 -17.499 1.00 . A A . 210 GLU OE2  1 1 
        3  6199 1 1   1 ALA C    C  38.794  15.444 -21.251 1.00 . A A .   1 ALA C    1 1 
        3  6200 1 1   1 ALA CA   C  39.739  14.271 -21.482 1.00 . A A .   1 ALA CA   1 1 
        3  6201 1 1   1 ALA CB   C  40.819  14.246 -20.409 1.00 . A A .   1 ALA CB   1 1 
        3  6202 1 1   1 ALA H1   H  39.633  14.690 -23.492 1.00 . A A .   1 ALA H1   1 1 
        3  6203 1 1   1 ALA H2   H  40.667  13.381 -23.087 1.00 . A A .   1 ALA H2   1 1 
        3  6204 1 1   1 ALA H3   H  41.161  14.996 -22.779 1.00 . A A .   1 ALA H3   1 1 
        3  6205 1 1   1 ALA HA   H  39.178  13.351 -21.412 1.00 . A A .   1 ALA HA   1 1 
        3  6206 1 1   1 ALA HB1  H  40.432  14.680 -19.498 1.00 . A A .   1 ALA HB1  1 1 
        3  6207 1 1   1 ALA HB2  H  41.673  14.816 -20.745 1.00 . A A .   1 ALA HB2  1 1 
        3  6208 1 1   1 ALA HB3  H  41.118  13.225 -20.223 1.00 . A A .   1 ALA HB3  1 1 
        3  6209 1 1   1 ALA N    N  40.356  14.341 -22.831 1.00 . A A .   1 ALA N    1 1 
        3  6210 1 1   1 ALA O    O  39.135  16.593 -21.526 1.00 . A A .   1 ALA O    1 1 
        3  6211 1 1   2 ARG C    C  35.692  15.760 -19.325 1.00 . A A .   2 ARG C    1 1 
        3  6212 1 1   2 ARG CA   C  36.607  16.175 -20.473 1.00 . A A .   2 ARG CA   1 1 
        3  6213 1 1   2 ARG CB   C  35.779  16.454 -21.728 1.00 . A A .   2 ARG CB   1 1 
        3  6214 1 1   2 ARG CD   C  35.752  17.239 -24.118 1.00 . A A .   2 ARG CD   1 1 
        3  6215 1 1   2 ARG CG   C  36.564  17.139 -22.836 1.00 . A A .   2 ARG CG   1 1 
        3  6216 1 1   2 ARG CZ   C  34.836  19.042 -25.528 1.00 . A A .   2 ARG CZ   1 1 
        3  6217 1 1   2 ARG H    H  37.389  14.209 -20.542 1.00 . A A .   2 ARG H    1 1 
        3  6218 1 1   2 ARG HA   H  37.130  17.078 -20.192 1.00 . A A .   2 ARG HA   1 1 
        3  6219 1 1   2 ARG HB2  H  35.401  15.517 -22.111 1.00 . A A .   2 ARG HB2  1 1 
        3  6220 1 1   2 ARG HB3  H  34.944  17.086 -21.463 1.00 . A A .   2 ARG HB3  1 1 
        3  6221 1 1   2 ARG HD2  H  36.380  16.954 -24.948 1.00 . A A .   2 ARG HD2  1 1 
        3  6222 1 1   2 ARG HD3  H  34.914  16.561 -24.053 1.00 . A A .   2 ARG HD3  1 1 
        3  6223 1 1   2 ARG HE   H  35.226  19.200 -23.576 1.00 . A A .   2 ARG HE   1 1 
        3  6224 1 1   2 ARG HG2  H  36.829  18.134 -22.512 1.00 . A A .   2 ARG HG2  1 1 
        3  6225 1 1   2 ARG HG3  H  37.460  16.571 -23.031 1.00 . A A .   2 ARG HG3  1 1 
        3  6226 1 1   2 ARG HH11 H  35.187  17.307 -26.508 1.00 . A A .   2 ARG HH11 1 1 
        3  6227 1 1   2 ARG HH12 H  34.544  18.591 -27.477 1.00 . A A .   2 ARG HH12 1 1 
        3  6228 1 1   2 ARG HH21 H  34.378  20.890 -24.847 1.00 . A A .   2 ARG HH21 1 1 
        3  6229 1 1   2 ARG HH22 H  34.085  20.625 -26.535 1.00 . A A .   2 ARG HH22 1 1 
        3  6230 1 1   2 ARG N    N  37.602  15.145 -20.742 1.00 . A A .   2 ARG N    1 1 
        3  6231 1 1   2 ARG NE   N  35.252  18.594 -24.346 1.00 . A A .   2 ARG NE   1 1 
        3  6232 1 1   2 ARG NH1  N  34.858  18.248 -26.591 1.00 . A A .   2 ARG NH1  1 1 
        3  6233 1 1   2 ARG NH2  N  34.398  20.287 -25.646 1.00 . A A .   2 ARG NH2  1 1 
        3  6234 1 1   2 ARG O    O  35.438  16.540 -18.408 1.00 . A A .   2 ARG O    1 1 
        3  6235 1 1   3 ILE C    C  35.122  13.441 -17.179 1.00 . A A .   3 ILE C    1 1 
        3  6236 1 1   3 ILE CA   C  34.320  14.006 -18.346 1.00 . A A .   3 ILE CA   1 1 
        3  6237 1 1   3 ILE CB   C  33.389  12.905 -18.893 1.00 . A A .   3 ILE CB   1 1 
        3  6238 1 1   3 ILE CD1  C  32.399  12.269 -21.149 1.00 . A A .   3 ILE CD1  1 1 
        3  6239 1 1   3 ILE CG1  C  32.687  13.382 -20.166 1.00 . A A .   3 ILE CG1  1 1 
        3  6240 1 1   3 ILE CG2  C  32.367  12.502 -17.839 1.00 . A A .   3 ILE CG2  1 1 
        3  6241 1 1   3 ILE H    H  35.444  13.950 -20.137 1.00 . A A .   3 ILE H    1 1 
        3  6242 1 1   3 ILE HA   H  33.708  14.822 -17.988 1.00 . A A .   3 ILE HA   1 1 
        3  6243 1 1   3 ILE HB   H  33.991  12.040 -19.125 1.00 . A A .   3 ILE HB   1 1 
        3  6244 1 1   3 ILE HD11 H  33.329  11.896 -21.554 1.00 . A A .   3 ILE HD11 1 1 
        3  6245 1 1   3 ILE HD12 H  31.784  12.647 -21.952 1.00 . A A .   3 ILE HD12 1 1 
        3  6246 1 1   3 ILE HD13 H  31.880  11.467 -20.644 1.00 . A A .   3 ILE HD13 1 1 
        3  6247 1 1   3 ILE HG12 H  31.746  13.841 -19.901 1.00 . A A .   3 ILE HG12 1 1 
        3  6248 1 1   3 ILE HG13 H  33.310  14.112 -20.662 1.00 . A A .   3 ILE HG13 1 1 
        3  6249 1 1   3 ILE HG21 H  32.247  11.428 -17.847 1.00 . A A .   3 ILE HG21 1 1 
        3  6250 1 1   3 ILE HG22 H  31.420  12.972 -18.058 1.00 . A A .   3 ILE HG22 1 1 
        3  6251 1 1   3 ILE HG23 H  32.710  12.818 -16.865 1.00 . A A .   3 ILE HG23 1 1 
        3  6252 1 1   3 ILE N    N  35.203  14.526 -19.382 1.00 . A A .   3 ILE N    1 1 
        3  6253 1 1   3 ILE O    O  36.111  12.735 -17.377 1.00 . A A .   3 ILE O    1 1 
        3  6254 1 1   4 MET C    C  34.363  12.834 -13.708 1.00 . A A .   4 MET C    1 1 
        3  6255 1 1   4 MET CA   C  35.372  13.278 -14.763 1.00 . A A .   4 MET CA   1 1 
        3  6256 1 1   4 MET CB   C  36.284  14.373 -14.200 1.00 . A A .   4 MET CB   1 1 
        3  6257 1 1   4 MET CE   C  39.384  11.911 -14.768 1.00 . A A .   4 MET CE   1 1 
        3  6258 1 1   4 MET CG   C  37.759  14.137 -14.481 1.00 . A A .   4 MET CG   1 1 
        3  6259 1 1   4 MET H    H  33.898  14.323 -15.867 1.00 . A A .   4 MET H    1 1 
        3  6260 1 1   4 MET HA   H  35.978  12.429 -15.044 1.00 . A A .   4 MET HA   1 1 
        3  6261 1 1   4 MET HB2  H  36.003  15.320 -14.639 1.00 . A A .   4 MET HB2  1 1 
        3  6262 1 1   4 MET HB3  H  36.147  14.429 -13.130 1.00 . A A .   4 MET HB3  1 1 
        3  6263 1 1   4 MET HE1  H  38.712  11.492 -15.503 1.00 . A A .   4 MET HE1  1 1 
        3  6264 1 1   4 MET HE2  H  39.953  11.117 -14.308 1.00 . A A .   4 MET HE2  1 1 
        3  6265 1 1   4 MET HE3  H  40.059  12.603 -15.252 1.00 . A A .   4 MET HE3  1 1 
        3  6266 1 1   4 MET HG2  H  37.880  13.912 -15.530 1.00 . A A .   4 MET HG2  1 1 
        3  6267 1 1   4 MET HG3  H  38.306  15.039 -14.242 1.00 . A A .   4 MET HG3  1 1 
        3  6268 1 1   4 MET N    N  34.691  13.756 -15.961 1.00 . A A .   4 MET N    1 1 
        3  6269 1 1   4 MET O    O  34.542  13.083 -12.515 1.00 . A A .   4 MET O    1 1 
        3  6270 1 1   4 MET SD   S  38.439  12.775 -13.516 1.00 . A A .   4 MET SD   1 1 
        3  6271 1 1   5 LYS C    C  31.778  10.306 -13.673 1.00 . A A .   5 LYS C    1 1 
        3  6272 1 1   5 LYS CA   C  32.263  11.691 -13.253 1.00 . A A .   5 LYS CA   1 1 
        3  6273 1 1   5 LYS CB   C  31.088  12.672 -13.225 1.00 . A A .   5 LYS CB   1 1 
        3  6274 1 1   5 LYS CD   C  29.723  14.309 -11.894 1.00 . A A .   5 LYS CD   1 1 
        3  6275 1 1   5 LYS CE   C  29.066  14.311 -10.523 1.00 . A A .   5 LYS CE   1 1 
        3  6276 1 1   5 LYS CG   C  30.966  13.436 -11.915 1.00 . A A .   5 LYS CG   1 1 
        3  6277 1 1   5 LYS H    H  33.215  12.003 -15.117 1.00 . A A .   5 LYS H    1 1 
        3  6278 1 1   5 LYS HA   H  32.690  11.624 -12.263 1.00 . A A .   5 LYS HA   1 1 
        3  6279 1 1   5 LYS HB2  H  31.215  13.389 -14.022 1.00 . A A .   5 LYS HB2  1 1 
        3  6280 1 1   5 LYS HB3  H  30.171  12.127 -13.384 1.00 . A A .   5 LYS HB3  1 1 
        3  6281 1 1   5 LYS HD2  H  30.002  15.321 -12.150 1.00 . A A .   5 LYS HD2  1 1 
        3  6282 1 1   5 LYS HD3  H  29.017  13.933 -12.621 1.00 . A A .   5 LYS HD3  1 1 
        3  6283 1 1   5 LYS HE2  H  28.348  13.506 -10.481 1.00 . A A .   5 LYS HE2  1 1 
        3  6284 1 1   5 LYS HE3  H  29.827  14.154  -9.774 1.00 . A A .   5 LYS HE3  1 1 
        3  6285 1 1   5 LYS HG2  H  30.911  12.728 -11.100 1.00 . A A .   5 LYS HG2  1 1 
        3  6286 1 1   5 LYS HG3  H  31.838  14.062 -11.791 1.00 . A A .   5 LYS HG3  1 1 
        3  6287 1 1   5 LYS HZ1  H  28.083  15.638  -9.244 1.00 . A A .   5 LYS HZ1  1 1 
        3  6288 1 1   5 LYS HZ2  H  27.520  15.679 -10.839 1.00 . A A .   5 LYS HZ2  1 1 
        3  6289 1 1   5 LYS HZ3  H  28.999  16.398 -10.444 1.00 . A A .   5 LYS HZ3  1 1 
        3  6290 1 1   5 LYS N    N  33.302  12.173 -14.156 1.00 . A A .   5 LYS N    1 1 
        3  6291 1 1   5 LYS NZ   N  28.369  15.597 -10.242 1.00 . A A .   5 LYS NZ   1 1 
        3  6292 1 1   5 LYS O    O  31.205  10.138 -14.751 1.00 . A A .   5 LYS O    1 1 
        3  6293 1 1   6 ALA C    C  30.084   7.800 -12.998 1.00 . A A .   6 ALA C    1 1 
        3  6294 1 1   6 ALA CA   C  31.598   7.948 -13.100 1.00 . A A .   6 ALA CA   1 1 
        3  6295 1 1   6 ALA CB   C  32.291   6.982 -12.151 1.00 . A A .   6 ALA CB   1 1 
        3  6296 1 1   6 ALA H    H  32.473   9.513 -11.974 1.00 . A A .   6 ALA H    1 1 
        3  6297 1 1   6 ALA HA   H  31.907   7.709 -14.107 1.00 . A A .   6 ALA HA   1 1 
        3  6298 1 1   6 ALA HB1  H  33.319   6.852 -12.457 1.00 . A A .   6 ALA HB1  1 1 
        3  6299 1 1   6 ALA HB2  H  31.785   6.029 -12.175 1.00 . A A .   6 ALA HB2  1 1 
        3  6300 1 1   6 ALA HB3  H  32.262   7.380 -11.146 1.00 . A A .   6 ALA HB3  1 1 
        3  6301 1 1   6 ALA N    N  32.011   9.317 -12.816 1.00 . A A .   6 ALA N    1 1 
        3  6302 1 1   6 ALA O    O  29.541   7.614 -11.909 1.00 . A A .   6 ALA O    1 1 
        3  6303 1 1   7 ILE C    C  27.539   6.345 -14.584 1.00 . A A .   7 ILE C    1 1 
        3  6304 1 1   7 ILE CA   C  27.958   7.756 -14.178 1.00 . A A .   7 ILE CA   1 1 
        3  6305 1 1   7 ILE CB   C  27.331   8.768 -15.158 1.00 . A A .   7 ILE CB   1 1 
        3  6306 1 1   7 ILE CD1  C  26.817   7.847 -17.475 1.00 . A A .   7 ILE CD1  1 1 
        3  6307 1 1   7 ILE CG1  C  27.836   8.522 -16.583 1.00 . A A .   7 ILE CG1  1 1 
        3  6308 1 1   7 ILE CG2  C  27.641  10.191 -14.717 1.00 . A A .   7 ILE CG2  1 1 
        3  6309 1 1   7 ILE H    H  29.899   8.031 -14.975 1.00 . A A .   7 ILE H    1 1 
        3  6310 1 1   7 ILE HA   H  27.580   7.962 -13.189 1.00 . A A .   7 ILE HA   1 1 
        3  6311 1 1   7 ILE HB   H  26.258   8.638 -15.136 1.00 . A A .   7 ILE HB   1 1 
        3  6312 1 1   7 ILE HD11 H  26.024   8.544 -17.708 1.00 . A A .   7 ILE HD11 1 1 
        3  6313 1 1   7 ILE HD12 H  26.404   6.989 -16.966 1.00 . A A .   7 ILE HD12 1 1 
        3  6314 1 1   7 ILE HD13 H  27.295   7.529 -18.391 1.00 . A A .   7 ILE HD13 1 1 
        3  6315 1 1   7 ILE HG12 H  28.097   9.467 -17.035 1.00 . A A .   7 ILE HG12 1 1 
        3  6316 1 1   7 ILE HG13 H  28.711   7.892 -16.544 1.00 . A A .   7 ILE HG13 1 1 
        3  6317 1 1   7 ILE HG21 H  27.074  10.424 -13.827 1.00 . A A .   7 ILE HG21 1 1 
        3  6318 1 1   7 ILE HG22 H  27.372  10.878 -15.504 1.00 . A A .   7 ILE HG22 1 1 
        3  6319 1 1   7 ILE HG23 H  28.696  10.280 -14.505 1.00 . A A .   7 ILE HG23 1 1 
        3  6320 1 1   7 ILE N    N  29.410   7.881 -14.139 1.00 . A A .   7 ILE N    1 1 
        3  6321 1 1   7 ILE O    O  28.305   5.615 -15.208 1.00 . A A .   7 ILE O    1 1 
        3  6322 1 1   8 PHE C    C  24.269   4.641 -14.504 1.00 . A A .   8 PHE C    1 1 
        3  6323 1 1   8 PHE CA   C  25.793   4.648 -14.548 1.00 . A A .   8 PHE CA   1 1 
        3  6324 1 1   8 PHE CB   C  26.347   3.605 -13.576 1.00 . A A .   8 PHE CB   1 1 
        3  6325 1 1   8 PHE CD1  C  27.462   1.849 -14.981 1.00 . A A .   8 PHE CD1  1 1 
        3  6326 1 1   8 PHE CD2  C  28.836   3.295 -13.673 1.00 . A A .   8 PHE CD2  1 1 
        3  6327 1 1   8 PHE CE1  C  28.587   1.199 -15.452 1.00 . A A .   8 PHE CE1  1 1 
        3  6328 1 1   8 PHE CE2  C  29.965   2.649 -14.142 1.00 . A A .   8 PHE CE2  1 1 
        3  6329 1 1   8 PHE CG   C  27.573   2.902 -14.088 1.00 . A A .   8 PHE CG   1 1 
        3  6330 1 1   8 PHE CZ   C  29.841   1.600 -15.032 1.00 . A A .   8 PHE CZ   1 1 
        3  6331 1 1   8 PHE H    H  25.750   6.599 -13.726 1.00 . A A .   8 PHE H    1 1 
        3  6332 1 1   8 PHE HA   H  26.115   4.403 -15.548 1.00 . A A .   8 PHE HA   1 1 
        3  6333 1 1   8 PHE HB2  H  26.608   4.089 -12.648 1.00 . A A .   8 PHE HB2  1 1 
        3  6334 1 1   8 PHE HB3  H  25.589   2.859 -13.390 1.00 . A A .   8 PHE HB3  1 1 
        3  6335 1 1   8 PHE HD1  H  26.482   1.534 -15.309 1.00 . A A .   8 PHE HD1  1 1 
        3  6336 1 1   8 PHE HD2  H  28.934   4.114 -12.978 1.00 . A A .   8 PHE HD2  1 1 
        3  6337 1 1   8 PHE HE1  H  28.487   0.381 -16.148 1.00 . A A .   8 PHE HE1  1 1 
        3  6338 1 1   8 PHE HE2  H  30.943   2.965 -13.812 1.00 . A A .   8 PHE HE2  1 1 
        3  6339 1 1   8 PHE HZ   H  30.721   1.095 -15.398 1.00 . A A .   8 PHE HZ   1 1 
        3  6340 1 1   8 PHE N    N  26.316   5.970 -14.222 1.00 . A A .   8 PHE N    1 1 
        3  6341 1 1   8 PHE O    O  23.666   4.855 -13.453 1.00 . A A .   8 PHE O    1 1 
        3  6342 1 1   9 VAL C    C  21.723   3.109 -16.485 1.00 . A A .   9 VAL C    1 1 
        3  6343 1 1   9 VAL CA   C  22.196   4.358 -15.748 1.00 . A A .   9 VAL CA   1 1 
        3  6344 1 1   9 VAL CB   C  21.648   5.603 -16.470 1.00 . A A .   9 VAL CB   1 1 
        3  6345 1 1   9 VAL CG1  C  20.130   5.648 -16.381 1.00 . A A .   9 VAL CG1  1 1 
        3  6346 1 1   9 VAL CG2  C  22.259   6.868 -15.888 1.00 . A A .   9 VAL CG2  1 1 
        3  6347 1 1   9 VAL H    H  24.186   4.230 -16.460 1.00 . A A .   9 VAL H    1 1 
        3  6348 1 1   9 VAL HA   H  21.798   4.344 -14.744 1.00 . A A .   9 VAL HA   1 1 
        3  6349 1 1   9 VAL HB   H  21.923   5.541 -17.512 1.00 . A A .   9 VAL HB   1 1 
        3  6350 1 1   9 VAL HG11 H  19.801   6.676 -16.351 1.00 . A A .   9 VAL HG11 1 1 
        3  6351 1 1   9 VAL HG12 H  19.806   5.139 -15.484 1.00 . A A .   9 VAL HG12 1 1 
        3  6352 1 1   9 VAL HG13 H  19.705   5.158 -17.246 1.00 . A A .   9 VAL HG13 1 1 
        3  6353 1 1   9 VAL HG21 H  21.768   7.733 -16.311 1.00 . A A .   9 VAL HG21 1 1 
        3  6354 1 1   9 VAL HG22 H  23.313   6.901 -16.126 1.00 . A A .   9 VAL HG22 1 1 
        3  6355 1 1   9 VAL HG23 H  22.134   6.871 -14.816 1.00 . A A .   9 VAL HG23 1 1 
        3  6356 1 1   9 VAL N    N  23.650   4.394 -15.654 1.00 . A A .   9 VAL N    1 1 
        3  6357 1 1   9 VAL O    O  21.089   2.233 -15.897 1.00 . A A .   9 VAL O    1 1 
        3  6358 1 1  10 LEU C    C  22.664   1.633 -19.693 1.00 . A A .  10 LEU C    1 1 
        3  6359 1 1  10 LEU CA   C  21.642   1.893 -18.591 1.00 . A A .  10 LEU CA   1 1 
        3  6360 1 1  10 LEU CB   C  20.260   2.132 -19.204 1.00 . A A .  10 LEU CB   1 1 
        3  6361 1 1  10 LEU CD1  C  18.174   3.042 -18.139 1.00 . A A .  10 LEU CD1  1 1 
        3  6362 1 1  10 LEU CD2  C  18.290   0.623 -18.784 1.00 . A A .  10 LEU CD2  1 1 
        3  6363 1 1  10 LEU CG   C  19.079   1.825 -18.276 1.00 . A A .  10 LEU CG   1 1 
        3  6364 1 1  10 LEU H    H  22.542   3.766 -18.186 1.00 . A A .  10 LEU H    1 1 
        3  6365 1 1  10 LEU HA   H  21.595   1.028 -17.948 1.00 . A A .  10 LEU HA   1 1 
        3  6366 1 1  10 LEU HB2  H  20.199   3.169 -19.503 1.00 . A A .  10 LEU HB2  1 1 
        3  6367 1 1  10 LEU HB3  H  20.168   1.516 -20.084 1.00 . A A .  10 LEU HB3  1 1 
        3  6368 1 1  10 LEU HD11 H  18.282   3.670 -19.010 1.00 . A A .  10 LEU HD11 1 1 
        3  6369 1 1  10 LEU HD12 H  18.450   3.599 -17.256 1.00 . A A .  10 LEU HD12 1 1 
        3  6370 1 1  10 LEU HD13 H  17.146   2.719 -18.053 1.00 . A A .  10 LEU HD13 1 1 
        3  6371 1 1  10 LEU HD21 H  18.723   0.271 -19.708 1.00 . A A .  10 LEU HD21 1 1 
        3  6372 1 1  10 LEU HD22 H  17.263   0.913 -18.954 1.00 . A A .  10 LEU HD22 1 1 
        3  6373 1 1  10 LEU HD23 H  18.323  -0.164 -18.047 1.00 . A A .  10 LEU HD23 1 1 
        3  6374 1 1  10 LEU HG   H  19.459   1.584 -17.293 1.00 . A A .  10 LEU HG   1 1 
        3  6375 1 1  10 LEU N    N  22.036   3.035 -17.774 1.00 . A A .  10 LEU N    1 1 
        3  6376 1 1  10 LEU O    O  22.409   1.900 -20.867 1.00 . A A .  10 LEU O    1 1 
        3  6377 1 1  11 ASN C    C  24.583  -0.466 -21.031 1.00 . A A .  11 ASN C    1 1 
        3  6378 1 1  11 ASN CA   C  24.885   0.812 -20.258 1.00 . A A .  11 ASN CA   1 1 
        3  6379 1 1  11 ASN CB   C  26.226   0.680 -19.534 1.00 . A A .  11 ASN CB   1 1 
        3  6380 1 1  11 ASN CG   C  26.870   2.026 -19.259 1.00 . A A .  11 ASN CG   1 1 
        3  6381 1 1  11 ASN H    H  23.967   0.919 -18.355 1.00 . A A .  11 ASN H    1 1 
        3  6382 1 1  11 ASN HA   H  24.943   1.635 -20.956 1.00 . A A .  11 ASN HA   1 1 
        3  6383 1 1  11 ASN HB2  H  26.072   0.177 -18.592 1.00 . A A .  11 ASN HB2  1 1 
        3  6384 1 1  11 ASN HB3  H  26.901   0.096 -20.143 1.00 . A A .  11 ASN HB3  1 1 
        3  6385 1 1  11 ASN HD21 H  28.548   1.133 -18.678 1.00 . A A .  11 ASN HD21 1 1 
        3  6386 1 1  11 ASN HD22 H  28.558   2.859 -18.621 1.00 . A A .  11 ASN HD22 1 1 
        3  6387 1 1  11 ASN N    N  23.823   1.110 -19.305 1.00 . A A .  11 ASN N    1 1 
        3  6388 1 1  11 ASN ND2  N  28.118   2.004 -18.806 1.00 . A A .  11 ASN ND2  1 1 
        3  6389 1 1  11 ASN O    O  24.477  -0.452 -22.258 1.00 . A A .  11 ASN O    1 1 
        3  6390 1 1  11 ASN OD1  O  26.253   3.074 -19.452 1.00 . A A .  11 ASN OD1  1 1 
        3  6391 1 1  12 ALA C    C  22.884  -3.475 -20.340 1.00 . A A .  12 ALA C    1 1 
        3  6392 1 1  12 ALA CA   C  24.151  -2.859 -20.925 1.00 . A A .  12 ALA CA   1 1 
        3  6393 1 1  12 ALA CB   C  25.328  -3.806 -20.751 1.00 . A A .  12 ALA CB   1 1 
        3  6394 1 1  12 ALA H    H  24.538  -1.520 -19.332 1.00 . A A .  12 ALA H    1 1 
        3  6395 1 1  12 ALA HA   H  24.004  -2.696 -21.983 1.00 . A A .  12 ALA HA   1 1 
        3  6396 1 1  12 ALA HB1  H  25.384  -4.126 -19.719 1.00 . A A .  12 ALA HB1  1 1 
        3  6397 1 1  12 ALA HB2  H  26.243  -3.298 -21.020 1.00 . A A .  12 ALA HB2  1 1 
        3  6398 1 1  12 ALA HB3  H  25.195  -4.668 -21.388 1.00 . A A .  12 ALA HB3  1 1 
        3  6399 1 1  12 ALA N    N  24.442  -1.572 -20.307 1.00 . A A .  12 ALA N    1 1 
        3  6400 1 1  12 ALA O    O  22.758  -4.697 -20.254 1.00 . A A .  12 ALA O    1 1 
        3  6401 1 1  13 ALA C    C  19.527  -2.847 -20.323 1.00 . A A .  13 ALA C    1 1 
        3  6402 1 1  13 ALA CA   C  20.691  -3.081 -19.360 1.00 . A A .  13 ALA CA   1 1 
        3  6403 1 1  13 ALA CB   C  20.433  -2.376 -18.037 1.00 . A A .  13 ALA CB   1 1 
        3  6404 1 1  13 ALA H    H  22.107  -1.658 -20.032 1.00 . A A .  13 ALA H    1 1 
        3  6405 1 1  13 ALA HA   H  20.782  -4.138 -19.166 1.00 . A A .  13 ALA HA   1 1 
        3  6406 1 1  13 ALA HB1  H  19.985  -3.070 -17.341 1.00 . A A .  13 ALA HB1  1 1 
        3  6407 1 1  13 ALA HB2  H  19.762  -1.545 -18.198 1.00 . A A .  13 ALA HB2  1 1 
        3  6408 1 1  13 ALA HB3  H  21.367  -2.013 -17.635 1.00 . A A .  13 ALA HB3  1 1 
        3  6409 1 1  13 ALA N    N  21.949  -2.622 -19.938 1.00 . A A .  13 ALA N    1 1 
        3  6410 1 1  13 ALA O    O  19.211  -1.706 -20.656 1.00 . A A .  13 ALA O    1 1 
        3  6411 1 1  14 PRO C    C  16.501  -3.222 -21.050 1.00 . A A .  14 PRO C    1 1 
        3  6412 1 1  14 PRO CA   C  17.737  -3.820 -21.712 1.00 . A A .  14 PRO CA   1 1 
        3  6413 1 1  14 PRO CB   C  17.473  -5.270 -22.122 1.00 . A A .  14 PRO CB   1 1 
        3  6414 1 1  14 PRO CD   C  19.173  -5.330 -20.444 1.00 . A A .  14 PRO CD   1 1 
        3  6415 1 1  14 PRO CG   C  17.992  -6.084 -20.988 1.00 . A A .  14 PRO CG   1 1 
        3  6416 1 1  14 PRO HA   H  17.995  -3.238 -22.584 1.00 . A A .  14 PRO HA   1 1 
        3  6417 1 1  14 PRO HB2  H  16.412  -5.420 -22.263 1.00 . A A .  14 PRO HB2  1 1 
        3  6418 1 1  14 PRO HB3  H  17.999  -5.491 -23.038 1.00 . A A .  14 PRO HB3  1 1 
        3  6419 1 1  14 PRO HD2  H  19.244  -5.460 -19.374 1.00 . A A .  14 PRO HD2  1 1 
        3  6420 1 1  14 PRO HD3  H  20.082  -5.655 -20.925 1.00 . A A .  14 PRO HD3  1 1 
        3  6421 1 1  14 PRO HG2  H  17.229  -6.186 -20.229 1.00 . A A .  14 PRO HG2  1 1 
        3  6422 1 1  14 PRO HG3  H  18.300  -7.056 -21.344 1.00 . A A .  14 PRO HG3  1 1 
        3  6423 1 1  14 PRO N    N  18.869  -3.927 -20.785 1.00 . A A .  14 PRO N    1 1 
        3  6424 1 1  14 PRO O    O  15.838  -2.353 -21.618 1.00 . A A .  14 PRO O    1 1 
        3  6425 1 1  15 LYS C    C  15.273  -3.297 -17.599 1.00 . A A .  15 LYS C    1 1 
        3  6426 1 1  15 LYS CA   C  15.038  -3.200 -19.103 1.00 . A A .  15 LYS CA   1 1 
        3  6427 1 1  15 LYS CB   C  13.787  -3.991 -19.491 1.00 . A A .  15 LYS CB   1 1 
        3  6428 1 1  15 LYS CD   C  11.506  -3.704 -20.504 1.00 . A A .  15 LYS CD   1 1 
        3  6429 1 1  15 LYS CE   C  10.848  -3.743 -21.874 1.00 . A A .  15 LYS CE   1 1 
        3  6430 1 1  15 LYS CG   C  12.980  -3.345 -20.604 1.00 . A A .  15 LYS CG   1 1 
        3  6431 1 1  15 LYS H    H  16.761  -4.382 -19.442 1.00 . A A .  15 LYS H    1 1 
        3  6432 1 1  15 LYS HA   H  14.892  -2.163 -19.366 1.00 . A A .  15 LYS HA   1 1 
        3  6433 1 1  15 LYS HB2  H  14.085  -4.976 -19.817 1.00 . A A .  15 LYS HB2  1 1 
        3  6434 1 1  15 LYS HB3  H  13.153  -4.086 -18.622 1.00 . A A .  15 LYS HB3  1 1 
        3  6435 1 1  15 LYS HD2  H  11.413  -4.677 -20.043 1.00 . A A .  15 LYS HD2  1 1 
        3  6436 1 1  15 LYS HD3  H  11.005  -2.965 -19.894 1.00 . A A .  15 LYS HD3  1 1 
        3  6437 1 1  15 LYS HE2  H  11.369  -4.463 -22.488 1.00 . A A .  15 LYS HE2  1 1 
        3  6438 1 1  15 LYS HE3  H   9.819  -4.049 -21.756 1.00 . A A .  15 LYS HE3  1 1 
        3  6439 1 1  15 LYS HG2  H  13.083  -2.272 -20.535 1.00 . A A .  15 LYS HG2  1 1 
        3  6440 1 1  15 LYS HG3  H  13.360  -3.685 -21.555 1.00 . A A .  15 LYS HG3  1 1 
        3  6441 1 1  15 LYS HZ1  H  10.245  -1.753 -22.066 1.00 . A A .  15 LYS HZ1  1 1 
        3  6442 1 1  15 LYS HZ2  H  10.592  -2.509 -23.540 1.00 . A A .  15 LYS HZ2  1 1 
        3  6443 1 1  15 LYS HZ3  H  11.851  -2.029 -22.518 1.00 . A A .  15 LYS HZ3  1 1 
        3  6444 1 1  15 LYS N    N  16.195  -3.689 -19.844 1.00 . A A .  15 LYS N    1 1 
        3  6445 1 1  15 LYS NZ   N  10.886  -2.416 -22.547 1.00 . A A .  15 LYS NZ   1 1 
        3  6446 1 1  15 LYS O    O  15.478  -4.386 -17.063 1.00 . A A .  15 LYS O    1 1 
        3  6447 1 1  16 ASP C    C  14.256  -2.710 -14.744 1.00 . A A .  16 ASP C    1 1 
        3  6448 1 1  16 ASP CA   C  15.447  -2.108 -15.483 1.00 . A A .  16 ASP CA   1 1 
        3  6449 1 1  16 ASP CB   C  15.675  -0.667 -15.024 1.00 . A A .  16 ASP CB   1 1 
        3  6450 1 1  16 ASP CG   C  17.147  -0.316 -14.932 1.00 . A A .  16 ASP CG   1 1 
        3  6451 1 1  16 ASP H    H  15.069  -1.317 -17.410 1.00 . A A .  16 ASP H    1 1 
        3  6452 1 1  16 ASP HA   H  16.327  -2.692 -15.258 1.00 . A A .  16 ASP HA   1 1 
        3  6453 1 1  16 ASP HB2  H  15.207   0.008 -15.725 1.00 . A A .  16 ASP HB2  1 1 
        3  6454 1 1  16 ASP HB3  H  15.229  -0.531 -14.049 1.00 . A A .  16 ASP HB3  1 1 
        3  6455 1 1  16 ASP N    N  15.238  -2.153 -16.925 1.00 . A A .  16 ASP N    1 1 
        3  6456 1 1  16 ASP O    O  13.358  -1.990 -14.304 1.00 . A A .  16 ASP O    1 1 
        3  6457 1 1  16 ASP OD1  O  17.759  -0.594 -13.879 1.00 . A A .  16 ASP OD1  1 1 
        3  6458 1 1  16 ASP OD2  O  17.688   0.236 -15.914 1.00 . A A .  16 ASP OD2  1 1 
        3  6459 1 1  17 ASN C    C  13.450  -4.821 -12.428 1.00 . A A .  17 ASN C    1 1 
        3  6460 1 1  17 ASN CA   C  13.174  -4.729 -13.925 1.00 . A A .  17 ASN CA   1 1 
        3  6461 1 1  17 ASN CB   C  12.993  -6.131 -14.509 1.00 . A A .  17 ASN CB   1 1 
        3  6462 1 1  17 ASN CG   C  11.583  -6.655 -14.327 1.00 . A A .  17 ASN CG   1 1 
        3  6463 1 1  17 ASN H    H  14.998  -4.549 -14.983 1.00 . A A .  17 ASN H    1 1 
        3  6464 1 1  17 ASN HA   H  12.266  -4.165 -14.077 1.00 . A A .  17 ASN HA   1 1 
        3  6465 1 1  17 ASN HB2  H  13.213  -6.105 -15.565 1.00 . A A .  17 ASN HB2  1 1 
        3  6466 1 1  17 ASN HB3  H  13.676  -6.809 -14.019 1.00 . A A .  17 ASN HB3  1 1 
        3  6467 1 1  17 ASN HD21 H  12.284  -8.462 -13.883 1.00 . A A .  17 ASN HD21 1 1 
        3  6468 1 1  17 ASN HD22 H  10.564  -8.300 -13.868 1.00 . A A .  17 ASN HD22 1 1 
        3  6469 1 1  17 ASN N    N  14.254  -4.031 -14.612 1.00 . A A .  17 ASN N    1 1 
        3  6470 1 1  17 ASN ND2  N  11.465  -7.935 -13.991 1.00 . A A .  17 ASN ND2  1 1 
        3  6471 1 1  17 ASN O    O  14.573  -5.100 -12.010 1.00 . A A .  17 ASN O    1 1 
        3  6472 1 1  17 ASN OD1  O  10.609  -5.918 -14.483 1.00 . A A .  17 ASN OD1  1 1 
        3  6473 1 1  18 THR C    C  11.208  -4.958  -9.520 1.00 . A A .  18 THR C    1 1 
        3  6474 1 1  18 THR CA   C  12.548  -4.643 -10.175 1.00 . A A .  18 THR CA   1 1 
        3  6475 1 1  18 THR CB   C  13.091  -3.317  -9.637 1.00 . A A .  18 THR CB   1 1 
        3  6476 1 1  18 THR CG2  C  14.603  -3.268  -9.587 1.00 . A A .  18 THR CG2  1 1 
        3  6477 1 1  18 THR H    H  11.546  -4.368 -12.018 1.00 . A A .  18 THR H    1 1 
        3  6478 1 1  18 THR HA   H  13.247  -5.431  -9.935 1.00 . A A .  18 THR HA   1 1 
        3  6479 1 1  18 THR HB   H  12.721  -3.169  -8.633 1.00 . A A .  18 THR HB   1 1 
        3  6480 1 1  18 THR HG1  H  13.026  -2.315 -11.320 1.00 . A A .  18 THR HG1  1 1 
        3  6481 1 1  18 THR HG21 H  14.960  -2.486 -10.240 1.00 . A A .  18 THR HG21 1 1 
        3  6482 1 1  18 THR HG22 H  15.005  -4.218  -9.908 1.00 . A A .  18 THR HG22 1 1 
        3  6483 1 1  18 THR HG23 H  14.923  -3.065  -8.575 1.00 . A A .  18 THR HG23 1 1 
        3  6484 1 1  18 THR N    N  12.418  -4.586 -11.625 1.00 . A A .  18 THR N    1 1 
        3  6485 1 1  18 THR O    O  10.187  -5.075 -10.198 1.00 . A A .  18 THR O    1 1 
        3  6486 1 1  18 THR OG1  O  12.653  -2.234 -10.438 1.00 . A A .  18 THR OG1  1 1 
        3  6487 1 1  19 TRP C    C   9.972  -4.645  -6.129 1.00 . A A .  19 TRP C    1 1 
        3  6488 1 1  19 TRP CA   C  10.001  -5.400  -7.454 1.00 . A A .  19 TRP CA   1 1 
        3  6489 1 1  19 TRP CB   C   9.898  -6.907  -7.203 1.00 . A A .  19 TRP CB   1 1 
        3  6490 1 1  19 TRP CD1  C   8.615  -7.585  -9.314 1.00 . A A .  19 TRP CD1  1 1 
        3  6491 1 1  19 TRP CD2  C   7.672  -8.275  -7.406 1.00 . A A .  19 TRP CD2  1 1 
        3  6492 1 1  19 TRP CE2  C   6.875  -8.708  -8.481 1.00 . A A .  19 TRP CE2  1 1 
        3  6493 1 1  19 TRP CE3  C   7.276  -8.593  -6.103 1.00 . A A .  19 TRP CE3  1 1 
        3  6494 1 1  19 TRP CG   C   8.780  -7.557  -7.961 1.00 . A A .  19 TRP CG   1 1 
        3  6495 1 1  19 TRP CH2  C   5.344  -9.741  -7.009 1.00 . A A .  19 TRP CH2  1 1 
        3  6496 1 1  19 TRP CZ2  C   5.707  -9.443  -8.293 1.00 . A A .  19 TRP CZ2  1 1 
        3  6497 1 1  19 TRP CZ3  C   6.117  -9.321  -5.918 1.00 . A A .  19 TRP CZ3  1 1 
        3  6498 1 1  19 TRP H    H  12.063  -4.992  -7.714 1.00 . A A .  19 TRP H    1 1 
        3  6499 1 1  19 TRP HA   H   9.161  -5.086  -8.053 1.00 . A A .  19 TRP HA   1 1 
        3  6500 1 1  19 TRP HB2  H  10.822  -7.379  -7.501 1.00 . A A .  19 TRP HB2  1 1 
        3  6501 1 1  19 TRP HB3  H   9.733  -7.080  -6.150 1.00 . A A .  19 TRP HB3  1 1 
        3  6502 1 1  19 TRP HD1  H   9.292  -7.126 -10.020 1.00 . A A .  19 TRP HD1  1 1 
        3  6503 1 1  19 TRP HE1  H   7.137  -8.432 -10.544 1.00 . A A .  19 TRP HE1  1 1 
        3  6504 1 1  19 TRP HE3  H   7.859  -8.278  -5.250 1.00 . A A .  19 TRP HE3  1 1 
        3  6505 1 1  19 TRP HH2  H   4.444 -10.306  -6.817 1.00 . A A .  19 TRP HH2  1 1 
        3  6506 1 1  19 TRP HZ2  H   5.100  -9.775  -9.124 1.00 . A A .  19 TRP HZ2  1 1 
        3  6507 1 1  19 TRP HZ3  H   5.795  -9.575  -4.919 1.00 . A A .  19 TRP HZ3  1 1 
        3  6508 1 1  19 TRP N    N  11.217  -5.096  -8.199 1.00 . A A .  19 TRP N    1 1 
        3  6509 1 1  19 TRP NE1  N   7.472  -8.276  -9.637 1.00 . A A .  19 TRP NE1  1 1 
        3  6510 1 1  19 TRP O    O  11.015  -4.285  -5.584 1.00 . A A .  19 TRP O    1 1 
        3  6511 1 1  20 TYR C    C   7.398  -4.238  -3.587 1.00 . A A .  20 TYR C    1 1 
        3  6512 1 1  20 TYR CA   C   8.599  -3.697  -4.356 1.00 . A A .  20 TYR CA   1 1 
        3  6513 1 1  20 TYR CB   C   8.424  -2.198  -4.613 1.00 . A A .  20 TYR CB   1 1 
        3  6514 1 1  20 TYR CD1  C  10.722  -1.294  -5.143 1.00 . A A .  20 TYR CD1  1 1 
        3  6515 1 1  20 TYR CD2  C   9.724  -0.683  -3.066 1.00 . A A .  20 TYR CD2  1 1 
        3  6516 1 1  20 TYR CE1  C  11.841  -0.544  -4.831 1.00 . A A .  20 TYR CE1  1 1 
        3  6517 1 1  20 TYR CE2  C  10.839   0.070  -2.747 1.00 . A A .  20 TYR CE2  1 1 
        3  6518 1 1  20 TYR CG   C   9.647  -1.377  -4.267 1.00 . A A .  20 TYR CG   1 1 
        3  6519 1 1  20 TYR CZ   C  11.894   0.135  -3.633 1.00 . A A .  20 TYR CZ   1 1 
        3  6520 1 1  20 TYR H    H   7.975  -4.721  -6.100 1.00 . A A .  20 TYR H    1 1 
        3  6521 1 1  20 TYR HA   H   9.490  -3.851  -3.766 1.00 . A A .  20 TYR HA   1 1 
        3  6522 1 1  20 TYR HB2  H   8.207  -2.042  -5.659 1.00 . A A .  20 TYR HB2  1 1 
        3  6523 1 1  20 TYR HB3  H   7.599  -1.830  -4.020 1.00 . A A .  20 TYR HB3  1 1 
        3  6524 1 1  20 TYR HD1  H  10.678  -1.827  -6.081 1.00 . A A .  20 TYR HD1  1 1 
        3  6525 1 1  20 TYR HD2  H   8.896  -0.737  -2.375 1.00 . A A .  20 TYR HD2  1 1 
        3  6526 1 1  20 TYR HE1  H  12.667  -0.493  -5.525 1.00 . A A .  20 TYR HE1  1 1 
        3  6527 1 1  20 TYR HE2  H  10.879   0.602  -1.808 1.00 . A A .  20 TYR HE2  1 1 
        3  6528 1 1  20 TYR HH   H  13.205   0.784  -2.384 1.00 . A A .  20 TYR HH   1 1 
        3  6529 1 1  20 TYR N    N   8.769  -4.408  -5.618 1.00 . A A .  20 TYR N    1 1 
        3  6530 1 1  20 TYR O    O   6.335  -4.472  -4.163 1.00 . A A .  20 TYR O    1 1 
        3  6531 1 1  20 TYR OH   O  13.006   0.883  -3.317 1.00 . A A .  20 TYR OH   1 1 
        3  6532 1 1  21 ALA C    C   6.558  -4.344  -0.045 1.00 . A A .  21 ALA C    1 1 
        3  6533 1 1  21 ALA CA   C   6.502  -4.952  -1.442 1.00 . A A .  21 ALA CA   1 1 
        3  6534 1 1  21 ALA CB   C   6.577  -6.468  -1.362 1.00 . A A .  21 ALA CB   1 1 
        3  6535 1 1  21 ALA H    H   8.445  -4.232  -1.882 1.00 . A A .  21 ALA H    1 1 
        3  6536 1 1  21 ALA HA   H   5.560  -4.685  -1.901 1.00 . A A .  21 ALA HA   1 1 
        3  6537 1 1  21 ALA HB1  H   7.292  -6.754  -0.604 1.00 . A A .  21 ALA HB1  1 1 
        3  6538 1 1  21 ALA HB2  H   6.887  -6.865  -2.318 1.00 . A A .  21 ALA HB2  1 1 
        3  6539 1 1  21 ALA HB3  H   5.606  -6.865  -1.107 1.00 . A A .  21 ALA HB3  1 1 
        3  6540 1 1  21 ALA N    N   7.574  -4.437  -2.285 1.00 . A A .  21 ALA N    1 1 
        3  6541 1 1  21 ALA O    O   7.636  -4.167   0.524 1.00 . A A .  21 ALA O    1 1 
        3  6542 1 1  22 GLY C    C   3.904  -3.206   2.294 1.00 . A A .  22 GLY C    1 1 
        3  6543 1 1  22 GLY CA   C   5.328  -3.442   1.831 1.00 . A A .  22 GLY CA   1 1 
        3  6544 1 1  22 GLY H    H   4.562  -4.190   0.004 1.00 . A A .  22 GLY H    1 1 
        3  6545 1 1  22 GLY HA2  H   5.816  -4.106   2.527 1.00 . A A .  22 GLY HA2  1 1 
        3  6546 1 1  22 GLY HA3  H   5.853  -2.498   1.822 1.00 . A A .  22 GLY HA3  1 1 
        3  6547 1 1  22 GLY N    N   5.389  -4.026   0.504 1.00 . A A .  22 GLY N    1 1 
        3  6548 1 1  22 GLY O    O   2.952  -3.640   1.645 1.00 . A A .  22 GLY O    1 1 
        3  6549 1 1  23 GLY C    C   2.366  -0.891   4.645 1.00 . A A .  23 GLY C    1 1 
        3  6550 1 1  23 GLY CA   C   2.436  -2.236   3.951 1.00 . A A .  23 GLY CA   1 1 
        3  6551 1 1  23 GLY H    H   4.552  -2.196   3.895 1.00 . A A .  23 GLY H    1 1 
        3  6552 1 1  23 GLY HA2  H   1.724  -2.248   3.138 1.00 . A A .  23 GLY HA2  1 1 
        3  6553 1 1  23 GLY HA3  H   2.173  -3.008   4.658 1.00 . A A .  23 GLY HA3  1 1 
        3  6554 1 1  23 GLY N    N   3.757  -2.516   3.422 1.00 . A A .  23 GLY N    1 1 
        3  6555 1 1  23 GLY O    O   3.361  -0.414   5.195 1.00 . A A .  23 GLY O    1 1 
        3  6556 1 1  24 LYS C    C  -0.253   1.027   6.132 1.00 . A A .  24 LYS C    1 1 
        3  6557 1 1  24 LYS CA   C   0.992   1.025   5.251 1.00 . A A .  24 LYS CA   1 1 
        3  6558 1 1  24 LYS CB   C   0.881   2.120   4.189 1.00 . A A .  24 LYS CB   1 1 
        3  6559 1 1  24 LYS CD   C  -1.066   2.970   2.836 1.00 . A A .  24 LYS CD   1 1 
        3  6560 1 1  24 LYS CE   C  -2.464   2.683   3.357 1.00 . A A .  24 LYS CE   1 1 
        3  6561 1 1  24 LYS CG   C  -0.124   1.802   3.091 1.00 . A A .  24 LYS CG   1 1 
        3  6562 1 1  24 LYS H    H   0.431  -0.704   4.164 1.00 . A A .  24 LYS H    1 1 
        3  6563 1 1  24 LYS HA   H   1.854   1.224   5.870 1.00 . A A .  24 LYS HA   1 1 
        3  6564 1 1  24 LYS HB2  H   0.579   3.040   4.668 1.00 . A A .  24 LYS HB2  1 1 
        3  6565 1 1  24 LYS HB3  H   1.847   2.262   3.732 1.00 . A A .  24 LYS HB3  1 1 
        3  6566 1 1  24 LYS HD2  H  -0.681   3.847   3.333 1.00 . A A .  24 LYS HD2  1 1 
        3  6567 1 1  24 LYS HD3  H  -1.117   3.151   1.772 1.00 . A A .  24 LYS HD3  1 1 
        3  6568 1 1  24 LYS HE2  H  -2.759   1.695   3.039 1.00 . A A .  24 LYS HE2  1 1 
        3  6569 1 1  24 LYS HE3  H  -2.448   2.724   4.436 1.00 . A A .  24 LYS HE3  1 1 
        3  6570 1 1  24 LYS HG2  H   0.412   1.581   2.181 1.00 . A A .  24 LYS HG2  1 1 
        3  6571 1 1  24 LYS HG3  H  -0.703   0.941   3.387 1.00 . A A .  24 LYS HG3  1 1 
        3  6572 1 1  24 LYS HZ1  H  -4.336   3.611   3.406 1.00 . A A .  24 LYS HZ1  1 1 
        3  6573 1 1  24 LYS HZ2  H  -3.680   3.473   1.852 1.00 . A A .  24 LYS HZ2  1 1 
        3  6574 1 1  24 LYS HZ3  H  -3.078   4.633   2.925 1.00 . A A .  24 LYS HZ3  1 1 
        3  6575 1 1  24 LYS N    N   1.187  -0.274   4.621 1.00 . A A .  24 LYS N    1 1 
        3  6576 1 1  24 LYS NZ   N  -3.459   3.669   2.849 1.00 . A A .  24 LYS NZ   1 1 
        3  6577 1 1  24 LYS O    O  -1.184   0.251   5.913 1.00 . A A .  24 LYS O    1 1 
        3  6578 1 1  25 LEU C    C  -1.854   3.470   8.140 1.00 . A A .  25 LEU C    1 1 
        3  6579 1 1  25 LEU CA   C  -1.386   2.021   8.046 1.00 . A A .  25 LEU CA   1 1 
        3  6580 1 1  25 LEU CB   C  -0.992   1.502   9.432 1.00 . A A .  25 LEU CB   1 1 
        3  6581 1 1  25 LEU CD1  C  -3.310   0.999  10.258 1.00 . A A .  25 LEU CD1  1 1 
        3  6582 1 1  25 LEU CD2  C  -1.448   1.353  11.894 1.00 . A A .  25 LEU CD2  1 1 
        3  6583 1 1  25 LEU CG   C  -2.018   1.753  10.541 1.00 . A A .  25 LEU CG   1 1 
        3  6584 1 1  25 LEU H    H   0.511   2.497   7.244 1.00 . A A .  25 LEU H    1 1 
        3  6585 1 1  25 LEU HA   H  -2.193   1.417   7.659 1.00 . A A .  25 LEU HA   1 1 
        3  6586 1 1  25 LEU HB2  H  -0.827   0.437   9.360 1.00 . A A .  25 LEU HB2  1 1 
        3  6587 1 1  25 LEU HB3  H  -0.064   1.974   9.720 1.00 . A A .  25 LEU HB3  1 1 
        3  6588 1 1  25 LEU HD11 H  -3.669   0.544  11.170 1.00 . A A .  25 LEU HD11 1 1 
        3  6589 1 1  25 LEU HD12 H  -3.125   0.231   9.522 1.00 . A A .  25 LEU HD12 1 1 
        3  6590 1 1  25 LEU HD13 H  -4.053   1.686   9.883 1.00 . A A .  25 LEU HD13 1 1 
        3  6591 1 1  25 LEU HD21 H  -1.063   2.228  12.396 1.00 . A A .  25 LEU HD21 1 1 
        3  6592 1 1  25 LEU HD22 H  -0.649   0.640  11.752 1.00 . A A .  25 LEU HD22 1 1 
        3  6593 1 1  25 LEU HD23 H  -2.225   0.906  12.495 1.00 . A A .  25 LEU HD23 1 1 
        3  6594 1 1  25 LEU HG   H  -2.250   2.808  10.574 1.00 . A A .  25 LEU HG   1 1 
        3  6595 1 1  25 LEU N    N  -0.260   1.906   7.127 1.00 . A A .  25 LEU N    1 1 
        3  6596 1 1  25 LEU O    O  -1.040   4.394   8.173 1.00 . A A .  25 LEU O    1 1 
        3  6597 1 1  26 GLY C    C  -5.000   5.050   9.077 1.00 . A A .  26 GLY C    1 1 
        3  6598 1 1  26 GLY CA   C  -3.719   5.000   8.269 1.00 . A A .  26 GLY CA   1 1 
        3  6599 1 1  26 GLY H    H  -3.769   2.885   8.148 1.00 . A A .  26 GLY H    1 1 
        3  6600 1 1  26 GLY HA2  H  -2.989   5.648   8.730 1.00 . A A .  26 GLY HA2  1 1 
        3  6601 1 1  26 GLY HA3  H  -3.923   5.359   7.270 1.00 . A A .  26 GLY HA3  1 1 
        3  6602 1 1  26 GLY N    N  -3.169   3.661   8.181 1.00 . A A .  26 GLY N    1 1 
        3  6603 1 1  26 GLY O    O  -5.553   4.014   9.444 1.00 . A A .  26 GLY O    1 1 
        3  6604 1 1  27 TRP C    C  -7.927   6.225   9.255 1.00 . A A .  27 TRP C    1 1 
        3  6605 1 1  27 TRP CA   C  -6.695   6.446  10.129 1.00 . A A .  27 TRP CA   1 1 
        3  6606 1 1  27 TRP CB   C  -6.732   7.849  10.739 1.00 . A A .  27 TRP CB   1 1 
        3  6607 1 1  27 TRP CD1  C  -6.859   7.720  13.294 1.00 . A A .  27 TRP CD1  1 1 
        3  6608 1 1  27 TRP CD2  C  -4.817   8.174  12.496 1.00 . A A .  27 TRP CD2  1 1 
        3  6609 1 1  27 TRP CE2  C  -4.750   8.131  13.902 1.00 . A A .  27 TRP CE2  1 1 
        3  6610 1 1  27 TRP CE3  C  -3.650   8.443  11.775 1.00 . A A .  27 TRP CE3  1 1 
        3  6611 1 1  27 TRP CG   C  -6.174   7.908  12.127 1.00 . A A .  27 TRP CG   1 1 
        3  6612 1 1  27 TRP CH2  C  -2.437   8.609  13.867 1.00 . A A .  27 TRP CH2  1 1 
        3  6613 1 1  27 TRP CZ2  C  -3.564   8.348  14.598 1.00 . A A .  27 TRP CZ2  1 1 
        3  6614 1 1  27 TRP CZ3  C  -2.473   8.658  12.468 1.00 . A A .  27 TRP CZ3  1 1 
        3  6615 1 1  27 TRP H    H  -4.985   7.050   9.036 1.00 . A A .  27 TRP H    1 1 
        3  6616 1 1  27 TRP HA   H  -6.699   5.716  10.924 1.00 . A A .  27 TRP HA   1 1 
        3  6617 1 1  27 TRP HB2  H  -6.155   8.518  10.120 1.00 . A A .  27 TRP HB2  1 1 
        3  6618 1 1  27 TRP HB3  H  -7.756   8.192  10.774 1.00 . A A .  27 TRP HB3  1 1 
        3  6619 1 1  27 TRP HD1  H  -7.915   7.501  13.352 1.00 . A A .  27 TRP HD1  1 1 
        3  6620 1 1  27 TRP HE1  H  -6.264   7.763  15.309 1.00 . A A .  27 TRP HE1  1 1 
        3  6621 1 1  27 TRP HE3  H  -3.657   8.484  10.696 1.00 . A A .  27 TRP HE3  1 1 
        3  6622 1 1  27 TRP HH2  H  -1.496   8.784  14.366 1.00 . A A .  27 TRP HH2  1 1 
        3  6623 1 1  27 TRP HZ2  H  -3.520   8.314  15.677 1.00 . A A .  27 TRP HZ2  1 1 
        3  6624 1 1  27 TRP HZ3  H  -1.563   8.868  11.926 1.00 . A A .  27 TRP HZ3  1 1 
        3  6625 1 1  27 TRP N    N  -5.472   6.262   9.357 1.00 . A A .  27 TRP N    1 1 
        3  6626 1 1  27 TRP NE1  N  -6.009   7.854  14.365 1.00 . A A .  27 TRP NE1  1 1 
        3  6627 1 1  27 TRP O    O  -7.930   6.568   8.072 1.00 . A A .  27 TRP O    1 1 
        3  6628 1 1  28 SER C    C -11.215   6.511   9.335 1.00 . A A .  28 SER C    1 1 
        3  6629 1 1  28 SER CA   C -10.207   5.387   9.119 1.00 . A A .  28 SER CA   1 1 
        3  6630 1 1  28 SER CB   C -10.808   4.053   9.565 1.00 . A A .  28 SER CB   1 1 
        3  6631 1 1  28 SER H    H  -8.907   5.402  10.791 1.00 . A A .  28 SER H    1 1 
        3  6632 1 1  28 SER HA   H  -9.968   5.331   8.068 1.00 . A A .  28 SER HA   1 1 
        3  6633 1 1  28 SER HB2  H -10.044   3.457  10.044 1.00 . A A .  28 SER HB2  1 1 
        3  6634 1 1  28 SER HB3  H -11.611   4.237  10.264 1.00 . A A .  28 SER HB3  1 1 
        3  6635 1 1  28 SER HG   H -10.753   2.578   8.277 1.00 . A A .  28 SER HG   1 1 
        3  6636 1 1  28 SER N    N  -8.970   5.653   9.845 1.00 . A A .  28 SER N    1 1 
        3  6637 1 1  28 SER O    O -11.515   7.275   8.417 1.00 . A A .  28 SER O    1 1 
        3  6638 1 1  28 SER OG   O -11.322   3.330   8.460 1.00 . A A .  28 SER OG   1 1 
        3  6639 1 1  29 GLN C    C -12.554   8.081  12.340 1.00 . A A .  29 GLN C    1 1 
        3  6640 1 1  29 GLN CA   C -12.711   7.638  10.891 1.00 . A A .  29 GLN CA   1 1 
        3  6641 1 1  29 GLN CB   C -14.132   7.123  10.653 1.00 . A A .  29 GLN CB   1 1 
        3  6642 1 1  29 GLN CD   C -15.703   6.223   8.892 1.00 . A A .  29 GLN CD   1 1 
        3  6643 1 1  29 GLN CG   C -14.563   7.175   9.196 1.00 . A A .  29 GLN CG   1 1 
        3  6644 1 1  29 GLN H    H -11.459   5.968  11.245 1.00 . A A .  29 GLN H    1 1 
        3  6645 1 1  29 GLN HA   H -12.533   8.485  10.245 1.00 . A A .  29 GLN HA   1 1 
        3  6646 1 1  29 GLN HB2  H -14.191   6.098  10.987 1.00 . A A .  29 GLN HB2  1 1 
        3  6647 1 1  29 GLN HB3  H -14.821   7.720  11.231 1.00 . A A .  29 GLN HB3  1 1 
        3  6648 1 1  29 GLN HE21 H -15.660   6.745   6.974 1.00 . A A .  29 GLN HE21 1 1 
        3  6649 1 1  29 GLN HE22 H -16.847   5.567   7.404 1.00 . A A .  29 GLN HE22 1 1 
        3  6650 1 1  29 GLN HG2  H -14.882   8.179   8.964 1.00 . A A .  29 GLN HG2  1 1 
        3  6651 1 1  29 GLN HG3  H -13.719   6.912   8.575 1.00 . A A .  29 GLN HG3  1 1 
        3  6652 1 1  29 GLN N    N -11.737   6.607  10.554 1.00 . A A .  29 GLN N    1 1 
        3  6653 1 1  29 GLN NE2  N -16.111   6.174   7.629 1.00 . A A .  29 GLN NE2  1 1 
        3  6654 1 1  29 GLN O    O -12.053   7.332  13.179 1.00 . A A .  29 GLN O    1 1 
        3  6655 1 1  29 GLN OE1  O -16.212   5.541   9.781 1.00 . A A .  29 GLN OE1  1 1 
        3  6656 1 1  30 TYR C    C -14.281  10.157  14.539 1.00 . A A .  30 TYR C    1 1 
        3  6657 1 1  30 TYR CA   C -12.894   9.850  13.980 1.00 . A A .  30 TYR CA   1 1 
        3  6658 1 1  30 TYR CB   C -12.035  11.117  13.983 1.00 . A A .  30 TYR CB   1 1 
        3  6659 1 1  30 TYR CD1  C  -9.673  10.509  14.638 1.00 . A A .  30 TYR CD1  1 1 
        3  6660 1 1  30 TYR CD2  C -11.044  11.598  16.256 1.00 . A A .  30 TYR CD2  1 1 
        3  6661 1 1  30 TYR CE1  C  -8.630  10.469  15.545 1.00 . A A .  30 TYR CE1  1 1 
        3  6662 1 1  30 TYR CE2  C -10.006  11.561  17.167 1.00 . A A .  30 TYR CE2  1 1 
        3  6663 1 1  30 TYR CG   C -10.896  11.074  14.978 1.00 . A A .  30 TYR CG   1 1 
        3  6664 1 1  30 TYR CZ   C  -8.802  10.996  16.808 1.00 . A A .  30 TYR CZ   1 1 
        3  6665 1 1  30 TYR H    H -13.376   9.855  11.919 1.00 . A A .  30 TYR H    1 1 
        3  6666 1 1  30 TYR HA   H -12.424   9.107  14.606 1.00 . A A .  30 TYR HA   1 1 
        3  6667 1 1  30 TYR HB2  H -11.609  11.257  13.001 1.00 . A A .  30 TYR HB2  1 1 
        3  6668 1 1  30 TYR HB3  H -12.656  11.966  14.225 1.00 . A A .  30 TYR HB3  1 1 
        3  6669 1 1  30 TYR HD1  H  -9.541  10.097  13.649 1.00 . A A .  30 TYR HD1  1 1 
        3  6670 1 1  30 TYR HD2  H -11.990  12.041  16.535 1.00 . A A .  30 TYR HD2  1 1 
        3  6671 1 1  30 TYR HE1  H  -7.686  10.026  15.262 1.00 . A A .  30 TYR HE1  1 1 
        3  6672 1 1  30 TYR HE2  H -10.142  11.976  18.156 1.00 . A A .  30 TYR HE2  1 1 
        3  6673 1 1  30 TYR HH   H  -7.528  10.046  17.889 1.00 . A A .  30 TYR HH   1 1 
        3  6674 1 1  30 TYR N    N -12.986   9.305  12.630 1.00 . A A .  30 TYR N    1 1 
        3  6675 1 1  30 TYR O    O -15.039  10.928  13.952 1.00 . A A .  30 TYR O    1 1 
        3  6676 1 1  30 TYR OH   O  -7.765  10.957  17.712 1.00 . A A .  30 TYR OH   1 1 
        3  6677 1 1  31 HIS C    C -16.000  11.163  16.891 1.00 . A A .  31 HIS C    1 1 
        3  6678 1 1  31 HIS CA   C -15.898   9.755  16.311 1.00 . A A .  31 HIS CA   1 1 
        3  6679 1 1  31 HIS CB   C -16.121   8.716  17.414 1.00 . A A .  31 HIS CB   1 1 
        3  6680 1 1  31 HIS CD2  C -18.244   7.236  17.572 1.00 . A A .  31 HIS CD2  1 1 
        3  6681 1 1  31 HIS CE1  C -17.852   5.929  15.854 1.00 . A A .  31 HIS CE1  1 1 
        3  6682 1 1  31 HIS CG   C -17.068   7.625  17.024 1.00 . A A .  31 HIS CG   1 1 
        3  6683 1 1  31 HIS H    H -13.955   8.944  16.094 1.00 . A A .  31 HIS H    1 1 
        3  6684 1 1  31 HIS HA   H -16.661   9.634  15.556 1.00 . A A .  31 HIS HA   1 1 
        3  6685 1 1  31 HIS HB2  H -15.174   8.260  17.664 1.00 . A A .  31 HIS HB2  1 1 
        3  6686 1 1  31 HIS HB3  H -16.520   9.208  18.288 1.00 . A A .  31 HIS HB3  1 1 
        3  6687 1 1  31 HIS HD1  H -16.078   6.816  15.348 1.00 . A A .  31 HIS HD1  1 1 
        3  6688 1 1  31 HIS HD2  H -18.726   7.673  18.436 1.00 . A A .  31 HIS HD2  1 1 
        3  6689 1 1  31 HIS HE1  H -17.951   5.156  15.108 1.00 . A A .  31 HIS HE1  1 1 
        3  6690 1 1  31 HIS HE2  H -19.584   5.750  16.934 1.00 . A A .  31 HIS HE2  1 1 
        3  6691 1 1  31 HIS N    N -14.604   9.547  15.674 1.00 . A A .  31 HIS N    1 1 
        3  6692 1 1  31 HIS ND1  N -16.851   6.786  15.951 1.00 . A A .  31 HIS ND1  1 1 
        3  6693 1 1  31 HIS NE2  N -18.709   6.180  16.827 1.00 . A A .  31 HIS NE2  1 1 
        3  6694 1 1  31 HIS O    O -15.395  11.467  17.919 1.00 . A A .  31 HIS O    1 1 
        3  6695 1 1  32 ASP C    C -18.402  13.660  17.046 1.00 . A A .  32 ASP C    1 1 
        3  6696 1 1  32 ASP CA   C -16.947  13.395  16.672 1.00 . A A .  32 ASP CA   1 1 
        3  6697 1 1  32 ASP CB   C -16.504  14.370  15.581 1.00 . A A .  32 ASP CB   1 1 
        3  6698 1 1  32 ASP CG   C -17.265  14.174  14.285 1.00 . A A .  32 ASP CG   1 1 
        3  6699 1 1  32 ASP H    H -17.224  11.717  15.410 1.00 . A A .  32 ASP H    1 1 
        3  6700 1 1  32 ASP HA   H -16.332  13.541  17.546 1.00 . A A .  32 ASP HA   1 1 
        3  6701 1 1  32 ASP HB2  H -16.666  15.382  15.923 1.00 . A A .  32 ASP HB2  1 1 
        3  6702 1 1  32 ASP HB3  H -15.451  14.226  15.384 1.00 . A A .  32 ASP HB3  1 1 
        3  6703 1 1  32 ASP N    N -16.767  12.018  16.224 1.00 . A A .  32 ASP N    1 1 
        3  6704 1 1  32 ASP O    O -18.687  14.367  18.013 1.00 . A A .  32 ASP O    1 1 
        3  6705 1 1  32 ASP OD1  O -17.837  13.081  14.092 1.00 . A A .  32 ASP OD1  1 1 
        3  6706 1 1  32 ASP OD2  O -17.291  15.115  13.464 1.00 . A A .  32 ASP OD2  1 1 
        3  6707 1 1  33 THR C    C -21.123  12.759  17.910 1.00 . A A .  33 THR C    1 1 
        3  6708 1 1  33 THR CA   C -20.747  13.263  16.521 1.00 . A A .  33 THR CA   1 1 
        3  6709 1 1  33 THR CB   C -21.565  12.526  15.459 1.00 . A A .  33 THR CB   1 1 
        3  6710 1 1  33 THR CG2  C -23.058  12.717  15.616 1.00 . A A .  33 THR CG2  1 1 
        3  6711 1 1  33 THR H    H -19.032  12.536  15.516 1.00 . A A .  33 THR H    1 1 
        3  6712 1 1  33 THR HA   H -20.966  14.319  16.463 1.00 . A A .  33 THR HA   1 1 
        3  6713 1 1  33 THR HB   H -21.358  11.467  15.531 1.00 . A A .  33 THR HB   1 1 
        3  6714 1 1  33 THR HG1  H -20.318  12.668  13.956 1.00 . A A .  33 THR HG1  1 1 
        3  6715 1 1  33 THR HG21 H -23.375  12.311  16.564 1.00 . A A .  33 THR HG21 1 1 
        3  6716 1 1  33 THR HG22 H -23.572  12.205  14.815 1.00 . A A .  33 THR HG22 1 1 
        3  6717 1 1  33 THR HG23 H -23.292  13.770  15.577 1.00 . A A .  33 THR HG23 1 1 
        3  6718 1 1  33 THR N    N -19.320  13.088  16.272 1.00 . A A .  33 THR N    1 1 
        3  6719 1 1  33 THR O    O -21.657  13.507  18.730 1.00 . A A .  33 THR O    1 1 
        3  6720 1 1  33 THR OG1  O -21.209  12.962  14.160 1.00 . A A .  33 THR OG1  1 1 
        3  6721 1 1  34 GLY C    C -22.574  10.362  19.520 1.00 . A A .  34 GLY C    1 1 
        3  6722 1 1  34 GLY CA   C -21.159  10.903  19.460 1.00 . A A .  34 GLY CA   1 1 
        3  6723 1 1  34 GLY H    H -20.418  10.937  17.477 1.00 . A A .  34 GLY H    1 1 
        3  6724 1 1  34 GLY HA2  H -20.468  10.099  19.658 1.00 . A A .  34 GLY HA2  1 1 
        3  6725 1 1  34 GLY HA3  H -21.044  11.661  20.222 1.00 . A A .  34 GLY HA3  1 1 
        3  6726 1 1  34 GLY N    N -20.844  11.486  18.168 1.00 . A A .  34 GLY N    1 1 
        3  6727 1 1  34 GLY O    O -23.154  10.007  18.494 1.00 . A A .  34 GLY O    1 1 
        3  6728 1 1  35 PHE C    C -25.219  10.601  21.983 1.00 . A A .  35 PHE C    1 1 
        3  6729 1 1  35 PHE CA   C -24.486   9.795  20.916 1.00 . A A .  35 PHE CA   1 1 
        3  6730 1 1  35 PHE CB   C -24.454   8.316  21.308 1.00 . A A .  35 PHE CB   1 1 
        3  6731 1 1  35 PHE CD1  C -26.853   7.730  20.860 1.00 . A A .  35 PHE CD1  1 1 
        3  6732 1 1  35 PHE CD2  C -25.154   6.480  19.746 1.00 . A A .  35 PHE CD2  1 1 
        3  6733 1 1  35 PHE CE1  C -27.825   6.973  20.233 1.00 . A A .  35 PHE CE1  1 1 
        3  6734 1 1  35 PHE CE2  C -26.122   5.721  19.116 1.00 . A A .  35 PHE CE2  1 1 
        3  6735 1 1  35 PHE CG   C -25.508   7.492  20.624 1.00 . A A .  35 PHE CG   1 1 
        3  6736 1 1  35 PHE CZ   C -27.458   5.967  19.360 1.00 . A A .  35 PHE CZ   1 1 
        3  6737 1 1  35 PHE H    H -22.617  10.595  21.506 1.00 . A A .  35 PHE H    1 1 
        3  6738 1 1  35 PHE HA   H -25.013   9.899  19.980 1.00 . A A .  35 PHE HA   1 1 
        3  6739 1 1  35 PHE HB2  H -23.491   7.903  21.048 1.00 . A A .  35 PHE HB2  1 1 
        3  6740 1 1  35 PHE HB3  H -24.602   8.228  22.374 1.00 . A A .  35 PHE HB3  1 1 
        3  6741 1 1  35 PHE HD1  H -27.140   8.516  21.543 1.00 . A A .  35 PHE HD1  1 1 
        3  6742 1 1  35 PHE HD2  H -24.110   6.286  19.554 1.00 . A A .  35 PHE HD2  1 1 
        3  6743 1 1  35 PHE HE1  H -28.870   7.167  20.426 1.00 . A A .  35 PHE HE1  1 1 
        3  6744 1 1  35 PHE HE2  H -25.832   4.935  18.433 1.00 . A A .  35 PHE HE2  1 1 
        3  6745 1 1  35 PHE HZ   H -28.216   5.375  18.869 1.00 . A A .  35 PHE HZ   1 1 
        3  6746 1 1  35 PHE N    N -23.131  10.298  20.725 1.00 . A A .  35 PHE N    1 1 
        3  6747 1 1  35 PHE O    O -26.155  11.341  21.682 1.00 . A A .  35 PHE O    1 1 
        3  6748 1 1  36 TYR C    C -24.437  11.284  25.517 1.00 . A A .  36 TYR C    1 1 
        3  6749 1 1  36 TYR CA   C -25.405  11.163  24.345 1.00 . A A .  36 TYR CA   1 1 
        3  6750 1 1  36 TYR CB   C -26.680  10.448  24.793 1.00 . A A .  36 TYR CB   1 1 
        3  6751 1 1  36 TYR CD1  C -25.746   8.646  26.295 1.00 . A A .  36 TYR CD1  1 1 
        3  6752 1 1  36 TYR CD2  C -26.980   7.977  24.367 1.00 . A A .  36 TYR CD2  1 1 
        3  6753 1 1  36 TYR CE1  C -25.546   7.320  26.632 1.00 . A A .  36 TYR CE1  1 1 
        3  6754 1 1  36 TYR CE2  C -26.784   6.650  24.697 1.00 . A A .  36 TYR CE2  1 1 
        3  6755 1 1  36 TYR CG   C -26.464   8.996  25.158 1.00 . A A .  36 TYR CG   1 1 
        3  6756 1 1  36 TYR CZ   C -26.067   6.327  25.830 1.00 . A A .  36 TYR CZ   1 1 
        3  6757 1 1  36 TYR H    H -24.039   9.845  23.409 1.00 . A A .  36 TYR H    1 1 
        3  6758 1 1  36 TYR HA   H -25.662  12.154  24.001 1.00 . A A .  36 TYR HA   1 1 
        3  6759 1 1  36 TYR HB2  H -27.081  10.950  25.660 1.00 . A A .  36 TYR HB2  1 1 
        3  6760 1 1  36 TYR HB3  H -27.405  10.484  23.993 1.00 . A A .  36 TYR HB3  1 1 
        3  6761 1 1  36 TYR HD1  H -25.340   9.426  26.921 1.00 . A A .  36 TYR HD1  1 1 
        3  6762 1 1  36 TYR HD2  H -27.540   8.232  23.480 1.00 . A A .  36 TYR HD2  1 1 
        3  6763 1 1  36 TYR HE1  H -24.985   7.069  27.519 1.00 . A A .  36 TYR HE1  1 1 
        3  6764 1 1  36 TYR HE2  H -27.191   5.871  24.069 1.00 . A A .  36 TYR HE2  1 1 
        3  6765 1 1  36 TYR HH   H -24.961   4.877  26.441 1.00 . A A .  36 TYR HH   1 1 
        3  6766 1 1  36 TYR N    N -24.789  10.450  23.232 1.00 . A A .  36 TYR N    1 1 
        3  6767 1 1  36 TYR O    O -23.333  10.740  25.482 1.00 . A A .  36 TYR O    1 1 
        3  6768 1 1  36 TYR OH   O -25.870   5.006  26.163 1.00 . A A .  36 TYR OH   1 1 
        3  6769 1 1  37 GLY C    C -24.808  12.554  28.958 1.00 . A A .  37 GLY C    1 1 
        3  6770 1 1  37 GLY CA   C -24.014  12.182  27.720 1.00 . A A .  37 GLY CA   1 1 
        3  6771 1 1  37 GLY H    H -25.746  12.414  26.524 1.00 . A A .  37 GLY H    1 1 
        3  6772 1 1  37 GLY HA2  H -23.481  11.263  27.911 1.00 . A A .  37 GLY HA2  1 1 
        3  6773 1 1  37 GLY HA3  H -23.298  12.966  27.517 1.00 . A A .  37 GLY HA3  1 1 
        3  6774 1 1  37 GLY N    N -24.856  12.002  26.553 1.00 . A A .  37 GLY N    1 1 
        3  6775 1 1  37 GLY O    O -25.087  13.729  29.195 1.00 . A A .  37 GLY O    1 1 
        3  6776 1 1  38 ASN C    C -25.043  12.306  32.084 1.00 . A A .  38 ASN C    1 1 
        3  6777 1 1  38 ASN CA   C -25.938  11.777  30.968 1.00 . A A .  38 ASN CA   1 1 
        3  6778 1 1  38 ASN CB   C -26.619  10.483  31.417 1.00 . A A .  38 ASN CB   1 1 
        3  6779 1 1  38 ASN CG   C -28.017  10.338  30.846 1.00 . A A .  38 ASN CG   1 1 
        3  6780 1 1  38 ASN H    H -24.919  10.634  29.506 1.00 . A A .  38 ASN H    1 1 
        3  6781 1 1  38 ASN HA   H -26.695  12.516  30.751 1.00 . A A .  38 ASN HA   1 1 
        3  6782 1 1  38 ASN HB2  H -26.029   9.640  31.088 1.00 . A A .  38 ASN HB2  1 1 
        3  6783 1 1  38 ASN HB3  H -26.688  10.473  32.493 1.00 . A A .  38 ASN HB3  1 1 
        3  6784 1 1  38 ASN HD21 H -28.052   8.415  31.351 1.00 . A A .  38 ASN HD21 1 1 
        3  6785 1 1  38 ASN HD22 H -29.471   9.011  30.569 1.00 . A A .  38 ASN HD22 1 1 
        3  6786 1 1  38 ASN N    N -25.173  11.549  29.748 1.00 . A A .  38 ASN N    1 1 
        3  6787 1 1  38 ASN ND2  N -28.570   9.133  30.930 1.00 . A A .  38 ASN ND2  1 1 
        3  6788 1 1  38 ASN O    O -25.340  13.328  32.701 1.00 . A A .  38 ASN O    1 1 
        3  6789 1 1  38 ASN OD1  O -28.594  11.298  30.334 1.00 . A A .  38 ASN OD1  1 1 
        3  6790 1 1  39 GLY C    C -21.628  11.456  33.174 1.00 . A A .  39 GLY C    1 1 
        3  6791 1 1  39 GLY CA   C -23.022  12.016  33.377 1.00 . A A .  39 GLY CA   1 1 
        3  6792 1 1  39 GLY H    H -23.758  10.795  31.812 1.00 . A A .  39 GLY H    1 1 
        3  6793 1 1  39 GLY HA2  H -22.965  13.094  33.385 1.00 . A A .  39 GLY HA2  1 1 
        3  6794 1 1  39 GLY HA3  H -23.398  11.678  34.332 1.00 . A A .  39 GLY HA3  1 1 
        3  6795 1 1  39 GLY N    N -23.944  11.602  32.336 1.00 . A A .  39 GLY N    1 1 
        3  6796 1 1  39 GLY O    O -20.679  12.204  32.934 1.00 . A A .  39 GLY O    1 1 
        3  6797 1 1  40 PHE C    C -19.940   9.198  31.622 1.00 . A A .  40 PHE C    1 1 
        3  6798 1 1  40 PHE CA   C -20.214   9.476  33.098 1.00 . A A .  40 PHE CA   1 1 
        3  6799 1 1  40 PHE CB   C -20.176   8.168  33.890 1.00 . A A .  40 PHE CB   1 1 
        3  6800 1 1  40 PHE CD1  C -17.817   7.855  34.680 1.00 . A A .  40 PHE CD1  1 1 
        3  6801 1 1  40 PHE CD2  C -18.628   6.434  32.945 1.00 . A A .  40 PHE CD2  1 1 
        3  6802 1 1  40 PHE CE1  C -16.592   7.216  34.634 1.00 . A A .  40 PHE CE1  1 1 
        3  6803 1 1  40 PHE CE2  C -17.405   5.792  32.894 1.00 . A A .  40 PHE CE2  1 1 
        3  6804 1 1  40 PHE CG   C -18.846   7.471  33.838 1.00 . A A .  40 PHE CG   1 1 
        3  6805 1 1  40 PHE CZ   C -16.385   6.184  33.740 1.00 . A A .  40 PHE CZ   1 1 
        3  6806 1 1  40 PHE H    H -22.295   9.595  33.465 1.00 . A A .  40 PHE H    1 1 
        3  6807 1 1  40 PHE HA   H -19.449  10.137  33.475 1.00 . A A .  40 PHE HA   1 1 
        3  6808 1 1  40 PHE HB2  H -20.402   8.376  34.925 1.00 . A A .  40 PHE HB2  1 1 
        3  6809 1 1  40 PHE HB3  H -20.922   7.493  33.493 1.00 . A A .  40 PHE HB3  1 1 
        3  6810 1 1  40 PHE HD1  H -17.976   8.661  35.380 1.00 . A A .  40 PHE HD1  1 1 
        3  6811 1 1  40 PHE HD2  H -19.424   6.128  32.283 1.00 . A A .  40 PHE HD2  1 1 
        3  6812 1 1  40 PHE HE1  H -15.796   7.524  35.297 1.00 . A A .  40 PHE HE1  1 1 
        3  6813 1 1  40 PHE HE2  H -17.247   4.985  32.194 1.00 . A A .  40 PHE HE2  1 1 
        3  6814 1 1  40 PHE HZ   H -15.428   5.683  33.703 1.00 . A A .  40 PHE HZ   1 1 
        3  6815 1 1  40 PHE N    N -21.501  10.135  33.272 1.00 . A A .  40 PHE N    1 1 
        3  6816 1 1  40 PHE O    O -20.840   8.813  30.876 1.00 . A A .  40 PHE O    1 1 
        3  6817 1 1  41 GLN C    C -16.830   8.777  29.732 1.00 . A A .  41 GLN C    1 1 
        3  6818 1 1  41 GLN CA   C -18.301   9.170  29.823 1.00 . A A .  41 GLN CA   1 1 
        3  6819 1 1  41 GLN CB   C -18.559  10.424  28.986 1.00 . A A .  41 GLN CB   1 1 
        3  6820 1 1  41 GLN CD   C -18.948  12.834  29.644 1.00 . A A .  41 GLN CD   1 1 
        3  6821 1 1  41 GLN CG   C -17.957  11.687  29.582 1.00 . A A .  41 GLN CG   1 1 
        3  6822 1 1  41 GLN H    H -18.020   9.706  31.852 1.00 . A A .  41 GLN H    1 1 
        3  6823 1 1  41 GLN HA   H -18.903   8.361  29.438 1.00 . A A .  41 GLN HA   1 1 
        3  6824 1 1  41 GLN HB2  H -18.138  10.280  28.003 1.00 . A A .  41 GLN HB2  1 1 
        3  6825 1 1  41 GLN HB3  H -19.625  10.569  28.894 1.00 . A A .  41 GLN HB3  1 1 
        3  6826 1 1  41 GLN HE21 H -17.468  14.153  29.496 1.00 . A A .  41 GLN HE21 1 1 
        3  6827 1 1  41 GLN HE22 H -19.057  14.819  29.616 1.00 . A A .  41 GLN HE22 1 1 
        3  6828 1 1  41 GLN HG2  H -17.617  11.471  30.584 1.00 . A A .  41 GLN HG2  1 1 
        3  6829 1 1  41 GLN HG3  H -17.115  11.990  28.975 1.00 . A A .  41 GLN HG3  1 1 
        3  6830 1 1  41 GLN N    N -18.693   9.398  31.209 1.00 . A A .  41 GLN N    1 1 
        3  6831 1 1  41 GLN NE2  N -18.439  14.059  29.579 1.00 . A A .  41 GLN NE2  1 1 
        3  6832 1 1  41 GLN O    O -16.102   8.821  30.723 1.00 . A A .  41 GLN O    1 1 
        3  6833 1 1  41 GLN OE1  O -20.155  12.621  29.748 1.00 . A A .  41 GLN OE1  1 1 
        3  6834 1 1  42 ASN C    C -14.324   8.934  27.335 1.00 . A A .  42 ASN C    1 1 
        3  6835 1 1  42 ASN CA   C -15.016   7.989  28.312 1.00 . A A .  42 ASN CA   1 1 
        3  6836 1 1  42 ASN CB   C -14.959   6.557  27.778 1.00 . A A .  42 ASN CB   1 1 
        3  6837 1 1  42 ASN CG   C -15.790   6.373  26.524 1.00 . A A .  42 ASN CG   1 1 
        3  6838 1 1  42 ASN H    H -17.029   8.377  27.782 1.00 . A A .  42 ASN H    1 1 
        3  6839 1 1  42 ASN HA   H -14.502   8.031  29.260 1.00 . A A .  42 ASN HA   1 1 
        3  6840 1 1  42 ASN HB2  H -13.934   6.304  27.549 1.00 . A A .  42 ASN HB2  1 1 
        3  6841 1 1  42 ASN HB3  H -15.329   5.882  28.536 1.00 . A A .  42 ASN HB3  1 1 
        3  6842 1 1  42 ASN HD21 H -14.348   5.282  25.698 1.00 . A A .  42 ASN HD21 1 1 
        3  6843 1 1  42 ASN HD22 H -15.758   5.517  24.729 1.00 . A A .  42 ASN HD22 1 1 
        3  6844 1 1  42 ASN N    N -16.400   8.391  28.534 1.00 . A A .  42 ASN N    1 1 
        3  6845 1 1  42 ASN ND2  N -15.244   5.651  25.551 1.00 . A A .  42 ASN ND2  1 1 
        3  6846 1 1  42 ASN O    O -14.204   8.637  26.147 1.00 . A A .  42 ASN O    1 1 
        3  6847 1 1  42 ASN OD1  O -16.911   6.874  26.428 1.00 . A A .  42 ASN OD1  1 1 
        3  6848 1 1  43 ASN C    C -11.771  10.620  26.692 1.00 . A A .  43 ASN C    1 1 
        3  6849 1 1  43 ASN CA   C -13.193  11.066  27.017 1.00 . A A .  43 ASN CA   1 1 
        3  6850 1 1  43 ASN CB   C -13.164  12.422  27.724 1.00 . A A .  43 ASN CB   1 1 
        3  6851 1 1  43 ASN CG   C -13.244  13.582  26.752 1.00 . A A .  43 ASN CG   1 1 
        3  6852 1 1  43 ASN H    H -13.998  10.258  28.799 1.00 . A A .  43 ASN H    1 1 
        3  6853 1 1  43 ASN HA   H -13.745  11.163  26.094 1.00 . A A .  43 ASN HA   1 1 
        3  6854 1 1  43 ASN HB2  H -14.004  12.485  28.402 1.00 . A A .  43 ASN HB2  1 1 
        3  6855 1 1  43 ASN HB3  H -12.246  12.508  28.287 1.00 . A A .  43 ASN HB3  1 1 
        3  6856 1 1  43 ASN HD21 H -15.088  14.005  27.372 1.00 . A A .  43 ASN HD21 1 1 
        3  6857 1 1  43 ASN HD22 H -14.456  15.034  26.135 1.00 . A A .  43 ASN HD22 1 1 
        3  6858 1 1  43 ASN N    N -13.872  10.076  27.844 1.00 . A A .  43 ASN N    1 1 
        3  6859 1 1  43 ASN ND2  N -14.377  14.277  26.753 1.00 . A A .  43 ASN ND2  1 1 
        3  6860 1 1  43 ASN O    O -11.395  10.505  25.526 1.00 . A A .  43 ASN O    1 1 
        3  6861 1 1  43 ASN OD1  O -12.301  13.853  26.011 1.00 . A A .  43 ASN OD1  1 1 
        3  6862 1 1  44 ASN C    C  -9.199   8.949  28.653 1.00 . A A .  44 ASN C    1 1 
        3  6863 1 1  44 ASN CA   C  -9.601   9.936  27.560 1.00 . A A .  44 ASN CA   1 1 
        3  6864 1 1  44 ASN CB   C  -8.661  11.143  27.576 1.00 . A A .  44 ASN CB   1 1 
        3  6865 1 1  44 ASN CG   C  -8.715  11.901  28.888 1.00 . A A .  44 ASN CG   1 1 
        3  6866 1 1  44 ASN H    H -11.339  10.479  28.640 1.00 . A A .  44 ASN H    1 1 
        3  6867 1 1  44 ASN HA   H  -9.525   9.445  26.602 1.00 . A A .  44 ASN HA   1 1 
        3  6868 1 1  44 ASN HB2  H  -7.648  10.805  27.418 1.00 . A A .  44 ASN HB2  1 1 
        3  6869 1 1  44 ASN HB3  H  -8.938  11.818  26.778 1.00 . A A .  44 ASN HB3  1 1 
        3  6870 1 1  44 ASN HD21 H  -9.723  13.379  28.022 1.00 . A A .  44 ASN HD21 1 1 
        3  6871 1 1  44 ASN HD22 H  -9.387  13.584  29.705 1.00 . A A .  44 ASN HD22 1 1 
        3  6872 1 1  44 ASN N    N -10.982  10.370  27.733 1.00 . A A .  44 ASN N    1 1 
        3  6873 1 1  44 ASN ND2  N  -9.338  13.073  28.869 1.00 . A A .  44 ASN ND2  1 1 
        3  6874 1 1  44 ASN O    O  -8.080   8.996  29.164 1.00 . A A .  44 ASN O    1 1 
        3  6875 1 1  44 ASN OD1  O  -8.201  11.438  29.907 1.00 . A A .  44 ASN OD1  1 1 
        3  6876 1 1  45 GLY C    C  -9.291   5.777  29.463 1.00 . A A .  45 GLY C    1 1 
        3  6877 1 1  45 GLY CA   C  -9.840   7.072  30.032 1.00 . A A .  45 GLY CA   1 1 
        3  6878 1 1  45 GLY H    H -10.993   8.068  28.561 1.00 . A A .  45 GLY H    1 1 
        3  6879 1 1  45 GLY HA2  H  -9.120   7.483  30.724 1.00 . A A .  45 GLY HA2  1 1 
        3  6880 1 1  45 GLY HA3  H -10.755   6.858  30.567 1.00 . A A .  45 GLY HA3  1 1 
        3  6881 1 1  45 GLY N    N -10.118   8.057  29.004 1.00 . A A .  45 GLY N    1 1 
        3  6882 1 1  45 GLY O    O  -8.078   5.635  29.300 1.00 . A A .  45 GLY O    1 1 
        3  6883 1 1  46 PRO C    C  -8.851   3.674  27.368 1.00 . A A .  46 PRO C    1 1 
        3  6884 1 1  46 PRO CA   C  -9.743   3.514  28.594 1.00 . A A .  46 PRO CA   1 1 
        3  6885 1 1  46 PRO CB   C -11.064   2.842  28.210 1.00 . A A .  46 PRO CB   1 1 
        3  6886 1 1  46 PRO CD   C -11.627   4.886  29.312 1.00 . A A .  46 PRO CD   1 1 
        3  6887 1 1  46 PRO CG   C -12.080   3.468  29.100 1.00 . A A .  46 PRO CG   1 1 
        3  6888 1 1  46 PRO HA   H  -9.231   2.914  29.333 1.00 . A A .  46 PRO HA   1 1 
        3  6889 1 1  46 PRO HB2  H -11.278   3.032  27.169 1.00 . A A .  46 PRO HB2  1 1 
        3  6890 1 1  46 PRO HB3  H -10.994   1.779  28.381 1.00 . A A .  46 PRO HB3  1 1 
        3  6891 1 1  46 PRO HD2  H -12.062   5.537  28.568 1.00 . A A .  46 PRO HD2  1 1 
        3  6892 1 1  46 PRO HD3  H -11.886   5.221  30.306 1.00 . A A .  46 PRO HD3  1 1 
        3  6893 1 1  46 PRO HG2  H -13.048   3.452  28.622 1.00 . A A .  46 PRO HG2  1 1 
        3  6894 1 1  46 PRO HG3  H -12.117   2.944  30.043 1.00 . A A .  46 PRO HG3  1 1 
        3  6895 1 1  46 PRO N    N -10.164   4.804  29.150 1.00 . A A .  46 PRO N    1 1 
        3  6896 1 1  46 PRO O    O  -7.695   3.252  27.369 1.00 . A A .  46 PRO O    1 1 
        3  6897 1 1  47 THR C    C  -8.924   5.891  24.519 1.00 . A A .  47 THR C    1 1 
        3  6898 1 1  47 THR CA   C  -8.648   4.502  25.089 1.00 . A A .  47 THR CA   1 1 
        3  6899 1 1  47 THR CB   C  -9.009   3.434  24.056 1.00 . A A .  47 THR CB   1 1 
        3  6900 1 1  47 THR CG2  C  -8.266   2.131  24.260 1.00 . A A .  47 THR CG2  1 1 
        3  6901 1 1  47 THR H    H -10.322   4.601  26.381 1.00 . A A .  47 THR H    1 1 
        3  6902 1 1  47 THR HA   H  -7.596   4.425  25.321 1.00 . A A .  47 THR HA   1 1 
        3  6903 1 1  47 THR HB   H  -8.764   3.803  23.070 1.00 . A A .  47 THR HB   1 1 
        3  6904 1 1  47 THR HG1  H -10.613   2.521  23.400 1.00 . A A .  47 THR HG1  1 1 
        3  6905 1 1  47 THR HG21 H  -7.339   2.155  23.709 1.00 . A A .  47 THR HG21 1 1 
        3  6906 1 1  47 THR HG22 H  -8.875   1.311  23.905 1.00 . A A .  47 THR HG22 1 1 
        3  6907 1 1  47 THR HG23 H  -8.059   1.996  25.312 1.00 . A A .  47 THR HG23 1 1 
        3  6908 1 1  47 THR N    N  -9.396   4.287  26.322 1.00 . A A .  47 THR N    1 1 
        3  6909 1 1  47 THR O    O  -9.960   6.493  24.801 1.00 . A A .  47 THR O    1 1 
        3  6910 1 1  47 THR OG1  O -10.397   3.150  24.093 1.00 . A A .  47 THR OG1  1 1 
        3  6911 1 1  48 ARG C    C  -8.135   7.609  21.584 1.00 . A A .  48 ARG C    1 1 
        3  6912 1 1  48 ARG CA   C  -8.132   7.710  23.107 1.00 . A A .  48 ARG CA   1 1 
        3  6913 1 1  48 ARG CB   C  -7.002   8.632  23.566 1.00 . A A .  48 ARG CB   1 1 
        3  6914 1 1  48 ARG CD   C  -4.536   8.961  23.919 1.00 . A A .  48 ARG CD   1 1 
        3  6915 1 1  48 ARG CG   C  -5.623   7.998  23.471 1.00 . A A .  48 ARG CG   1 1 
        3  6916 1 1  48 ARG CZ   C  -3.062   9.290  25.867 1.00 . A A .  48 ARG CZ   1 1 
        3  6917 1 1  48 ARG H    H  -7.186   5.864  23.531 1.00 . A A .  48 ARG H    1 1 
        3  6918 1 1  48 ARG HA   H  -9.076   8.124  23.430 1.00 . A A .  48 ARG HA   1 1 
        3  6919 1 1  48 ARG HB2  H  -7.008   9.522  22.955 1.00 . A A .  48 ARG HB2  1 1 
        3  6920 1 1  48 ARG HB3  H  -7.175   8.910  24.594 1.00 . A A .  48 ARG HB3  1 1 
        3  6921 1 1  48 ARG HD2  H  -3.682   8.849  23.267 1.00 . A A .  48 ARG HD2  1 1 
        3  6922 1 1  48 ARG HD3  H  -4.913   9.970  23.846 1.00 . A A .  48 ARG HD3  1 1 
        3  6923 1 1  48 ARG HE   H  -4.645   8.077  25.822 1.00 . A A .  48 ARG HE   1 1 
        3  6924 1 1  48 ARG HG2  H  -5.596   7.122  24.102 1.00 . A A .  48 ARG HG2  1 1 
        3  6925 1 1  48 ARG HG3  H  -5.439   7.712  22.447 1.00 . A A .  48 ARG HG3  1 1 
        3  6926 1 1  48 ARG HH11 H  -2.549  10.372  24.237 1.00 . A A .  48 ARG HH11 1 1 
        3  6927 1 1  48 ARG HH12 H  -1.530  10.586  25.619 1.00 . A A .  48 ARG HH12 1 1 
        3  6928 1 1  48 ARG HH21 H  -3.304   8.357  27.642 1.00 . A A .  48 ARG HH21 1 1 
        3  6929 1 1  48 ARG HH22 H  -1.957   9.441  27.553 1.00 . A A .  48 ARG HH22 1 1 
        3  6930 1 1  48 ARG N    N  -7.991   6.392  23.717 1.00 . A A .  48 ARG N    1 1 
        3  6931 1 1  48 ARG NE   N  -4.115   8.710  25.296 1.00 . A A .  48 ARG NE   1 1 
        3  6932 1 1  48 ARG NH1  N  -2.319  10.154  25.183 1.00 . A A .  48 ARG NH1  1 1 
        3  6933 1 1  48 ARG NH2  N  -2.749   9.006  27.124 1.00 . A A .  48 ARG NH2  1 1 
        3  6934 1 1  48 ARG O    O  -8.902   8.297  20.909 1.00 . A A .  48 ARG O    1 1 
        3  6935 1 1  49 ASN C    C  -8.512   6.104  19.028 1.00 . A A .  49 ASN C    1 1 
        3  6936 1 1  49 ASN CA   C  -7.177   6.561  19.608 1.00 . A A .  49 ASN CA   1 1 
        3  6937 1 1  49 ASN CB   C  -6.089   5.539  19.278 1.00 . A A .  49 ASN CB   1 1 
        3  6938 1 1  49 ASN CG   C  -6.353   4.186  19.911 1.00 . A A .  49 ASN CG   1 1 
        3  6939 1 1  49 ASN H    H  -6.689   6.230  21.641 1.00 . A A .  49 ASN H    1 1 
        3  6940 1 1  49 ASN HA   H  -6.913   7.509  19.167 1.00 . A A .  49 ASN HA   1 1 
        3  6941 1 1  49 ASN HB2  H  -6.037   5.410  18.207 1.00 . A A .  49 ASN HB2  1 1 
        3  6942 1 1  49 ASN HB3  H  -5.138   5.905  19.639 1.00 . A A .  49 ASN HB3  1 1 
        3  6943 1 1  49 ASN HD21 H  -4.718   4.363  21.030 1.00 . A A .  49 ASN HD21 1 1 
        3  6944 1 1  49 ASN HD22 H  -5.622   2.907  21.247 1.00 . A A .  49 ASN HD22 1 1 
        3  6945 1 1  49 ASN N    N  -7.275   6.749  21.051 1.00 . A A .  49 ASN N    1 1 
        3  6946 1 1  49 ASN ND2  N  -5.476   3.777  20.821 1.00 . A A .  49 ASN ND2  1 1 
        3  6947 1 1  49 ASN O    O  -9.387   5.632  19.752 1.00 . A A .  49 ASN O    1 1 
        3  6948 1 1  49 ASN OD1  O  -7.334   3.517  19.586 1.00 . A A .  49 ASN OD1  1 1 
        3  6949 1 1  50 ASP C    C  -9.626   4.698  16.072 1.00 . A A .  50 ASP C    1 1 
        3  6950 1 1  50 ASP CA   C  -9.888   5.854  17.034 1.00 . A A .  50 ASP CA   1 1 
        3  6951 1 1  50 ASP CB   C -10.480   7.045  16.276 1.00 . A A .  50 ASP CB   1 1 
        3  6952 1 1  50 ASP CG   C -11.645   7.677  17.013 1.00 . A A .  50 ASP CG   1 1 
        3  6953 1 1  50 ASP H    H  -7.926   6.634  17.191 1.00 . A A .  50 ASP H    1 1 
        3  6954 1 1  50 ASP HA   H -10.592   5.530  17.785 1.00 . A A .  50 ASP HA   1 1 
        3  6955 1 1  50 ASP HB2  H  -9.715   7.794  16.142 1.00 . A A .  50 ASP HB2  1 1 
        3  6956 1 1  50 ASP HB3  H -10.828   6.713  15.308 1.00 . A A .  50 ASP HB3  1 1 
        3  6957 1 1  50 ASP N    N  -8.660   6.251  17.715 1.00 . A A .  50 ASP N    1 1 
        3  6958 1 1  50 ASP O    O  -8.535   4.128  16.054 1.00 . A A .  50 ASP O    1 1 
        3  6959 1 1  50 ASP OD1  O -12.323   6.960  17.779 1.00 . A A .  50 ASP OD1  1 1 
        3  6960 1 1  50 ASP OD2  O -11.879   8.889  16.825 1.00 . A A .  50 ASP OD2  1 1 
        3  6961 1 1  51 GLN C    C  -9.329   3.496  13.376 1.00 . A A .  51 GLN C    1 1 
        3  6962 1 1  51 GLN CA   C -10.513   3.267  14.311 1.00 . A A .  51 GLN CA   1 1 
        3  6963 1 1  51 GLN CB   C -11.802   3.135  13.498 1.00 . A A .  51 GLN CB   1 1 
        3  6964 1 1  51 GLN CD   C -14.218   2.395  13.450 1.00 . A A .  51 GLN CD   1 1 
        3  6965 1 1  51 GLN CG   C -12.963   2.549  14.286 1.00 . A A .  51 GLN CG   1 1 
        3  6966 1 1  51 GLN H    H -11.479   4.848  15.336 1.00 . A A .  51 GLN H    1 1 
        3  6967 1 1  51 GLN HA   H -10.351   2.354  14.863 1.00 . A A .  51 GLN HA   1 1 
        3  6968 1 1  51 GLN HB2  H -12.095   4.114  13.145 1.00 . A A .  51 GLN HB2  1 1 
        3  6969 1 1  51 GLN HB3  H -11.614   2.497  12.647 1.00 . A A .  51 GLN HB3  1 1 
        3  6970 1 1  51 GLN HE21 H -14.603   4.338  13.624 1.00 . A A .  51 GLN HE21 1 1 
        3  6971 1 1  51 GLN HE22 H -15.741   3.427  12.697 1.00 . A A .  51 GLN HE22 1 1 
        3  6972 1 1  51 GLN HG2  H -12.674   1.577  14.655 1.00 . A A .  51 GLN HG2  1 1 
        3  6973 1 1  51 GLN HG3  H -13.180   3.200  15.120 1.00 . A A .  51 GLN HG3  1 1 
        3  6974 1 1  51 GLN N    N -10.634   4.356  15.275 1.00 . A A .  51 GLN N    1 1 
        3  6975 1 1  51 GLN NE2  N -14.925   3.497  13.236 1.00 . A A .  51 GLN NE2  1 1 
        3  6976 1 1  51 GLN O    O  -8.872   4.625  13.203 1.00 . A A .  51 GLN O    1 1 
        3  6977 1 1  51 GLN OE1  O -14.548   1.297  12.999 1.00 . A A .  51 GLN OE1  1 1 
        3  6978 1 1  52 LEU C    C  -7.915   1.598  10.649 1.00 . A A .  52 LEU C    1 1 
        3  6979 1 1  52 LEU CA   C  -7.706   2.500  11.861 1.00 . A A .  52 LEU CA   1 1 
        3  6980 1 1  52 LEU CB   C  -6.413   2.111  12.581 1.00 . A A .  52 LEU CB   1 1 
        3  6981 1 1  52 LEU CD1  C  -5.871  -0.332  12.421 1.00 . A A .  52 LEU CD1  1 1 
        3  6982 1 1  52 LEU CD2  C  -5.704   0.840  14.624 1.00 . A A .  52 LEU CD2  1 1 
        3  6983 1 1  52 LEU CG   C  -6.454   0.762  13.301 1.00 . A A .  52 LEU CG   1 1 
        3  6984 1 1  52 LEU H    H  -9.244   1.542  12.956 1.00 . A A .  52 LEU H    1 1 
        3  6985 1 1  52 LEU HA   H  -7.626   3.523  11.525 1.00 . A A .  52 LEU HA   1 1 
        3  6986 1 1  52 LEU HB2  H  -5.615   2.085  11.853 1.00 . A A .  52 LEU HB2  1 1 
        3  6987 1 1  52 LEU HB3  H  -6.187   2.876  13.308 1.00 . A A .  52 LEU HB3  1 1 
        3  6988 1 1  52 LEU HD11 H  -5.929  -0.029  11.385 1.00 . A A .  52 LEU HD11 1 1 
        3  6989 1 1  52 LEU HD12 H  -6.430  -1.244  12.562 1.00 . A A .  52 LEU HD12 1 1 
        3  6990 1 1  52 LEU HD13 H  -4.838  -0.497  12.688 1.00 . A A .  52 LEU HD13 1 1 
        3  6991 1 1  52 LEU HD21 H  -4.665   1.066  14.437 1.00 . A A .  52 LEU HD21 1 1 
        3  6992 1 1  52 LEU HD22 H  -5.781  -0.107  15.137 1.00 . A A .  52 LEU HD22 1 1 
        3  6993 1 1  52 LEU HD23 H  -6.136   1.617  15.237 1.00 . A A .  52 LEU HD23 1 1 
        3  6994 1 1  52 LEU HG   H  -7.481   0.506  13.513 1.00 . A A .  52 LEU HG   1 1 
        3  6995 1 1  52 LEU N    N  -8.838   2.417  12.777 1.00 . A A .  52 LEU N    1 1 
        3  6996 1 1  52 LEU O    O  -8.783   0.723  10.656 1.00 . A A .  52 LEU O    1 1 
        3  6997 1 1  53 GLY C    C  -5.888   0.500   7.926 1.00 . A A .  53 GLY C    1 1 
        3  6998 1 1  53 GLY CA   C  -7.229   1.019   8.404 1.00 . A A .  53 GLY CA   1 1 
        3  6999 1 1  53 GLY H    H  -6.444   2.528   9.663 1.00 . A A .  53 GLY H    1 1 
        3  7000 1 1  53 GLY HA2  H  -7.878   0.178   8.601 1.00 . A A .  53 GLY HA2  1 1 
        3  7001 1 1  53 GLY HA3  H  -7.667   1.623   7.624 1.00 . A A .  53 GLY HA3  1 1 
        3  7002 1 1  53 GLY N    N  -7.117   1.818   9.609 1.00 . A A .  53 GLY N    1 1 
        3  7003 1 1  53 GLY O    O  -4.908   1.245   7.875 1.00 . A A .  53 GLY O    1 1 
        3  7004 1 1  54 ALA C    C  -4.613  -1.520   5.574 1.00 . A A .  54 ALA C    1 1 
        3  7005 1 1  54 ALA CA   C  -4.611  -1.399   7.094 1.00 . A A .  54 ALA CA   1 1 
        3  7006 1 1  54 ALA CB   C  -4.423  -2.766   7.736 1.00 . A A .  54 ALA CB   1 1 
        3  7007 1 1  54 ALA H    H  -6.655  -1.324   7.633 1.00 . A A .  54 ALA H    1 1 
        3  7008 1 1  54 ALA HA   H  -3.785  -0.770   7.394 1.00 . A A .  54 ALA HA   1 1 
        3  7009 1 1  54 ALA HB1  H  -5.385  -3.161   8.028 1.00 . A A .  54 ALA HB1  1 1 
        3  7010 1 1  54 ALA HB2  H  -3.792  -2.670   8.607 1.00 . A A .  54 ALA HB2  1 1 
        3  7011 1 1  54 ALA HB3  H  -3.958  -3.436   7.027 1.00 . A A .  54 ALA HB3  1 1 
        3  7012 1 1  54 ALA N    N  -5.842  -0.780   7.571 1.00 . A A .  54 ALA N    1 1 
        3  7013 1 1  54 ALA O    O  -5.633  -1.842   4.968 1.00 . A A .  54 ALA O    1 1 
        3  7014 1 1  55 GLY C    C  -1.991  -1.839   3.073 1.00 . A A .  55 GLY C    1 1 
        3  7015 1 1  55 GLY CA   C  -3.352  -1.345   3.522 1.00 . A A .  55 GLY CA   1 1 
        3  7016 1 1  55 GLY H    H  -2.680  -1.009   5.500 1.00 . A A .  55 GLY H    1 1 
        3  7017 1 1  55 GLY HA2  H  -4.108  -2.023   3.154 1.00 . A A .  55 GLY HA2  1 1 
        3  7018 1 1  55 GLY HA3  H  -3.525  -0.367   3.100 1.00 . A A .  55 GLY HA3  1 1 
        3  7019 1 1  55 GLY N    N  -3.461  -1.260   4.965 1.00 . A A .  55 GLY N    1 1 
        3  7020 1 1  55 GLY O    O  -0.963  -1.287   3.468 1.00 . A A .  55 GLY O    1 1 
        3  7021 1 1  56 ALA C    C  -0.378  -2.857   0.384 1.00 . A A .  56 ALA C    1 1 
        3  7022 1 1  56 ALA CA   C  -0.736  -3.445   1.744 1.00 . A A .  56 ALA CA   1 1 
        3  7023 1 1  56 ALA CB   C  -0.843  -4.959   1.655 1.00 . A A .  56 ALA CB   1 1 
        3  7024 1 1  56 ALA H    H  -2.835  -3.273   1.966 1.00 . A A .  56 ALA H    1 1 
        3  7025 1 1  56 ALA HA   H   0.047  -3.202   2.448 1.00 . A A .  56 ALA HA   1 1 
        3  7026 1 1  56 ALA HB1  H  -1.380  -5.229   0.759 1.00 . A A .  56 ALA HB1  1 1 
        3  7027 1 1  56 ALA HB2  H  -1.372  -5.333   2.518 1.00 . A A .  56 ALA HB2  1 1 
        3  7028 1 1  56 ALA HB3  H   0.147  -5.388   1.626 1.00 . A A .  56 ALA HB3  1 1 
        3  7029 1 1  56 ALA N    N  -1.982  -2.878   2.246 1.00 . A A .  56 ALA N    1 1 
        3  7030 1 1  56 ALA O    O  -1.253  -2.619  -0.449 1.00 . A A .  56 ALA O    1 1 
        3  7031 1 1  57 PHE C    C   2.430  -2.962  -1.739 1.00 . A A .  57 PHE C    1 1 
        3  7032 1 1  57 PHE CA   C   1.383  -2.058  -1.095 1.00 . A A .  57 PHE CA   1 1 
        3  7033 1 1  57 PHE CB   C   1.968  -0.662  -0.866 1.00 . A A .  57 PHE CB   1 1 
        3  7034 1 1  57 PHE CD1  C  -0.063   0.637  -0.171 1.00 . A A .  57 PHE CD1  1 1 
        3  7035 1 1  57 PHE CD2  C   1.077   1.296  -2.158 1.00 . A A .  57 PHE CD2  1 1 
        3  7036 1 1  57 PHE CE1  C  -0.979   1.654  -0.354 1.00 . A A .  57 PHE CE1  1 1 
        3  7037 1 1  57 PHE CE2  C   0.165   2.317  -2.347 1.00 . A A .  57 PHE CE2  1 1 
        3  7038 1 1  57 PHE CG   C   0.974   0.446  -1.069 1.00 . A A .  57 PHE CG   1 1 
        3  7039 1 1  57 PHE CZ   C  -0.865   2.496  -1.444 1.00 . A A .  57 PHE CZ   1 1 
        3  7040 1 1  57 PHE H    H   1.563  -2.830   0.869 1.00 . A A .  57 PHE H    1 1 
        3  7041 1 1  57 PHE HA   H   0.537  -1.979  -1.759 1.00 . A A .  57 PHE HA   1 1 
        3  7042 1 1  57 PHE HB2  H   2.337  -0.596   0.146 1.00 . A A .  57 PHE HB2  1 1 
        3  7043 1 1  57 PHE HB3  H   2.786  -0.505  -1.553 1.00 . A A .  57 PHE HB3  1 1 
        3  7044 1 1  57 PHE HD1  H  -0.154  -0.020   0.682 1.00 . A A .  57 PHE HD1  1 1 
        3  7045 1 1  57 PHE HD2  H   1.882   1.156  -2.865 1.00 . A A .  57 PHE HD2  1 1 
        3  7046 1 1  57 PHE HE1  H  -1.784   1.793   0.353 1.00 . A A .  57 PHE HE1  1 1 
        3  7047 1 1  57 PHE HE2  H   0.256   2.973  -3.200 1.00 . A A .  57 PHE HE2  1 1 
        3  7048 1 1  57 PHE HZ   H  -1.580   3.293  -1.590 1.00 . A A .  57 PHE HZ   1 1 
        3  7049 1 1  57 PHE N    N   0.912  -2.621   0.166 1.00 . A A .  57 PHE N    1 1 
        3  7050 1 1  57 PHE O    O   3.430  -3.315  -1.115 1.00 . A A .  57 PHE O    1 1 
        3  7051 1 1  58 GLY C    C   3.036  -4.001  -5.209 1.00 . A A .  58 GLY C    1 1 
        3  7052 1 1  58 GLY CA   C   3.120  -4.185  -3.707 1.00 . A A .  58 GLY CA   1 1 
        3  7053 1 1  58 GLY H    H   1.379  -3.013  -3.440 1.00 . A A .  58 GLY H    1 1 
        3  7054 1 1  58 GLY HA2  H   4.125  -3.957  -3.383 1.00 . A A .  58 GLY HA2  1 1 
        3  7055 1 1  58 GLY HA3  H   2.901  -5.215  -3.469 1.00 . A A .  58 GLY HA3  1 1 
        3  7056 1 1  58 GLY N    N   2.191  -3.328  -2.995 1.00 . A A .  58 GLY N    1 1 
        3  7057 1 1  58 GLY O    O   1.962  -4.125  -5.797 1.00 . A A .  58 GLY O    1 1 
        3  7058 1 1  59 GLY C    C   5.572  -3.698  -7.868 1.00 . A A .  59 GLY C    1 1 
        3  7059 1 1  59 GLY CA   C   4.193  -3.502  -7.271 1.00 . A A .  59 GLY CA   1 1 
        3  7060 1 1  59 GLY H    H   4.998  -3.613  -5.315 1.00 . A A .  59 GLY H    1 1 
        3  7061 1 1  59 GLY HA2  H   3.512  -4.203  -7.729 1.00 . A A .  59 GLY HA2  1 1 
        3  7062 1 1  59 GLY HA3  H   3.860  -2.498  -7.487 1.00 . A A .  59 GLY HA3  1 1 
        3  7063 1 1  59 GLY N    N   4.172  -3.701  -5.834 1.00 . A A .  59 GLY N    1 1 
        3  7064 1 1  59 GLY O    O   6.480  -4.198  -7.203 1.00 . A A .  59 GLY O    1 1 
        3  7065 1 1  60 TYR C    C   7.120  -2.412 -10.945 1.00 . A A .  60 TYR C    1 1 
        3  7066 1 1  60 TYR CA   C   7.005  -3.436  -9.820 1.00 . A A .  60 TYR CA   1 1 
        3  7067 1 1  60 TYR CB   C   7.157  -4.850 -10.383 1.00 . A A .  60 TYR CB   1 1 
        3  7068 1 1  60 TYR CD1  C   5.883  -4.670 -12.557 1.00 . A A .  60 TYR CD1  1 1 
        3  7069 1 1  60 TYR CD2  C   5.112  -6.228 -10.924 1.00 . A A .  60 TYR CD2  1 1 
        3  7070 1 1  60 TYR CE1  C   4.854  -5.040 -13.401 1.00 . A A .  60 TYR CE1  1 1 
        3  7071 1 1  60 TYR CE2  C   4.080  -6.602 -11.765 1.00 . A A .  60 TYR CE2  1 1 
        3  7072 1 1  60 TYR CG   C   6.030  -5.257 -11.305 1.00 . A A .  60 TYR CG   1 1 
        3  7073 1 1  60 TYR CZ   C   3.955  -6.006 -13.001 1.00 . A A .  60 TYR CZ   1 1 
        3  7074 1 1  60 TYR H    H   4.967  -2.913  -9.603 1.00 . A A .  60 TYR H    1 1 
        3  7075 1 1  60 TYR HA   H   7.792  -3.257  -9.104 1.00 . A A .  60 TYR HA   1 1 
        3  7076 1 1  60 TYR HB2  H   8.080  -4.910 -10.941 1.00 . A A .  60 TYR HB2  1 1 
        3  7077 1 1  60 TYR HB3  H   7.189  -5.554  -9.565 1.00 . A A .  60 TYR HB3  1 1 
        3  7078 1 1  60 TYR HD1  H   6.589  -3.915 -12.867 1.00 . A A .  60 TYR HD1  1 1 
        3  7079 1 1  60 TYR HD2  H   5.211  -6.694  -9.955 1.00 . A A .  60 TYR HD2  1 1 
        3  7080 1 1  60 TYR HE1  H   4.758  -4.572 -14.369 1.00 . A A .  60 TYR HE1  1 1 
        3  7081 1 1  60 TYR HE2  H   3.376  -7.360 -11.451 1.00 . A A .  60 TYR HE2  1 1 
        3  7082 1 1  60 TYR HH   H   2.087  -6.209 -13.408 1.00 . A A .  60 TYR HH   1 1 
        3  7083 1 1  60 TYR N    N   5.729  -3.303  -9.127 1.00 . A A .  60 TYR N    1 1 
        3  7084 1 1  60 TYR O    O   6.118  -1.861 -11.400 1.00 . A A .  60 TYR O    1 1 
        3  7085 1 1  60 TYR OH   O   2.929  -6.376 -13.839 1.00 . A A .  60 TYR OH   1 1 
        3  7086 1 1  61 GLN C    C   9.022  -1.916 -13.741 1.00 . A A .  61 GLN C    1 1 
        3  7087 1 1  61 GLN CA   C   8.592  -1.204 -12.463 1.00 . A A .  61 GLN CA   1 1 
        3  7088 1 1  61 GLN CB   C   9.663  -0.197 -12.041 1.00 . A A .  61 GLN CB   1 1 
        3  7089 1 1  61 GLN CD   C  10.357   1.598 -10.406 1.00 . A A .  61 GLN CD   1 1 
        3  7090 1 1  61 GLN CG   C   9.341   0.525 -10.743 1.00 . A A .  61 GLN CG   1 1 
        3  7091 1 1  61 GLN H    H   9.107  -2.633 -10.988 1.00 . A A .  61 GLN H    1 1 
        3  7092 1 1  61 GLN HA   H   7.669  -0.678 -12.651 1.00 . A A .  61 GLN HA   1 1 
        3  7093 1 1  61 GLN HB2  H  10.601  -0.718 -11.915 1.00 . A A .  61 GLN HB2  1 1 
        3  7094 1 1  61 GLN HB3  H   9.772   0.540 -12.821 1.00 . A A .  61 GLN HB3  1 1 
        3  7095 1 1  61 GLN HE21 H   9.792   2.665 -11.985 1.00 . A A .  61 GLN HE21 1 1 
        3  7096 1 1  61 GLN HE22 H  11.055   3.353 -11.028 1.00 . A A .  61 GLN HE22 1 1 
        3  7097 1 1  61 GLN HG2  H   8.370   0.989 -10.834 1.00 . A A .  61 GLN HG2  1 1 
        3  7098 1 1  61 GLN HG3  H   9.319  -0.196  -9.940 1.00 . A A .  61 GLN HG3  1 1 
        3  7099 1 1  61 GLN N    N   8.347  -2.163 -11.390 1.00 . A A .  61 GLN N    1 1 
        3  7100 1 1  61 GLN NE2  N  10.406   2.645 -11.222 1.00 . A A .  61 GLN NE2  1 1 
        3  7101 1 1  61 GLN O    O   9.859  -2.817 -13.710 1.00 . A A .  61 GLN O    1 1 
        3  7102 1 1  61 GLN OE1  O  11.091   1.487  -9.424 1.00 . A A .  61 GLN OE1  1 1 
        3  7103 1 1  62 VAL C    C   8.817  -1.040 -17.254 1.00 . A A .  62 VAL C    1 1 
        3  7104 1 1  62 VAL CA   C   8.769  -2.100 -16.156 1.00 . A A .  62 VAL CA   1 1 
        3  7105 1 1  62 VAL CB   C   7.746  -3.184 -16.550 1.00 . A A .  62 VAL CB   1 1 
        3  7106 1 1  62 VAL CG1  C   8.233  -3.963 -17.762 1.00 . A A .  62 VAL CG1  1 1 
        3  7107 1 1  62 VAL CG2  C   7.478  -4.118 -15.380 1.00 . A A .  62 VAL CG2  1 1 
        3  7108 1 1  62 VAL H    H   7.785  -0.779 -14.827 1.00 . A A .  62 VAL H    1 1 
        3  7109 1 1  62 VAL HA   H   9.741  -2.562 -16.074 1.00 . A A .  62 VAL HA   1 1 
        3  7110 1 1  62 VAL HB   H   6.820  -2.696 -16.812 1.00 . A A .  62 VAL HB   1 1 
        3  7111 1 1  62 VAL HG11 H   7.859  -4.974 -17.713 1.00 . A A .  62 VAL HG11 1 1 
        3  7112 1 1  62 VAL HG12 H   9.314  -3.979 -17.770 1.00 . A A .  62 VAL HG12 1 1 
        3  7113 1 1  62 VAL HG13 H   7.875  -3.489 -18.663 1.00 . A A .  62 VAL HG13 1 1 
        3  7114 1 1  62 VAL HG21 H   8.329  -4.112 -14.713 1.00 . A A .  62 VAL HG21 1 1 
        3  7115 1 1  62 VAL HG22 H   7.317  -5.120 -15.749 1.00 . A A .  62 VAL HG22 1 1 
        3  7116 1 1  62 VAL HG23 H   6.601  -3.785 -14.847 1.00 . A A .  62 VAL HG23 1 1 
        3  7117 1 1  62 VAL N    N   8.444  -1.503 -14.866 1.00 . A A .  62 VAL N    1 1 
        3  7118 1 1  62 VAL O    O   8.543  -1.328 -18.419 1.00 . A A .  62 VAL O    1 1 
        3  7119 1 1  63 ASN C    C  10.068   2.439 -17.249 1.00 . A A .  63 ASN C    1 1 
        3  7120 1 1  63 ASN CA   C   9.249   1.286 -17.825 1.00 . A A .  63 ASN CA   1 1 
        3  7121 1 1  63 ASN CB   C   7.846   1.773 -18.197 1.00 . A A .  63 ASN CB   1 1 
        3  7122 1 1  63 ASN CG   C   7.465   1.410 -19.618 1.00 . A A .  63 ASN CG   1 1 
        3  7123 1 1  63 ASN H    H   9.371   0.352 -15.930 1.00 . A A .  63 ASN H    1 1 
        3  7124 1 1  63 ASN HA   H   9.741   0.920 -18.714 1.00 . A A .  63 ASN HA   1 1 
        3  7125 1 1  63 ASN HB2  H   7.127   1.327 -17.526 1.00 . A A .  63 ASN HB2  1 1 
        3  7126 1 1  63 ASN HB3  H   7.805   2.848 -18.096 1.00 . A A .  63 ASN HB3  1 1 
        3  7127 1 1  63 ASN HD21 H   7.306   3.334 -20.094 1.00 . A A .  63 ASN HD21 1 1 
        3  7128 1 1  63 ASN HD22 H   6.975   2.216 -21.369 1.00 . A A .  63 ASN HD22 1 1 
        3  7129 1 1  63 ASN N    N   9.166   0.184 -16.873 1.00 . A A .  63 ASN N    1 1 
        3  7130 1 1  63 ASN ND2  N   7.224   2.422 -20.443 1.00 . A A .  63 ASN ND2  1 1 
        3  7131 1 1  63 ASN O    O  10.301   2.503 -16.042 1.00 . A A .  63 ASN O    1 1 
        3  7132 1 1  63 ASN OD1  O   7.387   0.233 -19.971 1.00 . A A .  63 ASN OD1  1 1 
        3  7133 1 1  64 PRO C    C  10.648   5.296 -16.545 1.00 . A A .  64 PRO C    1 1 
        3  7134 1 1  64 PRO CA   C  11.314   4.523 -17.678 1.00 . A A .  64 PRO CA   1 1 
        3  7135 1 1  64 PRO CB   C  11.401   5.387 -18.937 1.00 . A A .  64 PRO CB   1 1 
        3  7136 1 1  64 PRO CD   C  10.286   3.371 -19.565 1.00 . A A .  64 PRO CD   1 1 
        3  7137 1 1  64 PRO CG   C  11.224   4.433 -20.066 1.00 . A A .  64 PRO CG   1 1 
        3  7138 1 1  64 PRO HA   H  12.308   4.225 -17.373 1.00 . A A .  64 PRO HA   1 1 
        3  7139 1 1  64 PRO HB2  H  10.618   6.131 -18.921 1.00 . A A .  64 PRO HB2  1 1 
        3  7140 1 1  64 PRO HB3  H  12.365   5.873 -18.979 1.00 . A A .  64 PRO HB3  1 1 
        3  7141 1 1  64 PRO HD2  H   9.263   3.631 -19.793 1.00 . A A .  64 PRO HD2  1 1 
        3  7142 1 1  64 PRO HD3  H  10.538   2.411 -19.995 1.00 . A A .  64 PRO HD3  1 1 
        3  7143 1 1  64 PRO HG2  H  10.794   4.944 -20.915 1.00 . A A .  64 PRO HG2  1 1 
        3  7144 1 1  64 PRO HG3  H  12.176   3.998 -20.331 1.00 . A A .  64 PRO HG3  1 1 
        3  7145 1 1  64 PRO N    N  10.518   3.368 -18.108 1.00 . A A .  64 PRO N    1 1 
        3  7146 1 1  64 PRO O    O  11.311   5.733 -15.605 1.00 . A A .  64 PRO O    1 1 
        3  7147 1 1  65 TYR C    C   7.162   5.625 -15.500 1.00 . A A .  65 TYR C    1 1 
        3  7148 1 1  65 TYR CA   C   8.576   6.183 -15.625 1.00 . A A .  65 TYR CA   1 1 
        3  7149 1 1  65 TYR CB   C   8.520   7.673 -15.964 1.00 . A A .  65 TYR CB   1 1 
        3  7150 1 1  65 TYR CD1  C   6.765   7.999 -17.749 1.00 . A A .  65 TYR CD1  1 1 
        3  7151 1 1  65 TYR CD2  C   9.058   8.178 -18.378 1.00 . A A .  65 TYR CD2  1 1 
        3  7152 1 1  65 TYR CE1  C   6.383   8.255 -19.052 1.00 . A A .  65 TYR CE1  1 1 
        3  7153 1 1  65 TYR CE2  C   8.684   8.436 -19.683 1.00 . A A .  65 TYR CE2  1 1 
        3  7154 1 1  65 TYR CG   C   8.108   7.955 -17.390 1.00 . A A .  65 TYR CG   1 1 
        3  7155 1 1  65 TYR CZ   C   7.346   8.474 -20.015 1.00 . A A .  65 TYR CZ   1 1 
        3  7156 1 1  65 TYR H    H   8.860   5.089 -17.415 1.00 . A A .  65 TYR H    1 1 
        3  7157 1 1  65 TYR HA   H   9.086   6.056 -14.681 1.00 . A A .  65 TYR HA   1 1 
        3  7158 1 1  65 TYR HB2  H   7.809   8.157 -15.311 1.00 . A A .  65 TYR HB2  1 1 
        3  7159 1 1  65 TYR HB3  H   9.497   8.107 -15.809 1.00 . A A .  65 TYR HB3  1 1 
        3  7160 1 1  65 TYR HD1  H   6.013   7.827 -16.992 1.00 . A A .  65 TYR HD1  1 1 
        3  7161 1 1  65 TYR HD2  H  10.104   8.148 -18.115 1.00 . A A .  65 TYR HD2  1 1 
        3  7162 1 1  65 TYR HE1  H   5.336   8.285 -19.311 1.00 . A A .  65 TYR HE1  1 1 
        3  7163 1 1  65 TYR HE2  H   9.438   8.608 -20.438 1.00 . A A .  65 TYR HE2  1 1 
        3  7164 1 1  65 TYR HH   H   6.191   9.291 -21.317 1.00 . A A .  65 TYR HH   1 1 
        3  7165 1 1  65 TYR N    N   9.333   5.460 -16.642 1.00 . A A .  65 TYR N    1 1 
        3  7166 1 1  65 TYR O    O   6.206   6.371 -15.297 1.00 . A A .  65 TYR O    1 1 
        3  7167 1 1  65 TYR OH   O   6.969   8.731 -21.313 1.00 . A A .  65 TYR OH   1 1 
        3  7168 1 1  66 LEU C    C   5.851   2.349 -14.733 1.00 . A A .  66 LEU C    1 1 
        3  7169 1 1  66 LEU CA   C   5.741   3.649 -15.524 1.00 . A A .  66 LEU CA   1 1 
        3  7170 1 1  66 LEU CB   C   5.188   3.366 -16.925 1.00 . A A .  66 LEU CB   1 1 
        3  7171 1 1  66 LEU CD1  C   2.759   3.262 -16.322 1.00 . A A .  66 LEU CD1  1 1 
        3  7172 1 1  66 LEU CD2  C   3.787   5.444 -16.983 1.00 . A A .  66 LEU CD2  1 1 
        3  7173 1 1  66 LEU CG   C   3.798   3.939 -17.202 1.00 . A A .  66 LEU CG   1 1 
        3  7174 1 1  66 LEU H    H   7.840   3.764 -15.785 1.00 . A A .  66 LEU H    1 1 
        3  7175 1 1  66 LEU HA   H   5.068   4.318 -15.008 1.00 . A A .  66 LEU HA   1 1 
        3  7176 1 1  66 LEU HB2  H   5.875   3.781 -17.649 1.00 . A A .  66 LEU HB2  1 1 
        3  7177 1 1  66 LEU HB3  H   5.147   2.297 -17.065 1.00 . A A .  66 LEU HB3  1 1 
        3  7178 1 1  66 LEU HD11 H   2.806   2.194 -16.468 1.00 . A A .  66 LEU HD11 1 1 
        3  7179 1 1  66 LEU HD12 H   1.774   3.617 -16.589 1.00 . A A .  66 LEU HD12 1 1 
        3  7180 1 1  66 LEU HD13 H   2.957   3.494 -15.287 1.00 . A A .  66 LEU HD13 1 1 
        3  7181 1 1  66 LEU HD21 H   3.902   5.655 -15.929 1.00 . A A .  66 LEU HD21 1 1 
        3  7182 1 1  66 LEU HD22 H   2.850   5.852 -17.333 1.00 . A A .  66 LEU HD22 1 1 
        3  7183 1 1  66 LEU HD23 H   4.603   5.892 -17.531 1.00 . A A .  66 LEU HD23 1 1 
        3  7184 1 1  66 LEU HG   H   3.536   3.747 -18.234 1.00 . A A .  66 LEU HG   1 1 
        3  7185 1 1  66 LEU N    N   7.039   4.307 -15.622 1.00 . A A .  66 LEU N    1 1 
        3  7186 1 1  66 LEU O    O   6.525   1.410 -15.156 1.00 . A A .  66 LEU O    1 1 
        3  7187 1 1  67 GLY C    C   3.844   0.632 -12.354 1.00 . A A .  67 GLY C    1 1 
        3  7188 1 1  67 GLY CA   C   5.225   1.104 -12.759 1.00 . A A .  67 GLY CA   1 1 
        3  7189 1 1  67 GLY H    H   4.662   3.076 -13.290 1.00 . A A .  67 GLY H    1 1 
        3  7190 1 1  67 GLY HA2  H   5.715   0.317 -13.312 1.00 . A A .  67 GLY HA2  1 1 
        3  7191 1 1  67 GLY HA3  H   5.797   1.315 -11.868 1.00 . A A .  67 GLY HA3  1 1 
        3  7192 1 1  67 GLY N    N   5.185   2.298 -13.583 1.00 . A A .  67 GLY N    1 1 
        3  7193 1 1  67 GLY O    O   2.906   1.426 -12.270 1.00 . A A .  67 GLY O    1 1 
        3  7194 1 1  68 PHE C    C   2.364  -1.354 -10.171 1.00 . A A .  68 PHE C    1 1 
        3  7195 1 1  68 PHE CA   C   2.440  -1.245 -11.690 1.00 . A A .  68 PHE CA   1 1 
        3  7196 1 1  68 PHE CB   C   2.256  -2.625 -12.327 1.00 . A A .  68 PHE CB   1 1 
        3  7197 1 1  68 PHE CD1  C   0.663  -2.041 -14.175 1.00 . A A .  68 PHE CD1  1 1 
        3  7198 1 1  68 PHE CD2  C  -0.007  -3.679 -12.578 1.00 . A A .  68 PHE CD2  1 1 
        3  7199 1 1  68 PHE CE1  C  -0.542  -2.187 -14.836 1.00 . A A .  68 PHE CE1  1 1 
        3  7200 1 1  68 PHE CE2  C  -1.215  -3.829 -13.234 1.00 . A A .  68 PHE CE2  1 1 
        3  7201 1 1  68 PHE CG   C   0.945  -2.786 -13.041 1.00 . A A .  68 PHE CG   1 1 
        3  7202 1 1  68 PHE CZ   C  -1.483  -3.081 -14.365 1.00 . A A .  68 PHE CZ   1 1 
        3  7203 1 1  68 PHE H    H   4.500  -1.249 -12.177 1.00 . A A .  68 PHE H    1 1 
        3  7204 1 1  68 PHE HA   H   1.654  -0.589 -12.033 1.00 . A A .  68 PHE HA   1 1 
        3  7205 1 1  68 PHE HB2  H   3.046  -2.791 -13.044 1.00 . A A .  68 PHE HB2  1 1 
        3  7206 1 1  68 PHE HB3  H   2.310  -3.381 -11.557 1.00 . A A .  68 PHE HB3  1 1 
        3  7207 1 1  68 PHE HD1  H   1.398  -1.341 -14.546 1.00 . A A .  68 PHE HD1  1 1 
        3  7208 1 1  68 PHE HD2  H   0.201  -4.264 -11.694 1.00 . A A .  68 PHE HD2  1 1 
        3  7209 1 1  68 PHE HE1  H  -0.749  -1.601 -15.719 1.00 . A A .  68 PHE HE1  1 1 
        3  7210 1 1  68 PHE HE2  H  -1.948  -4.529 -12.863 1.00 . A A .  68 PHE HE2  1 1 
        3  7211 1 1  68 PHE HZ   H  -2.426  -3.196 -14.879 1.00 . A A .  68 PHE HZ   1 1 
        3  7212 1 1  68 PHE N    N   3.716  -0.666 -12.096 1.00 . A A .  68 PHE N    1 1 
        3  7213 1 1  68 PHE O    O   3.269  -1.890  -9.535 1.00 . A A .  68 PHE O    1 1 
        3  7214 1 1  69 GLU C    C  -0.185  -1.590  -7.765 1.00 . A A .  69 GLU C    1 1 
        3  7215 1 1  69 GLU CA   C   1.106  -0.875  -8.147 1.00 . A A .  69 GLU CA   1 1 
        3  7216 1 1  69 GLU CB   C   1.107   0.546  -7.576 1.00 . A A .  69 GLU CB   1 1 
        3  7217 1 1  69 GLU CD   C   2.382  -0.162  -5.514 1.00 . A A .  69 GLU CD   1 1 
        3  7218 1 1  69 GLU CG   C   2.283   0.829  -6.655 1.00 . A A .  69 GLU CG   1 1 
        3  7219 1 1  69 GLU H    H   0.595  -0.415 -10.147 1.00 . A A .  69 GLU H    1 1 
        3  7220 1 1  69 GLU HA   H   1.940  -1.418  -7.727 1.00 . A A .  69 GLU HA   1 1 
        3  7221 1 1  69 GLU HB2  H   1.138   1.249  -8.394 1.00 . A A .  69 GLU HB2  1 1 
        3  7222 1 1  69 GLU HB3  H   0.196   0.699  -7.015 1.00 . A A .  69 GLU HB3  1 1 
        3  7223 1 1  69 GLU HG2  H   3.194   0.781  -7.232 1.00 . A A .  69 GLU HG2  1 1 
        3  7224 1 1  69 GLU HG3  H   2.170   1.822  -6.245 1.00 . A A .  69 GLU HG3  1 1 
        3  7225 1 1  69 GLU N    N   1.285  -0.836  -9.593 1.00 . A A .  69 GLU N    1 1 
        3  7226 1 1  69 GLU O    O  -1.258  -1.286  -8.290 1.00 . A A .  69 GLU O    1 1 
        3  7227 1 1  69 GLU OE1  O   1.327  -0.655  -5.062 1.00 . A A .  69 GLU OE1  1 1 
        3  7228 1 1  69 GLU OE2  O   3.515  -0.446  -5.069 1.00 . A A .  69 GLU OE2  1 1 
        3  7229 1 1  70 MET C    C  -1.425  -3.076  -4.876 1.00 . A A .  70 MET C    1 1 
        3  7230 1 1  70 MET CA   C  -1.222  -3.295  -6.369 1.00 . A A .  70 MET CA   1 1 
        3  7231 1 1  70 MET CB   C  -1.034  -4.786  -6.662 1.00 . A A .  70 MET CB   1 1 
        3  7232 1 1  70 MET CE   C  -1.420  -6.855 -10.266 1.00 . A A .  70 MET CE   1 1 
        3  7233 1 1  70 MET CG   C  -1.502  -5.197  -8.047 1.00 . A A .  70 MET CG   1 1 
        3  7234 1 1  70 MET H    H   0.811  -2.724  -6.457 1.00 . A A .  70 MET H    1 1 
        3  7235 1 1  70 MET HA   H  -2.094  -2.938  -6.897 1.00 . A A .  70 MET HA   1 1 
        3  7236 1 1  70 MET HB2  H   0.014  -5.030  -6.572 1.00 . A A .  70 MET HB2  1 1 
        3  7237 1 1  70 MET HB3  H  -1.591  -5.355  -5.933 1.00 . A A .  70 MET HB3  1 1 
        3  7238 1 1  70 MET HE1  H  -2.040  -5.994 -10.469 1.00 . A A .  70 MET HE1  1 1 
        3  7239 1 1  70 MET HE2  H  -2.024  -7.749 -10.301 1.00 . A A .  70 MET HE2  1 1 
        3  7240 1 1  70 MET HE3  H  -0.638  -6.919 -11.007 1.00 . A A .  70 MET HE3  1 1 
        3  7241 1 1  70 MET HG2  H  -2.566  -5.373  -8.016 1.00 . A A .  70 MET HG2  1 1 
        3  7242 1 1  70 MET HG3  H  -1.292  -4.393  -8.737 1.00 . A A .  70 MET HG3  1 1 
        3  7243 1 1  70 MET N    N  -0.071  -2.536  -6.840 1.00 . A A .  70 MET N    1 1 
        3  7244 1 1  70 MET O    O  -0.497  -3.245  -4.083 1.00 . A A .  70 MET O    1 1 
        3  7245 1 1  70 MET SD   S  -0.688  -6.693  -8.639 1.00 . A A .  70 MET SD   1 1 
        3  7246 1 1  71 GLY C    C  -3.842  -3.494  -2.493 1.00 . A A .  71 GLY C    1 1 
        3  7247 1 1  71 GLY CA   C  -2.925  -2.446  -3.092 1.00 . A A .  71 GLY CA   1 1 
        3  7248 1 1  71 GLY H    H  -3.338  -2.565  -5.167 1.00 . A A .  71 GLY H    1 1 
        3  7249 1 1  71 GLY HA2  H  -1.997  -2.440  -2.541 1.00 . A A .  71 GLY HA2  1 1 
        3  7250 1 1  71 GLY HA3  H  -3.395  -1.478  -2.996 1.00 . A A .  71 GLY HA3  1 1 
        3  7251 1 1  71 GLY N    N  -2.637  -2.689  -4.494 1.00 . A A .  71 GLY N    1 1 
        3  7252 1 1  71 GLY O    O  -4.572  -4.175  -3.213 1.00 . A A .  71 GLY O    1 1 
        3  7253 1 1  72 TYR C    C  -5.400  -3.932   0.669 1.00 . A A .  72 TYR C    1 1 
        3  7254 1 1  72 TYR CA   C  -4.638  -4.594  -0.473 1.00 . A A .  72 TYR CA   1 1 
        3  7255 1 1  72 TYR CB   C  -3.777  -5.739   0.065 1.00 . A A .  72 TYR CB   1 1 
        3  7256 1 1  72 TYR CD1  C  -4.899  -7.548  -1.292 1.00 . A A .  72 TYR CD1  1 1 
        3  7257 1 1  72 TYR CD2  C  -4.562  -7.933   1.036 1.00 . A A .  72 TYR CD2  1 1 
        3  7258 1 1  72 TYR CE1  C  -5.491  -8.792  -1.416 1.00 . A A .  72 TYR CE1  1 1 
        3  7259 1 1  72 TYR CE2  C  -5.152  -9.178   0.920 1.00 . A A .  72 TYR CE2  1 1 
        3  7260 1 1  72 TYR CG   C  -4.426  -7.099  -0.066 1.00 . A A .  72 TYR CG   1 1 
        3  7261 1 1  72 TYR CZ   C  -5.614  -9.602  -0.308 1.00 . A A .  72 TYR CZ   1 1 
        3  7262 1 1  72 TYR H    H  -3.200  -3.048  -0.652 1.00 . A A .  72 TYR H    1 1 
        3  7263 1 1  72 TYR HA   H  -5.348  -4.992  -1.184 1.00 . A A .  72 TYR HA   1 1 
        3  7264 1 1  72 TYR HB2  H  -2.844  -5.764  -0.475 1.00 . A A .  72 TYR HB2  1 1 
        3  7265 1 1  72 TYR HB3  H  -3.576  -5.567   1.113 1.00 . A A .  72 TYR HB3  1 1 
        3  7266 1 1  72 TYR HD1  H  -4.800  -6.912  -2.159 1.00 . A A .  72 TYR HD1  1 1 
        3  7267 1 1  72 TYR HD2  H  -4.200  -7.599   1.997 1.00 . A A .  72 TYR HD2  1 1 
        3  7268 1 1  72 TYR HE1  H  -5.853  -9.124  -2.379 1.00 . A A .  72 TYR HE1  1 1 
        3  7269 1 1  72 TYR HE2  H  -5.248  -9.813   1.788 1.00 . A A .  72 TYR HE2  1 1 
        3  7270 1 1  72 TYR HH   H  -5.607 -11.512  -0.084 1.00 . A A .  72 TYR HH   1 1 
        3  7271 1 1  72 TYR N    N  -3.803  -3.622  -1.170 1.00 . A A .  72 TYR N    1 1 
        3  7272 1 1  72 TYR O    O  -4.802  -3.461   1.635 1.00 . A A .  72 TYR O    1 1 
        3  7273 1 1  72 TYR OH   O  -6.202 -10.841  -0.428 1.00 . A A .  72 TYR OH   1 1 
        3  7274 1 1  73 ASP C    C  -7.838  -4.274   2.708 1.00 . A A .  73 ASP C    1 1 
        3  7275 1 1  73 ASP CA   C  -7.566  -3.291   1.575 1.00 . A A .  73 ASP CA   1 1 
        3  7276 1 1  73 ASP CB   C  -8.886  -2.817   0.967 1.00 . A A .  73 ASP CB   1 1 
        3  7277 1 1  73 ASP CG   C  -9.348  -1.493   1.546 1.00 . A A .  73 ASP CG   1 1 
        3  7278 1 1  73 ASP H    H  -7.144  -4.289  -0.245 1.00 . A A .  73 ASP H    1 1 
        3  7279 1 1  73 ASP HA   H  -7.037  -2.439   1.975 1.00 . A A .  73 ASP HA   1 1 
        3  7280 1 1  73 ASP HB2  H  -8.763  -2.697  -0.100 1.00 . A A .  73 ASP HB2  1 1 
        3  7281 1 1  73 ASP HB3  H  -9.650  -3.557   1.155 1.00 . A A .  73 ASP HB3  1 1 
        3  7282 1 1  73 ASP N    N  -6.724  -3.898   0.551 1.00 . A A .  73 ASP N    1 1 
        3  7283 1 1  73 ASP O    O  -8.478  -5.308   2.506 1.00 . A A .  73 ASP O    1 1 
        3  7284 1 1  73 ASP OD1  O  -9.987  -1.505   2.620 1.00 . A A .  73 ASP OD1  1 1 
        3  7285 1 1  73 ASP OD2  O  -9.071  -0.444   0.926 1.00 . A A .  73 ASP OD2  1 1 
        3  7286 1 1  74 TRP C    C  -7.841  -3.954   6.306 1.00 . A A .  74 TRP C    1 1 
        3  7287 1 1  74 TRP CA   C  -7.534  -4.792   5.069 1.00 . A A .  74 TRP CA   1 1 
        3  7288 1 1  74 TRP CB   C  -6.284  -5.641   5.313 1.00 . A A .  74 TRP CB   1 1 
        3  7289 1 1  74 TRP CD1  C  -7.172  -6.992   7.301 1.00 . A A .  74 TRP CD1  1 1 
        3  7290 1 1  74 TRP CD2  C  -6.230  -8.233   5.694 1.00 . A A .  74 TRP CD2  1 1 
        3  7291 1 1  74 TRP CE2  C  -6.672  -9.089   6.720 1.00 . A A .  74 TRP CE2  1 1 
        3  7292 1 1  74 TRP CE3  C  -5.604  -8.792   4.575 1.00 . A A .  74 TRP CE3  1 1 
        3  7293 1 1  74 TRP CG   C  -6.559  -6.896   6.084 1.00 . A A .  74 TRP CG   1 1 
        3  7294 1 1  74 TRP CH2  C  -5.894 -10.989   5.554 1.00 . A A .  74 TRP CH2  1 1 
        3  7295 1 1  74 TRP CZ2  C  -6.509 -10.471   6.660 1.00 . A A .  74 TRP CZ2  1 1 
        3  7296 1 1  74 TRP CZ3  C  -5.443 -10.163   4.516 1.00 . A A .  74 TRP CZ3  1 1 
        3  7297 1 1  74 TRP H    H  -6.845  -3.107   3.993 1.00 . A A .  74 TRP H    1 1 
        3  7298 1 1  74 TRP HA   H  -8.370  -5.447   4.874 1.00 . A A .  74 TRP HA   1 1 
        3  7299 1 1  74 TRP HB2  H  -5.857  -5.922   4.363 1.00 . A A .  74 TRP HB2  1 1 
        3  7300 1 1  74 TRP HB3  H  -5.565  -5.057   5.868 1.00 . A A .  74 TRP HB3  1 1 
        3  7301 1 1  74 TRP HD1  H  -7.540  -6.148   7.866 1.00 . A A .  74 TRP HD1  1 1 
        3  7302 1 1  74 TRP HE1  H  -7.641  -8.633   8.525 1.00 . A A .  74 TRP HE1  1 1 
        3  7303 1 1  74 TRP HE3  H  -5.250  -8.170   3.765 1.00 . A A .  74 TRP HE3  1 1 
        3  7304 1 1  74 TRP HH2  H  -5.745 -12.056   5.465 1.00 . A A .  74 TRP HH2  1 1 
        3  7305 1 1  74 TRP HZ2  H  -6.853 -11.121   7.450 1.00 . A A .  74 TRP HZ2  1 1 
        3  7306 1 1  74 TRP HZ3  H  -4.961 -10.611   3.660 1.00 . A A .  74 TRP HZ3  1 1 
        3  7307 1 1  74 TRP N    N  -7.346  -3.943   3.898 1.00 . A A .  74 TRP N    1 1 
        3  7308 1 1  74 TRP NE1  N  -7.245  -8.308   7.690 1.00 . A A .  74 TRP NE1  1 1 
        3  7309 1 1  74 TRP O    O  -7.178  -2.948   6.567 1.00 . A A .  74 TRP O    1 1 
        3  7310 1 1  75 LEU C    C  -9.240  -4.592   9.481 1.00 . A A .  75 LEU C    1 1 
        3  7311 1 1  75 LEU CA   C  -9.243  -3.658   8.274 1.00 . A A .  75 LEU CA   1 1 
        3  7312 1 1  75 LEU CB   C -10.627  -3.030   8.094 1.00 . A A .  75 LEU CB   1 1 
        3  7313 1 1  75 LEU CD1  C -10.476  -0.578   7.588 1.00 . A A .  75 LEU CD1  1 1 
        3  7314 1 1  75 LEU CD2  C -12.172  -1.411   9.227 1.00 . A A .  75 LEU CD2  1 1 
        3  7315 1 1  75 LEU CG   C -10.774  -1.616   8.660 1.00 . A A .  75 LEU CG   1 1 
        3  7316 1 1  75 LEU H    H  -9.339  -5.180   6.805 1.00 . A A .  75 LEU H    1 1 
        3  7317 1 1  75 LEU HA   H  -8.521  -2.872   8.443 1.00 . A A .  75 LEU HA   1 1 
        3  7318 1 1  75 LEU HB2  H -10.848  -2.996   7.037 1.00 . A A .  75 LEU HB2  1 1 
        3  7319 1 1  75 LEU HB3  H -11.357  -3.664   8.576 1.00 . A A .  75 LEU HB3  1 1 
        3  7320 1 1  75 LEU HD11 H -10.893  -0.904   6.647 1.00 . A A .  75 LEU HD11 1 1 
        3  7321 1 1  75 LEU HD12 H  -9.406  -0.463   7.488 1.00 . A A .  75 LEU HD12 1 1 
        3  7322 1 1  75 LEU HD13 H -10.916   0.367   7.870 1.00 . A A .  75 LEU HD13 1 1 
        3  7323 1 1  75 LEU HD21 H -12.164  -1.617  10.287 1.00 . A A .  75 LEU HD21 1 1 
        3  7324 1 1  75 LEU HD22 H -12.862  -2.081   8.736 1.00 . A A .  75 LEU HD22 1 1 
        3  7325 1 1  75 LEU HD23 H -12.482  -0.390   9.061 1.00 . A A .  75 LEU HD23 1 1 
        3  7326 1 1  75 LEU HG   H -10.063  -1.480   9.462 1.00 . A A .  75 LEU HG   1 1 
        3  7327 1 1  75 LEU N    N  -8.850  -4.371   7.064 1.00 . A A .  75 LEU N    1 1 
        3  7328 1 1  75 LEU O    O -10.292  -4.926  10.026 1.00 . A A .  75 LEU O    1 1 
        3  7329 1 1  76 GLY C    C  -6.495  -6.313  11.300 1.00 . A A .  76 GLY C    1 1 
        3  7330 1 1  76 GLY CA   C  -7.930  -5.905  11.032 1.00 . A A .  76 GLY CA   1 1 
        3  7331 1 1  76 GLY H    H  -7.243  -4.714   9.420 1.00 . A A .  76 GLY H    1 1 
        3  7332 1 1  76 GLY HA2  H  -8.321  -5.406  11.907 1.00 . A A .  76 GLY HA2  1 1 
        3  7333 1 1  76 GLY HA3  H  -8.515  -6.791  10.842 1.00 . A A .  76 GLY HA3  1 1 
        3  7334 1 1  76 GLY N    N  -8.048  -5.012   9.894 1.00 . A A .  76 GLY N    1 1 
        3  7335 1 1  76 GLY O    O  -5.570  -5.523  11.109 1.00 . A A .  76 GLY O    1 1 
        3  7336 1 1  77 ARG C    C  -5.001  -9.583  12.198 1.00 . A A .  77 ARG C    1 1 
        3  7337 1 1  77 ARG CA   C  -4.977  -8.065  12.043 1.00 . A A .  77 ARG CA   1 1 
        3  7338 1 1  77 ARG CB   C  -4.430  -7.418  13.317 1.00 . A A .  77 ARG CB   1 1 
        3  7339 1 1  77 ARG CD   C  -2.638  -5.947  14.287 1.00 . A A .  77 ARG CD   1 1 
        3  7340 1 1  77 ARG CG   C  -2.996  -6.933  13.185 1.00 . A A .  77 ARG CG   1 1 
        3  7341 1 1  77 ARG CZ   C  -0.689  -4.593  14.950 1.00 . A A .  77 ARG CZ   1 1 
        3  7342 1 1  77 ARG H    H  -7.086  -8.134  11.879 1.00 . A A .  77 ARG H    1 1 
        3  7343 1 1  77 ARG HA   H  -4.331  -7.811  11.216 1.00 . A A .  77 ARG HA   1 1 
        3  7344 1 1  77 ARG HB2  H  -5.051  -6.572  13.572 1.00 . A A .  77 ARG HB2  1 1 
        3  7345 1 1  77 ARG HB3  H  -4.470  -8.138  14.121 1.00 . A A .  77 ARG HB3  1 1 
        3  7346 1 1  77 ARG HD2  H  -3.205  -5.040  14.139 1.00 . A A .  77 ARG HD2  1 1 
        3  7347 1 1  77 ARG HD3  H  -2.898  -6.383  15.239 1.00 . A A .  77 ARG HD3  1 1 
        3  7348 1 1  77 ARG HE   H  -0.617  -6.197  13.767 1.00 . A A .  77 ARG HE   1 1 
        3  7349 1 1  77 ARG HG2  H  -2.330  -7.781  13.247 1.00 . A A .  77 ARG HG2  1 1 
        3  7350 1 1  77 ARG HG3  H  -2.876  -6.447  12.227 1.00 . A A .  77 ARG HG3  1 1 
        3  7351 1 1  77 ARG HH11 H  -2.451  -3.954  15.711 1.00 . A A .  77 ARG HH11 1 1 
        3  7352 1 1  77 ARG HH12 H  -1.067  -3.019  16.163 1.00 . A A .  77 ARG HH12 1 1 
        3  7353 1 1  77 ARG HH21 H   1.206  -4.969  14.362 1.00 . A A .  77 ARG HH21 1 1 
        3  7354 1 1  77 ARG HH22 H   1.010  -3.593  15.397 1.00 . A A .  77 ARG HH22 1 1 
        3  7355 1 1  77 ARG N    N  -6.309  -7.552  11.746 1.00 . A A .  77 ARG N    1 1 
        3  7356 1 1  77 ARG NE   N  -1.214  -5.621  14.288 1.00 . A A .  77 ARG NE   1 1 
        3  7357 1 1  77 ARG NH1  N  -1.467  -3.789  15.666 1.00 . A A .  77 ARG NH1  1 1 
        3  7358 1 1  77 ARG NH2  N   0.615  -4.366  14.899 1.00 . A A .  77 ARG NH2  1 1 
        3  7359 1 1  77 ARG O    O  -6.041 -10.169  12.497 1.00 . A A .  77 ARG O    1 1 
        3  7360 1 1  78 MET C    C  -4.028 -12.116  13.535 1.00 . A A .  78 MET C    1 1 
        3  7361 1 1  78 MET CA   C  -3.739 -11.663  12.109 1.00 . A A .  78 MET CA   1 1 
        3  7362 1 1  78 MET CB   C  -2.344 -12.126  11.685 1.00 . A A .  78 MET CB   1 1 
        3  7363 1 1  78 MET CE   C  -0.567 -15.836  11.192 1.00 . A A .  78 MET CE   1 1 
        3  7364 1 1  78 MET CG   C  -2.183 -13.637  11.673 1.00 . A A .  78 MET CG   1 1 
        3  7365 1 1  78 MET H    H  -3.054  -9.691  11.754 1.00 . A A .  78 MET H    1 1 
        3  7366 1 1  78 MET HA   H  -4.471 -12.105  11.448 1.00 . A A .  78 MET HA   1 1 
        3  7367 1 1  78 MET HB2  H  -2.140 -11.757  10.691 1.00 . A A .  78 MET HB2  1 1 
        3  7368 1 1  78 MET HB3  H  -1.618 -11.714  12.370 1.00 . A A .  78 MET HB3  1 1 
        3  7369 1 1  78 MET HE1  H  -1.482 -15.961  10.633 1.00 . A A .  78 MET HE1  1 1 
        3  7370 1 1  78 MET HE2  H  -0.558 -16.520  12.028 1.00 . A A .  78 MET HE2  1 1 
        3  7371 1 1  78 MET HE3  H   0.278 -16.042  10.550 1.00 . A A .  78 MET HE3  1 1 
        3  7372 1 1  78 MET HG2  H  -2.727 -14.051  12.510 1.00 . A A .  78 MET HG2  1 1 
        3  7373 1 1  78 MET HG3  H  -2.596 -14.023  10.753 1.00 . A A .  78 MET HG3  1 1 
        3  7374 1 1  78 MET N    N  -3.850 -10.213  11.991 1.00 . A A .  78 MET N    1 1 
        3  7375 1 1  78 MET O    O  -3.150 -12.085  14.396 1.00 . A A .  78 MET O    1 1 
        3  7376 1 1  78 MET SD   S  -0.460 -14.152  11.795 1.00 . A A .  78 MET SD   1 1 
        3  7377 1 1  79 ALA C    C  -6.842 -13.966  15.009 1.00 . A A .  79 ALA C    1 1 
        3  7378 1 1  79 ALA CA   C  -5.670 -12.994  15.102 1.00 . A A .  79 ALA CA   1 1 
        3  7379 1 1  79 ALA CB   C  -6.032 -11.807  15.983 1.00 . A A .  79 ALA CB   1 1 
        3  7380 1 1  79 ALA H    H  -5.921 -12.535  13.051 1.00 . A A .  79 ALA H    1 1 
        3  7381 1 1  79 ALA HA   H  -4.829 -13.502  15.550 1.00 . A A .  79 ALA HA   1 1 
        3  7382 1 1  79 ALA HB1  H  -6.312 -10.971  15.361 1.00 . A A .  79 ALA HB1  1 1 
        3  7383 1 1  79 ALA HB2  H  -5.179 -11.536  16.588 1.00 . A A .  79 ALA HB2  1 1 
        3  7384 1 1  79 ALA HB3  H  -6.859 -12.072  16.624 1.00 . A A .  79 ALA HB3  1 1 
        3  7385 1 1  79 ALA N    N  -5.265 -12.535  13.778 1.00 . A A .  79 ALA N    1 1 
        3  7386 1 1  79 ALA O    O  -7.261 -14.347  13.917 1.00 . A A .  79 ALA O    1 1 
        3  7387 1 1  80 TYR C    C  -9.696 -14.726  15.464 1.00 . A A .  80 TYR C    1 1 
        3  7388 1 1  80 TYR CA   C  -8.493 -15.288  16.215 1.00 . A A .  80 TYR CA   1 1 
        3  7389 1 1  80 TYR CB   C  -8.874 -15.579  17.667 1.00 . A A .  80 TYR CB   1 1 
        3  7390 1 1  80 TYR CD1  C  -8.336 -13.542  19.059 1.00 . A A .  80 TYR CD1  1 1 
        3  7391 1 1  80 TYR CD2  C -10.623 -13.994  18.563 1.00 . A A .  80 TYR CD2  1 1 
        3  7392 1 1  80 TYR CE1  C  -8.708 -12.416  19.770 1.00 . A A .  80 TYR CE1  1 1 
        3  7393 1 1  80 TYR CE2  C -11.003 -12.869  19.272 1.00 . A A .  80 TYR CE2  1 1 
        3  7394 1 1  80 TYR CG   C  -9.286 -14.349  18.444 1.00 . A A .  80 TYR CG   1 1 
        3  7395 1 1  80 TYR CZ   C -10.041 -12.085  19.873 1.00 . A A .  80 TYR CZ   1 1 
        3  7396 1 1  80 TYR H    H  -6.991 -14.022  17.003 1.00 . A A .  80 TYR H    1 1 
        3  7397 1 1  80 TYR HA   H  -8.185 -16.208  15.742 1.00 . A A .  80 TYR HA   1 1 
        3  7398 1 1  80 TYR HB2  H  -9.701 -16.273  17.683 1.00 . A A .  80 TYR HB2  1 1 
        3  7399 1 1  80 TYR HB3  H  -8.029 -16.024  18.173 1.00 . A A .  80 TYR HB3  1 1 
        3  7400 1 1  80 TYR HD1  H  -7.291 -13.805  18.975 1.00 . A A .  80 TYR HD1  1 1 
        3  7401 1 1  80 TYR HD2  H -11.374 -14.610  18.092 1.00 . A A .  80 TYR HD2  1 1 
        3  7402 1 1  80 TYR HE1  H  -7.954 -11.802  20.241 1.00 . A A .  80 TYR HE1  1 1 
        3  7403 1 1  80 TYR HE2  H -12.048 -12.610  19.354 1.00 . A A .  80 TYR HE2  1 1 
        3  7404 1 1  80 TYR HH   H -10.507 -10.223  19.978 1.00 . A A .  80 TYR HH   1 1 
        3  7405 1 1  80 TYR N    N  -7.368 -14.361  16.165 1.00 . A A .  80 TYR N    1 1 
        3  7406 1 1  80 TYR O    O  -9.647 -13.616  14.935 1.00 . A A .  80 TYR O    1 1 
        3  7407 1 1  80 TYR OH   O -10.416 -10.966  20.580 1.00 . A A .  80 TYR OH   1 1 
        3  7408 1 1  81 LYS C    C -12.552 -13.805  15.359 1.00 . A A .  81 LYS C    1 1 
        3  7409 1 1  81 LYS CA   C -11.991 -15.081  14.738 1.00 . A A .  81 LYS CA   1 1 
        3  7410 1 1  81 LYS CB   C -13.040 -16.195  14.788 1.00 . A A .  81 LYS CB   1 1 
        3  7411 1 1  81 LYS CD   C -14.675 -17.426  13.330 1.00 . A A .  81 LYS CD   1 1 
        3  7412 1 1  81 LYS CE   C -14.971 -17.897  11.915 1.00 . A A .  81 LYS CE   1 1 
        3  7413 1 1  81 LYS CG   C -13.261 -16.883  13.451 1.00 . A A .  81 LYS CG   1 1 
        3  7414 1 1  81 LYS H    H -10.753 -16.376  15.865 1.00 . A A .  81 LYS H    1 1 
        3  7415 1 1  81 LYS HA   H -11.739 -14.883  13.706 1.00 . A A .  81 LYS HA   1 1 
        3  7416 1 1  81 LYS HB2  H -12.724 -16.939  15.503 1.00 . A A .  81 LYS HB2  1 1 
        3  7417 1 1  81 LYS HB3  H -13.982 -15.776  15.111 1.00 . A A .  81 LYS HB3  1 1 
        3  7418 1 1  81 LYS HD2  H -14.791 -18.257  14.008 1.00 . A A .  81 LYS HD2  1 1 
        3  7419 1 1  81 LYS HD3  H -15.374 -16.643  13.592 1.00 . A A .  81 LYS HD3  1 1 
        3  7420 1 1  81 LYS HE2  H -16.005 -18.206  11.862 1.00 . A A .  81 LYS HE2  1 1 
        3  7421 1 1  81 LYS HE3  H -14.806 -17.076  11.233 1.00 . A A .  81 LYS HE3  1 1 
        3  7422 1 1  81 LYS HG2  H -13.090 -16.170  12.658 1.00 . A A .  81 LYS HG2  1 1 
        3  7423 1 1  81 LYS HG3  H -12.561 -17.701  13.359 1.00 . A A .  81 LYS HG3  1 1 
        3  7424 1 1  81 LYS HZ1  H -13.725 -18.886  10.561 1.00 . A A .  81 LYS HZ1  1 1 
        3  7425 1 1  81 LYS HZ2  H -14.654 -19.924  11.520 1.00 . A A .  81 LYS HZ2  1 1 
        3  7426 1 1  81 LYS HZ3  H -13.309 -19.138  12.180 1.00 . A A .  81 LYS HZ3  1 1 
        3  7427 1 1  81 LYS N    N -10.775 -15.501  15.423 1.00 . A A .  81 LYS N    1 1 
        3  7428 1 1  81 LYS NZ   N -14.104 -19.042  11.516 1.00 . A A .  81 LYS NZ   1 1 
        3  7429 1 1  81 LYS O    O -12.792 -13.743  16.565 1.00 . A A .  81 LYS O    1 1 
        3  7430 1 1  82 GLY C    C -14.806 -11.506  15.029 1.00 . A A .  82 GLY C    1 1 
        3  7431 1 1  82 GLY CA   C -13.290 -11.529  15.013 1.00 . A A .  82 GLY CA   1 1 
        3  7432 1 1  82 GLY H    H -12.549 -12.895  13.576 1.00 . A A .  82 GLY H    1 1 
        3  7433 1 1  82 GLY HA2  H -12.928 -11.362  16.017 1.00 . A A .  82 GLY HA2  1 1 
        3  7434 1 1  82 GLY HA3  H -12.935 -10.732  14.376 1.00 . A A .  82 GLY HA3  1 1 
        3  7435 1 1  82 GLY N    N -12.759 -12.789  14.528 1.00 . A A .  82 GLY N    1 1 
        3  7436 1 1  82 GLY O    O -15.430 -11.950  15.993 1.00 . A A .  82 GLY O    1 1 
        3  7437 1 1  83 SER C    C -17.450 -12.284  13.563 1.00 . A A .  83 SER C    1 1 
        3  7438 1 1  83 SER CA   C -16.851 -10.912  13.853 1.00 . A A .  83 SER CA   1 1 
        3  7439 1 1  83 SER CB   C -17.251  -9.926  12.753 1.00 . A A .  83 SER CB   1 1 
        3  7440 1 1  83 SER H    H -14.847 -10.653  13.223 1.00 . A A .  83 SER H    1 1 
        3  7441 1 1  83 SER HA   H -17.233 -10.557  14.798 1.00 . A A .  83 SER HA   1 1 
        3  7442 1 1  83 SER HB2  H -16.633 -10.091  11.882 1.00 . A A .  83 SER HB2  1 1 
        3  7443 1 1  83 SER HB3  H -18.287 -10.080  12.494 1.00 . A A .  83 SER HB3  1 1 
        3  7444 1 1  83 SER HG   H -17.496  -8.470  14.042 1.00 . A A .  83 SER HG   1 1 
        3  7445 1 1  83 SER N    N -15.398 -10.990  13.958 1.00 . A A .  83 SER N    1 1 
        3  7446 1 1  83 SER O    O -16.726 -13.265  13.397 1.00 . A A .  83 SER O    1 1 
        3  7447 1 1  83 SER OG   O -17.081  -8.585  13.183 1.00 . A A .  83 SER OG   1 1 
        3  7448 1 1  84 VAL C    C -20.392 -13.466  12.025 1.00 . A A .  84 VAL C    1 1 
        3  7449 1 1  84 VAL CA   C -19.472 -13.596  13.234 1.00 . A A .  84 VAL CA   1 1 
        3  7450 1 1  84 VAL CB   C -20.304 -14.049  14.449 1.00 . A A .  84 VAL CB   1 1 
        3  7451 1 1  84 VAL CG1  C -19.396 -14.469  15.594 1.00 . A A .  84 VAL CG1  1 1 
        3  7452 1 1  84 VAL CG2  C -21.251 -12.943  14.889 1.00 . A A .  84 VAL CG2  1 1 
        3  7453 1 1  84 VAL H    H -19.299 -11.527  13.645 1.00 . A A .  84 VAL H    1 1 
        3  7454 1 1  84 VAL HA   H -18.731 -14.354  13.030 1.00 . A A .  84 VAL HA   1 1 
        3  7455 1 1  84 VAL HB   H -20.897 -14.904  14.157 1.00 . A A .  84 VAL HB   1 1 
        3  7456 1 1  84 VAL HG11 H -18.413 -14.701  15.207 1.00 . A A .  84 VAL HG11 1 1 
        3  7457 1 1  84 VAL HG12 H -19.807 -15.342  16.078 1.00 . A A .  84 VAL HG12 1 1 
        3  7458 1 1  84 VAL HG13 H -19.320 -13.663  16.309 1.00 . A A .  84 VAL HG13 1 1 
        3  7459 1 1  84 VAL HG21 H -22.008 -12.796  14.134 1.00 . A A .  84 VAL HG21 1 1 
        3  7460 1 1  84 VAL HG22 H -20.697 -12.027  15.026 1.00 . A A .  84 VAL HG22 1 1 
        3  7461 1 1  84 VAL HG23 H -21.721 -13.221  15.821 1.00 . A A .  84 VAL HG23 1 1 
        3  7462 1 1  84 VAL N    N -18.777 -12.345  13.504 1.00 . A A .  84 VAL N    1 1 
        3  7463 1 1  84 VAL O    O -21.298 -12.632  12.009 1.00 . A A .  84 VAL O    1 1 
        3  7464 1 1  85 ASP C    C -20.705 -15.515   8.954 1.00 . A A .  85 ASP C    1 1 
        3  7465 1 1  85 ASP CA   C -20.959 -14.270   9.799 1.00 . A A .  85 ASP CA   1 1 
        3  7466 1 1  85 ASP CB   C -20.651 -13.013   8.983 1.00 . A A .  85 ASP CB   1 1 
        3  7467 1 1  85 ASP CG   C -19.177 -12.880   8.659 1.00 . A A .  85 ASP CG   1 1 
        3  7468 1 1  85 ASP H    H -19.415 -14.935  11.086 1.00 . A A .  85 ASP H    1 1 
        3  7469 1 1  85 ASP HA   H -21.999 -14.254  10.091 1.00 . A A .  85 ASP HA   1 1 
        3  7470 1 1  85 ASP HB2  H -21.203 -13.051   8.055 1.00 . A A .  85 ASP HB2  1 1 
        3  7471 1 1  85 ASP HB3  H -20.959 -12.143   9.544 1.00 . A A .  85 ASP HB3  1 1 
        3  7472 1 1  85 ASP N    N -20.152 -14.293  11.014 1.00 . A A .  85 ASP N    1 1 
        3  7473 1 1  85 ASP O    O -19.709 -16.212   9.143 1.00 . A A .  85 ASP O    1 1 
        3  7474 1 1  85 ASP OD1  O -18.422 -12.382   9.520 1.00 . A A .  85 ASP OD1  1 1 
        3  7475 1 1  85 ASP OD2  O -18.777 -13.273   7.543 1.00 . A A .  85 ASP OD2  1 1 
        3  7476 1 1  86 ASN C    C -21.779 -16.569   5.698 1.00 . A A .  86 ASN C    1 1 
        3  7477 1 1  86 ASN CA   C -21.486 -16.945   7.147 1.00 . A A .  86 ASN CA   1 1 
        3  7478 1 1  86 ASN CB   C -22.434 -18.057   7.600 1.00 . A A .  86 ASN CB   1 1 
        3  7479 1 1  86 ASN CG   C -21.786 -19.427   7.551 1.00 . A A .  86 ASN CG   1 1 
        3  7480 1 1  86 ASN H    H -22.385 -15.191   7.919 1.00 . A A .  86 ASN H    1 1 
        3  7481 1 1  86 ASN HA   H -20.470 -17.302   7.215 1.00 . A A .  86 ASN HA   1 1 
        3  7482 1 1  86 ASN HB2  H -22.746 -17.863   8.616 1.00 . A A .  86 ASN HB2  1 1 
        3  7483 1 1  86 ASN HB3  H -23.303 -18.067   6.958 1.00 . A A .  86 ASN HB3  1 1 
        3  7484 1 1  86 ASN HD21 H -22.638 -19.920   9.278 1.00 . A A .  86 ASN HD21 1 1 
        3  7485 1 1  86 ASN HD22 H -21.641 -21.134   8.558 1.00 . A A .  86 ASN HD22 1 1 
        3  7486 1 1  86 ASN N    N -21.612 -15.785   8.021 1.00 . A A .  86 ASN N    1 1 
        3  7487 1 1  86 ASN ND2  N -22.048 -20.243   8.565 1.00 . A A .  86 ASN ND2  1 1 
        3  7488 1 1  86 ASN O    O -22.705 -15.808   5.419 1.00 . A A .  86 ASN O    1 1 
        3  7489 1 1  86 ASN OD1  O -21.057 -19.747   6.612 1.00 . A A .  86 ASN OD1  1 1 
        3  7490 1 1  87 GLY C    C -19.891 -16.378   2.692 1.00 . A A .  87 GLY C    1 1 
        3  7491 1 1  87 GLY CA   C -21.172 -16.818   3.370 1.00 . A A .  87 GLY CA   1 1 
        3  7492 1 1  87 GLY H    H -20.262 -17.708   5.062 1.00 . A A .  87 GLY H    1 1 
        3  7493 1 1  87 GLY HA2  H -21.541 -17.705   2.879 1.00 . A A .  87 GLY HA2  1 1 
        3  7494 1 1  87 GLY HA3  H -21.907 -16.033   3.272 1.00 . A A .  87 GLY HA3  1 1 
        3  7495 1 1  87 GLY N    N -20.983 -17.107   4.780 1.00 . A A .  87 GLY N    1 1 
        3  7496 1 1  87 GLY O    O -19.107 -17.208   2.232 1.00 . A A .  87 GLY O    1 1 
        3  7497 1 1  88 ALA C    C -17.230 -14.880   2.791 1.00 . A A .  88 ALA C    1 1 
        3  7498 1 1  88 ALA CA   C -18.481 -14.518   1.999 1.00 . A A .  88 ALA CA   1 1 
        3  7499 1 1  88 ALA CB   C -18.605 -13.008   1.864 1.00 . A A .  88 ALA CB   1 1 
        3  7500 1 1  88 ALA H    H -20.339 -14.455   3.012 1.00 . A A .  88 ALA H    1 1 
        3  7501 1 1  88 ALA HA   H -18.403 -14.940   1.008 1.00 . A A .  88 ALA HA   1 1 
        3  7502 1 1  88 ALA HB1  H -17.620 -12.568   1.829 1.00 . A A .  88 ALA HB1  1 1 
        3  7503 1 1  88 ALA HB2  H -19.146 -12.613   2.711 1.00 . A A .  88 ALA HB2  1 1 
        3  7504 1 1  88 ALA HB3  H -19.136 -12.770   0.953 1.00 . A A .  88 ALA HB3  1 1 
        3  7505 1 1  88 ALA N    N -19.677 -15.067   2.627 1.00 . A A .  88 ALA N    1 1 
        3  7506 1 1  88 ALA O    O -16.146 -15.030   2.225 1.00 . A A .  88 ALA O    1 1 
        3  7507 1 1  89 PHE C    C -15.175 -14.298   4.905 1.00 . A A .  89 PHE C    1 1 
        3  7508 1 1  89 PHE CA   C -16.266 -15.363   4.973 1.00 . A A .  89 PHE CA   1 1 
        3  7509 1 1  89 PHE CB   C -15.691 -16.724   4.584 1.00 . A A .  89 PHE CB   1 1 
        3  7510 1 1  89 PHE CD1  C -15.548 -17.777   6.857 1.00 . A A .  89 PHE CD1  1 1 
        3  7511 1 1  89 PHE CD2  C -13.556 -17.619   5.555 1.00 . A A .  89 PHE CD2  1 1 
        3  7512 1 1  89 PHE CE1  C -14.838 -18.386   7.874 1.00 . A A .  89 PHE CE1  1 1 
        3  7513 1 1  89 PHE CE2  C -12.840 -18.227   6.569 1.00 . A A .  89 PHE CE2  1 1 
        3  7514 1 1  89 PHE CG   C -14.916 -17.387   5.687 1.00 . A A .  89 PHE CG   1 1 
        3  7515 1 1  89 PHE CZ   C -13.483 -18.612   7.730 1.00 . A A .  89 PHE CZ   1 1 
        3  7516 1 1  89 PHE H    H -18.272 -14.885   4.496 1.00 . A A .  89 PHE H    1 1 
        3  7517 1 1  89 PHE HA   H -16.637 -15.415   5.987 1.00 . A A .  89 PHE HA   1 1 
        3  7518 1 1  89 PHE HB2  H -16.499 -17.384   4.305 1.00 . A A .  89 PHE HB2  1 1 
        3  7519 1 1  89 PHE HB3  H -15.028 -16.599   3.740 1.00 . A A .  89 PHE HB3  1 1 
        3  7520 1 1  89 PHE HD1  H -16.607 -17.602   6.972 1.00 . A A .  89 PHE HD1  1 1 
        3  7521 1 1  89 PHE HD2  H -13.054 -17.317   4.647 1.00 . A A .  89 PHE HD2  1 1 
        3  7522 1 1  89 PHE HE1  H -15.342 -18.686   8.781 1.00 . A A .  89 PHE HE1  1 1 
        3  7523 1 1  89 PHE HE2  H -11.781 -18.403   6.453 1.00 . A A .  89 PHE HE2  1 1 
        3  7524 1 1  89 PHE HZ   H -12.926 -19.087   8.523 1.00 . A A .  89 PHE HZ   1 1 
        3  7525 1 1  89 PHE N    N -17.384 -15.018   4.104 1.00 . A A .  89 PHE N    1 1 
        3  7526 1 1  89 PHE O    O -14.317 -14.330   4.024 1.00 . A A .  89 PHE O    1 1 
        3  7527 1 1  90 LYS C    C -14.264 -11.455   4.610 1.00 . A A .  90 LYS C    1 1 
        3  7528 1 1  90 LYS CA   C -14.228 -12.284   5.891 1.00 . A A .  90 LYS CA   1 1 
        3  7529 1 1  90 LYS CB   C -12.827 -12.860   6.102 1.00 . A A .  90 LYS CB   1 1 
        3  7530 1 1  90 LYS CD   C -11.731 -12.763   8.364 1.00 . A A .  90 LYS CD   1 1 
        3  7531 1 1  90 LYS CE   C -12.909 -12.600   9.310 1.00 . A A .  90 LYS CE   1 1 
        3  7532 1 1  90 LYS CG   C -11.967 -12.037   7.049 1.00 . A A .  90 LYS CG   1 1 
        3  7533 1 1  90 LYS H    H -15.923 -13.385   6.520 1.00 . A A .  90 LYS H    1 1 
        3  7534 1 1  90 LYS HA   H -14.475 -11.644   6.726 1.00 . A A .  90 LYS HA   1 1 
        3  7535 1 1  90 LYS HB2  H -12.918 -13.858   6.505 1.00 . A A .  90 LYS HB2  1 1 
        3  7536 1 1  90 LYS HB3  H -12.323 -12.911   5.148 1.00 . A A .  90 LYS HB3  1 1 
        3  7537 1 1  90 LYS HD2  H -11.586 -13.815   8.163 1.00 . A A .  90 LYS HD2  1 1 
        3  7538 1 1  90 LYS HD3  H -10.845 -12.358   8.833 1.00 . A A .  90 LYS HD3  1 1 
        3  7539 1 1  90 LYS HE2  H -13.092 -11.547   9.460 1.00 . A A .  90 LYS HE2  1 1 
        3  7540 1 1  90 LYS HE3  H -13.780 -13.055   8.862 1.00 . A A .  90 LYS HE3  1 1 
        3  7541 1 1  90 LYS HG2  H -11.014 -11.844   6.581 1.00 . A A .  90 LYS HG2  1 1 
        3  7542 1 1  90 LYS HG3  H -12.467 -11.101   7.251 1.00 . A A .  90 LYS HG3  1 1 
        3  7543 1 1  90 LYS HZ1  H -13.253 -12.805  11.361 1.00 . A A .  90 LYS HZ1  1 1 
        3  7544 1 1  90 LYS HZ2  H -11.656 -13.119  10.899 1.00 . A A .  90 LYS HZ2  1 1 
        3  7545 1 1  90 LYS HZ3  H -12.867 -14.257  10.584 1.00 . A A .  90 LYS HZ3  1 1 
        3  7546 1 1  90 LYS N    N -15.215 -13.357   5.844 1.00 . A A .  90 LYS N    1 1 
        3  7547 1 1  90 LYS NZ   N -12.654 -13.240  10.631 1.00 . A A .  90 LYS NZ   1 1 
        3  7548 1 1  90 LYS O    O -15.083 -11.699   3.723 1.00 . A A .  90 LYS O    1 1 
        3  7549 1 1  91 ALA C    C -11.852  -9.335   2.956 1.00 . A A .  91 ALA C    1 1 
        3  7550 1 1  91 ALA CA   C -13.300  -9.610   3.349 1.00 . A A .  91 ALA CA   1 1 
        3  7551 1 1  91 ALA CB   C -14.036  -8.306   3.610 1.00 . A A .  91 ALA CB   1 1 
        3  7552 1 1  91 ALA H    H -12.744 -10.330   5.260 1.00 . A A .  91 ALA H    1 1 
        3  7553 1 1  91 ALA HA   H -13.793 -10.116   2.531 1.00 . A A .  91 ALA HA   1 1 
        3  7554 1 1  91 ALA HB1  H -15.058  -8.397   3.281 1.00 . A A .  91 ALA HB1  1 1 
        3  7555 1 1  91 ALA HB2  H -13.552  -7.506   3.067 1.00 . A A .  91 ALA HB2  1 1 
        3  7556 1 1  91 ALA HB3  H -14.014  -8.086   4.667 1.00 . A A .  91 ALA HB3  1 1 
        3  7557 1 1  91 ALA N    N -13.370 -10.475   4.520 1.00 . A A .  91 ALA N    1 1 
        3  7558 1 1  91 ALA O    O -10.936  -9.509   3.760 1.00 . A A .  91 ALA O    1 1 
        3  7559 1 1  92 GLN C    C -10.391  -7.659   0.018 1.00 . A A .  92 GLN C    1 1 
        3  7560 1 1  92 GLN CA   C -10.317  -8.601   1.214 1.00 . A A .  92 GLN CA   1 1 
        3  7561 1 1  92 GLN CB   C  -9.592  -9.891   0.821 1.00 . A A .  92 GLN CB   1 1 
        3  7562 1 1  92 GLN CD   C  -7.959 -11.691   1.508 1.00 . A A .  92 GLN CD   1 1 
        3  7563 1 1  92 GLN CG   C  -8.802 -10.516   1.959 1.00 . A A .  92 GLN CG   1 1 
        3  7564 1 1  92 GLN H    H -12.424  -8.782   1.120 1.00 . A A .  92 GLN H    1 1 
        3  7565 1 1  92 GLN HA   H  -9.766  -8.117   2.007 1.00 . A A .  92 GLN HA   1 1 
        3  7566 1 1  92 GLN HB2  H -10.323 -10.610   0.481 1.00 . A A .  92 GLN HB2  1 1 
        3  7567 1 1  92 GLN HB3  H  -8.910  -9.675   0.013 1.00 . A A .  92 GLN HB3  1 1 
        3  7568 1 1  92 GLN HE21 H  -6.966 -11.670   3.231 1.00 . A A .  92 GLN HE21 1 1 
        3  7569 1 1  92 GLN HE22 H  -6.484 -12.885   2.101 1.00 . A A .  92 GLN HE22 1 1 
        3  7570 1 1  92 GLN HG2  H  -8.151  -9.766   2.382 1.00 . A A .  92 GLN HG2  1 1 
        3  7571 1 1  92 GLN HG3  H  -9.495 -10.856   2.715 1.00 . A A .  92 GLN HG3  1 1 
        3  7572 1 1  92 GLN N    N -11.653  -8.904   1.714 1.00 . A A .  92 GLN N    1 1 
        3  7573 1 1  92 GLN NE2  N  -7.043 -12.126   2.365 1.00 . A A .  92 GLN NE2  1 1 
        3  7574 1 1  92 GLN O    O -11.077  -7.941  -0.964 1.00 . A A .  92 GLN O    1 1 
        3  7575 1 1  92 GLN OE1  O  -8.127 -12.202   0.401 1.00 . A A .  92 GLN OE1  1 1 
        3  7576 1 1  93 GLY C    C  -8.479  -5.668  -1.871 1.00 . A A .  93 GLY C    1 1 
        3  7577 1 1  93 GLY CA   C  -9.697  -5.571  -0.976 1.00 . A A .  93 GLY CA   1 1 
        3  7578 1 1  93 GLY H    H  -9.159  -6.357   0.917 1.00 . A A .  93 GLY H    1 1 
        3  7579 1 1  93 GLY HA2  H -10.581  -5.736  -1.575 1.00 . A A .  93 GLY HA2  1 1 
        3  7580 1 1  93 GLY HA3  H  -9.744  -4.578  -0.556 1.00 . A A .  93 GLY HA3  1 1 
        3  7581 1 1  93 GLY N    N  -9.686  -6.535   0.107 1.00 . A A .  93 GLY N    1 1 
        3  7582 1 1  93 GLY O    O  -7.367  -5.907  -1.398 1.00 . A A .  93 GLY O    1 1 
        3  7583 1 1  94 VAL C    C  -7.582  -4.238  -4.967 1.00 . A A .  94 VAL C    1 1 
        3  7584 1 1  94 VAL CA   C  -7.611  -5.523  -4.146 1.00 . A A .  94 VAL CA   1 1 
        3  7585 1 1  94 VAL CB   C  -7.751  -6.733  -5.097 1.00 . A A .  94 VAL CB   1 1 
        3  7586 1 1  94 VAL CG1  C  -6.945  -7.916  -4.582 1.00 . A A .  94 VAL CG1  1 1 
        3  7587 1 1  94 VAL CG2  C  -9.211  -7.121  -5.276 1.00 . A A .  94 VAL CG2  1 1 
        3  7588 1 1  94 VAL H    H  -9.602  -5.277  -3.476 1.00 . A A .  94 VAL H    1 1 
        3  7589 1 1  94 VAL HA   H  -6.678  -5.616  -3.608 1.00 . A A .  94 VAL HA   1 1 
        3  7590 1 1  94 VAL HB   H  -7.354  -6.453  -6.062 1.00 . A A .  94 VAL HB   1 1 
        3  7591 1 1  94 VAL HG11 H  -7.026  -7.966  -3.506 1.00 . A A .  94 VAL HG11 1 1 
        3  7592 1 1  94 VAL HG12 H  -5.908  -7.795  -4.860 1.00 . A A .  94 VAL HG12 1 1 
        3  7593 1 1  94 VAL HG13 H  -7.330  -8.828  -5.014 1.00 . A A .  94 VAL HG13 1 1 
        3  7594 1 1  94 VAL HG21 H  -9.279  -7.980  -5.926 1.00 . A A .  94 VAL HG21 1 1 
        3  7595 1 1  94 VAL HG22 H  -9.752  -6.295  -5.714 1.00 . A A .  94 VAL HG22 1 1 
        3  7596 1 1  94 VAL HG23 H  -9.641  -7.363  -4.314 1.00 . A A .  94 VAL HG23 1 1 
        3  7597 1 1  94 VAL N    N  -8.691  -5.470  -3.168 1.00 . A A .  94 VAL N    1 1 
        3  7598 1 1  94 VAL O    O  -8.573  -3.873  -5.599 1.00 . A A .  94 VAL O    1 1 
        3  7599 1 1  95 GLN C    C  -5.386  -2.441  -6.879 1.00 . A A .  95 GLN C    1 1 
        3  7600 1 1  95 GLN CA   C  -6.307  -2.290  -5.672 1.00 . A A .  95 GLN CA   1 1 
        3  7601 1 1  95 GLN CB   C  -5.770  -1.198  -4.746 1.00 . A A .  95 GLN CB   1 1 
        3  7602 1 1  95 GLN CD   C  -6.539  -0.422  -2.467 1.00 . A A .  95 GLN CD   1 1 
        3  7603 1 1  95 GLN CG   C  -6.853  -0.487  -3.949 1.00 . A A .  95 GLN CG   1 1 
        3  7604 1 1  95 GLN H    H  -5.695  -3.876  -4.410 1.00 . A A .  95 GLN H    1 1 
        3  7605 1 1  95 GLN HA   H  -7.288  -1.998  -6.020 1.00 . A A .  95 GLN HA   1 1 
        3  7606 1 1  95 GLN HB2  H  -5.073  -1.643  -4.051 1.00 . A A .  95 GLN HB2  1 1 
        3  7607 1 1  95 GLN HB3  H  -5.250  -0.460  -5.340 1.00 . A A .  95 GLN HB3  1 1 
        3  7608 1 1  95 GLN HE21 H  -7.733   1.155  -2.260 1.00 . A A .  95 GLN HE21 1 1 
        3  7609 1 1  95 GLN HE22 H  -6.950   0.612  -0.819 1.00 . A A .  95 GLN HE22 1 1 
        3  7610 1 1  95 GLN HG2  H  -6.954   0.520  -4.324 1.00 . A A .  95 GLN HG2  1 1 
        3  7611 1 1  95 GLN HG3  H  -7.785  -1.018  -4.083 1.00 . A A .  95 GLN HG3  1 1 
        3  7612 1 1  95 GLN N    N  -6.448  -3.544  -4.942 1.00 . A A .  95 GLN N    1 1 
        3  7613 1 1  95 GLN NE2  N  -7.133   0.546  -1.779 1.00 . A A .  95 GLN NE2  1 1 
        3  7614 1 1  95 GLN O    O  -4.358  -3.114  -6.813 1.00 . A A .  95 GLN O    1 1 
        3  7615 1 1  95 GLN OE1  O  -5.773  -1.232  -1.946 1.00 . A A .  95 GLN OE1  1 1 
        3  7616 1 1  96 LEU C    C  -4.739  -0.407  -9.702 1.00 . A A .  96 LEU C    1 1 
        3  7617 1 1  96 LEU CA   C  -4.986  -1.828  -9.208 1.00 . A A .  96 LEU CA   1 1 
        3  7618 1 1  96 LEU CB   C  -5.725  -2.644 -10.276 1.00 . A A .  96 LEU CB   1 1 
        3  7619 1 1  96 LEU CD1  C  -5.119  -3.929 -12.346 1.00 . A A .  96 LEU CD1  1 1 
        3  7620 1 1  96 LEU CD2  C  -5.949  -1.576 -12.535 1.00 . A A .  96 LEU CD2  1 1 
        3  7621 1 1  96 LEU CG   C  -5.144  -2.555 -11.692 1.00 . A A .  96 LEU CG   1 1 
        3  7622 1 1  96 LEU H    H  -6.593  -1.266  -7.955 1.00 . A A .  96 LEU H    1 1 
        3  7623 1 1  96 LEU HA   H  -4.038  -2.298  -8.993 1.00 . A A .  96 LEU HA   1 1 
        3  7624 1 1  96 LEU HB2  H  -5.718  -3.681  -9.972 1.00 . A A .  96 LEU HB2  1 1 
        3  7625 1 1  96 LEU HB3  H  -6.749  -2.305 -10.310 1.00 . A A .  96 LEU HB3  1 1 
        3  7626 1 1  96 LEU HD11 H  -4.789  -4.664 -11.629 1.00 . A A .  96 LEU HD11 1 1 
        3  7627 1 1  96 LEU HD12 H  -4.440  -3.914 -13.187 1.00 . A A .  96 LEU HD12 1 1 
        3  7628 1 1  96 LEU HD13 H  -6.112  -4.181 -12.691 1.00 . A A .  96 LEU HD13 1 1 
        3  7629 1 1  96 LEU HD21 H  -6.983  -1.885 -12.556 1.00 . A A .  96 LEU HD21 1 1 
        3  7630 1 1  96 LEU HD22 H  -5.557  -1.563 -13.542 1.00 . A A .  96 LEU HD22 1 1 
        3  7631 1 1  96 LEU HD23 H  -5.877  -0.588 -12.107 1.00 . A A .  96 LEU HD23 1 1 
        3  7632 1 1  96 LEU HG   H  -4.127  -2.193 -11.634 1.00 . A A .  96 LEU HG   1 1 
        3  7633 1 1  96 LEU N    N  -5.766  -1.793  -7.977 1.00 . A A .  96 LEU N    1 1 
        3  7634 1 1  96 LEU O    O  -5.680   0.316 -10.027 1.00 . A A .  96 LEU O    1 1 
        3  7635 1 1  97 THR C    C  -1.719   1.427 -10.735 1.00 . A A .  97 THR C    1 1 
        3  7636 1 1  97 THR CA   C  -3.133   1.352 -10.169 1.00 . A A .  97 THR CA   1 1 
        3  7637 1 1  97 THR CB   C  -3.268   2.325  -8.996 1.00 . A A .  97 THR CB   1 1 
        3  7638 1 1  97 THR CG2  C  -2.705   1.784  -7.697 1.00 . A A .  97 THR CG2  1 1 
        3  7639 1 1  97 THR H    H  -2.757  -0.607  -9.452 1.00 . A A .  97 THR H    1 1 
        3  7640 1 1  97 THR HA   H  -3.831   1.638 -10.940 1.00 . A A .  97 THR HA   1 1 
        3  7641 1 1  97 THR HB   H  -4.314   2.542  -8.837 1.00 . A A .  97 THR HB   1 1 
        3  7642 1 1  97 THR HG1  H  -2.843   4.200  -8.618 1.00 . A A .  97 THR HG1  1 1 
        3  7643 1 1  97 THR HG21 H  -3.388   2.004  -6.890 1.00 . A A .  97 THR HG21 1 1 
        3  7644 1 1  97 THR HG22 H  -1.751   2.249  -7.496 1.00 . A A .  97 THR HG22 1 1 
        3  7645 1 1  97 THR HG23 H  -2.575   0.715  -7.776 1.00 . A A .  97 THR HG23 1 1 
        3  7646 1 1  97 THR N    N  -3.473   0.002  -9.736 1.00 . A A .  97 THR N    1 1 
        3  7647 1 1  97 THR O    O  -0.904   0.529 -10.527 1.00 . A A .  97 THR O    1 1 
        3  7648 1 1  97 THR OG1  O  -2.598   3.542  -9.272 1.00 . A A .  97 THR OG1  1 1 
        3  7649 1 1  98 ALA C    C   0.686   3.695 -11.163 1.00 . A A .  98 ALA C    1 1 
        3  7650 1 1  98 ALA CA   C  -0.127   2.740 -12.029 1.00 . A A .  98 ALA CA   1 1 
        3  7651 1 1  98 ALA CB   C  -0.263   3.283 -13.442 1.00 . A A .  98 ALA CB   1 1 
        3  7652 1 1  98 ALA H    H  -2.136   3.199 -11.557 1.00 . A A .  98 ALA H    1 1 
        3  7653 1 1  98 ALA HA   H   0.383   1.788 -12.076 1.00 . A A .  98 ALA HA   1 1 
        3  7654 1 1  98 ALA HB1  H   0.719   3.400 -13.879 1.00 . A A .  98 ALA HB1  1 1 
        3  7655 1 1  98 ALA HB2  H  -0.759   4.242 -13.413 1.00 . A A .  98 ALA HB2  1 1 
        3  7656 1 1  98 ALA HB3  H  -0.843   2.597 -14.038 1.00 . A A .  98 ALA HB3  1 1 
        3  7657 1 1  98 ALA N    N  -1.440   2.518 -11.440 1.00 . A A .  98 ALA N    1 1 
        3  7658 1 1  98 ALA O    O   0.235   4.799 -10.853 1.00 . A A .  98 ALA O    1 1 
        3  7659 1 1  99 LYS C    C   3.872   4.711 -10.718 1.00 . A A .  99 LYS C    1 1 
        3  7660 1 1  99 LYS CA   C   2.741   4.072  -9.918 1.00 . A A .  99 LYS CA   1 1 
        3  7661 1 1  99 LYS CB   C   3.324   3.224  -8.785 1.00 . A A .  99 LYS CB   1 1 
        3  7662 1 1  99 LYS CD   C   5.364   3.538  -7.346 1.00 . A A .  99 LYS CD   1 1 
        3  7663 1 1  99 LYS CE   C   6.413   4.130  -8.273 1.00 . A A .  99 LYS CE   1 1 
        3  7664 1 1  99 LYS CG   C   3.971   4.047  -7.682 1.00 . A A .  99 LYS CG   1 1 
        3  7665 1 1  99 LYS H    H   2.173   2.367 -11.033 1.00 . A A .  99 LYS H    1 1 
        3  7666 1 1  99 LYS HA   H   2.138   4.858  -9.487 1.00 . A A .  99 LYS HA   1 1 
        3  7667 1 1  99 LYS HB2  H   2.531   2.637  -8.348 1.00 . A A .  99 LYS HB2  1 1 
        3  7668 1 1  99 LYS HB3  H   4.069   2.560  -9.197 1.00 . A A .  99 LYS HB3  1 1 
        3  7669 1 1  99 LYS HD2  H   5.602   3.811  -6.330 1.00 . A A .  99 LYS HD2  1 1 
        3  7670 1 1  99 LYS HD3  H   5.376   2.461  -7.444 1.00 . A A .  99 LYS HD3  1 1 
        3  7671 1 1  99 LYS HE2  H   5.921   4.510  -9.157 1.00 . A A .  99 LYS HE2  1 1 
        3  7672 1 1  99 LYS HE3  H   6.909   4.942  -7.762 1.00 . A A .  99 LYS HE3  1 1 
        3  7673 1 1  99 LYS HG2  H   4.044   5.074  -8.008 1.00 . A A .  99 LYS HG2  1 1 
        3  7674 1 1  99 LYS HG3  H   3.354   3.992  -6.797 1.00 . A A .  99 LYS HG3  1 1 
        3  7675 1 1  99 LYS HZ1  H   8.364   3.569  -8.761 1.00 . A A .  99 LYS HZ1  1 1 
        3  7676 1 1  99 LYS HZ2  H   7.174   2.709  -9.601 1.00 . A A .  99 LYS HZ2  1 1 
        3  7677 1 1  99 LYS HZ3  H   7.480   2.361  -7.974 1.00 . A A .  99 LYS HZ3  1 1 
        3  7678 1 1  99 LYS N    N   1.875   3.260 -10.763 1.00 . A A .  99 LYS N    1 1 
        3  7679 1 1  99 LYS NZ   N   7.429   3.122  -8.680 1.00 . A A .  99 LYS NZ   1 1 
        3  7680 1 1  99 LYS O    O   4.553   4.044 -11.500 1.00 . A A .  99 LYS O    1 1 
        3  7681 1 1 100 LEU C    C   5.868   7.641 -10.188 1.00 . A A . 100 LEU C    1 1 
        3  7682 1 1 100 LEU CA   C   5.122   6.753 -11.180 1.00 . A A . 100 LEU CA   1 1 
        3  7683 1 1 100 LEU CB   C   4.537   7.603 -12.314 1.00 . A A . 100 LEU CB   1 1 
        3  7684 1 1 100 LEU CD1  C   4.609  10.030 -11.678 1.00 . A A . 100 LEU CD1  1 1 
        3  7685 1 1 100 LEU CD2  C   2.618   9.113 -12.880 1.00 . A A . 100 LEU CD2  1 1 
        3  7686 1 1 100 LEU CG   C   3.714   8.814 -11.868 1.00 . A A . 100 LEU CG   1 1 
        3  7687 1 1 100 LEU H    H   3.495   6.476  -9.858 1.00 . A A . 100 LEU H    1 1 
        3  7688 1 1 100 LEU HA   H   5.817   6.039 -11.598 1.00 . A A . 100 LEU HA   1 1 
        3  7689 1 1 100 LEU HB2  H   5.353   7.955 -12.928 1.00 . A A . 100 LEU HB2  1 1 
        3  7690 1 1 100 LEU HB3  H   3.903   6.970 -12.918 1.00 . A A . 100 LEU HB3  1 1 
        3  7691 1 1 100 LEU HD11 H   4.536  10.669 -12.546 1.00 . A A . 100 LEU HD11 1 1 
        3  7692 1 1 100 LEU HD12 H   5.633   9.709 -11.555 1.00 . A A . 100 LEU HD12 1 1 
        3  7693 1 1 100 LEU HD13 H   4.295  10.576 -10.801 1.00 . A A . 100 LEU HD13 1 1 
        3  7694 1 1 100 LEU HD21 H   3.065   9.384 -13.824 1.00 . A A . 100 LEU HD21 1 1 
        3  7695 1 1 100 LEU HD22 H   2.011   9.933 -12.522 1.00 . A A . 100 LEU HD22 1 1 
        3  7696 1 1 100 LEU HD23 H   1.999   8.239 -13.011 1.00 . A A . 100 LEU HD23 1 1 
        3  7697 1 1 100 LEU HG   H   3.245   8.594 -10.920 1.00 . A A . 100 LEU HG   1 1 
        3  7698 1 1 100 LEU N    N   4.069   6.008 -10.501 1.00 . A A . 100 LEU N    1 1 
        3  7699 1 1 100 LEU O    O   5.259   8.454  -9.489 1.00 . A A . 100 LEU O    1 1 
        3  7700 1 1 101 GLY C    C   9.435   8.374  -9.622 1.00 . A A . 101 GLY C    1 1 
        3  7701 1 1 101 GLY CA   C   7.984   8.263  -9.197 1.00 . A A . 101 GLY CA   1 1 
        3  7702 1 1 101 GLY H    H   7.619   6.804 -10.690 1.00 . A A . 101 GLY H    1 1 
        3  7703 1 1 101 GLY HA2  H   7.563   9.255  -9.135 1.00 . A A . 101 GLY HA2  1 1 
        3  7704 1 1 101 GLY HA3  H   7.942   7.805  -8.220 1.00 . A A . 101 GLY HA3  1 1 
        3  7705 1 1 101 GLY N    N   7.186   7.472 -10.118 1.00 . A A . 101 GLY N    1 1 
        3  7706 1 1 101 GLY O    O   9.817   7.894 -10.691 1.00 . A A . 101 GLY O    1 1 
        3  7707 1 1 102 TYR C    C  12.431   9.634  -7.826 1.00 . A A . 102 TYR C    1 1 
        3  7708 1 1 102 TYR CA   C  11.667   9.188  -9.074 1.00 . A A . 102 TYR CA   1 1 
        3  7709 1 1 102 TYR CB   C  11.855  10.217 -10.193 1.00 . A A . 102 TYR CB   1 1 
        3  7710 1 1 102 TYR CD1  C  12.814   8.488 -11.766 1.00 . A A . 102 TYR CD1  1 1 
        3  7711 1 1 102 TYR CD2  C  11.352  10.143 -12.666 1.00 . A A . 102 TYR CD2  1 1 
        3  7712 1 1 102 TYR CE1  C  12.958   7.928 -13.023 1.00 . A A . 102 TYR CE1  1 1 
        3  7713 1 1 102 TYR CE2  C  11.491   9.588 -13.924 1.00 . A A . 102 TYR CE2  1 1 
        3  7714 1 1 102 TYR CG   C  12.009   9.603 -11.566 1.00 . A A . 102 TYR CG   1 1 
        3  7715 1 1 102 TYR CZ   C  12.294   8.481 -14.096 1.00 . A A . 102 TYR CZ   1 1 
        3  7716 1 1 102 TYR H    H   9.883   9.373  -7.947 1.00 . A A . 102 TYR H    1 1 
        3  7717 1 1 102 TYR HA   H  12.059   8.238  -9.401 1.00 . A A . 102 TYR HA   1 1 
        3  7718 1 1 102 TYR HB2  H  10.996  10.870 -10.218 1.00 . A A . 102 TYR HB2  1 1 
        3  7719 1 1 102 TYR HB3  H  12.740  10.802  -9.989 1.00 . A A . 102 TYR HB3  1 1 
        3  7720 1 1 102 TYR HD1  H  13.332   8.056 -10.923 1.00 . A A . 102 TYR HD1  1 1 
        3  7721 1 1 102 TYR HD2  H  10.723  11.009 -12.526 1.00 . A A . 102 TYR HD2  1 1 
        3  7722 1 1 102 TYR HE1  H  13.587   7.061 -13.156 1.00 . A A . 102 TYR HE1  1 1 
        3  7723 1 1 102 TYR HE2  H  10.971  10.022 -14.765 1.00 . A A . 102 TYR HE2  1 1 
        3  7724 1 1 102 TYR HH   H  11.590   7.935 -15.800 1.00 . A A . 102 TYR HH   1 1 
        3  7725 1 1 102 TYR N    N  10.247   9.012  -8.783 1.00 . A A . 102 TYR N    1 1 
        3  7726 1 1 102 TYR O    O  11.839  10.149  -6.879 1.00 . A A . 102 TYR O    1 1 
        3  7727 1 1 102 TYR OH   O  12.436   7.927 -15.348 1.00 . A A . 102 TYR OH   1 1 
        3  7728 1 1 103 PRO C    C  14.803  11.341  -6.597 1.00 . A A . 103 PRO C    1 1 
        3  7729 1 1 103 PRO CA   C  14.606   9.831  -6.677 1.00 . A A . 103 PRO CA   1 1 
        3  7730 1 1 103 PRO CB   C  15.933   9.131  -6.972 1.00 . A A . 103 PRO CB   1 1 
        3  7731 1 1 103 PRO CD   C  14.550   8.836  -8.904 1.00 . A A . 103 PRO CD   1 1 
        3  7732 1 1 103 PRO CG   C  15.976   9.020  -8.457 1.00 . A A . 103 PRO CG   1 1 
        3  7733 1 1 103 PRO HA   H  14.204   9.472  -5.743 1.00 . A A . 103 PRO HA   1 1 
        3  7734 1 1 103 PRO HB2  H  16.751   9.730  -6.596 1.00 . A A . 103 PRO HB2  1 1 
        3  7735 1 1 103 PRO HB3  H  15.944   8.161  -6.503 1.00 . A A . 103 PRO HB3  1 1 
        3  7736 1 1 103 PRO HD2  H  14.379   9.356  -9.836 1.00 . A A . 103 PRO HD2  1 1 
        3  7737 1 1 103 PRO HD3  H  14.319   7.788  -9.008 1.00 . A A . 103 PRO HD3  1 1 
        3  7738 1 1 103 PRO HG2  H  16.390   9.923  -8.881 1.00 . A A . 103 PRO HG2  1 1 
        3  7739 1 1 103 PRO HG3  H  16.570   8.164  -8.743 1.00 . A A . 103 PRO HG3  1 1 
        3  7740 1 1 103 PRO N    N  13.762   9.443  -7.813 1.00 . A A . 103 PRO N    1 1 
        3  7741 1 1 103 PRO O    O  14.446  12.071  -7.523 1.00 . A A . 103 PRO O    1 1 
        3  7742 1 1 104 ILE C    C  17.090  13.529  -5.063 1.00 . A A . 104 ILE C    1 1 
        3  7743 1 1 104 ILE CA   C  15.610  13.236  -5.303 1.00 . A A . 104 ILE CA   1 1 
        3  7744 1 1 104 ILE CB   C  14.768  13.798  -4.134 1.00 . A A . 104 ILE CB   1 1 
        3  7745 1 1 104 ILE CD1  C  13.152  15.594  -4.932 1.00 . A A . 104 ILE CD1  1 1 
        3  7746 1 1 104 ILE CG1  C  14.511  15.291  -4.338 1.00 . A A . 104 ILE CG1  1 1 
        3  7747 1 1 104 ILE CG2  C  15.452  13.549  -2.794 1.00 . A A . 104 ILE CG2  1 1 
        3  7748 1 1 104 ILE H    H  15.639  11.179  -4.782 1.00 . A A . 104 ILE H    1 1 
        3  7749 1 1 104 ILE HA   H  15.302  13.739  -6.209 1.00 . A A . 104 ILE HA   1 1 
        3  7750 1 1 104 ILE HB   H  13.823  13.279  -4.124 1.00 . A A . 104 ILE HB   1 1 
        3  7751 1 1 104 ILE HD11 H  12.592  16.219  -4.254 1.00 . A A . 104 ILE HD11 1 1 
        3  7752 1 1 104 ILE HD12 H  12.618  14.669  -5.094 1.00 . A A . 104 ILE HD12 1 1 
        3  7753 1 1 104 ILE HD13 H  13.278  16.106  -5.875 1.00 . A A . 104 ILE HD13 1 1 
        3  7754 1 1 104 ILE HG12 H  14.574  15.795  -3.385 1.00 . A A . 104 ILE HG12 1 1 
        3  7755 1 1 104 ILE HG13 H  15.262  15.693  -5.003 1.00 . A A . 104 ILE HG13 1 1 
        3  7756 1 1 104 ILE HG21 H  15.765  12.518  -2.736 1.00 . A A . 104 ILE HG21 1 1 
        3  7757 1 1 104 ILE HG22 H  14.758  13.761  -1.992 1.00 . A A . 104 ILE HG22 1 1 
        3  7758 1 1 104 ILE HG23 H  16.314  14.193  -2.704 1.00 . A A . 104 ILE HG23 1 1 
        3  7759 1 1 104 ILE N    N  15.374  11.807  -5.490 1.00 . A A . 104 ILE N    1 1 
        3  7760 1 1 104 ILE O    O  17.625  14.516  -5.566 1.00 . A A . 104 ILE O    1 1 
        3  7761 1 1 105 THR C    C  19.903  11.513  -4.076 1.00 . A A . 105 THR C    1 1 
        3  7762 1 1 105 THR CA   C  19.158  12.840  -3.982 1.00 . A A . 105 THR CA   1 1 
        3  7763 1 1 105 THR CB   C  19.328  13.436  -2.584 1.00 . A A . 105 THR CB   1 1 
        3  7764 1 1 105 THR CG2  C  18.738  14.823  -2.448 1.00 . A A . 105 THR CG2  1 1 
        3  7765 1 1 105 THR H    H  17.263  11.901  -3.915 1.00 . A A . 105 THR H    1 1 
        3  7766 1 1 105 THR HA   H  19.573  13.525  -4.707 1.00 . A A . 105 THR HA   1 1 
        3  7767 1 1 105 THR HB   H  20.383  13.500  -2.357 1.00 . A A . 105 THR HB   1 1 
        3  7768 1 1 105 THR HG1  H  19.357  12.378  -0.936 1.00 . A A . 105 THR HG1  1 1 
        3  7769 1 1 105 THR HG21 H  18.153  14.878  -1.542 1.00 . A A . 105 THR HG21 1 1 
        3  7770 1 1 105 THR HG22 H  18.106  15.030  -3.298 1.00 . A A . 105 THR HG22 1 1 
        3  7771 1 1 105 THR HG23 H  19.536  15.551  -2.406 1.00 . A A . 105 THR HG23 1 1 
        3  7772 1 1 105 THR N    N  17.742  12.668  -4.288 1.00 . A A . 105 THR N    1 1 
        3  7773 1 1 105 THR O    O  20.843  11.373  -4.857 1.00 . A A . 105 THR O    1 1 
        3  7774 1 1 105 THR OG1  O  18.714  12.612  -1.609 1.00 . A A . 105 THR OG1  1 1 
        3  7775 1 1 106 ASP C    C  19.252   8.209  -2.523 1.00 . A A . 106 ASP C    1 1 
        3  7776 1 1 106 ASP CA   C  20.107   9.227  -3.272 1.00 . A A . 106 ASP CA   1 1 
        3  7777 1 1 106 ASP CB   C  21.497   9.307  -2.637 1.00 . A A . 106 ASP CB   1 1 
        3  7778 1 1 106 ASP CG   C  22.496   8.390  -3.315 1.00 . A A . 106 ASP CG   1 1 
        3  7779 1 1 106 ASP H    H  18.722  10.712  -2.674 1.00 . A A . 106 ASP H    1 1 
        3  7780 1 1 106 ASP HA   H  20.209   8.906  -4.298 1.00 . A A . 106 ASP HA   1 1 
        3  7781 1 1 106 ASP HB2  H  21.862  10.321  -2.710 1.00 . A A . 106 ASP HB2  1 1 
        3  7782 1 1 106 ASP HB3  H  21.427   9.028  -1.596 1.00 . A A . 106 ASP HB3  1 1 
        3  7783 1 1 106 ASP N    N  19.478  10.542  -3.275 1.00 . A A . 106 ASP N    1 1 
        3  7784 1 1 106 ASP O    O  19.087   7.075  -2.972 1.00 . A A . 106 ASP O    1 1 
        3  7785 1 1 106 ASP OD1  O  22.075   7.336  -3.836 1.00 . A A . 106 ASP OD1  1 1 
        3  7786 1 1 106 ASP OD2  O  23.698   8.725  -3.325 1.00 . A A . 106 ASP OD2  1 1 
        3  7787 1 1 107 ASP C    C  16.519   8.371  -0.286 1.00 . A A . 107 ASP C    1 1 
        3  7788 1 1 107 ASP CA   C  17.877   7.738  -0.570 1.00 . A A . 107 ASP CA   1 1 
        3  7789 1 1 107 ASP CB   C  18.583   7.401   0.745 1.00 . A A . 107 ASP CB   1 1 
        3  7790 1 1 107 ASP CG   C  19.471   6.179   0.630 1.00 . A A . 107 ASP CG   1 1 
        3  7791 1 1 107 ASP H    H  18.881   9.534  -1.071 1.00 . A A . 107 ASP H    1 1 
        3  7792 1 1 107 ASP HA   H  17.724   6.825  -1.128 1.00 . A A . 107 ASP HA   1 1 
        3  7793 1 1 107 ASP HB2  H  19.194   8.240   1.044 1.00 . A A . 107 ASP HB2  1 1 
        3  7794 1 1 107 ASP HB3  H  17.839   7.214   1.507 1.00 . A A . 107 ASP HB3  1 1 
        3  7795 1 1 107 ASP N    N  18.713   8.619  -1.379 1.00 . A A . 107 ASP N    1 1 
        3  7796 1 1 107 ASP O    O  15.893   8.083   0.735 1.00 . A A . 107 ASP O    1 1 
        3  7797 1 1 107 ASP OD1  O  19.838   5.817  -0.508 1.00 . A A . 107 ASP OD1  1 1 
        3  7798 1 1 107 ASP OD2  O  19.800   5.581   1.677 1.00 . A A . 107 ASP OD2  1 1 
        3  7799 1 1 108 LEU C    C  14.102  10.052  -2.391 1.00 . A A . 108 LEU C    1 1 
        3  7800 1 1 108 LEU CA   C  14.781   9.901  -1.035 1.00 . A A . 108 LEU CA   1 1 
        3  7801 1 1 108 LEU CB   C  14.959  11.275  -0.371 1.00 . A A . 108 LEU CB   1 1 
        3  7802 1 1 108 LEU CD1  C  16.538  13.146   0.201 1.00 . A A . 108 LEU CD1  1 1 
        3  7803 1 1 108 LEU CD2  C  16.827  10.902   1.268 1.00 . A A . 108 LEU CD2  1 1 
        3  7804 1 1 108 LEU CG   C  16.400  11.644   0.009 1.00 . A A . 108 LEU CG   1 1 
        3  7805 1 1 108 LEU H    H  16.609   9.421  -1.988 1.00 . A A . 108 LEU H    1 1 
        3  7806 1 1 108 LEU HA   H  14.161   9.282  -0.403 1.00 . A A . 108 LEU HA   1 1 
        3  7807 1 1 108 LEU HB2  H  14.585  12.031  -1.047 1.00 . A A . 108 LEU HB2  1 1 
        3  7808 1 1 108 LEU HB3  H  14.361  11.295   0.527 1.00 . A A . 108 LEU HB3  1 1 
        3  7809 1 1 108 LEU HD11 H  15.590  13.559   0.510 1.00 . A A . 108 LEU HD11 1 1 
        3  7810 1 1 108 LEU HD12 H  16.844  13.603  -0.729 1.00 . A A . 108 LEU HD12 1 1 
        3  7811 1 1 108 LEU HD13 H  17.281  13.344   0.960 1.00 . A A . 108 LEU HD13 1 1 
        3  7812 1 1 108 LEU HD21 H  17.204  11.610   1.993 1.00 . A A . 108 LEU HD21 1 1 
        3  7813 1 1 108 LEU HD22 H  17.605  10.193   1.021 1.00 . A A . 108 LEU HD22 1 1 
        3  7814 1 1 108 LEU HD23 H  15.980  10.377   1.684 1.00 . A A . 108 LEU HD23 1 1 
        3  7815 1 1 108 LEU HG   H  17.061  11.349  -0.794 1.00 . A A . 108 LEU HG   1 1 
        3  7816 1 1 108 LEU N    N  16.068   9.232  -1.191 1.00 . A A . 108 LEU N    1 1 
        3  7817 1 1 108 LEU O    O  14.642  10.687  -3.296 1.00 . A A . 108 LEU O    1 1 
        3  7818 1 1 109 ASP C    C  10.709   9.777  -3.588 1.00 . A A . 109 ASP C    1 1 
        3  7819 1 1 109 ASP CA   C  12.198   9.517  -3.802 1.00 . A A . 109 ASP CA   1 1 
        3  7820 1 1 109 ASP CB   C  12.388   8.215  -4.584 1.00 . A A . 109 ASP CB   1 1 
        3  7821 1 1 109 ASP CG   C  11.756   7.023  -3.893 1.00 . A A . 109 ASP CG   1 1 
        3  7822 1 1 109 ASP H    H  12.543   8.947  -1.788 1.00 . A A . 109 ASP H    1 1 
        3  7823 1 1 109 ASP HA   H  12.611  10.331  -4.377 1.00 . A A . 109 ASP HA   1 1 
        3  7824 1 1 109 ASP HB2  H  11.940   8.319  -5.561 1.00 . A A . 109 ASP HB2  1 1 
        3  7825 1 1 109 ASP HB3  H  13.446   8.021  -4.697 1.00 . A A . 109 ASP HB3  1 1 
        3  7826 1 1 109 ASP N    N  12.924   9.451  -2.538 1.00 . A A . 109 ASP N    1 1 
        3  7827 1 1 109 ASP O    O  10.170   9.539  -2.508 1.00 . A A . 109 ASP O    1 1 
        3  7828 1 1 109 ASP OD1  O  12.346   6.525  -2.910 1.00 . A A . 109 ASP OD1  1 1 
        3  7829 1 1 109 ASP OD2  O  10.671   6.589  -4.332 1.00 . A A . 109 ASP OD2  1 1 
        3  7830 1 1 110 ILE C    C   7.872   9.623  -5.553 1.00 . A A . 110 ILE C    1 1 
        3  7831 1 1 110 ILE CA   C   8.625  10.545  -4.598 1.00 . A A . 110 ILE CA   1 1 
        3  7832 1 1 110 ILE CB   C   8.337  12.015  -4.975 1.00 . A A . 110 ILE CB   1 1 
        3  7833 1 1 110 ILE CD1  C   7.569  12.811  -7.270 1.00 . A A . 110 ILE CD1  1 1 
        3  7834 1 1 110 ILE CG1  C   8.716  12.283  -6.435 1.00 . A A . 110 ILE CG1  1 1 
        3  7835 1 1 110 ILE CG2  C   9.092  12.956  -4.046 1.00 . A A . 110 ILE CG2  1 1 
        3  7836 1 1 110 ILE H    H  10.544  10.416  -5.474 1.00 . A A . 110 ILE H    1 1 
        3  7837 1 1 110 ILE HA   H   8.276  10.373  -3.590 1.00 . A A . 110 ILE HA   1 1 
        3  7838 1 1 110 ILE HB   H   7.279  12.193  -4.845 1.00 . A A . 110 ILE HB   1 1 
        3  7839 1 1 110 ILE HD11 H   7.858  13.744  -7.729 1.00 . A A . 110 ILE HD11 1 1 
        3  7840 1 1 110 ILE HD12 H   6.710  12.972  -6.637 1.00 . A A . 110 ILE HD12 1 1 
        3  7841 1 1 110 ILE HD13 H   7.322  12.093  -8.037 1.00 . A A . 110 ILE HD13 1 1 
        3  7842 1 1 110 ILE HG12 H   9.511  13.012  -6.469 1.00 . A A . 110 ILE HG12 1 1 
        3  7843 1 1 110 ILE HG13 H   9.060  11.364  -6.887 1.00 . A A . 110 ILE HG13 1 1 
        3  7844 1 1 110 ILE HG21 H   9.940  13.373  -4.568 1.00 . A A . 110 ILE HG21 1 1 
        3  7845 1 1 110 ILE HG22 H   9.434  12.411  -3.180 1.00 . A A . 110 ILE HG22 1 1 
        3  7846 1 1 110 ILE HG23 H   8.435  13.754  -3.732 1.00 . A A . 110 ILE HG23 1 1 
        3  7847 1 1 110 ILE N    N  10.053  10.257  -4.641 1.00 . A A . 110 ILE N    1 1 
        3  7848 1 1 110 ILE O    O   8.401   9.239  -6.596 1.00 . A A . 110 ILE O    1 1 
        3  7849 1 1 111 TYR C    C   4.356   8.674  -5.915 1.00 . A A . 111 TYR C    1 1 
        3  7850 1 1 111 TYR CA   C   5.846   8.377  -6.041 1.00 . A A . 111 TYR CA   1 1 
        3  7851 1 1 111 TYR CB   C   6.120   6.916  -5.678 1.00 . A A . 111 TYR CB   1 1 
        3  7852 1 1 111 TYR CD1  C   4.300   6.295  -4.041 1.00 . A A . 111 TYR CD1  1 1 
        3  7853 1 1 111 TYR CD2  C   6.544   6.407  -3.242 1.00 . A A . 111 TYR CD2  1 1 
        3  7854 1 1 111 TYR CE1  C   3.863   5.944  -2.778 1.00 . A A . 111 TYR CE1  1 1 
        3  7855 1 1 111 TYR CE2  C   6.114   6.055  -1.976 1.00 . A A . 111 TYR CE2  1 1 
        3  7856 1 1 111 TYR CG   C   5.645   6.533  -4.294 1.00 . A A . 111 TYR CG   1 1 
        3  7857 1 1 111 TYR CZ   C   4.773   5.826  -1.751 1.00 . A A . 111 TYR CZ   1 1 
        3  7858 1 1 111 TYR H    H   6.264   9.590  -4.354 1.00 . A A . 111 TYR H    1 1 
        3  7859 1 1 111 TYR HA   H   6.146   8.544  -7.065 1.00 . A A . 111 TYR HA   1 1 
        3  7860 1 1 111 TYR HB2  H   5.615   6.277  -6.389 1.00 . A A . 111 TYR HB2  1 1 
        3  7861 1 1 111 TYR HB3  H   7.182   6.733  -5.729 1.00 . A A . 111 TYR HB3  1 1 
        3  7862 1 1 111 TYR HD1  H   3.590   6.389  -4.850 1.00 . A A . 111 TYR HD1  1 1 
        3  7863 1 1 111 TYR HD2  H   7.593   6.588  -3.422 1.00 . A A . 111 TYR HD2  1 1 
        3  7864 1 1 111 TYR HE1  H   2.813   5.764  -2.602 1.00 . A A . 111 TYR HE1  1 1 
        3  7865 1 1 111 TYR HE2  H   6.827   5.963  -1.171 1.00 . A A . 111 TYR HE2  1 1 
        3  7866 1 1 111 TYR HH   H   3.941   4.605  -0.520 1.00 . A A . 111 TYR HH   1 1 
        3  7867 1 1 111 TYR N    N   6.641   9.262  -5.197 1.00 . A A . 111 TYR N    1 1 
        3  7868 1 1 111 TYR O    O   3.866   9.025  -4.842 1.00 . A A . 111 TYR O    1 1 
        3  7869 1 1 111 TYR OH   O   4.342   5.476  -0.491 1.00 . A A . 111 TYR OH   1 1 
        3  7870 1 1 112 THR C    C   1.508   7.669  -7.869 1.00 . A A . 112 THR C    1 1 
        3  7871 1 1 112 THR CA   C   2.204   8.757  -7.057 1.00 . A A . 112 THR CA   1 1 
        3  7872 1 1 112 THR CB   C   1.902  10.132  -7.654 1.00 . A A . 112 THR CB   1 1 
        3  7873 1 1 112 THR CG2  C   1.717  11.211  -6.610 1.00 . A A . 112 THR CG2  1 1 
        3  7874 1 1 112 THR H    H   4.095   8.231  -7.848 1.00 . A A . 112 THR H    1 1 
        3  7875 1 1 112 THR HA   H   1.839   8.723  -6.042 1.00 . A A . 112 THR HA   1 1 
        3  7876 1 1 112 THR HB   H   0.989  10.071  -8.231 1.00 . A A . 112 THR HB   1 1 
        3  7877 1 1 112 THR HG1  H   2.600  10.665  -9.405 1.00 . A A . 112 THR HG1  1 1 
        3  7878 1 1 112 THR HG21 H   1.693  12.178  -7.090 1.00 . A A . 112 THR HG21 1 1 
        3  7879 1 1 112 THR HG22 H   2.538  11.178  -5.909 1.00 . A A . 112 THR HG22 1 1 
        3  7880 1 1 112 THR HG23 H   0.788  11.046  -6.083 1.00 . A A . 112 THR HG23 1 1 
        3  7881 1 1 112 THR N    N   3.643   8.519  -7.026 1.00 . A A . 112 THR N    1 1 
        3  7882 1 1 112 THR O    O   1.914   7.366  -8.992 1.00 . A A . 112 THR O    1 1 
        3  7883 1 1 112 THR OG1  O   2.946  10.544  -8.517 1.00 . A A . 112 THR OG1  1 1 
        3  7884 1 1 113 ARG C    C  -1.680   6.464  -8.351 1.00 . A A . 113 ARG C    1 1 
        3  7885 1 1 113 ARG CA   C  -0.269   6.016  -7.974 1.00 . A A . 113 ARG CA   1 1 
        3  7886 1 1 113 ARG CB   C  -0.332   4.763  -7.097 1.00 . A A . 113 ARG CB   1 1 
        3  7887 1 1 113 ARG CD   C  -2.065   3.801  -5.549 1.00 . A A . 113 ARG CD   1 1 
        3  7888 1 1 113 ARG CG   C  -1.103   4.953  -5.800 1.00 . A A . 113 ARG CG   1 1 
        3  7889 1 1 113 ARG CZ   C  -3.220   2.838  -3.595 1.00 . A A . 113 ARG CZ   1 1 
        3  7890 1 1 113 ARG H    H   0.190   7.351  -6.395 1.00 . A A . 113 ARG H    1 1 
        3  7891 1 1 113 ARG HA   H   0.267   5.778  -8.880 1.00 . A A . 113 ARG HA   1 1 
        3  7892 1 1 113 ARG HB2  H  -0.804   3.970  -7.659 1.00 . A A . 113 ARG HB2  1 1 
        3  7893 1 1 113 ARG HB3  H   0.676   4.463  -6.851 1.00 . A A . 113 ARG HB3  1 1 
        3  7894 1 1 113 ARG HD2  H  -2.837   3.824  -6.302 1.00 . A A . 113 ARG HD2  1 1 
        3  7895 1 1 113 ARG HD3  H  -1.518   2.872  -5.625 1.00 . A A . 113 ARG HD3  1 1 
        3  7896 1 1 113 ARG HE   H  -2.708   4.755  -3.793 1.00 . A A . 113 ARG HE   1 1 
        3  7897 1 1 113 ARG HG2  H  -0.401   5.008  -4.981 1.00 . A A . 113 ARG HG2  1 1 
        3  7898 1 1 113 ARG HG3  H  -1.664   5.874  -5.856 1.00 . A A . 113 ARG HG3  1 1 
        3  7899 1 1 113 ARG HH11 H  -2.808   1.504  -5.059 1.00 . A A . 113 ARG HH11 1 1 
        3  7900 1 1 113 ARG HH12 H  -3.618   0.857  -3.673 1.00 . A A . 113 ARG HH12 1 1 
        3  7901 1 1 113 ARG HH21 H  -3.774   3.906  -1.970 1.00 . A A . 113 ARG HH21 1 1 
        3  7902 1 1 113 ARG HH22 H  -4.167   2.219  -1.920 1.00 . A A . 113 ARG HH22 1 1 
        3  7903 1 1 113 ARG N    N   0.465   7.076  -7.296 1.00 . A A . 113 ARG N    1 1 
        3  7904 1 1 113 ARG NE   N  -2.686   3.880  -4.229 1.00 . A A . 113 ARG NE   1 1 
        3  7905 1 1 113 ARG NH1  N  -3.214   1.635  -4.156 1.00 . A A . 113 ARG NH1  1 1 
        3  7906 1 1 113 ARG NH2  N  -3.764   3.001  -2.397 1.00 . A A . 113 ARG NH2  1 1 
        3  7907 1 1 113 ARG O    O  -2.403   7.041  -7.537 1.00 . A A . 113 ARG O    1 1 
        3  7908 1 1 114 LEU C    C  -4.101   5.307 -10.632 1.00 . A A . 114 LEU C    1 1 
        3  7909 1 1 114 LEU CA   C  -3.384   6.544 -10.096 1.00 . A A . 114 LEU CA   1 1 
        3  7910 1 1 114 LEU CB   C  -3.267   7.603 -11.200 1.00 . A A . 114 LEU CB   1 1 
        3  7911 1 1 114 LEU CD1  C  -4.562   9.528 -12.172 1.00 . A A . 114 LEU CD1  1 1 
        3  7912 1 1 114 LEU CD2  C  -4.891   7.217 -13.073 1.00 . A A . 114 LEU CD2  1 1 
        3  7913 1 1 114 LEU CG   C  -4.594   8.042 -11.830 1.00 . A A . 114 LEU CG   1 1 
        3  7914 1 1 114 LEU H    H  -1.437   5.718 -10.192 1.00 . A A . 114 LEU H    1 1 
        3  7915 1 1 114 LEU HA   H  -3.954   6.951  -9.274 1.00 . A A . 114 LEU HA   1 1 
        3  7916 1 1 114 LEU HB2  H  -2.782   8.473 -10.782 1.00 . A A . 114 LEU HB2  1 1 
        3  7917 1 1 114 LEU HB3  H  -2.638   7.205 -11.983 1.00 . A A . 114 LEU HB3  1 1 
        3  7918 1 1 114 LEU HD11 H  -5.033   9.686 -13.132 1.00 . A A . 114 LEU HD11 1 1 
        3  7919 1 1 114 LEU HD12 H  -3.540   9.869 -12.213 1.00 . A A . 114 LEU HD12 1 1 
        3  7920 1 1 114 LEU HD13 H  -5.097  10.082 -11.415 1.00 . A A . 114 LEU HD13 1 1 
        3  7921 1 1 114 LEU HD21 H  -4.347   6.283 -13.025 1.00 . A A . 114 LEU HD21 1 1 
        3  7922 1 1 114 LEU HD22 H  -4.583   7.766 -13.951 1.00 . A A . 114 LEU HD22 1 1 
        3  7923 1 1 114 LEU HD23 H  -5.950   7.015 -13.129 1.00 . A A . 114 LEU HD23 1 1 
        3  7924 1 1 114 LEU HG   H  -5.392   7.880 -11.121 1.00 . A A . 114 LEU HG   1 1 
        3  7925 1 1 114 LEU N    N  -2.061   6.185  -9.595 1.00 . A A . 114 LEU N    1 1 
        3  7926 1 1 114 LEU O    O  -3.589   4.619 -11.519 1.00 . A A . 114 LEU O    1 1 
        3  7927 1 1 115 GLY C    C  -7.349   3.696  -9.793 1.00 . A A . 115 GLY C    1 1 
        3  7928 1 1 115 GLY CA   C  -6.034   3.859 -10.529 1.00 . A A . 115 GLY CA   1 1 
        3  7929 1 1 115 GLY H    H  -5.641   5.597  -9.377 1.00 . A A . 115 GLY H    1 1 
        3  7930 1 1 115 GLY HA2  H  -6.237   3.958 -11.585 1.00 . A A . 115 GLY HA2  1 1 
        3  7931 1 1 115 GLY HA3  H  -5.435   2.975 -10.373 1.00 . A A . 115 GLY HA3  1 1 
        3  7932 1 1 115 GLY N    N  -5.281   5.021 -10.087 1.00 . A A . 115 GLY N    1 1 
        3  7933 1 1 115 GLY O    O  -8.095   4.660  -9.624 1.00 . A A . 115 GLY O    1 1 
        3  7934 1 1 116 GLY C    C  -8.767   1.069  -7.661 1.00 . A A . 116 GLY C    1 1 
        3  7935 1 1 116 GLY CA   C  -8.876   2.218  -8.643 1.00 . A A . 116 GLY CA   1 1 
        3  7936 1 1 116 GLY H    H  -7.007   1.738  -9.519 1.00 . A A . 116 GLY H    1 1 
        3  7937 1 1 116 GLY HA2  H  -9.151   3.110  -8.101 1.00 . A A . 116 GLY HA2  1 1 
        3  7938 1 1 116 GLY HA3  H  -9.651   1.993  -9.360 1.00 . A A . 116 GLY HA3  1 1 
        3  7939 1 1 116 GLY N    N  -7.637   2.473  -9.355 1.00 . A A . 116 GLY N    1 1 
        3  7940 1 1 116 GLY O    O  -7.780   0.329  -7.664 1.00 . A A . 116 GLY O    1 1 
        3  7941 1 1 117 MET C    C -11.038  -1.023  -5.973 1.00 . A A . 117 MET C    1 1 
        3  7942 1 1 117 MET CA   C  -9.803  -0.141  -5.818 1.00 . A A . 117 MET CA   1 1 
        3  7943 1 1 117 MET CB   C  -9.766   0.459  -4.410 1.00 . A A . 117 MET CB   1 1 
        3  7944 1 1 117 MET CE   C -12.441   2.720  -2.200 1.00 . A A . 117 MET CE   1 1 
        3  7945 1 1 117 MET CG   C -10.946   1.369  -4.104 1.00 . A A . 117 MET CG   1 1 
        3  7946 1 1 117 MET H    H -10.538   1.546  -6.865 1.00 . A A . 117 MET H    1 1 
        3  7947 1 1 117 MET HA   H  -8.922  -0.747  -5.963 1.00 . A A . 117 MET HA   1 1 
        3  7948 1 1 117 MET HB2  H  -9.762  -0.345  -3.690 1.00 . A A . 117 MET HB2  1 1 
        3  7949 1 1 117 MET HB3  H  -8.860   1.034  -4.300 1.00 . A A . 117 MET HB3  1 1 
        3  7950 1 1 117 MET HE1  H -13.465   2.589  -2.514 1.00 . A A . 117 MET HE1  1 1 
        3  7951 1 1 117 MET HE2  H -11.977   3.492  -2.797 1.00 . A A . 117 MET HE2  1 1 
        3  7952 1 1 117 MET HE3  H -12.418   3.008  -1.159 1.00 . A A . 117 MET HE3  1 1 
        3  7953 1 1 117 MET HG2  H -10.640   2.394  -4.250 1.00 . A A . 117 MET HG2  1 1 
        3  7954 1 1 117 MET HG3  H -11.751   1.134  -4.785 1.00 . A A . 117 MET HG3  1 1 
        3  7955 1 1 117 MET N    N  -9.784   0.921  -6.816 1.00 . A A . 117 MET N    1 1 
        3  7956 1 1 117 MET O    O -12.144  -0.528  -6.212 1.00 . A A . 117 MET O    1 1 
        3  7957 1 1 117 MET SD   S -11.548   1.182  -2.414 1.00 . A A . 117 MET SD   1 1 
        3  7958 1 1 118 VAL C    C -11.928  -4.244  -4.743 1.00 . A A . 118 VAL C    1 1 
        3  7959 1 1 118 VAL CA   C -11.930  -3.295  -5.938 1.00 . A A . 118 VAL CA   1 1 
        3  7960 1 1 118 VAL CB   C -11.838  -4.130  -7.234 1.00 . A A . 118 VAL CB   1 1 
        3  7961 1 1 118 VAL CG1  C -13.213  -4.648  -7.632 1.00 . A A . 118 VAL CG1  1 1 
        3  7962 1 1 118 VAL CG2  C -11.222  -3.320  -8.370 1.00 . A A . 118 VAL CG2  1 1 
        3  7963 1 1 118 VAL H    H  -9.937  -2.658  -5.632 1.00 . A A . 118 VAL H    1 1 
        3  7964 1 1 118 VAL HA   H -12.863  -2.747  -5.949 1.00 . A A . 118 VAL HA   1 1 
        3  7965 1 1 118 VAL HB   H -11.202  -4.982  -7.043 1.00 . A A . 118 VAL HB   1 1 
        3  7966 1 1 118 VAL HG11 H -13.642  -5.196  -6.808 1.00 . A A . 118 VAL HG11 1 1 
        3  7967 1 1 118 VAL HG12 H -13.119  -5.299  -8.488 1.00 . A A . 118 VAL HG12 1 1 
        3  7968 1 1 118 VAL HG13 H -13.853  -3.815  -7.881 1.00 . A A . 118 VAL HG13 1 1 
        3  7969 1 1 118 VAL HG21 H -11.352  -2.268  -8.175 1.00 . A A . 118 VAL HG21 1 1 
        3  7970 1 1 118 VAL HG22 H -11.707  -3.578  -9.301 1.00 . A A . 118 VAL HG22 1 1 
        3  7971 1 1 118 VAL HG23 H -10.167  -3.546  -8.442 1.00 . A A . 118 VAL HG23 1 1 
        3  7972 1 1 118 VAL N    N -10.840  -2.331  -5.827 1.00 . A A . 118 VAL N    1 1 
        3  7973 1 1 118 VAL O    O -10.911  -4.873  -4.445 1.00 . A A . 118 VAL O    1 1 
        3  7974 1 1 119 TRP C    C -14.602  -5.722  -2.717 1.00 . A A . 119 TRP C    1 1 
        3  7975 1 1 119 TRP CA   C -13.173  -5.217  -2.895 1.00 . A A . 119 TRP CA   1 1 
        3  7976 1 1 119 TRP CB   C -12.713  -4.483  -1.632 1.00 . A A . 119 TRP CB   1 1 
        3  7977 1 1 119 TRP CD1  C -14.116  -2.376  -2.041 1.00 . A A . 119 TRP CD1  1 1 
        3  7978 1 1 119 TRP CD2  C -14.113  -3.082   0.084 1.00 . A A . 119 TRP CD2  1 1 
        3  7979 1 1 119 TRP CE2  C -14.914  -1.928  -0.004 1.00 . A A . 119 TRP CE2  1 1 
        3  7980 1 1 119 TRP CE3  C -13.963  -3.703   1.326 1.00 . A A . 119 TRP CE3  1 1 
        3  7981 1 1 119 TRP CG   C -13.612  -3.354  -1.231 1.00 . A A . 119 TRP CG   1 1 
        3  7982 1 1 119 TRP CH2  C -15.396  -2.013   2.306 1.00 . A A . 119 TRP CH2  1 1 
        3  7983 1 1 119 TRP CZ2  C -15.561  -1.384   1.102 1.00 . A A . 119 TRP CZ2  1 1 
        3  7984 1 1 119 TRP CZ3  C -14.605  -3.163   2.424 1.00 . A A . 119 TRP CZ3  1 1 
        3  7985 1 1 119 TRP H    H -13.840  -3.818  -4.340 1.00 . A A . 119 TRP H    1 1 
        3  7986 1 1 119 TRP HA   H -12.525  -6.066  -3.060 1.00 . A A . 119 TRP HA   1 1 
        3  7987 1 1 119 TRP HB2  H -12.674  -5.183  -0.812 1.00 . A A . 119 TRP HB2  1 1 
        3  7988 1 1 119 TRP HB3  H -11.725  -4.080  -1.799 1.00 . A A . 119 TRP HB3  1 1 
        3  7989 1 1 119 TRP HD1  H -13.919  -2.302  -3.100 1.00 . A A . 119 TRP HD1  1 1 
        3  7990 1 1 119 TRP HE1  H -15.373  -0.736  -1.669 1.00 . A A . 119 TRP HE1  1 1 
        3  7991 1 1 119 TRP HE3  H -13.356  -4.591   1.436 1.00 . A A . 119 TRP HE3  1 1 
        3  7992 1 1 119 TRP HH2  H -15.880  -1.625   3.190 1.00 . A A . 119 TRP HH2  1 1 
        3  7993 1 1 119 TRP HZ2  H -16.175  -0.499   1.028 1.00 . A A . 119 TRP HZ2  1 1 
        3  7994 1 1 119 TRP HZ3  H -14.500  -3.630   3.392 1.00 . A A . 119 TRP HZ3  1 1 
        3  7995 1 1 119 TRP N    N -13.062  -4.343  -4.059 1.00 . A A . 119 TRP N    1 1 
        3  7996 1 1 119 TRP NE1  N -14.900  -1.516  -1.311 1.00 . A A . 119 TRP NE1  1 1 
        3  7997 1 1 119 TRP O    O -15.491  -5.386  -3.499 1.00 . A A . 119 TRP O    1 1 
        3  7998 1 1 120 ARG C    C -16.847  -6.268  -0.328 1.00 . A A . 120 ARG C    1 1 
        3  7999 1 1 120 ARG CA   C -16.134  -7.083  -1.402 1.00 . A A . 120 ARG CA   1 1 
        3  8000 1 1 120 ARG CB   C -16.016  -8.542  -0.956 1.00 . A A . 120 ARG CB   1 1 
        3  8001 1 1 120 ARG CD   C -15.691 -10.947  -1.611 1.00 . A A . 120 ARG CD   1 1 
        3  8002 1 1 120 ARG CG   C -15.820  -9.516  -2.107 1.00 . A A . 120 ARG CG   1 1 
        3  8003 1 1 120 ARG CZ   C -13.860 -12.471  -0.981 1.00 . A A . 120 ARG CZ   1 1 
        3  8004 1 1 120 ARG H    H -14.064  -6.764  -1.095 1.00 . A A . 120 ARG H    1 1 
        3  8005 1 1 120 ARG HA   H -16.712  -7.040  -2.313 1.00 . A A . 120 ARG HA   1 1 
        3  8006 1 1 120 ARG HB2  H -15.172  -8.635  -0.288 1.00 . A A . 120 ARG HB2  1 1 
        3  8007 1 1 120 ARG HB3  H -16.916  -8.820  -0.428 1.00 . A A . 120 ARG HB3  1 1 
        3  8008 1 1 120 ARG HD2  H -16.036 -10.994  -0.589 1.00 . A A . 120 ARG HD2  1 1 
        3  8009 1 1 120 ARG HD3  H -16.306 -11.585  -2.228 1.00 . A A . 120 ARG HD3  1 1 
        3  8010 1 1 120 ARG HE   H -13.688 -10.938  -2.247 1.00 . A A . 120 ARG HE   1 1 
        3  8011 1 1 120 ARG HG2  H -16.670  -9.452  -2.769 1.00 . A A . 120 ARG HG2  1 1 
        3  8012 1 1 120 ARG HG3  H -14.921  -9.247  -2.644 1.00 . A A . 120 ARG HG3  1 1 
        3  8013 1 1 120 ARG HH11 H -15.632 -12.882  -0.099 1.00 . A A . 120 ARG HH11 1 1 
        3  8014 1 1 120 ARG HH12 H -14.328 -13.940   0.327 1.00 . A A . 120 ARG HH12 1 1 
        3  8015 1 1 120 ARG HH21 H -11.972 -12.327  -1.688 1.00 . A A . 120 ARG HH21 1 1 
        3  8016 1 1 120 ARG HH22 H -12.250 -13.624  -0.574 1.00 . A A . 120 ARG HH22 1 1 
        3  8017 1 1 120 ARG N    N -14.813  -6.531  -1.683 1.00 . A A . 120 ARG N    1 1 
        3  8018 1 1 120 ARG NE   N -14.311 -11.424  -1.667 1.00 . A A . 120 ARG NE   1 1 
        3  8019 1 1 120 ARG NH1  N -14.674 -13.153  -0.185 1.00 . A A . 120 ARG NH1  1 1 
        3  8020 1 1 120 ARG NH2  N -12.590 -12.837  -1.090 1.00 . A A . 120 ARG NH2  1 1 
        3  8021 1 1 120 ARG O    O -16.216  -5.523   0.421 1.00 . A A . 120 ARG O    1 1 
        3  8022 1 1 121 ALA C    C -19.973  -6.623   1.397 1.00 . A A . 121 ALA C    1 1 
        3  8023 1 1 121 ALA CA   C -18.966  -5.696   0.726 1.00 . A A . 121 ALA CA   1 1 
        3  8024 1 1 121 ALA CB   C -19.680  -4.526   0.068 1.00 . A A . 121 ALA CB   1 1 
        3  8025 1 1 121 ALA H    H -18.612  -7.028  -0.882 1.00 . A A . 121 ALA H    1 1 
        3  8026 1 1 121 ALA HA   H -18.296  -5.304   1.476 1.00 . A A . 121 ALA HA   1 1 
        3  8027 1 1 121 ALA HB1  H -19.703  -3.689   0.750 1.00 . A A . 121 ALA HB1  1 1 
        3  8028 1 1 121 ALA HB2  H -20.690  -4.814  -0.182 1.00 . A A . 121 ALA HB2  1 1 
        3  8029 1 1 121 ALA HB3  H -19.154  -4.242  -0.832 1.00 . A A . 121 ALA HB3  1 1 
        3  8030 1 1 121 ALA N    N -18.166  -6.418  -0.259 1.00 . A A . 121 ALA N    1 1 
        3  8031 1 1 121 ALA O    O -20.654  -7.404   0.732 1.00 . A A . 121 ALA O    1 1 
        3  8032 1 1 122 ASP C    C -21.551  -6.597   4.674 1.00 . A A . 122 ASP C    1 1 
        3  8033 1 1 122 ASP CA   C -20.987  -7.363   3.482 1.00 . A A . 122 ASP CA   1 1 
        3  8034 1 1 122 ASP CB   C -20.285  -8.635   3.963 1.00 . A A . 122 ASP CB   1 1 
        3  8035 1 1 122 ASP CG   C -20.575  -9.827   3.071 1.00 . A A . 122 ASP CG   1 1 
        3  8036 1 1 122 ASP H    H -19.493  -5.891   3.195 1.00 . A A . 122 ASP H    1 1 
        3  8037 1 1 122 ASP HA   H -21.801  -7.636   2.828 1.00 . A A . 122 ASP HA   1 1 
        3  8038 1 1 122 ASP HB2  H -19.218  -8.469   3.971 1.00 . A A . 122 ASP HB2  1 1 
        3  8039 1 1 122 ASP HB3  H -20.617  -8.867   4.964 1.00 . A A . 122 ASP HB3  1 1 
        3  8040 1 1 122 ASP N    N -20.062  -6.532   2.720 1.00 . A A . 122 ASP N    1 1 
        3  8041 1 1 122 ASP O    O -20.997  -5.579   5.090 1.00 . A A . 122 ASP O    1 1 
        3  8042 1 1 122 ASP OD1  O -21.752 -10.235   2.991 1.00 . A A . 122 ASP OD1  1 1 
        3  8043 1 1 122 ASP OD2  O -19.624 -10.353   2.455 1.00 . A A . 122 ASP OD2  1 1 
        3  8044 1 1 123 SER C    C -24.282  -7.408   7.035 1.00 . A A . 123 SER C    1 1 
        3  8045 1 1 123 SER CA   C -23.298  -6.457   6.365 1.00 . A A . 123 SER CA   1 1 
        3  8046 1 1 123 SER CB   C -24.019  -5.180   5.928 1.00 . A A . 123 SER CB   1 1 
        3  8047 1 1 123 SER H    H -23.052  -7.908   4.843 1.00 . A A . 123 SER H    1 1 
        3  8048 1 1 123 SER HA   H -22.525  -6.197   7.074 1.00 . A A . 123 SER HA   1 1 
        3  8049 1 1 123 SER HB2  H -24.629  -4.818   6.742 1.00 . A A . 123 SER HB2  1 1 
        3  8050 1 1 123 SER HB3  H -23.290  -4.429   5.663 1.00 . A A . 123 SER HB3  1 1 
        3  8051 1 1 123 SER HG   H -25.754  -5.569   5.106 1.00 . A A . 123 SER HG   1 1 
        3  8052 1 1 123 SER N    N -22.657  -7.093   5.220 1.00 . A A . 123 SER N    1 1 
        3  8053 1 1 123 SER O    O -24.318  -7.520   8.260 1.00 . A A . 123 SER O    1 1 
        3  8054 1 1 123 SER OG   O -24.852  -5.424   4.808 1.00 . A A . 123 SER OG   1 1 
        3  8055 1 1 124 LYS C    C -25.584 -10.471   6.569 1.00 . A A . 124 LYS C    1 1 
        3  8056 1 1 124 LYS CA   C -26.068  -9.035   6.734 1.00 . A A . 124 LYS CA   1 1 
        3  8057 1 1 124 LYS CB   C -27.406  -8.849   6.016 1.00 . A A . 124 LYS CB   1 1 
        3  8058 1 1 124 LYS CD   C -29.227  -7.274   5.297 1.00 . A A . 124 LYS CD   1 1 
        3  8059 1 1 124 LYS CE   C -30.483  -7.444   6.137 1.00 . A A . 124 LYS CE   1 1 
        3  8060 1 1 124 LYS CG   C -27.970  -7.442   6.135 1.00 . A A . 124 LYS CG   1 1 
        3  8061 1 1 124 LYS H    H -25.006  -7.959   5.254 1.00 . A A . 124 LYS H    1 1 
        3  8062 1 1 124 LYS HA   H -26.205  -8.834   7.787 1.00 . A A . 124 LYS HA   1 1 
        3  8063 1 1 124 LYS HB2  H -27.271  -9.071   4.967 1.00 . A A . 124 LYS HB2  1 1 
        3  8064 1 1 124 LYS HB3  H -28.124  -9.538   6.433 1.00 . A A . 124 LYS HB3  1 1 
        3  8065 1 1 124 LYS HD2  H -29.229  -6.285   4.862 1.00 . A A . 124 LYS HD2  1 1 
        3  8066 1 1 124 LYS HD3  H -29.226  -8.015   4.511 1.00 . A A . 124 LYS HD3  1 1 
        3  8067 1 1 124 LYS HE2  H -30.736  -8.494   6.176 1.00 . A A . 124 LYS HE2  1 1 
        3  8068 1 1 124 LYS HE3  H -30.285  -7.083   7.135 1.00 . A A . 124 LYS HE3  1 1 
        3  8069 1 1 124 LYS HG2  H -28.211  -7.248   7.170 1.00 . A A . 124 LYS HG2  1 1 
        3  8070 1 1 124 LYS HG3  H -27.225  -6.736   5.798 1.00 . A A . 124 LYS HG3  1 1 
        3  8071 1 1 124 LYS HZ1  H -31.689  -5.743   5.994 1.00 . A A . 124 LYS HZ1  1 1 
        3  8072 1 1 124 LYS HZ2  H -32.525  -7.197   5.766 1.00 . A A . 124 LYS HZ2  1 1 
        3  8073 1 1 124 LYS HZ3  H -31.529  -6.592   4.540 1.00 . A A . 124 LYS HZ3  1 1 
        3  8074 1 1 124 LYS N    N -25.081  -8.091   6.222 1.00 . A A . 124 LYS N    1 1 
        3  8075 1 1 124 LYS NZ   N -31.637  -6.692   5.570 1.00 . A A . 124 LYS NZ   1 1 
        3  8076 1 1 124 LYS O    O -25.461 -10.970   5.450 1.00 . A A . 124 LYS O    1 1 
        3  8077 1 1 125 GLY C    C -24.650 -13.098   9.027 1.00 . A A . 125 GLY C    1 1 
        3  8078 1 1 125 GLY CA   C -24.845 -12.507   7.645 1.00 . A A . 125 GLY CA   1 1 
        3  8079 1 1 125 GLY H    H -25.429 -10.685   8.553 1.00 . A A . 125 GLY H    1 1 
        3  8080 1 1 125 GLY HA2  H -25.567 -13.104   7.109 1.00 . A A . 125 GLY HA2  1 1 
        3  8081 1 1 125 GLY HA3  H -23.904 -12.538   7.116 1.00 . A A . 125 GLY HA3  1 1 
        3  8082 1 1 125 GLY N    N -25.313 -11.133   7.689 1.00 . A A . 125 GLY N    1 1 
        3  8083 1 1 125 GLY O    O -23.709 -12.741   9.736 1.00 . A A . 125 GLY O    1 1 
        3  8084 1 1 126 ASN C    C -25.878 -16.114  10.629 1.00 . A A . 126 ASN C    1 1 
        3  8085 1 1 126 ASN CA   C -25.465 -14.648  10.718 1.00 . A A . 126 ASN CA   1 1 
        3  8086 1 1 126 ASN CB   C -26.353 -13.913  11.725 1.00 . A A . 126 ASN CB   1 1 
        3  8087 1 1 126 ASN CG   C -25.562 -12.976  12.617 1.00 . A A . 126 ASN CG   1 1 
        3  8088 1 1 126 ASN H    H -26.270 -14.250   8.802 1.00 . A A . 126 ASN H    1 1 
        3  8089 1 1 126 ASN HA   H -24.439 -14.596  11.052 1.00 . A A . 126 ASN HA   1 1 
        3  8090 1 1 126 ASN HB2  H -27.090 -13.334  11.190 1.00 . A A . 126 ASN HB2  1 1 
        3  8091 1 1 126 ASN HB3  H -26.855 -14.637  12.350 1.00 . A A . 126 ASN HB3  1 1 
        3  8092 1 1 126 ASN HD21 H -26.774 -11.470  12.146 1.00 . A A . 126 ASN HD21 1 1 
        3  8093 1 1 126 ASN HD22 H -25.493 -11.090  13.243 1.00 . A A . 126 ASN HD22 1 1 
        3  8094 1 1 126 ASN N    N -25.541 -14.005   9.412 1.00 . A A . 126 ASN N    1 1 
        3  8095 1 1 126 ASN ND2  N -25.986 -11.719  12.675 1.00 . A A . 126 ASN ND2  1 1 
        3  8096 1 1 126 ASN O    O -25.165 -17.000  11.101 1.00 . A A . 126 ASN O    1 1 
        3  8097 1 1 126 ASN OD1  O -24.582 -13.377  13.246 1.00 . A A . 126 ASN OD1  1 1 
        3  8098 1 1 127 TYR C    C -27.550 -18.137   8.403 1.00 . A A . 127 TYR C    1 1 
        3  8099 1 1 127 TYR CA   C -27.541 -17.719   9.870 1.00 . A A . 127 TYR CA   1 1 
        3  8100 1 1 127 TYR CB   C -28.952 -17.825  10.450 1.00 . A A . 127 TYR CB   1 1 
        3  8101 1 1 127 TYR CD1  C -28.672 -18.232  12.927 1.00 . A A . 127 TYR CD1  1 1 
        3  8102 1 1 127 TYR CD2  C -29.518 -16.117  12.223 1.00 . A A . 127 TYR CD2  1 1 
        3  8103 1 1 127 TYR CE1  C -28.759 -17.832  14.247 1.00 . A A . 127 TYR CE1  1 1 
        3  8104 1 1 127 TYR CE2  C -29.608 -15.710  13.539 1.00 . A A . 127 TYR CE2  1 1 
        3  8105 1 1 127 TYR CG   C -29.050 -17.384  11.894 1.00 . A A . 127 TYR CG   1 1 
        3  8106 1 1 127 TYR CZ   C -29.227 -16.571  14.547 1.00 . A A . 127 TYR CZ   1 1 
        3  8107 1 1 127 TYR H    H -27.556 -15.613   9.665 1.00 . A A . 127 TYR H    1 1 
        3  8108 1 1 127 TYR HA   H -26.886 -18.382  10.417 1.00 . A A . 127 TYR HA   1 1 
        3  8109 1 1 127 TYR HB2  H -29.620 -17.207   9.870 1.00 . A A . 127 TYR HB2  1 1 
        3  8110 1 1 127 TYR HB3  H -29.280 -18.853  10.395 1.00 . A A . 127 TYR HB3  1 1 
        3  8111 1 1 127 TYR HD1  H -28.306 -19.219  12.687 1.00 . A A . 127 TYR HD1  1 1 
        3  8112 1 1 127 TYR HD2  H -29.816 -15.446  11.430 1.00 . A A . 127 TYR HD2  1 1 
        3  8113 1 1 127 TYR HE1  H -28.461 -18.506  15.036 1.00 . A A . 127 TYR HE1  1 1 
        3  8114 1 1 127 TYR HE2  H -29.974 -14.721  13.775 1.00 . A A . 127 TYR HE2  1 1 
        3  8115 1 1 127 TYR HH   H -28.945 -15.288  15.952 1.00 . A A . 127 TYR HH   1 1 
        3  8116 1 1 127 TYR N    N -27.032 -16.361  10.020 1.00 . A A . 127 TYR N    1 1 
        3  8117 1 1 127 TYR O    O -28.236 -17.533   7.579 1.00 . A A . 127 TYR O    1 1 
        3  8118 1 1 127 TYR OH   O -29.315 -16.169  15.861 1.00 . A A . 127 TYR OH   1 1 
        3  8119 1 1 128 ALA C    C -27.646 -20.855   6.509 1.00 . A A . 128 ALA C    1 1 
        3  8120 1 1 128 ALA CA   C -26.702 -19.675   6.718 1.00 . A A . 128 ALA CA   1 1 
        3  8121 1 1 128 ALA CB   C -25.270 -20.069   6.385 1.00 . A A . 128 ALA CB   1 1 
        3  8122 1 1 128 ALA H    H -26.259 -19.616   8.786 1.00 . A A . 128 ALA H    1 1 
        3  8123 1 1 128 ALA HA   H -26.993 -18.874   6.054 1.00 . A A . 128 ALA HA   1 1 
        3  8124 1 1 128 ALA HB1  H -24.896 -19.432   5.599 1.00 . A A . 128 ALA HB1  1 1 
        3  8125 1 1 128 ALA HB2  H -25.245 -21.099   6.059 1.00 . A A . 128 ALA HB2  1 1 
        3  8126 1 1 128 ALA HB3  H -24.654 -19.957   7.265 1.00 . A A . 128 ALA HB3  1 1 
        3  8127 1 1 128 ALA N    N -26.784 -19.175   8.084 1.00 . A A . 128 ALA N    1 1 
        3  8128 1 1 128 ALA O    O -27.960 -21.584   7.451 1.00 . A A . 128 ALA O    1 1 
        3  8129 1 1 129 SER C    C -28.596 -22.792   3.622 1.00 . A A . 129 SER C    1 1 
        3  8130 1 1 129 SER CA   C -28.997 -22.132   4.937 1.00 . A A . 129 SER CA   1 1 
        3  8131 1 1 129 SER CB   C -30.435 -21.619   4.846 1.00 . A A . 129 SER CB   1 1 
        3  8132 1 1 129 SER H    H -27.803 -20.425   4.563 1.00 . A A . 129 SER H    1 1 
        3  8133 1 1 129 SER HA   H -28.936 -22.866   5.727 1.00 . A A . 129 SER HA   1 1 
        3  8134 1 1 129 SER HB2  H -30.515 -20.680   5.374 1.00 . A A . 129 SER HB2  1 1 
        3  8135 1 1 129 SER HB3  H -30.697 -21.471   3.808 1.00 . A A . 129 SER HB3  1 1 
        3  8136 1 1 129 SER HG   H -32.005 -22.066   5.930 1.00 . A A . 129 SER HG   1 1 
        3  8137 1 1 129 SER N    N -28.089 -21.039   5.270 1.00 . A A . 129 SER N    1 1 
        3  8138 1 1 129 SER O    O -27.802 -22.242   2.858 1.00 . A A . 129 SER O    1 1 
        3  8139 1 1 129 SER OG   O -31.345 -22.541   5.419 1.00 . A A . 129 SER OG   1 1 
        3  8140 1 1 130 THR C    C -29.839 -24.347   1.036 1.00 . A A . 130 THR C    1 1 
        3  8141 1 1 130 THR CA   C -28.849 -24.705   2.140 1.00 . A A . 130 THR CA   1 1 
        3  8142 1 1 130 THR CB   C -28.880 -26.211   2.401 1.00 . A A . 130 THR CB   1 1 
        3  8143 1 1 130 THR CG2  C -27.632 -26.727   3.083 1.00 . A A . 130 THR CG2  1 1 
        3  8144 1 1 130 THR H    H -29.775 -24.358   4.011 1.00 . A A . 130 THR H    1 1 
        3  8145 1 1 130 THR HA   H -27.856 -24.425   1.821 1.00 . A A . 130 THR HA   1 1 
        3  8146 1 1 130 THR HB   H -28.977 -26.727   1.456 1.00 . A A . 130 THR HB   1 1 
        3  8147 1 1 130 THR HG1  H -30.792 -26.523   2.688 1.00 . A A . 130 THR HG1  1 1 
        3  8148 1 1 130 THR HG21 H -26.974 -27.164   2.347 1.00 . A A . 130 THR HG21 1 1 
        3  8149 1 1 130 THR HG22 H -27.904 -27.475   3.812 1.00 . A A . 130 THR HG22 1 1 
        3  8150 1 1 130 THR HG23 H -27.127 -25.909   3.577 1.00 . A A . 130 THR HG23 1 1 
        3  8151 1 1 130 THR N    N -29.149 -23.971   3.364 1.00 . A A . 130 THR N    1 1 
        3  8152 1 1 130 THR O    O -30.952 -24.872   0.991 1.00 . A A . 130 THR O    1 1 
        3  8153 1 1 130 THR OG1  O -29.988 -26.556   3.212 1.00 . A A . 130 THR OG1  1 1 
        3  8154 1 1 131 GLY C    C -29.865 -23.632  -2.276 1.00 . A A . 131 GLY C    1 1 
        3  8155 1 1 131 GLY CA   C -30.289 -23.039  -0.947 1.00 . A A . 131 GLY CA   1 1 
        3  8156 1 1 131 GLY H    H -28.529 -23.065   0.230 1.00 . A A . 131 GLY H    1 1 
        3  8157 1 1 131 GLY HA2  H -31.300 -23.352  -0.731 1.00 . A A . 131 GLY HA2  1 1 
        3  8158 1 1 131 GLY HA3  H -30.266 -21.961  -1.022 1.00 . A A . 131 GLY HA3  1 1 
        3  8159 1 1 131 GLY N    N -29.427 -23.450   0.146 1.00 . A A . 131 GLY N    1 1 
        3  8160 1 1 131 GLY O    O -28.675 -23.722  -2.572 1.00 . A A . 131 GLY O    1 1 
        3  8161 1 1 132 VAL C    C -29.957 -23.598  -5.331 1.00 . A A . 132 VAL C    1 1 
        3  8162 1 1 132 VAL CA   C -30.566 -24.625  -4.384 1.00 . A A . 132 VAL CA   1 1 
        3  8163 1 1 132 VAL CB   C -31.843 -25.203  -5.023 1.00 . A A . 132 VAL CB   1 1 
        3  8164 1 1 132 VAL CG1  C -31.504 -25.984  -6.283 1.00 . A A . 132 VAL CG1  1 1 
        3  8165 1 1 132 VAL CG2  C -32.589 -26.080  -4.028 1.00 . A A . 132 VAL CG2  1 1 
        3  8166 1 1 132 VAL H    H -31.774 -23.938  -2.787 1.00 . A A . 132 VAL H    1 1 
        3  8167 1 1 132 VAL HA   H -29.862 -25.433  -4.243 1.00 . A A . 132 VAL HA   1 1 
        3  8168 1 1 132 VAL HB   H -32.486 -24.381  -5.300 1.00 . A A . 132 VAL HB   1 1 
        3  8169 1 1 132 VAL HG11 H -30.962 -26.880  -6.015 1.00 . A A . 132 VAL HG11 1 1 
        3  8170 1 1 132 VAL HG12 H -30.892 -25.374  -6.931 1.00 . A A . 132 VAL HG12 1 1 
        3  8171 1 1 132 VAL HG13 H -32.415 -26.253  -6.796 1.00 . A A . 132 VAL HG13 1 1 
        3  8172 1 1 132 VAL HG21 H -33.346 -25.491  -3.528 1.00 . A A . 132 VAL HG21 1 1 
        3  8173 1 1 132 VAL HG22 H -31.894 -26.466  -3.299 1.00 . A A . 132 VAL HG22 1 1 
        3  8174 1 1 132 VAL HG23 H -33.058 -26.900  -4.551 1.00 . A A . 132 VAL HG23 1 1 
        3  8175 1 1 132 VAL N    N -30.843 -24.037  -3.079 1.00 . A A . 132 VAL N    1 1 
        3  8176 1 1 132 VAL O    O -28.988 -23.884  -6.033 1.00 . A A . 132 VAL O    1 1 
        3  8177 1 1 133 SER C    C -28.767 -20.719  -5.648 1.00 . A A . 133 SER C    1 1 
        3  8178 1 1 133 SER CA   C -30.046 -21.329  -6.208 1.00 . A A . 133 SER CA   1 1 
        3  8179 1 1 133 SER CB   C -31.116 -20.248  -6.367 1.00 . A A . 133 SER CB   1 1 
        3  8180 1 1 133 SER H    H -31.303 -22.233  -4.764 1.00 . A A . 133 SER H    1 1 
        3  8181 1 1 133 SER HA   H -29.834 -21.756  -7.177 1.00 . A A . 133 SER HA   1 1 
        3  8182 1 1 133 SER HB2  H -31.061 -19.564  -5.532 1.00 . A A . 133 SER HB2  1 1 
        3  8183 1 1 133 SER HB3  H -30.945 -19.707  -7.285 1.00 . A A . 133 SER HB3  1 1 
        3  8184 1 1 133 SER HG   H -32.852 -20.676  -5.563 1.00 . A A . 133 SER HG   1 1 
        3  8185 1 1 133 SER N    N -30.534 -22.401  -5.346 1.00 . A A . 133 SER N    1 1 
        3  8186 1 1 133 SER O    O -28.409 -20.953  -4.493 1.00 . A A . 133 SER O    1 1 
        3  8187 1 1 133 SER OG   O -32.414 -20.815  -6.405 1.00 . A A . 133 SER OG   1 1 
        3  8188 1 1 134 ARG C    C -26.889 -17.787  -6.338 1.00 . A A . 134 ARG C    1 1 
        3  8189 1 1 134 ARG CA   C -26.841 -19.287  -6.060 1.00 . A A . 134 ARG CA   1 1 
        3  8190 1 1 134 ARG CB   C -25.649 -19.912  -6.785 1.00 . A A . 134 ARG CB   1 1 
        3  8191 1 1 134 ARG CD   C -25.592 -22.162  -7.911 1.00 . A A . 134 ARG CD   1 1 
        3  8192 1 1 134 ARG CG   C -25.536 -21.417  -6.587 1.00 . A A . 134 ARG CG   1 1 
        3  8193 1 1 134 ARG CZ   C -24.832 -24.444  -7.374 1.00 . A A . 134 ARG CZ   1 1 
        3  8194 1 1 134 ARG H    H -28.418 -19.783  -7.381 1.00 . A A . 134 ARG H    1 1 
        3  8195 1 1 134 ARG HA   H -26.726 -19.440  -4.996 1.00 . A A . 134 ARG HA   1 1 
        3  8196 1 1 134 ARG HB2  H -25.742 -19.713  -7.843 1.00 . A A . 134 ARG HB2  1 1 
        3  8197 1 1 134 ARG HB3  H -24.741 -19.455  -6.420 1.00 . A A . 134 ARG HB3  1 1 
        3  8198 1 1 134 ARG HD2  H -26.588 -22.558  -8.046 1.00 . A A . 134 ARG HD2  1 1 
        3  8199 1 1 134 ARG HD3  H -25.369 -21.470  -8.709 1.00 . A A . 134 ARG HD3  1 1 
        3  8200 1 1 134 ARG HE   H -23.800 -23.120  -8.453 1.00 . A A . 134 ARG HE   1 1 
        3  8201 1 1 134 ARG HG2  H -24.598 -21.637  -6.102 1.00 . A A . 134 ARG HG2  1 1 
        3  8202 1 1 134 ARG HG3  H -26.354 -21.749  -5.962 1.00 . A A . 134 ARG HG3  1 1 
        3  8203 1 1 134 ARG HH11 H -26.648 -23.968  -6.623 1.00 . A A . 134 ARG HH11 1 1 
        3  8204 1 1 134 ARG HH12 H -26.091 -25.566  -6.259 1.00 . A A . 134 ARG HH12 1 1 
        3  8205 1 1 134 ARG HH21 H -23.064 -25.220  -7.975 1.00 . A A . 134 ARG HH21 1 1 
        3  8206 1 1 134 ARG HH22 H -24.056 -26.278  -7.026 1.00 . A A . 134 ARG HH22 1 1 
        3  8207 1 1 134 ARG N    N -28.081 -19.933  -6.472 1.00 . A A . 134 ARG N    1 1 
        3  8208 1 1 134 ARG NE   N -24.634 -23.265  -7.959 1.00 . A A . 134 ARG NE   1 1 
        3  8209 1 1 134 ARG NH1  N -25.948 -24.678  -6.696 1.00 . A A . 134 ARG NH1  1 1 
        3  8210 1 1 134 ARG NH2  N -23.909 -25.391  -7.465 1.00 . A A . 134 ARG NH2  1 1 
        3  8211 1 1 134 ARG O    O -26.690 -17.350  -7.470 1.00 . A A . 134 ARG O    1 1 
        3  8212 1 1 135 SER C    C -25.838 -14.934  -5.380 1.00 . A A . 135 SER C    1 1 
        3  8213 1 1 135 SER CA   C -27.230 -15.556  -5.427 1.00 . A A . 135 SER CA   1 1 
        3  8214 1 1 135 SER CB   C -28.102 -14.965  -4.318 1.00 . A A . 135 SER CB   1 1 
        3  8215 1 1 135 SER H    H -27.304 -17.415  -4.417 1.00 . A A . 135 SER H    1 1 
        3  8216 1 1 135 SER HA   H -27.679 -15.333  -6.384 1.00 . A A . 135 SER HA   1 1 
        3  8217 1 1 135 SER HB2  H -28.414 -13.970  -4.600 1.00 . A A . 135 SER HB2  1 1 
        3  8218 1 1 135 SER HB3  H -28.973 -15.590  -4.177 1.00 . A A . 135 SER HB3  1 1 
        3  8219 1 1 135 SER HG   H -27.714 -15.563  -2.494 1.00 . A A . 135 SER HG   1 1 
        3  8220 1 1 135 SER N    N -27.156 -17.006  -5.295 1.00 . A A . 135 SER N    1 1 
        3  8221 1 1 135 SER O    O -24.917 -15.492  -4.785 1.00 . A A . 135 SER O    1 1 
        3  8222 1 1 135 SER OG   O -27.391 -14.889  -3.096 1.00 . A A . 135 SER OG   1 1 
        3  8223 1 1 136 GLU C    C -24.179 -12.309  -4.746 1.00 . A A . 136 GLU C    1 1 
        3  8224 1 1 136 GLU CA   C -24.413 -13.075  -6.045 1.00 . A A . 136 GLU CA   1 1 
        3  8225 1 1 136 GLU CB   C -24.361 -12.113  -7.233 1.00 . A A . 136 GLU CB   1 1 
        3  8226 1 1 136 GLU CD   C -22.298 -12.878  -8.473 1.00 . A A . 136 GLU CD   1 1 
        3  8227 1 1 136 GLU CG   C -23.808 -12.743  -8.501 1.00 . A A . 136 GLU CG   1 1 
        3  8228 1 1 136 GLU H    H -26.463 -13.378  -6.471 1.00 . A A . 136 GLU H    1 1 
        3  8229 1 1 136 GLU HA   H -23.635 -13.815  -6.158 1.00 . A A . 136 GLU HA   1 1 
        3  8230 1 1 136 GLU HB2  H -25.360 -11.759  -7.439 1.00 . A A . 136 GLU HB2  1 1 
        3  8231 1 1 136 GLU HB3  H -23.736 -11.271  -6.973 1.00 . A A . 136 GLU HB3  1 1 
        3  8232 1 1 136 GLU HG2  H -24.239 -13.726  -8.617 1.00 . A A . 136 GLU HG2  1 1 
        3  8233 1 1 136 GLU HG3  H -24.084 -12.127  -9.344 1.00 . A A . 136 GLU HG3  1 1 
        3  8234 1 1 136 GLU N    N -25.693 -13.774  -6.014 1.00 . A A . 136 GLU N    1 1 
        3  8235 1 1 136 GLU O    O -25.077 -12.193  -3.912 1.00 . A A . 136 GLU O    1 1 
        3  8236 1 1 136 GLU OE1  O -21.624 -11.922  -8.033 1.00 . A A . 136 GLU OE1  1 1 
        3  8237 1 1 136 GLU OE2  O -21.789 -13.939  -8.891 1.00 . A A . 136 GLU OE2  1 1 
        3  8238 1 1 137 HIS C    C -22.333  -9.574  -3.725 1.00 . A A . 137 HIS C    1 1 
        3  8239 1 1 137 HIS CA   C -22.615 -11.033  -3.385 1.00 . A A . 137 HIS CA   1 1 
        3  8240 1 1 137 HIS CB   C -21.392 -11.656  -2.707 1.00 . A A . 137 HIS CB   1 1 
        3  8241 1 1 137 HIS CD2  C -19.603 -10.818  -4.387 1.00 . A A . 137 HIS CD2  1 1 
        3  8242 1 1 137 HIS CE1  C -18.469 -12.681  -4.603 1.00 . A A . 137 HIS CE1  1 1 
        3  8243 1 1 137 HIS CG   C -20.194 -11.747  -3.600 1.00 . A A . 137 HIS CG   1 1 
        3  8244 1 1 137 HIS H    H -22.294 -11.915  -5.282 1.00 . A A . 137 HIS H    1 1 
        3  8245 1 1 137 HIS HA   H -23.453 -11.079  -2.707 1.00 . A A . 137 HIS HA   1 1 
        3  8246 1 1 137 HIS HB2  H -21.122 -11.057  -1.850 1.00 . A A . 137 HIS HB2  1 1 
        3  8247 1 1 137 HIS HB3  H -21.641 -12.654  -2.378 1.00 . A A . 137 HIS HB3  1 1 
        3  8248 1 1 137 HIS HD1  H -19.639 -13.760  -3.317 1.00 . A A . 137 HIS HD1  1 1 
        3  8249 1 1 137 HIS HD2  H -19.914  -9.790  -4.511 1.00 . A A . 137 HIS HD2  1 1 
        3  8250 1 1 137 HIS HE1  H -17.731 -13.405  -4.916 1.00 . A A . 137 HIS HE1  1 1 
        3  8251 1 1 137 HIS HE2  H -17.868 -10.974  -5.560 1.00 . A A . 137 HIS HE2  1 1 
        3  8252 1 1 137 HIS N    N -22.967 -11.789  -4.582 1.00 . A A . 137 HIS N    1 1 
        3  8253 1 1 137 HIS ND1  N -19.460 -12.904  -3.759 1.00 . A A . 137 HIS ND1  1 1 
        3  8254 1 1 137 HIS NE2  N -18.532 -11.424  -4.999 1.00 . A A . 137 HIS NE2  1 1 
        3  8255 1 1 137 HIS O    O -22.108  -9.229  -4.886 1.00 . A A . 137 HIS O    1 1 
        3  8256 1 1 138 ASP C    C -20.606  -7.034  -3.104 1.00 . A A . 138 ASP C    1 1 
        3  8257 1 1 138 ASP CA   C -22.093  -7.298  -2.898 1.00 . A A . 138 ASP CA   1 1 
        3  8258 1 1 138 ASP CB   C -22.602  -6.501  -1.696 1.00 . A A . 138 ASP CB   1 1 
        3  8259 1 1 138 ASP CG   C -22.974  -5.078  -2.061 1.00 . A A . 138 ASP CG   1 1 
        3  8260 1 1 138 ASP H    H -22.532  -9.057  -1.805 1.00 . A A . 138 ASP H    1 1 
        3  8261 1 1 138 ASP HA   H -22.628  -6.982  -3.781 1.00 . A A . 138 ASP HA   1 1 
        3  8262 1 1 138 ASP HB2  H -23.478  -6.989  -1.293 1.00 . A A . 138 ASP HB2  1 1 
        3  8263 1 1 138 ASP HB3  H -21.831  -6.470  -0.939 1.00 . A A . 138 ASP HB3  1 1 
        3  8264 1 1 138 ASP N    N -22.347  -8.722  -2.707 1.00 . A A . 138 ASP N    1 1 
        3  8265 1 1 138 ASP O    O -19.760  -7.659  -2.463 1.00 . A A . 138 ASP O    1 1 
        3  8266 1 1 138 ASP OD1  O -22.230  -4.453  -2.845 1.00 . A A . 138 ASP OD1  1 1 
        3  8267 1 1 138 ASP OD2  O -24.010  -4.588  -1.564 1.00 . A A . 138 ASP OD2  1 1 
        3  8268 1 1 139 THR C    C -18.721  -4.247  -4.357 1.00 . A A . 139 THR C    1 1 
        3  8269 1 1 139 THR CA   C -18.905  -5.761  -4.291 1.00 . A A . 139 THR CA   1 1 
        3  8270 1 1 139 THR CB   C -18.465  -6.397  -5.609 1.00 . A A . 139 THR CB   1 1 
        3  8271 1 1 139 THR CG2  C -18.566  -7.907  -5.609 1.00 . A A . 139 THR CG2  1 1 
        3  8272 1 1 139 THR H    H -21.011  -5.642  -4.480 1.00 . A A . 139 THR H    1 1 
        3  8273 1 1 139 THR HA   H -18.293  -6.150  -3.491 1.00 . A A . 139 THR HA   1 1 
        3  8274 1 1 139 THR HB   H -17.433  -6.135  -5.798 1.00 . A A . 139 THR HB   1 1 
        3  8275 1 1 139 THR HG1  H -20.180  -6.016  -6.476 1.00 . A A . 139 THR HG1  1 1 
        3  8276 1 1 139 THR HG21 H -19.564  -8.201  -5.900 1.00 . A A . 139 THR HG21 1 1 
        3  8277 1 1 139 THR HG22 H -18.355  -8.281  -4.618 1.00 . A A . 139 THR HG22 1 1 
        3  8278 1 1 139 THR HG23 H -17.852  -8.316  -6.309 1.00 . A A . 139 THR HG23 1 1 
        3  8279 1 1 139 THR N    N -20.292  -6.106  -4.001 1.00 . A A . 139 THR N    1 1 
        3  8280 1 1 139 THR O    O -19.628  -3.519  -4.763 1.00 . A A . 139 THR O    1 1 
        3  8281 1 1 139 THR OG1  O -19.249  -5.914  -6.687 1.00 . A A . 139 THR OG1  1 1 
        3  8282 1 1 140 GLY C    C -16.136  -2.008  -4.934 1.00 . A A . 140 GLY C    1 1 
        3  8283 1 1 140 GLY CA   C -17.261  -2.358  -3.978 1.00 . A A . 140 GLY CA   1 1 
        3  8284 1 1 140 GLY H    H -16.860  -4.410  -3.643 1.00 . A A . 140 GLY H    1 1 
        3  8285 1 1 140 GLY HA2  H -18.152  -1.828  -4.277 1.00 . A A . 140 GLY HA2  1 1 
        3  8286 1 1 140 GLY HA3  H -16.983  -2.042  -2.984 1.00 . A A . 140 GLY HA3  1 1 
        3  8287 1 1 140 GLY N    N -17.543  -3.781  -3.956 1.00 . A A . 140 GLY N    1 1 
        3  8288 1 1 140 GLY O    O -15.108  -2.681  -4.967 1.00 . A A . 140 GLY O    1 1 
        3  8289 1 1 141 VAL C    C -15.331   1.005  -6.822 1.00 . A A . 141 VAL C    1 1 
        3  8290 1 1 141 VAL CA   C -15.329  -0.512  -6.677 1.00 . A A . 141 VAL CA   1 1 
        3  8291 1 1 141 VAL CB   C -15.560  -1.156  -8.059 1.00 . A A . 141 VAL CB   1 1 
        3  8292 1 1 141 VAL CG1  C -16.914  -0.751  -8.621 1.00 . A A . 141 VAL CG1  1 1 
        3  8293 1 1 141 VAL CG2  C -14.442  -0.784  -9.021 1.00 . A A . 141 VAL CG2  1 1 
        3  8294 1 1 141 VAL H    H -17.178  -0.451  -5.643 1.00 . A A . 141 VAL H    1 1 
        3  8295 1 1 141 VAL HA   H -14.362  -0.827  -6.313 1.00 . A A . 141 VAL HA   1 1 
        3  8296 1 1 141 VAL HB   H -15.555  -2.230  -7.937 1.00 . A A . 141 VAL HB   1 1 
        3  8297 1 1 141 VAL HG11 H -16.782   0.051  -9.334 1.00 . A A . 141 VAL HG11 1 1 
        3  8298 1 1 141 VAL HG12 H -17.553  -0.417  -7.817 1.00 . A A . 141 VAL HG12 1 1 
        3  8299 1 1 141 VAL HG13 H -17.368  -1.598  -9.113 1.00 . A A . 141 VAL HG13 1 1 
        3  8300 1 1 141 VAL HG21 H -14.661   0.172  -9.476 1.00 . A A . 141 VAL HG21 1 1 
        3  8301 1 1 141 VAL HG22 H -14.361  -1.538  -9.789 1.00 . A A . 141 VAL HG22 1 1 
        3  8302 1 1 141 VAL HG23 H -13.509  -0.718  -8.480 1.00 . A A . 141 VAL HG23 1 1 
        3  8303 1 1 141 VAL N    N -16.335  -0.950  -5.714 1.00 . A A . 141 VAL N    1 1 
        3  8304 1 1 141 VAL O    O -16.377   1.612  -7.060 1.00 . A A . 141 VAL O    1 1 
        3  8305 1 1 142 SER C    C -12.621   3.496  -7.142 1.00 . A A . 142 SER C    1 1 
        3  8306 1 1 142 SER CA   C -14.047   3.071  -6.788 1.00 . A A . 142 SER CA   1 1 
        3  8307 1 1 142 SER CB   C -14.477   3.737  -5.479 1.00 . A A . 142 SER CB   1 1 
        3  8308 1 1 142 SER H    H -13.358   1.085  -6.482 1.00 . A A . 142 SER H    1 1 
        3  8309 1 1 142 SER HA   H -14.712   3.388  -7.575 1.00 . A A . 142 SER HA   1 1 
        3  8310 1 1 142 SER HB2  H -14.377   3.030  -4.669 1.00 . A A . 142 SER HB2  1 1 
        3  8311 1 1 142 SER HB3  H -13.846   4.594  -5.289 1.00 . A A . 142 SER HB3  1 1 
        3  8312 1 1 142 SER HG   H -15.860   5.124  -5.460 1.00 . A A . 142 SER HG   1 1 
        3  8313 1 1 142 SER N    N -14.160   1.618  -6.673 1.00 . A A . 142 SER N    1 1 
        3  8314 1 1 142 SER O    O -11.653   2.905  -6.661 1.00 . A A . 142 SER O    1 1 
        3  8315 1 1 142 SER OG   O -15.824   4.169  -5.546 1.00 . A A . 142 SER OG   1 1 
        3  8316 1 1 143 PRO C    C -10.479   5.824  -7.270 1.00 . A A . 143 PRO C    1 1 
        3  8317 1 1 143 PRO CA   C -11.157   5.044  -8.392 1.00 . A A . 143 PRO CA   1 1 
        3  8318 1 1 143 PRO CB   C -11.465   5.976  -9.576 1.00 . A A . 143 PRO CB   1 1 
        3  8319 1 1 143 PRO CD   C -13.554   5.308  -8.605 1.00 . A A . 143 PRO CD   1 1 
        3  8320 1 1 143 PRO CG   C -12.920   5.799  -9.873 1.00 . A A . 143 PRO CG   1 1 
        3  8321 1 1 143 PRO HA   H -10.509   4.245  -8.717 1.00 . A A . 143 PRO HA   1 1 
        3  8322 1 1 143 PRO HB2  H -11.245   6.996  -9.299 1.00 . A A . 143 PRO HB2  1 1 
        3  8323 1 1 143 PRO HB3  H -10.857   5.693 -10.422 1.00 . A A . 143 PRO HB3  1 1 
        3  8324 1 1 143 PRO HD2  H -13.846   6.139  -7.979 1.00 . A A . 143 PRO HD2  1 1 
        3  8325 1 1 143 PRO HD3  H -14.401   4.678  -8.825 1.00 . A A . 143 PRO HD3  1 1 
        3  8326 1 1 143 PRO HG2  H -13.352   6.744 -10.164 1.00 . A A . 143 PRO HG2  1 1 
        3  8327 1 1 143 PRO HG3  H -13.047   5.071 -10.660 1.00 . A A . 143 PRO HG3  1 1 
        3  8328 1 1 143 PRO N    N -12.469   4.537  -7.985 1.00 . A A . 143 PRO N    1 1 
        3  8329 1 1 143 PRO O    O -11.149   6.388  -6.405 1.00 . A A . 143 PRO O    1 1 
        3  8330 1 1 144 VAL C    C  -7.011   6.980  -6.759 1.00 . A A . 144 VAL C    1 1 
        3  8331 1 1 144 VAL CA   C  -8.397   6.578  -6.264 1.00 . A A . 144 VAL CA   1 1 
        3  8332 1 1 144 VAL CB   C  -8.242   5.740  -4.980 1.00 . A A . 144 VAL CB   1 1 
        3  8333 1 1 144 VAL CG1  C  -9.601   5.453  -4.360 1.00 . A A . 144 VAL CG1  1 1 
        3  8334 1 1 144 VAL CG2  C  -7.494   4.447  -5.270 1.00 . A A . 144 VAL CG2  1 1 
        3  8335 1 1 144 VAL H    H  -8.665   5.394  -8.002 1.00 . A A . 144 VAL H    1 1 
        3  8336 1 1 144 VAL HA   H  -8.950   7.472  -6.016 1.00 . A A . 144 VAL HA   1 1 
        3  8337 1 1 144 VAL HB   H  -7.665   6.313  -4.270 1.00 . A A . 144 VAL HB   1 1 
        3  8338 1 1 144 VAL HG11 H -10.188   6.359  -4.343 1.00 . A A . 144 VAL HG11 1 1 
        3  8339 1 1 144 VAL HG12 H  -9.468   5.092  -3.352 1.00 . A A . 144 VAL HG12 1 1 
        3  8340 1 1 144 VAL HG13 H -10.112   4.703  -4.945 1.00 . A A . 144 VAL HG13 1 1 
        3  8341 1 1 144 VAL HG21 H  -7.921   3.646  -4.684 1.00 . A A . 144 VAL HG21 1 1 
        3  8342 1 1 144 VAL HG22 H  -6.453   4.567  -5.008 1.00 . A A . 144 VAL HG22 1 1 
        3  8343 1 1 144 VAL HG23 H  -7.577   4.210  -6.320 1.00 . A A . 144 VAL HG23 1 1 
        3  8344 1 1 144 VAL N    N  -9.148   5.860  -7.287 1.00 . A A . 144 VAL N    1 1 
        3  8345 1 1 144 VAL O    O  -6.497   6.425  -7.733 1.00 . A A . 144 VAL O    1 1 
        3  8346 1 1 145 PHE C    C  -4.300   8.769  -5.152 1.00 . A A . 145 PHE C    1 1 
        3  8347 1 1 145 PHE CA   C  -5.086   8.439  -6.416 1.00 . A A . 145 PHE CA   1 1 
        3  8348 1 1 145 PHE CB   C  -5.194   9.680  -7.306 1.00 . A A . 145 PHE CB   1 1 
        3  8349 1 1 145 PHE CD1  C  -3.064  10.912  -6.805 1.00 . A A . 145 PHE CD1  1 1 
        3  8350 1 1 145 PHE CD2  C  -3.419  10.112  -9.024 1.00 . A A . 145 PHE CD2  1 1 
        3  8351 1 1 145 PHE CE1  C  -1.843  11.435  -7.184 1.00 . A A . 145 PHE CE1  1 1 
        3  8352 1 1 145 PHE CE2  C  -2.197  10.632  -9.409 1.00 . A A . 145 PHE CE2  1 1 
        3  8353 1 1 145 PHE CG   C  -3.866  10.245  -7.719 1.00 . A A . 145 PHE CG   1 1 
        3  8354 1 1 145 PHE CZ   C  -1.409  11.294  -8.489 1.00 . A A . 145 PHE CZ   1 1 
        3  8355 1 1 145 PHE H    H  -6.881   8.344  -5.304 1.00 . A A . 145 PHE H    1 1 
        3  8356 1 1 145 PHE HA   H  -4.571   7.659  -6.957 1.00 . A A . 145 PHE HA   1 1 
        3  8357 1 1 145 PHE HB2  H  -5.739   9.424  -8.202 1.00 . A A . 145 PHE HB2  1 1 
        3  8358 1 1 145 PHE HB3  H  -5.733  10.450  -6.772 1.00 . A A . 145 PHE HB3  1 1 
        3  8359 1 1 145 PHE HD1  H  -3.403  11.022  -5.786 1.00 . A A . 145 PHE HD1  1 1 
        3  8360 1 1 145 PHE HD2  H  -4.036   9.596  -9.743 1.00 . A A . 145 PHE HD2  1 1 
        3  8361 1 1 145 PHE HE1  H  -1.228  11.951  -6.463 1.00 . A A . 145 PHE HE1  1 1 
        3  8362 1 1 145 PHE HE2  H  -1.861  10.522 -10.429 1.00 . A A . 145 PHE HE2  1 1 
        3  8363 1 1 145 PHE HZ   H  -0.455  11.701  -8.788 1.00 . A A . 145 PHE HZ   1 1 
        3  8364 1 1 145 PHE N    N  -6.415   7.949  -6.070 1.00 . A A . 145 PHE N    1 1 
        3  8365 1 1 145 PHE O    O  -4.706   9.626  -4.366 1.00 . A A . 145 PHE O    1 1 
        3  8366 1 1 146 ALA C    C  -1.010   8.933  -4.151 1.00 . A A . 146 ALA C    1 1 
        3  8367 1 1 146 ALA CA   C  -2.348   8.309  -3.777 1.00 . A A . 146 ALA CA   1 1 
        3  8368 1 1 146 ALA CB   C  -2.130   7.005  -3.027 1.00 . A A . 146 ALA CB   1 1 
        3  8369 1 1 146 ALA H    H  -2.906   7.409  -5.612 1.00 . A A . 146 ALA H    1 1 
        3  8370 1 1 146 ALA HA   H  -2.877   8.988  -3.123 1.00 . A A . 146 ALA HA   1 1 
        3  8371 1 1 146 ALA HB1  H  -3.085   6.539  -2.832 1.00 . A A . 146 ALA HB1  1 1 
        3  8372 1 1 146 ALA HB2  H  -1.631   7.209  -2.091 1.00 . A A . 146 ALA HB2  1 1 
        3  8373 1 1 146 ALA HB3  H  -1.520   6.344  -3.624 1.00 . A A . 146 ALA HB3  1 1 
        3  8374 1 1 146 ALA N    N  -3.178   8.084  -4.955 1.00 . A A . 146 ALA N    1 1 
        3  8375 1 1 146 ALA O    O  -0.367   8.523  -5.117 1.00 . A A . 146 ALA O    1 1 
        3  8376 1 1 147 GLY C    C   1.486  10.768  -2.365 1.00 . A A . 147 GLY C    1 1 
        3  8377 1 1 147 GLY CA   C   0.669  10.594  -3.630 1.00 . A A . 147 GLY CA   1 1 
        3  8378 1 1 147 GLY H    H  -1.150  10.209  -2.615 1.00 . A A . 147 GLY H    1 1 
        3  8379 1 1 147 GLY HA2  H   1.237  10.010  -4.337 1.00 . A A . 147 GLY HA2  1 1 
        3  8380 1 1 147 GLY HA3  H   0.471  11.567  -4.055 1.00 . A A . 147 GLY HA3  1 1 
        3  8381 1 1 147 GLY N    N  -0.594   9.928  -3.374 1.00 . A A . 147 GLY N    1 1 
        3  8382 1 1 147 GLY O    O   0.999  11.319  -1.377 1.00 . A A . 147 GLY O    1 1 
        3  8383 1 1 148 GLY C    C   5.051  10.323  -1.558 1.00 . A A . 148 GLY C    1 1 
        3  8384 1 1 148 GLY CA   C   3.578  10.410  -1.222 1.00 . A A . 148 GLY CA   1 1 
        3  8385 1 1 148 GLY H    H   3.063   9.859  -3.202 1.00 . A A . 148 GLY H    1 1 
        3  8386 1 1 148 GLY HA2  H   3.386  11.360  -0.744 1.00 . A A . 148 GLY HA2  1 1 
        3  8387 1 1 148 GLY HA3  H   3.332   9.617  -0.532 1.00 . A A . 148 GLY HA3  1 1 
        3  8388 1 1 148 GLY N    N   2.726  10.293  -2.389 1.00 . A A . 148 GLY N    1 1 
        3  8389 1 1 148 GLY O    O   5.441  10.445  -2.722 1.00 . A A . 148 GLY O    1 1 
        3  8390 1 1 149 VAL C    C   7.877   8.786  -0.007 1.00 . A A . 149 VAL C    1 1 
        3  8391 1 1 149 VAL CA   C   7.315  10.010  -0.726 1.00 . A A . 149 VAL CA   1 1 
        3  8392 1 1 149 VAL CB   C   8.036  11.274  -0.219 1.00 . A A . 149 VAL CB   1 1 
        3  8393 1 1 149 VAL CG1  C   7.811  12.436  -1.177 1.00 . A A . 149 VAL CG1  1 1 
        3  8394 1 1 149 VAL CG2  C   7.566  11.631   1.183 1.00 . A A . 149 VAL CG2  1 1 
        3  8395 1 1 149 VAL H    H   5.500  10.024   0.368 1.00 . A A . 149 VAL H    1 1 
        3  8396 1 1 149 VAL HA   H   7.506   9.912  -1.785 1.00 . A A . 149 VAL HA   1 1 
        3  8397 1 1 149 VAL HB   H   9.096  11.068  -0.180 1.00 . A A . 149 VAL HB   1 1 
        3  8398 1 1 149 VAL HG11 H   6.891  12.941  -0.924 1.00 . A A . 149 VAL HG11 1 1 
        3  8399 1 1 149 VAL HG12 H   7.749  12.062  -2.186 1.00 . A A . 149 VAL HG12 1 1 
        3  8400 1 1 149 VAL HG13 H   8.634  13.130  -1.103 1.00 . A A . 149 VAL HG13 1 1 
        3  8401 1 1 149 VAL HG21 H   7.994  10.937   1.893 1.00 . A A . 149 VAL HG21 1 1 
        3  8402 1 1 149 VAL HG22 H   6.489  11.572   1.227 1.00 . A A . 149 VAL HG22 1 1 
        3  8403 1 1 149 VAL HG23 H   7.883  12.635   1.425 1.00 . A A . 149 VAL HG23 1 1 
        3  8404 1 1 149 VAL N    N   5.873  10.112  -0.537 1.00 . A A . 149 VAL N    1 1 
        3  8405 1 1 149 VAL O    O   7.228   8.217   0.869 1.00 . A A . 149 VAL O    1 1 
        3  8406 1 1 150 GLU C    C  11.148   7.553   0.676 1.00 . A A . 150 GLU C    1 1 
        3  8407 1 1 150 GLU CA   C   9.731   7.223   0.219 1.00 . A A . 150 GLU CA   1 1 
        3  8408 1 1 150 GLU CB   C   9.763   6.059  -0.773 1.00 . A A . 150 GLU CB   1 1 
        3  8409 1 1 150 GLU CD   C  11.434   4.219  -0.313 1.00 . A A . 150 GLU CD   1 1 
        3  8410 1 1 150 GLU CG   C  10.012   4.709  -0.118 1.00 . A A . 150 GLU CG   1 1 
        3  8411 1 1 150 GLU H    H   9.556   8.877  -1.093 1.00 . A A . 150 GLU H    1 1 
        3  8412 1 1 150 GLU HA   H   9.147   6.934   1.080 1.00 . A A . 150 GLU HA   1 1 
        3  8413 1 1 150 GLU HB2  H   8.816   6.015  -1.289 1.00 . A A . 150 GLU HB2  1 1 
        3  8414 1 1 150 GLU HB3  H  10.548   6.235  -1.492 1.00 . A A . 150 GLU HB3  1 1 
        3  8415 1 1 150 GLU HG2  H   9.820   4.797   0.941 1.00 . A A . 150 GLU HG2  1 1 
        3  8416 1 1 150 GLU HG3  H   9.335   3.985  -0.547 1.00 . A A . 150 GLU HG3  1 1 
        3  8417 1 1 150 GLU N    N   9.088   8.385  -0.387 1.00 . A A . 150 GLU N    1 1 
        3  8418 1 1 150 GLU O    O  11.884   8.265  -0.009 1.00 . A A . 150 GLU O    1 1 
        3  8419 1 1 150 GLU OE1  O  12.354   4.810   0.289 1.00 . A A . 150 GLU OE1  1 1 
        3  8420 1 1 150 GLU OE2  O  11.625   3.242  -1.068 1.00 . A A . 150 GLU OE2  1 1 
        3  8421 1 1 151 TRP C    C  13.566   5.936   2.654 1.00 . A A . 151 TRP C    1 1 
        3  8422 1 1 151 TRP CA   C  12.851   7.257   2.396 1.00 . A A . 151 TRP CA   1 1 
        3  8423 1 1 151 TRP CB   C  12.751   8.059   3.695 1.00 . A A . 151 TRP CB   1 1 
        3  8424 1 1 151 TRP CD1  C  10.487   9.256   3.687 1.00 . A A . 151 TRP CD1  1 1 
        3  8425 1 1 151 TRP CD2  C  12.242  10.609   3.374 1.00 . A A . 151 TRP CD2  1 1 
        3  8426 1 1 151 TRP CE2  C  11.067  11.384   3.349 1.00 . A A . 151 TRP CE2  1 1 
        3  8427 1 1 151 TRP CE3  C  13.474  11.247   3.199 1.00 . A A . 151 TRP CE3  1 1 
        3  8428 1 1 151 TRP CG   C  11.849   9.251   3.592 1.00 . A A . 151 TRP CG   1 1 
        3  8429 1 1 151 TRP CH2  C  12.310  13.361   2.986 1.00 . A A . 151 TRP CH2  1 1 
        3  8430 1 1 151 TRP CZ2  C  11.090  12.764   3.155 1.00 . A A . 151 TRP CZ2  1 1 
        3  8431 1 1 151 TRP CZ3  C  13.495  12.616   3.006 1.00 . A A . 151 TRP CZ3  1 1 
        3  8432 1 1 151 TRP H    H  10.887   6.467   2.336 1.00 . A A . 151 TRP H    1 1 
        3  8433 1 1 151 TRP HA   H  13.419   7.826   1.674 1.00 . A A . 151 TRP HA   1 1 
        3  8434 1 1 151 TRP HB2  H  12.372   7.420   4.476 1.00 . A A . 151 TRP HB2  1 1 
        3  8435 1 1 151 TRP HB3  H  13.737   8.409   3.970 1.00 . A A . 151 TRP HB3  1 1 
        3  8436 1 1 151 TRP HD1  H   9.885   8.375   3.852 1.00 . A A . 151 TRP HD1  1 1 
        3  8437 1 1 151 TRP HE1  H   9.066  10.799   3.572 1.00 . A A . 151 TRP HE1  1 1 
        3  8438 1 1 151 TRP HE3  H  14.398  10.688   3.212 1.00 . A A . 151 TRP HE3  1 1 
        3  8439 1 1 151 TRP HH2  H  12.373  14.427   2.832 1.00 . A A . 151 TRP HH2  1 1 
        3  8440 1 1 151 TRP HZ2  H  10.185  13.354   3.137 1.00 . A A . 151 TRP HZ2  1 1 
        3  8441 1 1 151 TRP HZ3  H  14.438  13.124   2.868 1.00 . A A . 151 TRP HZ3  1 1 
        3  8442 1 1 151 TRP N    N  11.522   7.027   1.840 1.00 . A A . 151 TRP N    1 1 
        3  8443 1 1 151 TRP NE1  N  10.009  10.536   3.542 1.00 . A A . 151 TRP NE1  1 1 
        3  8444 1 1 151 TRP O    O  13.089   5.101   3.422 1.00 . A A . 151 TRP O    1 1 
        3  8445 1 1 152 ALA C    C  16.452   4.628   3.340 1.00 . A A . 152 ALA C    1 1 
        3  8446 1 1 152 ALA CA   C  15.490   4.527   2.162 1.00 . A A . 152 ALA CA   1 1 
        3  8447 1 1 152 ALA CB   C  16.253   4.222   0.882 1.00 . A A . 152 ALA CB   1 1 
        3  8448 1 1 152 ALA H    H  15.040   6.453   1.403 1.00 . A A . 152 ALA H    1 1 
        3  8449 1 1 152 ALA HA   H  14.801   3.715   2.342 1.00 . A A . 152 ALA HA   1 1 
        3  8450 1 1 152 ALA HB1  H  16.342   3.152   0.762 1.00 . A A . 152 ALA HB1  1 1 
        3  8451 1 1 152 ALA HB2  H  17.238   4.661   0.938 1.00 . A A . 152 ALA HB2  1 1 
        3  8452 1 1 152 ALA HB3  H  15.722   4.637   0.038 1.00 . A A . 152 ALA HB3  1 1 
        3  8453 1 1 152 ALA N    N  14.711   5.750   2.005 1.00 . A A . 152 ALA N    1 1 
        3  8454 1 1 152 ALA O    O  17.243   5.566   3.432 1.00 . A A . 152 ALA O    1 1 
        3  8455 1 1 153 VAL C    C  18.170   2.408   5.381 1.00 . A A . 153 VAL C    1 1 
        3  8456 1 1 153 VAL CA   C  17.246   3.622   5.412 1.00 . A A . 153 VAL CA   1 1 
        3  8457 1 1 153 VAL CB   C  16.425   3.597   6.717 1.00 . A A . 153 VAL CB   1 1 
        3  8458 1 1 153 VAL CG1  C  17.342   3.636   7.931 1.00 . A A . 153 VAL CG1  1 1 
        3  8459 1 1 153 VAL CG2  C  15.440   4.756   6.748 1.00 . A A . 153 VAL CG2  1 1 
        3  8460 1 1 153 VAL H    H  15.730   2.929   4.108 1.00 . A A . 153 VAL H    1 1 
        3  8461 1 1 153 VAL HA   H  17.847   4.520   5.405 1.00 . A A . 153 VAL HA   1 1 
        3  8462 1 1 153 VAL HB   H  15.863   2.676   6.749 1.00 . A A . 153 VAL HB   1 1 
        3  8463 1 1 153 VAL HG11 H  17.517   2.629   8.282 1.00 . A A . 153 VAL HG11 1 1 
        3  8464 1 1 153 VAL HG12 H  16.878   4.214   8.716 1.00 . A A . 153 VAL HG12 1 1 
        3  8465 1 1 153 VAL HG13 H  18.284   4.090   7.657 1.00 . A A . 153 VAL HG13 1 1 
        3  8466 1 1 153 VAL HG21 H  14.510   4.428   7.188 1.00 . A A . 153 VAL HG21 1 1 
        3  8467 1 1 153 VAL HG22 H  15.260   5.103   5.741 1.00 . A A . 153 VAL HG22 1 1 
        3  8468 1 1 153 VAL HG23 H  15.852   5.563   7.337 1.00 . A A . 153 VAL HG23 1 1 
        3  8469 1 1 153 VAL N    N  16.380   3.650   4.239 1.00 . A A . 153 VAL N    1 1 
        3  8470 1 1 153 VAL O    O  19.382   2.541   5.217 1.00 . A A . 153 VAL O    1 1 
        3  8471 1 1 154 THR C    C  18.760  -0.395   4.108 1.00 . A A . 154 THR C    1 1 
        3  8472 1 1 154 THR CA   C  18.354  -0.016   5.530 1.00 . A A . 154 THR CA   1 1 
        3  8473 1 1 154 THR CB   C  17.540  -1.147   6.160 1.00 . A A . 154 THR CB   1 1 
        3  8474 1 1 154 THR CG2  C  18.380  -2.113   6.967 1.00 . A A . 154 THR CG2  1 1 
        3  8475 1 1 154 THR H    H  16.615   1.183   5.665 1.00 . A A . 154 THR H    1 1 
        3  8476 1 1 154 THR HA   H  19.246   0.143   6.116 1.00 . A A . 154 THR HA   1 1 
        3  8477 1 1 154 THR HB   H  17.053  -1.707   5.375 1.00 . A A . 154 THR HB   1 1 
        3  8478 1 1 154 THR HG1  H  16.956  -0.133   7.730 1.00 . A A . 154 THR HG1  1 1 
        3  8479 1 1 154 THR HG21 H  18.065  -2.090   8.000 1.00 . A A . 154 THR HG21 1 1 
        3  8480 1 1 154 THR HG22 H  19.420  -1.826   6.902 1.00 . A A . 154 THR HG22 1 1 
        3  8481 1 1 154 THR HG23 H  18.257  -3.111   6.574 1.00 . A A . 154 THR HG23 1 1 
        3  8482 1 1 154 THR N    N  17.586   1.225   5.539 1.00 . A A . 154 THR N    1 1 
        3  8483 1 1 154 THR O    O  18.544   0.367   3.166 1.00 . A A . 154 THR O    1 1 
        3  8484 1 1 154 THR OG1  O  16.542  -0.626   7.020 1.00 . A A . 154 THR OG1  1 1 
        3  8485 1 1 155 ARG C    C  18.603  -2.516   1.817 1.00 . A A . 155 ARG C    1 1 
        3  8486 1 1 155 ARG CA   C  19.791  -2.054   2.657 1.00 . A A . 155 ARG CA   1 1 
        3  8487 1 1 155 ARG CB   C  20.789  -3.202   2.820 1.00 . A A . 155 ARG CB   1 1 
        3  8488 1 1 155 ARG CD   C  23.164  -3.913   3.225 1.00 . A A . 155 ARG CD   1 1 
        3  8489 1 1 155 ARG CG   C  22.219  -2.738   3.039 1.00 . A A . 155 ARG CG   1 1 
        3  8490 1 1 155 ARG CZ   C  24.606  -3.611   1.249 1.00 . A A . 155 ARG CZ   1 1 
        3  8491 1 1 155 ARG H    H  19.498  -2.138   4.752 1.00 . A A . 155 ARG H    1 1 
        3  8492 1 1 155 ARG HA   H  20.278  -1.235   2.150 1.00 . A A . 155 ARG HA   1 1 
        3  8493 1 1 155 ARG HB2  H  20.494  -3.801   3.669 1.00 . A A . 155 ARG HB2  1 1 
        3  8494 1 1 155 ARG HB3  H  20.764  -3.815   1.931 1.00 . A A . 155 ARG HB3  1 1 
        3  8495 1 1 155 ARG HD2  H  23.331  -4.062   4.282 1.00 . A A . 155 ARG HD2  1 1 
        3  8496 1 1 155 ARG HD3  H  22.706  -4.798   2.807 1.00 . A A . 155 ARG HD3  1 1 
        3  8497 1 1 155 ARG HE   H  25.240  -3.597   3.143 1.00 . A A . 155 ARG HE   1 1 
        3  8498 1 1 155 ARG HG2  H  22.537  -2.165   2.181 1.00 . A A . 155 ARG HG2  1 1 
        3  8499 1 1 155 ARG HG3  H  22.254  -2.116   3.922 1.00 . A A . 155 ARG HG3  1 1 
        3  8500 1 1 155 ARG HH11 H  22.648  -3.886   0.824 1.00 . A A . 155 ARG HH11 1 1 
        3  8501 1 1 155 ARG HH12 H  23.682  -3.670  -0.548 1.00 . A A . 155 ARG HH12 1 1 
        3  8502 1 1 155 ARG HH21 H  26.603  -3.313   1.339 1.00 . A A . 155 ARG HH21 1 1 
        3  8503 1 1 155 ARG HH22 H  25.928  -3.346  -0.256 1.00 . A A . 155 ARG HH22 1 1 
        3  8504 1 1 155 ARG N    N  19.352  -1.575   3.962 1.00 . A A . 155 ARG N    1 1 
        3  8505 1 1 155 ARG NE   N  24.451  -3.691   2.570 1.00 . A A . 155 ARG NE   1 1 
        3  8506 1 1 155 ARG NH1  N  23.559  -3.731   0.442 1.00 . A A . 155 ARG NH1  1 1 
        3  8507 1 1 155 ARG NH2  N  25.811  -3.407   0.735 1.00 . A A . 155 ARG NH2  1 1 
        3  8508 1 1 155 ARG O    O  18.617  -2.403   0.592 1.00 . A A . 155 ARG O    1 1 
        3  8509 1 1 156 ASP C    C  15.134  -3.279   2.638 1.00 . A A . 156 ASP C    1 1 
        3  8510 1 1 156 ASP CA   C  16.384  -3.513   1.796 1.00 . A A . 156 ASP CA   1 1 
        3  8511 1 1 156 ASP CB   C  16.520  -5.002   1.470 1.00 . A A . 156 ASP CB   1 1 
        3  8512 1 1 156 ASP CG   C  16.982  -5.815   2.664 1.00 . A A . 156 ASP CG   1 1 
        3  8513 1 1 156 ASP H    H  17.624  -3.100   3.461 1.00 . A A . 156 ASP H    1 1 
        3  8514 1 1 156 ASP HA   H  16.290  -2.961   0.873 1.00 . A A . 156 ASP HA   1 1 
        3  8515 1 1 156 ASP HB2  H  15.564  -5.383   1.147 1.00 . A A . 156 ASP HB2  1 1 
        3  8516 1 1 156 ASP HB3  H  17.241  -5.125   0.674 1.00 . A A . 156 ASP HB3  1 1 
        3  8517 1 1 156 ASP N    N  17.578  -3.035   2.484 1.00 . A A . 156 ASP N    1 1 
        3  8518 1 1 156 ASP O    O  14.210  -4.092   2.635 1.00 . A A . 156 ASP O    1 1 
        3  8519 1 1 156 ASP OD1  O  16.155  -6.067   3.566 1.00 . A A . 156 ASP OD1  1 1 
        3  8520 1 1 156 ASP OD2  O  18.170  -6.198   2.699 1.00 . A A . 156 ASP OD2  1 1 
        3  8521 1 1 157 ILE C    C  13.807  -0.308   4.311 1.00 . A A . 157 ILE C    1 1 
        3  8522 1 1 157 ILE CA   C  13.974  -1.820   4.203 1.00 . A A . 157 ILE CA   1 1 
        3  8523 1 1 157 ILE CB   C  14.125  -2.411   5.619 1.00 . A A . 157 ILE CB   1 1 
        3  8524 1 1 157 ILE CD1  C  14.740  -4.525   6.898 1.00 . A A . 157 ILE CD1  1 1 
        3  8525 1 1 157 ILE CG1  C  14.559  -3.877   5.543 1.00 . A A . 157 ILE CG1  1 1 
        3  8526 1 1 157 ILE CG2  C  12.821  -2.278   6.389 1.00 . A A . 157 ILE CG2  1 1 
        3  8527 1 1 157 ILE H    H  15.878  -1.552   3.318 1.00 . A A . 157 ILE H    1 1 
        3  8528 1 1 157 ILE HA   H  13.086  -2.240   3.753 1.00 . A A . 157 ILE HA   1 1 
        3  8529 1 1 157 ILE HB   H  14.882  -1.845   6.140 1.00 . A A . 157 ILE HB   1 1 
        3  8530 1 1 157 ILE HD11 H  15.087  -5.539   6.768 1.00 . A A . 157 ILE HD11 1 1 
        3  8531 1 1 157 ILE HD12 H  13.796  -4.532   7.421 1.00 . A A . 157 ILE HD12 1 1 
        3  8532 1 1 157 ILE HD13 H  15.465  -3.965   7.470 1.00 . A A . 157 ILE HD13 1 1 
        3  8533 1 1 157 ILE HG12 H  13.811  -4.439   5.004 1.00 . A A . 157 ILE HG12 1 1 
        3  8534 1 1 157 ILE HG13 H  15.499  -3.941   5.015 1.00 . A A . 157 ILE HG13 1 1 
        3  8535 1 1 157 ILE HG21 H  12.224  -1.489   5.955 1.00 . A A . 157 ILE HG21 1 1 
        3  8536 1 1 157 ILE HG22 H  13.036  -2.040   7.421 1.00 . A A . 157 ILE HG22 1 1 
        3  8537 1 1 157 ILE HG23 H  12.277  -3.210   6.340 1.00 . A A . 157 ILE HG23 1 1 
        3  8538 1 1 157 ILE N    N  15.113  -2.162   3.358 1.00 . A A . 157 ILE N    1 1 
        3  8539 1 1 157 ILE O    O  14.520   0.352   5.067 1.00 . A A . 157 ILE O    1 1 
        3  8540 1 1 158 ALA C    C  11.206   1.983   4.069 1.00 . A A . 158 ALA C    1 1 
        3  8541 1 1 158 ALA CA   C  12.609   1.671   3.558 1.00 . A A . 158 ALA CA   1 1 
        3  8542 1 1 158 ALA CB   C  12.801   2.245   2.162 1.00 . A A . 158 ALA CB   1 1 
        3  8543 1 1 158 ALA H    H  12.331  -0.341   2.962 1.00 . A A . 158 ALA H    1 1 
        3  8544 1 1 158 ALA HA   H  13.332   2.133   4.213 1.00 . A A . 158 ALA HA   1 1 
        3  8545 1 1 158 ALA HB1  H  12.113   1.769   1.479 1.00 . A A . 158 ALA HB1  1 1 
        3  8546 1 1 158 ALA HB2  H  13.815   2.064   1.835 1.00 . A A . 158 ALA HB2  1 1 
        3  8547 1 1 158 ALA HB3  H  12.613   3.307   2.181 1.00 . A A . 158 ALA HB3  1 1 
        3  8548 1 1 158 ALA N    N  12.864   0.235   3.549 1.00 . A A . 158 ALA N    1 1 
        3  8549 1 1 158 ALA O    O  10.371   1.091   4.213 1.00 . A A . 158 ALA O    1 1 
        3  8550 1 1 159 THR C    C   9.120   4.832   3.941 1.00 . A A . 159 THR C    1 1 
        3  8551 1 1 159 THR CA   C   9.656   3.709   4.822 1.00 . A A . 159 THR CA   1 1 
        3  8552 1 1 159 THR CB   C   9.767   4.189   6.271 1.00 . A A . 159 THR CB   1 1 
        3  8553 1 1 159 THR CG2  C  10.796   5.283   6.462 1.00 . A A . 159 THR CG2  1 1 
        3  8554 1 1 159 THR H    H  11.663   3.925   4.192 1.00 . A A . 159 THR H    1 1 
        3  8555 1 1 159 THR HA   H   8.977   2.873   4.778 1.00 . A A . 159 THR HA   1 1 
        3  8556 1 1 159 THR HB   H  10.052   3.354   6.895 1.00 . A A . 159 THR HB   1 1 
        3  8557 1 1 159 THR HG1  H   8.310   5.496   6.268 1.00 . A A . 159 THR HG1  1 1 
        3  8558 1 1 159 THR HG21 H  10.568   5.838   7.360 1.00 . A A . 159 THR HG21 1 1 
        3  8559 1 1 159 THR HG22 H  10.775   5.948   5.612 1.00 . A A . 159 THR HG22 1 1 
        3  8560 1 1 159 THR HG23 H  11.778   4.842   6.552 1.00 . A A . 159 THR HG23 1 1 
        3  8561 1 1 159 THR N    N  10.956   3.263   4.334 1.00 . A A . 159 THR N    1 1 
        3  8562 1 1 159 THR O    O   9.886   5.653   3.438 1.00 . A A . 159 THR O    1 1 
        3  8563 1 1 159 THR OG1  O   8.523   4.684   6.733 1.00 . A A . 159 THR OG1  1 1 
        3  8564 1 1 160 ARG C    C   5.917   6.441   3.522 1.00 . A A . 160 ARG C    1 1 
        3  8565 1 1 160 ARG CA   C   7.196   5.882   2.903 1.00 . A A . 160 ARG CA   1 1 
        3  8566 1 1 160 ARG CB   C   6.892   5.312   1.517 1.00 . A A . 160 ARG CB   1 1 
        3  8567 1 1 160 ARG CD   C   6.707   2.949   0.664 1.00 . A A . 160 ARG CD   1 1 
        3  8568 1 1 160 ARG CG   C   6.091   4.019   1.553 1.00 . A A . 160 ARG CG   1 1 
        3  8569 1 1 160 ARG CZ   C   6.179   1.842  -1.474 1.00 . A A . 160 ARG CZ   1 1 
        3  8570 1 1 160 ARG H    H   7.241   4.176   4.159 1.00 . A A . 160 ARG H    1 1 
        3  8571 1 1 160 ARG HA   H   7.907   6.687   2.799 1.00 . A A . 160 ARG HA   1 1 
        3  8572 1 1 160 ARG HB2  H   6.329   6.044   0.956 1.00 . A A . 160 ARG HB2  1 1 
        3  8573 1 1 160 ARG HB3  H   7.826   5.122   1.008 1.00 . A A . 160 ARG HB3  1 1 
        3  8574 1 1 160 ARG HD2  H   7.611   3.339   0.220 1.00 . A A . 160 ARG HD2  1 1 
        3  8575 1 1 160 ARG HD3  H   6.949   2.090   1.270 1.00 . A A . 160 ARG HD3  1 1 
        3  8576 1 1 160 ARG HE   H   4.855   2.784  -0.317 1.00 . A A . 160 ARG HE   1 1 
        3  8577 1 1 160 ARG HG2  H   6.064   3.653   2.568 1.00 . A A . 160 ARG HG2  1 1 
        3  8578 1 1 160 ARG HG3  H   5.085   4.221   1.215 1.00 . A A . 160 ARG HG3  1 1 
        3  8579 1 1 160 ARG HH11 H   8.126   1.737  -0.934 1.00 . A A . 160 ARG HH11 1 1 
        3  8580 1 1 160 ARG HH12 H   7.729   0.967  -2.432 1.00 . A A . 160 ARG HH12 1 1 
        3  8581 1 1 160 ARG HH21 H   4.330   1.771  -2.288 1.00 . A A . 160 ARG HH21 1 1 
        3  8582 1 1 160 ARG HH22 H   5.575   0.985  -3.203 1.00 . A A . 160 ARG HH22 1 1 
        3  8583 1 1 160 ARG N    N   7.807   4.858   3.742 1.00 . A A . 160 ARG N    1 1 
        3  8584 1 1 160 ARG NE   N   5.799   2.535  -0.402 1.00 . A A . 160 ARG NE   1 1 
        3  8585 1 1 160 ARG NH1  N   7.449   1.486  -1.625 1.00 . A A . 160 ARG NH1  1 1 
        3  8586 1 1 160 ARG NH2  N   5.288   1.505  -2.397 1.00 . A A . 160 ARG NH2  1 1 
        3  8587 1 1 160 ARG O    O   5.195   5.743   4.238 1.00 . A A . 160 ARG O    1 1 
        3  8588 1 1 161 LEU C    C   3.549   8.741   2.522 1.00 . A A . 161 LEU C    1 1 
        3  8589 1 1 161 LEU CA   C   4.450   8.386   3.701 1.00 . A A . 161 LEU CA   1 1 
        3  8590 1 1 161 LEU CB   C   4.834   9.650   4.475 1.00 . A A . 161 LEU CB   1 1 
        3  8591 1 1 161 LEU CD1  C   4.669  10.995   6.589 1.00 . A A . 161 LEU CD1  1 1 
        3  8592 1 1 161 LEU CD2  C   2.587  10.334   5.362 1.00 . A A . 161 LEU CD2  1 1 
        3  8593 1 1 161 LEU CG   C   4.006   9.922   5.735 1.00 . A A . 161 LEU CG   1 1 
        3  8594 1 1 161 LEU H    H   6.258   8.193   2.626 1.00 . A A . 161 LEU H    1 1 
        3  8595 1 1 161 LEU HA   H   3.922   7.710   4.358 1.00 . A A . 161 LEU HA   1 1 
        3  8596 1 1 161 LEU HB2  H   5.871   9.569   4.764 1.00 . A A . 161 LEU HB2  1 1 
        3  8597 1 1 161 LEU HB3  H   4.728  10.499   3.814 1.00 . A A . 161 LEU HB3  1 1 
        3  8598 1 1 161 LEU HD11 H   4.345  11.970   6.261 1.00 . A A . 161 LEU HD11 1 1 
        3  8599 1 1 161 LEU HD12 H   5.742  10.920   6.492 1.00 . A A . 161 LEU HD12 1 1 
        3  8600 1 1 161 LEU HD13 H   4.392  10.854   7.625 1.00 . A A . 161 LEU HD13 1 1 
        3  8601 1 1 161 LEU HD21 H   1.923   9.492   5.487 1.00 . A A . 161 LEU HD21 1 1 
        3  8602 1 1 161 LEU HD22 H   2.566  10.659   4.332 1.00 . A A . 161 LEU HD22 1 1 
        3  8603 1 1 161 LEU HD23 H   2.266  11.145   6.001 1.00 . A A . 161 LEU HD23 1 1 
        3  8604 1 1 161 LEU HG   H   3.948   9.018   6.321 1.00 . A A . 161 LEU HG   1 1 
        3  8605 1 1 161 LEU N    N   5.644   7.705   3.213 1.00 . A A . 161 LEU N    1 1 
        3  8606 1 1 161 LEU O    O   3.977   9.426   1.590 1.00 . A A . 161 LEU O    1 1 
        3  8607 1 1 162 GLU C    C   0.223   9.416   1.918 1.00 . A A . 162 GLU C    1 1 
        3  8608 1 1 162 GLU CA   C   1.366   8.511   1.470 1.00 . A A . 162 GLU CA   1 1 
        3  8609 1 1 162 GLU CB   C   0.806   7.190   0.939 1.00 . A A . 162 GLU CB   1 1 
        3  8610 1 1 162 GLU CD   C   1.834   5.027   1.743 1.00 . A A . 162 GLU CD   1 1 
        3  8611 1 1 162 GLU CG   C   1.870   6.131   0.704 1.00 . A A . 162 GLU CG   1 1 
        3  8612 1 1 162 GLU H    H   2.031   7.703   3.315 1.00 . A A . 162 GLU H    1 1 
        3  8613 1 1 162 GLU HA   H   1.904   9.003   0.675 1.00 . A A . 162 GLU HA   1 1 
        3  8614 1 1 162 GLU HB2  H   0.092   6.803   1.651 1.00 . A A . 162 GLU HB2  1 1 
        3  8615 1 1 162 GLU HB3  H   0.302   7.379   0.003 1.00 . A A . 162 GLU HB3  1 1 
        3  8616 1 1 162 GLU HG2  H   1.714   5.692  -0.271 1.00 . A A . 162 GLU HG2  1 1 
        3  8617 1 1 162 GLU HG3  H   2.842   6.603   0.733 1.00 . A A . 162 GLU HG3  1 1 
        3  8618 1 1 162 GLU N    N   2.310   8.256   2.555 1.00 . A A . 162 GLU N    1 1 
        3  8619 1 1 162 GLU O    O  -0.232   9.346   3.059 1.00 . A A . 162 GLU O    1 1 
        3  8620 1 1 162 GLU OE1  O   2.341   5.248   2.862 1.00 . A A . 162 GLU OE1  1 1 
        3  8621 1 1 162 GLU OE2  O   1.299   3.941   1.436 1.00 . A A . 162 GLU OE2  1 1 
        3  8622 1 1 163 TYR C    C  -2.414  11.071   0.211 1.00 . A A . 163 TYR C    1 1 
        3  8623 1 1 163 TYR CA   C  -1.333  11.181   1.281 1.00 . A A . 163 TYR CA   1 1 
        3  8624 1 1 163 TYR CB   C  -0.815  12.620   1.352 1.00 . A A . 163 TYR CB   1 1 
        3  8625 1 1 163 TYR CD1  C   0.382  13.029   3.536 1.00 . A A . 163 TYR CD1  1 1 
        3  8626 1 1 163 TYR CD2  C   1.698  12.659   1.584 1.00 . A A . 163 TYR CD2  1 1 
        3  8627 1 1 163 TYR CE1  C   1.531  13.171   4.290 1.00 . A A . 163 TYR CE1  1 1 
        3  8628 1 1 163 TYR CE2  C   2.853  12.800   2.330 1.00 . A A . 163 TYR CE2  1 1 
        3  8629 1 1 163 TYR CG   C   0.445  12.772   2.174 1.00 . A A . 163 TYR CG   1 1 
        3  8630 1 1 163 TYR CZ   C   2.764  13.056   3.683 1.00 . A A . 163 TYR CZ   1 1 
        3  8631 1 1 163 TYR H    H   0.167  10.262   0.107 1.00 . A A . 163 TYR H    1 1 
        3  8632 1 1 163 TYR HA   H  -1.757  10.912   2.237 1.00 . A A . 163 TYR HA   1 1 
        3  8633 1 1 163 TYR HB2  H  -0.603  12.967   0.353 1.00 . A A . 163 TYR HB2  1 1 
        3  8634 1 1 163 TYR HB3  H  -1.577  13.246   1.792 1.00 . A A . 163 TYR HB3  1 1 
        3  8635 1 1 163 TYR HD1  H  -0.585  13.118   4.010 1.00 . A A . 163 TYR HD1  1 1 
        3  8636 1 1 163 TYR HD2  H   1.764  12.461   0.524 1.00 . A A . 163 TYR HD2  1 1 
        3  8637 1 1 163 TYR HE1  H   1.463  13.370   5.349 1.00 . A A . 163 TYR HE1  1 1 
        3  8638 1 1 163 TYR HE2  H   3.818  12.710   1.854 1.00 . A A . 163 TYR HE2  1 1 
        3  8639 1 1 163 TYR HH   H   4.315  14.046   4.239 1.00 . A A . 163 TYR HH   1 1 
        3  8640 1 1 163 TYR N    N  -0.237  10.262   1.001 1.00 . A A . 163 TYR N    1 1 
        3  8641 1 1 163 TYR O    O  -2.121  10.809  -0.956 1.00 . A A . 163 TYR O    1 1 
        3  8642 1 1 163 TYR OH   O   3.911  13.196   4.428 1.00 . A A . 163 TYR OH   1 1 
        3  8643 1 1 164 GLN C    C  -4.632  12.199  -1.448 1.00 . A A . 164 GLN C    1 1 
        3  8644 1 1 164 GLN CA   C  -4.789  11.191  -0.312 1.00 . A A . 164 GLN CA   1 1 
        3  8645 1 1 164 GLN CB   C  -6.104  11.440   0.428 1.00 . A A . 164 GLN CB   1 1 
        3  8646 1 1 164 GLN CD   C  -7.012   9.092   0.213 1.00 . A A . 164 GLN CD   1 1 
        3  8647 1 1 164 GLN CG   C  -7.249  10.565  -0.059 1.00 . A A . 164 GLN CG   1 1 
        3  8648 1 1 164 GLN H    H  -3.836  11.475   1.557 1.00 . A A . 164 GLN H    1 1 
        3  8649 1 1 164 GLN HA   H  -4.804  10.197  -0.730 1.00 . A A . 164 GLN HA   1 1 
        3  8650 1 1 164 GLN HB2  H  -5.955  11.248   1.479 1.00 . A A . 164 GLN HB2  1 1 
        3  8651 1 1 164 GLN HB3  H  -6.391  12.473   0.296 1.00 . A A . 164 GLN HB3  1 1 
        3  8652 1 1 164 GLN HE21 H  -7.926   9.244   1.972 1.00 . A A . 164 GLN HE21 1 1 
        3  8653 1 1 164 GLN HE22 H  -7.328   7.674   1.571 1.00 . A A . 164 GLN HE22 1 1 
        3  8654 1 1 164 GLN HG2  H  -8.155  10.866   0.446 1.00 . A A . 164 GLN HG2  1 1 
        3  8655 1 1 164 GLN HG3  H  -7.367  10.706  -1.123 1.00 . A A . 164 GLN HG3  1 1 
        3  8656 1 1 164 GLN N    N  -3.666  11.270   0.615 1.00 . A A . 164 GLN N    1 1 
        3  8657 1 1 164 GLN NE2  N  -7.468   8.622   1.368 1.00 . A A . 164 GLN NE2  1 1 
        3  8658 1 1 164 GLN O    O  -4.687  11.838  -2.623 1.00 . A A . 164 GLN O    1 1 
        3  8659 1 1 164 GLN OE1  O  -6.425   8.385  -0.607 1.00 . A A . 164 GLN OE1  1 1 
        3  8660 1 1 165 TRP C    C  -3.249  15.554  -1.598 1.00 . A A . 165 TRP C    1 1 
        3  8661 1 1 165 TRP CA   C  -4.267  14.522  -2.076 1.00 . A A . 165 TRP CA   1 1 
        3  8662 1 1 165 TRP CB   C  -5.608  15.201  -2.359 1.00 . A A . 165 TRP CB   1 1 
        3  8663 1 1 165 TRP CD1  C  -7.377  14.164  -3.896 1.00 . A A . 165 TRP CD1  1 1 
        3  8664 1 1 165 TRP CD2  C  -5.638  15.071  -4.975 1.00 . A A . 165 TRP CD2  1 1 
        3  8665 1 1 165 TRP CE2  C  -6.529  14.542  -5.927 1.00 . A A . 165 TRP CE2  1 1 
        3  8666 1 1 165 TRP CE3  C  -4.468  15.695  -5.423 1.00 . A A . 165 TRP CE3  1 1 
        3  8667 1 1 165 TRP CG   C  -6.198  14.820  -3.682 1.00 . A A . 165 TRP CG   1 1 
        3  8668 1 1 165 TRP CH2  C  -5.136  15.230  -7.705 1.00 . A A . 165 TRP CH2  1 1 
        3  8669 1 1 165 TRP CZ2  C  -6.288  14.616  -7.297 1.00 . A A . 165 TRP CZ2  1 1 
        3  8670 1 1 165 TRP CZ3  C  -4.230  15.767  -6.782 1.00 . A A . 165 TRP CZ3  1 1 
        3  8671 1 1 165 TRP H    H  -4.398  13.688  -0.134 1.00 . A A . 165 TRP H    1 1 
        3  8672 1 1 165 TRP HA   H  -3.901  14.070  -2.987 1.00 . A A . 165 TRP HA   1 1 
        3  8673 1 1 165 TRP HB2  H  -6.313  14.926  -1.588 1.00 . A A . 165 TRP HB2  1 1 
        3  8674 1 1 165 TRP HB3  H  -5.473  16.273  -2.349 1.00 . A A . 165 TRP HB3  1 1 
        3  8675 1 1 165 TRP HD1  H  -8.040  13.834  -3.111 1.00 . A A . 165 TRP HD1  1 1 
        3  8676 1 1 165 TRP HE1  H  -8.357  13.550  -5.649 1.00 . A A . 165 TRP HE1  1 1 
        3  8677 1 1 165 TRP HE3  H  -3.757  16.114  -4.727 1.00 . A A . 165 TRP HE3  1 1 
        3  8678 1 1 165 TRP HH2  H  -4.908  15.310  -8.758 1.00 . A A . 165 TRP HH2  1 1 
        3  8679 1 1 165 TRP HZ2  H  -6.977  14.207  -8.022 1.00 . A A . 165 TRP HZ2  1 1 
        3  8680 1 1 165 TRP HZ3  H  -3.332  16.244  -7.146 1.00 . A A . 165 TRP HZ3  1 1 
        3  8681 1 1 165 TRP N    N  -4.434  13.463  -1.087 1.00 . A A . 165 TRP N    1 1 
        3  8682 1 1 165 TRP NE1  N  -7.583  13.993  -5.244 1.00 . A A . 165 TRP NE1  1 1 
        3  8683 1 1 165 TRP O    O  -3.288  15.992  -0.448 1.00 . A A . 165 TRP O    1 1 
        3  8684 1 1 166 VAL C    C  -1.818  18.337  -2.358 1.00 . A A . 166 VAL C    1 1 
        3  8685 1 1 166 VAL CA   C  -1.310  16.914  -2.153 1.00 . A A . 166 VAL CA   1 1 
        3  8686 1 1 166 VAL CB   C  -0.041  16.708  -3.004 1.00 . A A . 166 VAL CB   1 1 
        3  8687 1 1 166 VAL CG1  C   0.632  15.391  -2.648 1.00 . A A . 166 VAL CG1  1 1 
        3  8688 1 1 166 VAL CG2  C  -0.377  16.760  -4.486 1.00 . A A . 166 VAL CG2  1 1 
        3  8689 1 1 166 VAL H    H  -2.356  15.548  -3.387 1.00 . A A . 166 VAL H    1 1 
        3  8690 1 1 166 VAL HA   H  -1.047  16.781  -1.114 1.00 . A A . 166 VAL HA   1 1 
        3  8691 1 1 166 VAL HB   H   0.648  17.509  -2.785 1.00 . A A . 166 VAL HB   1 1 
        3  8692 1 1 166 VAL HG11 H  -0.039  14.573  -2.865 1.00 . A A . 166 VAL HG11 1 1 
        3  8693 1 1 166 VAL HG12 H   0.878  15.385  -1.596 1.00 . A A . 166 VAL HG12 1 1 
        3  8694 1 1 166 VAL HG13 H   1.536  15.280  -3.229 1.00 . A A . 166 VAL HG13 1 1 
        3  8695 1 1 166 VAL HG21 H  -0.938  15.878  -4.759 1.00 . A A . 166 VAL HG21 1 1 
        3  8696 1 1 166 VAL HG22 H   0.536  16.799  -5.061 1.00 . A A . 166 VAL HG22 1 1 
        3  8697 1 1 166 VAL HG23 H  -0.969  17.639  -4.691 1.00 . A A . 166 VAL HG23 1 1 
        3  8698 1 1 166 VAL N    N  -2.337  15.935  -2.487 1.00 . A A . 166 VAL N    1 1 
        3  8699 1 1 166 VAL O    O  -1.433  19.253  -1.633 1.00 . A A . 166 VAL O    1 1 
        3  8700 1 1 167 ASN C    C  -4.467  20.107  -2.771 1.00 . A A . 167 ASN C    1 1 
        3  8701 1 1 167 ASN CA   C  -3.248  19.827  -3.644 1.00 . A A . 167 ASN CA   1 1 
        3  8702 1 1 167 ASN CB   C  -3.634  19.917  -5.122 1.00 . A A . 167 ASN CB   1 1 
        3  8703 1 1 167 ASN CG   C  -2.444  20.210  -6.014 1.00 . A A . 167 ASN CG   1 1 
        3  8704 1 1 167 ASN H    H  -2.957  17.744  -3.891 1.00 . A A . 167 ASN H    1 1 
        3  8705 1 1 167 ASN HA   H  -2.491  20.567  -3.433 1.00 . A A . 167 ASN HA   1 1 
        3  8706 1 1 167 ASN HB2  H  -4.068  18.977  -5.432 1.00 . A A . 167 ASN HB2  1 1 
        3  8707 1 1 167 ASN HB3  H  -4.362  20.706  -5.251 1.00 . A A . 167 ASN HB3  1 1 
        3  8708 1 1 167 ASN HD21 H  -3.083  22.073  -6.297 1.00 . A A . 167 ASN HD21 1 1 
        3  8709 1 1 167 ASN HD22 H  -1.613  21.653  -7.103 1.00 . A A . 167 ASN HD22 1 1 
        3  8710 1 1 167 ASN N    N  -2.688  18.514  -3.347 1.00 . A A . 167 ASN N    1 1 
        3  8711 1 1 167 ASN ND2  N  -2.373  21.435  -6.523 1.00 . A A . 167 ASN ND2  1 1 
        3  8712 1 1 167 ASN O    O  -4.986  19.210  -2.106 1.00 . A A . 167 ASN O    1 1 
        3  8713 1 1 167 ASN OD1  O  -1.597  19.347  -6.245 1.00 . A A . 167 ASN OD1  1 1 
        3  8714 1 1 168 ASN C    C  -7.097  22.494  -2.846 1.00 . A A . 168 ASN C    1 1 
        3  8715 1 1 168 ASN CA   C  -6.078  21.753  -1.984 1.00 . A A . 168 ASN CA   1 1 
        3  8716 1 1 168 ASN CB   C  -5.640  22.633  -0.809 1.00 . A A . 168 ASN CB   1 1 
        3  8717 1 1 168 ASN CG   C  -5.912  21.982   0.533 1.00 . A A . 168 ASN CG   1 1 
        3  8718 1 1 168 ASN H    H  -4.463  22.027  -3.326 1.00 . A A . 168 ASN H    1 1 
        3  8719 1 1 168 ASN HA   H  -6.536  20.855  -1.598 1.00 . A A . 168 ASN HA   1 1 
        3  8720 1 1 168 ASN HB2  H  -4.581  22.826  -0.887 1.00 . A A . 168 ASN HB2  1 1 
        3  8721 1 1 168 ASN HB3  H  -6.177  23.570  -0.849 1.00 . A A . 168 ASN HB3  1 1 
        3  8722 1 1 168 ASN HD21 H  -4.184  21.002   0.434 1.00 . A A . 168 ASN HD21 1 1 
        3  8723 1 1 168 ASN HD22 H  -5.131  20.712   1.850 1.00 . A A . 168 ASN HD22 1 1 
        3  8724 1 1 168 ASN N    N  -4.920  21.356  -2.776 1.00 . A A . 168 ASN N    1 1 
        3  8725 1 1 168 ASN ND2  N  -4.981  21.147   0.984 1.00 . A A . 168 ASN ND2  1 1 
        3  8726 1 1 168 ASN O    O  -8.277  22.145  -2.865 1.00 . A A . 168 ASN O    1 1 
        3  8727 1 1 168 ASN OD1  O  -6.943  22.224   1.158 1.00 . A A . 168 ASN OD1  1 1 
        3  8728 1 1 169 ILE C    C  -7.956  23.490  -5.630 1.00 . A A . 169 ILE C    1 1 
        3  8729 1 1 169 ILE CA   C  -7.504  24.302  -4.421 1.00 . A A . 169 ILE CA   1 1 
        3  8730 1 1 169 ILE CB   C  -6.803  25.584  -4.912 1.00 . A A . 169 ILE CB   1 1 
        3  8731 1 1 169 ILE CD1  C  -4.964  26.263  -6.534 1.00 . A A . 169 ILE CD1  1 1 
        3  8732 1 1 169 ILE CG1  C  -5.441  25.248  -5.518 1.00 . A A . 169 ILE CG1  1 1 
        3  8733 1 1 169 ILE CG2  C  -6.651  26.575  -3.767 1.00 . A A . 169 ILE CG2  1 1 
        3  8734 1 1 169 ILE H    H  -5.681  23.744  -3.501 1.00 . A A . 169 ILE H    1 1 
        3  8735 1 1 169 ILE HA   H  -8.373  24.589  -3.846 1.00 . A A . 169 ILE HA   1 1 
        3  8736 1 1 169 ILE HB   H  -7.425  26.040  -5.668 1.00 . A A . 169 ILE HB   1 1 
        3  8737 1 1 169 ILE HD11 H  -4.248  25.800  -7.197 1.00 . A A . 169 ILE HD11 1 1 
        3  8738 1 1 169 ILE HD12 H  -4.501  27.093  -6.025 1.00 . A A . 169 ILE HD12 1 1 
        3  8739 1 1 169 ILE HD13 H  -5.807  26.618  -7.110 1.00 . A A . 169 ILE HD13 1 1 
        3  8740 1 1 169 ILE HG12 H  -4.704  25.199  -4.730 1.00 . A A . 169 ILE HG12 1 1 
        3  8741 1 1 169 ILE HG13 H  -5.499  24.287  -6.010 1.00 . A A . 169 ILE HG13 1 1 
        3  8742 1 1 169 ILE HG21 H  -5.992  27.375  -4.070 1.00 . A A . 169 ILE HG21 1 1 
        3  8743 1 1 169 ILE HG22 H  -6.233  26.071  -2.908 1.00 . A A . 169 ILE HG22 1 1 
        3  8744 1 1 169 ILE HG23 H  -7.618  26.981  -3.513 1.00 . A A . 169 ILE HG23 1 1 
        3  8745 1 1 169 ILE N    N  -6.633  23.516  -3.557 1.00 . A A . 169 ILE N    1 1 
        3  8746 1 1 169 ILE O    O  -7.308  22.516  -6.012 1.00 . A A . 169 ILE O    1 1 
        3  8747 1 1 170 GLY C    C -10.603  24.016  -8.158 1.00 . A A . 170 GLY C    1 1 
        3  8748 1 1 170 GLY CA   C  -9.590  23.194  -7.383 1.00 . A A . 170 GLY CA   1 1 
        3  8749 1 1 170 GLY H    H  -9.547  24.679  -5.876 1.00 . A A . 170 GLY H    1 1 
        3  8750 1 1 170 GLY HA2  H  -8.769  22.945  -8.039 1.00 . A A . 170 GLY HA2  1 1 
        3  8751 1 1 170 GLY HA3  H -10.063  22.280  -7.055 1.00 . A A . 170 GLY HA3  1 1 
        3  8752 1 1 170 GLY N    N  -9.074  23.896  -6.225 1.00 . A A . 170 GLY N    1 1 
        3  8753 1 1 170 GLY O    O -10.245  24.729  -9.096 1.00 . A A . 170 GLY O    1 1 
        3  8754 1 1 171 ASP C    C -13.911  25.236  -7.408 1.00 . A A . 171 ASP C    1 1 
        3  8755 1 1 171 ASP CA   C -12.935  24.657  -8.428 1.00 . A A . 171 ASP CA   1 1 
        3  8756 1 1 171 ASP CB   C -13.680  23.749  -9.408 1.00 . A A . 171 ASP CB   1 1 
        3  8757 1 1 171 ASP CG   C -12.848  23.411 -10.630 1.00 . A A . 171 ASP CG   1 1 
        3  8758 1 1 171 ASP H    H -12.089  23.332  -7.011 1.00 . A A . 171 ASP H    1 1 
        3  8759 1 1 171 ASP HA   H -12.481  25.470  -8.977 1.00 . A A . 171 ASP HA   1 1 
        3  8760 1 1 171 ASP HB2  H -13.941  22.829  -8.908 1.00 . A A . 171 ASP HB2  1 1 
        3  8761 1 1 171 ASP HB3  H -14.581  24.246  -9.734 1.00 . A A . 171 ASP HB3  1 1 
        3  8762 1 1 171 ASP N    N -11.868  23.917  -7.765 1.00 . A A . 171 ASP N    1 1 
        3  8763 1 1 171 ASP O    O -14.186  24.620  -6.380 1.00 . A A . 171 ASP O    1 1 
        3  8764 1 1 171 ASP OD1  O -11.688  22.983 -10.459 1.00 . A A . 171 ASP OD1  1 1 
        3  8765 1 1 171 ASP OD2  O -13.359  23.576 -11.759 1.00 . A A . 171 ASP OD2  1 1 
        3  8766 1 1 172 ALA C    C -16.740  27.237  -7.475 1.00 . A A . 172 ALA C    1 1 
        3  8767 1 1 172 ALA CA   C -15.374  27.086  -6.813 1.00 . A A . 172 ALA CA   1 1 
        3  8768 1 1 172 ALA CB   C -14.839  28.445  -6.392 1.00 . A A . 172 ALA CB   1 1 
        3  8769 1 1 172 ALA H    H -14.170  26.865  -8.538 1.00 . A A . 172 ALA H    1 1 
        3  8770 1 1 172 ALA HA   H -15.481  26.477  -5.926 1.00 . A A . 172 ALA HA   1 1 
        3  8771 1 1 172 ALA HB1  H -15.664  29.121  -6.220 1.00 . A A . 172 ALA HB1  1 1 
        3  8772 1 1 172 ALA HB2  H -14.208  28.841  -7.175 1.00 . A A . 172 ALA HB2  1 1 
        3  8773 1 1 172 ALA HB3  H -14.263  28.341  -5.483 1.00 . A A . 172 ALA HB3  1 1 
        3  8774 1 1 172 ALA N    N -14.429  26.423  -7.703 1.00 . A A . 172 ALA N    1 1 
        3  8775 1 1 172 ALA O    O -16.911  28.042  -8.390 1.00 . A A . 172 ALA O    1 1 
        3  8776 1 1 173 GLY C    C -19.990  27.345  -6.714 1.00 . A A . 173 GLY C    1 1 
        3  8777 1 1 173 GLY CA   C -19.045  26.519  -7.565 1.00 . A A . 173 GLY CA   1 1 
        3  8778 1 1 173 GLY H    H -17.512  25.834  -6.276 1.00 . A A . 173 GLY H    1 1 
        3  8779 1 1 173 GLY HA2  H -18.991  26.954  -8.552 1.00 . A A . 173 GLY HA2  1 1 
        3  8780 1 1 173 GLY HA3  H -19.438  25.515  -7.646 1.00 . A A . 173 GLY HA3  1 1 
        3  8781 1 1 173 GLY N    N -17.708  26.456  -7.006 1.00 . A A . 173 GLY N    1 1 
        3  8782 1 1 173 GLY O    O -20.941  27.936  -7.227 1.00 . A A . 173 GLY O    1 1 
        3  8783 1 1 174 THR C    C -19.719  29.130  -3.680 1.00 . A A . 174 THR C    1 1 
        3  8784 1 1 174 THR CA   C -20.561  28.147  -4.488 1.00 . A A . 174 THR CA   1 1 
        3  8785 1 1 174 THR CB   C -21.306  27.200  -3.545 1.00 . A A . 174 THR CB   1 1 
        3  8786 1 1 174 THR CG2  C -22.155  26.178  -4.270 1.00 . A A . 174 THR CG2  1 1 
        3  8787 1 1 174 THR H    H -18.955  26.893  -5.065 1.00 . A A . 174 THR H    1 1 
        3  8788 1 1 174 THR HA   H -21.281  28.702  -5.070 1.00 . A A . 174 THR HA   1 1 
        3  8789 1 1 174 THR HB   H -21.959  27.782  -2.910 1.00 . A A . 174 THR HB   1 1 
        3  8790 1 1 174 THR HG1  H -19.730  26.073  -3.266 1.00 . A A . 174 THR HG1  1 1 
        3  8791 1 1 174 THR HG21 H -23.016  26.666  -4.700 1.00 . A A . 174 THR HG21 1 1 
        3  8792 1 1 174 THR HG22 H -22.479  25.422  -3.572 1.00 . A A . 174 THR HG22 1 1 
        3  8793 1 1 174 THR HG23 H -21.573  25.719  -5.055 1.00 . A A . 174 THR HG23 1 1 
        3  8794 1 1 174 THR N    N -19.727  27.386  -5.413 1.00 . A A . 174 THR N    1 1 
        3  8795 1 1 174 THR O    O -20.068  30.304  -3.557 1.00 . A A . 174 THR O    1 1 
        3  8796 1 1 174 THR OG1  O -20.395  26.496  -2.719 1.00 . A A . 174 THR OG1  1 1 
        3  8797 1 1 175 VAL C    C -16.308  28.904  -2.309 1.00 . A A . 175 VAL C    1 1 
        3  8798 1 1 175 VAL CA   C -17.721  29.476  -2.335 1.00 . A A . 175 VAL CA   1 1 
        3  8799 1 1 175 VAL CB   C -18.236  29.624  -0.889 1.00 . A A . 175 VAL CB   1 1 
        3  8800 1 1 175 VAL CG1  C -18.296  28.269  -0.200 1.00 . A A . 175 VAL CG1  1 1 
        3  8801 1 1 175 VAL CG2  C -17.360  30.590  -0.104 1.00 . A A . 175 VAL CG2  1 1 
        3  8802 1 1 175 VAL H    H -18.388  27.697  -3.265 1.00 . A A . 175 VAL H    1 1 
        3  8803 1 1 175 VAL HA   H -17.692  30.457  -2.787 1.00 . A A . 175 VAL HA   1 1 
        3  8804 1 1 175 VAL HB   H -19.236  30.029  -0.926 1.00 . A A . 175 VAL HB   1 1 
        3  8805 1 1 175 VAL HG11 H -19.191  28.212   0.404 1.00 . A A . 175 VAL HG11 1 1 
        3  8806 1 1 175 VAL HG12 H -17.428  28.146   0.430 1.00 . A A . 175 VAL HG12 1 1 
        3  8807 1 1 175 VAL HG13 H -18.314  27.487  -0.944 1.00 . A A . 175 VAL HG13 1 1 
        3  8808 1 1 175 VAL HG21 H -16.461  30.085   0.215 1.00 . A A . 175 VAL HG21 1 1 
        3  8809 1 1 175 VAL HG22 H -17.901  30.946   0.760 1.00 . A A . 175 VAL HG22 1 1 
        3  8810 1 1 175 VAL HG23 H -17.097  31.429  -0.733 1.00 . A A . 175 VAL HG23 1 1 
        3  8811 1 1 175 VAL N    N -18.611  28.641  -3.132 1.00 . A A . 175 VAL N    1 1 
        3  8812 1 1 175 VAL O    O -16.102  27.715  -2.552 1.00 . A A . 175 VAL O    1 1 
        3  8813 1 1 176 GLY C    C -13.574  28.767  -0.599 1.00 . A A . 176 GLY C    1 1 
        3  8814 1 1 176 GLY CA   C -13.952  29.321  -1.958 1.00 . A A . 176 GLY CA   1 1 
        3  8815 1 1 176 GLY H    H -15.556  30.696  -1.828 1.00 . A A . 176 GLY H    1 1 
        3  8816 1 1 176 GLY HA2  H -13.799  28.554  -2.704 1.00 . A A . 176 GLY HA2  1 1 
        3  8817 1 1 176 GLY HA3  H -13.310  30.160  -2.184 1.00 . A A . 176 GLY HA3  1 1 
        3  8818 1 1 176 GLY N    N -15.335  29.759  -2.012 1.00 . A A . 176 GLY N    1 1 
        3  8819 1 1 176 GLY O    O -12.618  29.229   0.023 1.00 . A A . 176 GLY O    1 1 
        3  8820 1 1 177 THR C    C -14.235  25.641   1.080 1.00 . A A . 177 THR C    1 1 
        3  8821 1 1 177 THR CA   C -14.069  27.157   1.158 1.00 . A A . 177 THR CA   1 1 
        3  8822 1 1 177 THR CB   C -15.011  27.734   2.219 1.00 . A A . 177 THR CB   1 1 
        3  8823 1 1 177 THR CG2  C -14.476  27.604   3.628 1.00 . A A . 177 THR CG2  1 1 
        3  8824 1 1 177 THR H    H -15.076  27.452  -0.680 1.00 . A A . 177 THR H    1 1 
        3  8825 1 1 177 THR HA   H -13.049  27.382   1.434 1.00 . A A . 177 THR HA   1 1 
        3  8826 1 1 177 THR HB   H -15.953  27.206   2.172 1.00 . A A . 177 THR HB   1 1 
        3  8827 1 1 177 THR HG1  H -14.423  29.579   1.929 1.00 . A A . 177 THR HG1  1 1 
        3  8828 1 1 177 THR HG21 H -14.525  28.564   4.120 1.00 . A A . 177 THR HG21 1 1 
        3  8829 1 1 177 THR HG22 H -13.452  27.268   3.595 1.00 . A A . 177 THR HG22 1 1 
        3  8830 1 1 177 THR HG23 H -15.072  26.888   4.175 1.00 . A A . 177 THR HG23 1 1 
        3  8831 1 1 177 THR N    N -14.328  27.775  -0.137 1.00 . A A . 177 THR N    1 1 
        3  8832 1 1 177 THR O    O -15.061  25.058   1.780 1.00 . A A . 177 THR O    1 1 
        3  8833 1 1 177 THR OG1  O -15.258  29.107   1.975 1.00 . A A . 177 THR OG1  1 1 
        3  8834 1 1 178 ARG C    C -12.744  22.849   1.166 1.00 . A A . 178 ARG C    1 1 
        3  8835 1 1 178 ARG CA   C -13.500  23.562   0.048 1.00 . A A . 178 ARG CA   1 1 
        3  8836 1 1 178 ARG CB   C -12.917  23.166  -1.311 1.00 . A A . 178 ARG CB   1 1 
        3  8837 1 1 178 ARG CD   C -12.498  24.024  -3.635 1.00 . A A . 178 ARG CD   1 1 
        3  8838 1 1 178 ARG CG   C -13.474  23.975  -2.471 1.00 . A A . 178 ARG CG   1 1 
        3  8839 1 1 178 ARG CZ   C -11.142  26.039  -3.223 1.00 . A A . 178 ARG CZ   1 1 
        3  8840 1 1 178 ARG H    H -12.803  25.529  -0.312 1.00 . A A . 178 ARG H    1 1 
        3  8841 1 1 178 ARG HA   H -14.538  23.266   0.084 1.00 . A A . 178 ARG HA   1 1 
        3  8842 1 1 178 ARG HB2  H -11.847  23.305  -1.285 1.00 . A A . 178 ARG HB2  1 1 
        3  8843 1 1 178 ARG HB3  H -13.132  22.123  -1.490 1.00 . A A . 178 ARG HB3  1 1 
        3  8844 1 1 178 ARG HD2  H -12.261  23.012  -3.932 1.00 . A A . 178 ARG HD2  1 1 
        3  8845 1 1 178 ARG HD3  H -12.966  24.541  -4.460 1.00 . A A . 178 ARG HD3  1 1 
        3  8846 1 1 178 ARG HE   H -10.476  24.163  -3.077 1.00 . A A . 178 ARG HE   1 1 
        3  8847 1 1 178 ARG HG2  H -14.394  23.518  -2.806 1.00 . A A . 178 ARG HG2  1 1 
        3  8848 1 1 178 ARG HG3  H -13.672  24.980  -2.135 1.00 . A A . 178 ARG HG3  1 1 
        3  8849 1 1 178 ARG HH11 H -13.060  26.412  -3.747 1.00 . A A . 178 ARG HH11 1 1 
        3  8850 1 1 178 ARG HH12 H -12.086  27.813  -3.450 1.00 . A A . 178 ARG HH12 1 1 
        3  8851 1 1 178 ARG HH21 H  -9.195  26.005  -2.684 1.00 . A A . 178 ARG HH21 1 1 
        3  8852 1 1 178 ARG HH22 H  -9.892  27.582  -2.846 1.00 . A A . 178 ARG HH22 1 1 
        3  8853 1 1 178 ARG N    N -13.442  25.009   0.220 1.00 . A A . 178 ARG N    1 1 
        3  8854 1 1 178 ARG NE   N -11.260  24.714  -3.281 1.00 . A A . 178 ARG NE   1 1 
        3  8855 1 1 178 ARG NH1  N -12.182  26.818  -3.495 1.00 . A A . 178 ARG NH1  1 1 
        3  8856 1 1 178 ARG NH2  N  -9.981  26.587  -2.890 1.00 . A A . 178 ARG NH2  1 1 
        3  8857 1 1 178 ARG O    O -11.840  23.419   1.778 1.00 . A A . 178 ARG O    1 1 
        3  8858 1 1 179 PRO C    C -10.942  20.772   2.355 1.00 . A A . 179 PRO C    1 1 
        3  8859 1 1 179 PRO CA   C -12.460  20.796   2.502 1.00 . A A . 179 PRO CA   1 1 
        3  8860 1 1 179 PRO CB   C -13.038  19.394   2.303 1.00 . A A . 179 PRO CB   1 1 
        3  8861 1 1 179 PRO CD   C -14.177  20.833   0.769 1.00 . A A . 179 PRO CD   1 1 
        3  8862 1 1 179 PRO CG   C -14.352  19.617   1.638 1.00 . A A . 179 PRO CG   1 1 
        3  8863 1 1 179 PRO HA   H -12.719  21.159   3.485 1.00 . A A . 179 PRO HA   1 1 
        3  8864 1 1 179 PRO HB2  H -12.374  18.812   1.681 1.00 . A A . 179 PRO HB2  1 1 
        3  8865 1 1 179 PRO HB3  H -13.160  18.912   3.261 1.00 . A A . 179 PRO HB3  1 1 
        3  8866 1 1 179 PRO HD2  H -13.873  20.545  -0.226 1.00 . A A . 179 PRO HD2  1 1 
        3  8867 1 1 179 PRO HD3  H -15.091  21.407   0.735 1.00 . A A . 179 PRO HD3  1 1 
        3  8868 1 1 179 PRO HG2  H -14.609  18.759   1.034 1.00 . A A . 179 PRO HG2  1 1 
        3  8869 1 1 179 PRO HG3  H -15.115  19.795   2.382 1.00 . A A . 179 PRO HG3  1 1 
        3  8870 1 1 179 PRO N    N -13.109  21.587   1.450 1.00 . A A . 179 PRO N    1 1 
        3  8871 1 1 179 PRO O    O -10.418  20.581   1.258 1.00 . A A . 179 PRO O    1 1 
        3  8872 1 1 180 ASP C    C  -8.238  19.630   3.950 1.00 . A A . 180 ASP C    1 1 
        3  8873 1 1 180 ASP CA   C  -8.785  20.967   3.463 1.00 . A A . 180 ASP CA   1 1 
        3  8874 1 1 180 ASP CB   C  -8.253  22.098   4.345 1.00 . A A . 180 ASP CB   1 1 
        3  8875 1 1 180 ASP CG   C  -8.755  22.004   5.771 1.00 . A A . 180 ASP CG   1 1 
        3  8876 1 1 180 ASP H    H -10.718  21.113   4.312 1.00 . A A . 180 ASP H    1 1 
        3  8877 1 1 180 ASP HA   H  -8.456  21.129   2.447 1.00 . A A . 180 ASP HA   1 1 
        3  8878 1 1 180 ASP HB2  H  -7.173  22.059   4.360 1.00 . A A . 180 ASP HB2  1 1 
        3  8879 1 1 180 ASP HB3  H  -8.569  23.046   3.933 1.00 . A A . 180 ASP HB3  1 1 
        3  8880 1 1 180 ASP N    N -10.243  20.967   3.467 1.00 . A A . 180 ASP N    1 1 
        3  8881 1 1 180 ASP O    O  -8.835  18.980   4.808 1.00 . A A . 180 ASP O    1 1 
        3  8882 1 1 180 ASP OD1  O  -9.981  22.124   5.979 1.00 . A A . 180 ASP OD1  1 1 
        3  8883 1 1 180 ASP OD2  O  -7.923  21.809   6.682 1.00 . A A . 180 ASP OD2  1 1 
        3  8884 1 1 181 ASN C    C  -7.393  16.786   3.485 1.00 . A A . 181 ASN C    1 1 
        3  8885 1 1 181 ASN CA   C  -6.470  17.965   3.781 1.00 . A A . 181 ASN CA   1 1 
        3  8886 1 1 181 ASN CB   C  -6.105  17.984   5.268 1.00 . A A . 181 ASN CB   1 1 
        3  8887 1 1 181 ASN CG   C  -4.643  17.662   5.508 1.00 . A A . 181 ASN CG   1 1 
        3  8888 1 1 181 ASN H    H  -6.669  19.787   2.723 1.00 . A A . 181 ASN H    1 1 
        3  8889 1 1 181 ASN HA   H  -5.568  17.855   3.199 1.00 . A A . 181 ASN HA   1 1 
        3  8890 1 1 181 ASN HB2  H  -6.306  18.966   5.669 1.00 . A A . 181 ASN HB2  1 1 
        3  8891 1 1 181 ASN HB3  H  -6.706  17.256   5.792 1.00 . A A . 181 ASN HB3  1 1 
        3  8892 1 1 181 ASN HD21 H  -5.067  15.723   5.638 1.00 . A A . 181 ASN HD21 1 1 
        3  8893 1 1 181 ASN HD22 H  -3.402  16.142   5.834 1.00 . A A . 181 ASN HD22 1 1 
        3  8894 1 1 181 ASN N    N  -7.098  19.225   3.400 1.00 . A A . 181 ASN N    1 1 
        3  8895 1 1 181 ASN ND2  N  -4.341  16.381   5.676 1.00 . A A . 181 ASN ND2  1 1 
        3  8896 1 1 181 ASN O    O  -8.602  16.956   3.327 1.00 . A A . 181 ASN O    1 1 
        3  8897 1 1 181 ASN OD1  O  -3.796  18.553   5.540 1.00 . A A . 181 ASN OD1  1 1 
        3  8898 1 1 182 GLY C    C  -7.297  13.270   4.090 1.00 . A A . 182 GLY C    1 1 
        3  8899 1 1 182 GLY CA   C  -7.599  14.403   3.131 1.00 . A A . 182 GLY CA   1 1 
        3  8900 1 1 182 GLY H    H  -5.846  15.518   3.543 1.00 . A A . 182 GLY H    1 1 
        3  8901 1 1 182 GLY HA2  H  -8.647  14.652   3.202 1.00 . A A . 182 GLY HA2  1 1 
        3  8902 1 1 182 GLY HA3  H  -7.386  14.073   2.124 1.00 . A A . 182 GLY HA3  1 1 
        3  8903 1 1 182 GLY N    N  -6.814  15.592   3.408 1.00 . A A . 182 GLY N    1 1 
        3  8904 1 1 182 GLY O    O  -7.986  13.099   5.095 1.00 . A A . 182 GLY O    1 1 
        3  8905 1 1 183 MET C    C  -4.363  11.152   4.575 1.00 . A A . 183 MET C    1 1 
        3  8906 1 1 183 MET CA   C  -5.873  11.371   4.625 1.00 . A A . 183 MET CA   1 1 
        3  8907 1 1 183 MET CB   C  -6.602  10.099   4.186 1.00 . A A . 183 MET CB   1 1 
        3  8908 1 1 183 MET CE   C  -9.905   9.319   5.143 1.00 . A A . 183 MET CE   1 1 
        3  8909 1 1 183 MET CG   C  -7.142   9.276   5.345 1.00 . A A . 183 MET CG   1 1 
        3  8910 1 1 183 MET H    H  -5.752  12.680   2.966 1.00 . A A . 183 MET H    1 1 
        3  8911 1 1 183 MET HA   H  -6.157  11.605   5.639 1.00 . A A . 183 MET HA   1 1 
        3  8912 1 1 183 MET HB2  H  -7.431  10.375   3.551 1.00 . A A . 183 MET HB2  1 1 
        3  8913 1 1 183 MET HB3  H  -5.919   9.480   3.621 1.00 . A A . 183 MET HB3  1 1 
        3  8914 1 1 183 MET HE1  H -10.559   8.748   5.786 1.00 . A A . 183 MET HE1  1 1 
        3  8915 1 1 183 MET HE2  H  -9.486   8.669   4.389 1.00 . A A . 183 MET HE2  1 1 
        3  8916 1 1 183 MET HE3  H -10.468  10.108   4.667 1.00 . A A . 183 MET HE3  1 1 
        3  8917 1 1 183 MET HG2  H  -7.420   8.300   4.977 1.00 . A A . 183 MET HG2  1 1 
        3  8918 1 1 183 MET HG3  H  -6.365   9.172   6.087 1.00 . A A . 183 MET HG3  1 1 
        3  8919 1 1 183 MET N    N  -6.263  12.494   3.781 1.00 . A A . 183 MET N    1 1 
        3  8920 1 1 183 MET O    O  -3.719  11.424   3.561 1.00 . A A . 183 MET O    1 1 
        3  8921 1 1 183 MET SD   S  -8.584  10.032   6.119 1.00 . A A . 183 MET SD   1 1 
        3  8922 1 1 184 LEU C    C  -2.102   9.001   6.288 1.00 . A A . 184 LEU C    1 1 
        3  8923 1 1 184 LEU CA   C  -2.373  10.406   5.759 1.00 . A A . 184 LEU CA   1 1 
        3  8924 1 1 184 LEU CB   C  -1.703  11.445   6.662 1.00 . A A . 184 LEU CB   1 1 
        3  8925 1 1 184 LEU CD1  C  -3.417  13.123   7.389 1.00 . A A . 184 LEU CD1  1 1 
        3  8926 1 1 184 LEU CD2  C  -1.110  13.879   6.783 1.00 . A A . 184 LEU CD2  1 1 
        3  8927 1 1 184 LEU CG   C  -2.217  12.876   6.489 1.00 . A A . 184 LEU CG   1 1 
        3  8928 1 1 184 LEU H    H  -4.372  10.464   6.451 1.00 . A A . 184 LEU H    1 1 
        3  8929 1 1 184 LEU HA   H  -1.964  10.488   4.763 1.00 . A A . 184 LEU HA   1 1 
        3  8930 1 1 184 LEU HB2  H  -1.855  11.150   7.689 1.00 . A A . 184 LEU HB2  1 1 
        3  8931 1 1 184 LEU HB3  H  -0.644  11.439   6.456 1.00 . A A . 184 LEU HB3  1 1 
        3  8932 1 1 184 LEU HD11 H  -3.161  12.875   8.408 1.00 . A A . 184 LEU HD11 1 1 
        3  8933 1 1 184 LEU HD12 H  -4.243  12.507   7.065 1.00 . A A . 184 LEU HD12 1 1 
        3  8934 1 1 184 LEU HD13 H  -3.701  14.164   7.333 1.00 . A A . 184 LEU HD13 1 1 
        3  8935 1 1 184 LEU HD21 H  -0.150  13.408   6.634 1.00 . A A . 184 LEU HD21 1 1 
        3  8936 1 1 184 LEU HD22 H  -1.193  14.214   7.806 1.00 . A A . 184 LEU HD22 1 1 
        3  8937 1 1 184 LEU HD23 H  -1.206  14.724   6.118 1.00 . A A . 184 LEU HD23 1 1 
        3  8938 1 1 184 LEU HG   H  -2.532  13.017   5.465 1.00 . A A . 184 LEU HG   1 1 
        3  8939 1 1 184 LEU N    N  -3.806  10.660   5.676 1.00 . A A . 184 LEU N    1 1 
        3  8940 1 1 184 LEU O    O  -2.737   8.554   7.244 1.00 . A A . 184 LEU O    1 1 
        3  8941 1 1 185 SER C    C   0.701   6.740   6.035 1.00 . A A . 185 SER C    1 1 
        3  8942 1 1 185 SER CA   C  -0.810   6.950   6.066 1.00 . A A . 185 SER CA   1 1 
        3  8943 1 1 185 SER CB   C  -1.497   5.931   5.156 1.00 . A A . 185 SER CB   1 1 
        3  8944 1 1 185 SER H    H  -0.690   8.715   4.903 1.00 . A A . 185 SER H    1 1 
        3  8945 1 1 185 SER HA   H  -1.160   6.808   7.078 1.00 . A A . 185 SER HA   1 1 
        3  8946 1 1 185 SER HB2  H  -2.538   6.194   5.047 1.00 . A A . 185 SER HB2  1 1 
        3  8947 1 1 185 SER HB3  H  -1.020   5.940   4.187 1.00 . A A . 185 SER HB3  1 1 
        3  8948 1 1 185 SER HG   H  -2.295   4.268   5.813 1.00 . A A . 185 SER HG   1 1 
        3  8949 1 1 185 SER N    N  -1.160   8.306   5.660 1.00 . A A . 185 SER N    1 1 
        3  8950 1 1 185 SER O    O   1.404   7.323   5.209 1.00 . A A . 185 SER O    1 1 
        3  8951 1 1 185 SER OG   O  -1.411   4.625   5.696 1.00 . A A . 185 SER OG   1 1 
        3  8952 1 1 186 LEU C    C   2.859   4.098   6.864 1.00 . A A . 186 LEU C    1 1 
        3  8953 1 1 186 LEU CA   C   2.619   5.597   7.014 1.00 . A A . 186 LEU CA   1 1 
        3  8954 1 1 186 LEU CB   C   3.214   6.088   8.343 1.00 . A A . 186 LEU CB   1 1 
        3  8955 1 1 186 LEU CD1  C   1.469   6.424  10.114 1.00 . A A . 186 LEU CD1  1 1 
        3  8956 1 1 186 LEU CD2  C   3.274   8.129   9.805 1.00 . A A . 186 LEU CD2  1 1 
        3  8957 1 1 186 LEU CG   C   2.374   7.119   9.106 1.00 . A A . 186 LEU CG   1 1 
        3  8958 1 1 186 LEU H    H   0.576   5.453   7.567 1.00 . A A . 186 LEU H    1 1 
        3  8959 1 1 186 LEU HA   H   3.107   6.110   6.199 1.00 . A A . 186 LEU HA   1 1 
        3  8960 1 1 186 LEU HB2  H   3.360   5.231   8.986 1.00 . A A . 186 LEU HB2  1 1 
        3  8961 1 1 186 LEU HB3  H   4.178   6.528   8.137 1.00 . A A . 186 LEU HB3  1 1 
        3  8962 1 1 186 LEU HD11 H   1.359   7.049  10.989 1.00 . A A . 186 LEU HD11 1 1 
        3  8963 1 1 186 LEU HD12 H   1.904   5.479  10.399 1.00 . A A . 186 LEU HD12 1 1 
        3  8964 1 1 186 LEU HD13 H   0.499   6.255   9.670 1.00 . A A . 186 LEU HD13 1 1 
        3  8965 1 1 186 LEU HD21 H   2.724   9.042   9.980 1.00 . A A . 186 LEU HD21 1 1 
        3  8966 1 1 186 LEU HD22 H   4.133   8.338   9.185 1.00 . A A . 186 LEU HD22 1 1 
        3  8967 1 1 186 LEU HD23 H   3.605   7.725  10.750 1.00 . A A . 186 LEU HD23 1 1 
        3  8968 1 1 186 LEU HG   H   1.749   7.653   8.407 1.00 . A A . 186 LEU HG   1 1 
        3  8969 1 1 186 LEU N    N   1.191   5.894   6.940 1.00 . A A . 186 LEU N    1 1 
        3  8970 1 1 186 LEU O    O   2.196   3.290   7.514 1.00 . A A . 186 LEU O    1 1 
        3  8971 1 1 187 GLY C    C   5.543   2.048   5.466 1.00 . A A . 187 GLY C    1 1 
        3  8972 1 1 187 GLY CA   C   4.089   2.319   5.796 1.00 . A A . 187 GLY CA   1 1 
        3  8973 1 1 187 GLY H    H   4.301   4.412   5.503 1.00 . A A . 187 GLY H    1 1 
        3  8974 1 1 187 GLY HA2  H   3.831   1.778   6.694 1.00 . A A . 187 GLY HA2  1 1 
        3  8975 1 1 187 GLY HA3  H   3.475   1.956   4.984 1.00 . A A . 187 GLY HA3  1 1 
        3  8976 1 1 187 GLY N    N   3.801   3.728   6.002 1.00 . A A . 187 GLY N    1 1 
        3  8977 1 1 187 GLY O    O   6.308   2.969   5.179 1.00 . A A . 187 GLY O    1 1 
        3  8978 1 1 188 VAL C    C   7.289  -0.734   4.134 1.00 . A A . 188 VAL C    1 1 
        3  8979 1 1 188 VAL CA   C   7.285   0.363   5.192 1.00 . A A . 188 VAL CA   1 1 
        3  8980 1 1 188 VAL CB   C   8.032  -0.137   6.447 1.00 . A A . 188 VAL CB   1 1 
        3  8981 1 1 188 VAL CG1  C   8.602   1.033   7.231 1.00 . A A . 188 VAL CG1  1 1 
        3  8982 1 1 188 VAL CG2  C   7.118  -0.981   7.325 1.00 . A A . 188 VAL CG2  1 1 
        3  8983 1 1 188 VAL H    H   5.254   0.086   5.725 1.00 . A A . 188 VAL H    1 1 
        3  8984 1 1 188 VAL HA   H   7.811   1.224   4.803 1.00 . A A . 188 VAL HA   1 1 
        3  8985 1 1 188 VAL HB   H   8.857  -0.757   6.124 1.00 . A A . 188 VAL HB   1 1 
        3  8986 1 1 188 VAL HG11 H   8.698   1.890   6.580 1.00 . A A . 188 VAL HG11 1 1 
        3  8987 1 1 188 VAL HG12 H   9.573   0.768   7.620 1.00 . A A . 188 VAL HG12 1 1 
        3  8988 1 1 188 VAL HG13 H   7.940   1.275   8.049 1.00 . A A . 188 VAL HG13 1 1 
        3  8989 1 1 188 VAL HG21 H   7.709  -1.491   8.074 1.00 . A A . 188 VAL HG21 1 1 
        3  8990 1 1 188 VAL HG22 H   6.602  -1.709   6.718 1.00 . A A . 188 VAL HG22 1 1 
        3  8991 1 1 188 VAL HG23 H   6.397  -0.342   7.814 1.00 . A A . 188 VAL HG23 1 1 
        3  8992 1 1 188 VAL N    N   5.918   0.772   5.498 1.00 . A A . 188 VAL N    1 1 
        3  8993 1 1 188 VAL O    O   6.407  -1.592   4.116 1.00 . A A . 188 VAL O    1 1 
        3  8994 1 1 189 SER C    C   9.826  -2.080   1.912 1.00 . A A . 189 SER C    1 1 
        3  8995 1 1 189 SER CA   C   8.377  -1.694   2.184 1.00 . A A . 189 SER CA   1 1 
        3  8996 1 1 189 SER CB   C   7.733  -1.159   0.904 1.00 . A A . 189 SER CB   1 1 
        3  8997 1 1 189 SER H    H   8.954   0.009   3.303 1.00 . A A . 189 SER H    1 1 
        3  8998 1 1 189 SER HA   H   7.837  -2.574   2.504 1.00 . A A . 189 SER HA   1 1 
        3  8999 1 1 189 SER HB2  H   8.497  -0.736   0.268 1.00 . A A . 189 SER HB2  1 1 
        3  9000 1 1 189 SER HB3  H   7.242  -1.970   0.384 1.00 . A A . 189 SER HB3  1 1 
        3  9001 1 1 189 SER HG   H   6.196  -0.460   1.896 1.00 . A A . 189 SER HG   1 1 
        3  9002 1 1 189 SER N    N   8.280  -0.700   3.246 1.00 . A A . 189 SER N    1 1 
        3  9003 1 1 189 SER O    O  10.756  -1.481   2.457 1.00 . A A . 189 SER O    1 1 
        3  9004 1 1 189 SER OG   O   6.775  -0.156   1.193 1.00 . A A . 189 SER OG   1 1 
        3  9005 1 1 190 TYR C    C  11.422  -3.848  -0.791 1.00 . A A . 190 TYR C    1 1 
        3  9006 1 1 190 TYR CA   C  11.337  -3.561   0.705 1.00 . A A . 190 TYR CA   1 1 
        3  9007 1 1 190 TYR CB   C  11.677  -4.824   1.499 1.00 . A A . 190 TYR CB   1 1 
        3  9008 1 1 190 TYR CD1  C   9.538  -5.827   2.385 1.00 . A A . 190 TYR CD1  1 1 
        3  9009 1 1 190 TYR CD2  C  10.599  -6.895   0.538 1.00 . A A . 190 TYR CD2  1 1 
        3  9010 1 1 190 TYR CE1  C   8.537  -6.778   2.366 1.00 . A A . 190 TYR CE1  1 1 
        3  9011 1 1 190 TYR CE2  C   9.601  -7.851   0.511 1.00 . A A . 190 TYR CE2  1 1 
        3  9012 1 1 190 TYR CG   C  10.585  -5.869   1.473 1.00 . A A . 190 TYR CG   1 1 
        3  9013 1 1 190 TYR CZ   C   8.572  -7.788   1.427 1.00 . A A . 190 TYR CZ   1 1 
        3  9014 1 1 190 TYR H    H   9.224  -3.517   0.662 1.00 . A A . 190 TYR H    1 1 
        3  9015 1 1 190 TYR HA   H  12.046  -2.785   0.952 1.00 . A A . 190 TYR HA   1 1 
        3  9016 1 1 190 TYR HB2  H  12.571  -5.270   1.086 1.00 . A A . 190 TYR HB2  1 1 
        3  9017 1 1 190 TYR HB3  H  11.859  -4.554   2.529 1.00 . A A . 190 TYR HB3  1 1 
        3  9018 1 1 190 TYR HD1  H   9.511  -5.035   3.119 1.00 . A A . 190 TYR HD1  1 1 
        3  9019 1 1 190 TYR HD2  H  11.407  -6.941  -0.178 1.00 . A A . 190 TYR HD2  1 1 
        3  9020 1 1 190 TYR HE1  H   7.729  -6.730   3.083 1.00 . A A . 190 TYR HE1  1 1 
        3  9021 1 1 190 TYR HE2  H   9.631  -8.642  -0.223 1.00 . A A . 190 TYR HE2  1 1 
        3  9022 1 1 190 TYR HH   H   7.329  -8.964   2.305 1.00 . A A . 190 TYR HH   1 1 
        3  9023 1 1 190 TYR N    N  10.007  -3.085   1.062 1.00 . A A . 190 TYR N    1 1 
        3  9024 1 1 190 TYR O    O  10.401  -4.029  -1.457 1.00 . A A . 190 TYR O    1 1 
        3  9025 1 1 190 TYR OH   O   7.578  -8.738   1.405 1.00 . A A . 190 TYR OH   1 1 
        3  9026 1 1 191 ARG C    C  13.558  -5.489  -2.938 1.00 . A A . 191 ARG C    1 1 
        3  9027 1 1 191 ARG CA   C  12.857  -4.151  -2.732 1.00 . A A . 191 ARG CA   1 1 
        3  9028 1 1 191 ARG CB   C  13.685  -3.028  -3.361 1.00 . A A . 191 ARG CB   1 1 
        3  9029 1 1 191 ARG CD   C  15.045  -1.324  -2.104 1.00 . A A . 191 ARG CD   1 1 
        3  9030 1 1 191 ARG CG   C  14.989  -2.750  -2.629 1.00 . A A . 191 ARG CG   1 1 
        3  9031 1 1 191 ARG CZ   C  16.961  -0.310  -3.274 1.00 . A A . 191 ARG CZ   1 1 
        3  9032 1 1 191 ARG H    H  13.417  -3.735  -0.733 1.00 . A A . 191 ARG H    1 1 
        3  9033 1 1 191 ARG HA   H  11.892  -4.185  -3.214 1.00 . A A . 191 ARG HA   1 1 
        3  9034 1 1 191 ARG HB2  H  13.919  -3.297  -4.380 1.00 . A A . 191 ARG HB2  1 1 
        3  9035 1 1 191 ARG HB3  H  13.098  -2.122  -3.363 1.00 . A A . 191 ARG HB3  1 1 
        3  9036 1 1 191 ARG HD2  H  14.040  -0.994  -1.889 1.00 . A A . 191 ARG HD2  1 1 
        3  9037 1 1 191 ARG HD3  H  15.628  -1.312  -1.195 1.00 . A A . 191 ARG HD3  1 1 
        3  9038 1 1 191 ARG HE   H  15.047   0.163  -3.589 1.00 . A A . 191 ARG HE   1 1 
        3  9039 1 1 191 ARG HG2  H  15.077  -3.433  -1.798 1.00 . A A . 191 ARG HG2  1 1 
        3  9040 1 1 191 ARG HG3  H  15.813  -2.905  -3.312 1.00 . A A . 191 ARG HG3  1 1 
        3  9041 1 1 191 ARG HH11 H  17.462  -1.717  -1.911 1.00 . A A . 191 ARG HH11 1 1 
        3  9042 1 1 191 ARG HH12 H  18.791  -0.988  -2.749 1.00 . A A . 191 ARG HH12 1 1 
        3  9043 1 1 191 ARG HH21 H  16.795   1.122  -4.691 1.00 . A A . 191 ARG HH21 1 1 
        3  9044 1 1 191 ARG HH22 H  18.413   0.623  -4.326 1.00 . A A . 191 ARG HH22 1 1 
        3  9045 1 1 191 ARG N    N  12.643  -3.887  -1.314 1.00 . A A . 191 ARG N    1 1 
        3  9046 1 1 191 ARG NE   N  15.650  -0.408  -3.068 1.00 . A A . 191 ARG NE   1 1 
        3  9047 1 1 191 ARG NH1  N  17.807  -1.067  -2.588 1.00 . A A . 191 ARG NH1  1 1 
        3  9048 1 1 191 ARG NH2  N  17.428   0.549  -4.170 1.00 . A A . 191 ARG NH2  1 1 
        3  9049 1 1 191 ARG O    O  14.444  -5.863  -2.170 1.00 . A A . 191 ARG O    1 1 
        3  9050 1 1 192 PHE C    C  14.921  -7.352  -5.251 1.00 . A A . 192 PHE C    1 1 
        3  9051 1 1 192 PHE CA   C  13.744  -7.505  -4.292 1.00 . A A . 192 PHE CA   1 1 
        3  9052 1 1 192 PHE CB   C  12.693  -8.432  -4.904 1.00 . A A . 192 PHE CB   1 1 
        3  9053 1 1 192 PHE CD1  C  12.285 -10.134  -3.105 1.00 . A A . 192 PHE CD1  1 1 
        3  9054 1 1 192 PHE CD2  C  10.500  -8.671  -3.706 1.00 . A A . 192 PHE CD2  1 1 
        3  9055 1 1 192 PHE CE1  C  11.473 -10.745  -2.167 1.00 . A A . 192 PHE CE1  1 1 
        3  9056 1 1 192 PHE CE2  C   9.684  -9.277  -2.770 1.00 . A A . 192 PHE CE2  1 1 
        3  9057 1 1 192 PHE CG   C  11.808  -9.092  -3.884 1.00 . A A . 192 PHE CG   1 1 
        3  9058 1 1 192 PHE CZ   C  10.172 -10.315  -2.000 1.00 . A A . 192 PHE CZ   1 1 
        3  9059 1 1 192 PHE H    H  12.446  -5.855  -4.559 1.00 . A A . 192 PHE H    1 1 
        3  9060 1 1 192 PHE HA   H  14.100  -7.936  -3.369 1.00 . A A . 192 PHE HA   1 1 
        3  9061 1 1 192 PHE HB2  H  12.062  -7.861  -5.569 1.00 . A A . 192 PHE HB2  1 1 
        3  9062 1 1 192 PHE HB3  H  13.191  -9.209  -5.465 1.00 . A A . 192 PHE HB3  1 1 
        3  9063 1 1 192 PHE HD1  H  13.303 -10.470  -3.235 1.00 . A A . 192 PHE HD1  1 1 
        3  9064 1 1 192 PHE HD2  H  10.119  -7.860  -4.308 1.00 . A A . 192 PHE HD2  1 1 
        3  9065 1 1 192 PHE HE1  H  11.856 -11.555  -1.566 1.00 . A A . 192 PHE HE1  1 1 
        3  9066 1 1 192 PHE HE2  H   8.667  -8.939  -2.640 1.00 . A A . 192 PHE HE2  1 1 
        3  9067 1 1 192 PHE HZ   H   9.535 -10.790  -1.267 1.00 . A A . 192 PHE HZ   1 1 
        3  9068 1 1 192 PHE N    N  13.155  -6.207  -3.983 1.00 . A A . 192 PHE N    1 1 
        3  9069 1 1 192 PHE O    O  14.737  -7.088  -6.439 1.00 . A A . 192 PHE O    1 1 
        3  9070 1 1 193 GLY C    C  18.176  -8.648  -5.526 1.00 . A A . 193 GLY C    1 1 
        3  9071 1 1 193 GLY CA   C  17.320  -7.397  -5.550 1.00 . A A . 193 GLY CA   1 1 
        3  9072 1 1 193 GLY H    H  16.217  -7.731  -3.773 1.00 . A A . 193 GLY H    1 1 
        3  9073 1 1 193 GLY HA2  H  17.020  -7.199  -6.570 1.00 . A A . 193 GLY HA2  1 1 
        3  9074 1 1 193 GLY HA3  H  17.908  -6.565  -5.191 1.00 . A A . 193 GLY HA3  1 1 
        3  9075 1 1 193 GLY N    N  16.132  -7.521  -4.727 1.00 . A A . 193 GLY N    1 1 
        3  9076 1 1 193 GLY O    O  18.158  -9.401  -4.553 1.00 . A A . 193 GLY O    1 1 
        3  9077 1 1 194 GLN C    C  21.188  -9.728  -6.163 1.00 . A A . 194 GLN C    1 1 
        3  9078 1 1 194 GLN CA   C  19.794 -10.037  -6.698 1.00 . A A . 194 GLN CA   1 1 
        3  9079 1 1 194 GLN CB   C  19.887 -10.508  -8.151 1.00 . A A . 194 GLN CB   1 1 
        3  9080 1 1 194 GLN CD   C  19.026 -12.526  -9.405 1.00 . A A . 194 GLN CD   1 1 
        3  9081 1 1 194 GLN CG   C  18.664 -11.281  -8.619 1.00 . A A . 194 GLN CG   1 1 
        3  9082 1 1 194 GLN H    H  18.898  -8.232  -7.343 1.00 . A A . 194 GLN H    1 1 
        3  9083 1 1 194 GLN HA   H  19.358 -10.825  -6.102 1.00 . A A . 194 GLN HA   1 1 
        3  9084 1 1 194 GLN HB2  H  20.007  -9.645  -8.790 1.00 . A A . 194 GLN HB2  1 1 
        3  9085 1 1 194 GLN HB3  H  20.751 -11.146  -8.257 1.00 . A A . 194 GLN HB3  1 1 
        3  9086 1 1 194 GLN HE21 H  18.091 -11.817 -11.009 1.00 . A A . 194 GLN HE21 1 1 
        3  9087 1 1 194 GLN HE22 H  18.824 -13.370 -11.194 1.00 . A A . 194 GLN HE22 1 1 
        3  9088 1 1 194 GLN HG2  H  18.086 -11.573  -7.756 1.00 . A A . 194 GLN HG2  1 1 
        3  9089 1 1 194 GLN HG3  H  18.066 -10.636  -9.249 1.00 . A A . 194 GLN HG3  1 1 
        3  9090 1 1 194 GLN N    N  18.926  -8.869  -6.600 1.00 . A A . 194 GLN N    1 1 
        3  9091 1 1 194 GLN NE2  N  18.605 -12.576 -10.663 1.00 . A A . 194 GLN NE2  1 1 
        3  9092 1 1 194 GLN O    O  21.722  -8.642  -6.387 1.00 . A A . 194 GLN O    1 1 
        3  9093 1 1 194 GLN OE1  O  19.678 -13.433  -8.886 1.00 . A A . 194 GLN OE1  1 1 
        3  9094 1 1 195 GLU C    C  24.039 -11.630  -5.346 1.00 . A A . 195 GLU C    1 1 
        3  9095 1 1 195 GLU CA   C  23.103 -10.517  -4.885 1.00 . A A . 195 GLU CA   1 1 
        3  9096 1 1 195 GLU CB   C  23.029 -10.499  -3.357 1.00 . A A . 195 GLU CB   1 1 
        3  9097 1 1 195 GLU CD   C  21.307  -9.751  -1.666 1.00 . A A . 195 GLU CD   1 1 
        3  9098 1 1 195 GLU CG   C  22.221  -9.337  -2.803 1.00 . A A . 195 GLU CG   1 1 
        3  9099 1 1 195 GLU H    H  21.295 -11.533  -5.309 1.00 . A A . 195 GLU H    1 1 
        3  9100 1 1 195 GLU HA   H  23.492  -9.572  -5.229 1.00 . A A . 195 GLU HA   1 1 
        3  9101 1 1 195 GLU HB2  H  22.576 -11.418  -3.018 1.00 . A A . 195 GLU HB2  1 1 
        3  9102 1 1 195 GLU HB3  H  24.031 -10.434  -2.960 1.00 . A A . 195 GLU HB3  1 1 
        3  9103 1 1 195 GLU HG2  H  22.903  -8.583  -2.437 1.00 . A A . 195 GLU HG2  1 1 
        3  9104 1 1 195 GLU HG3  H  21.619  -8.922  -3.597 1.00 . A A . 195 GLU HG3  1 1 
        3  9105 1 1 195 GLU N    N  21.771 -10.688  -5.453 1.00 . A A . 195 GLU N    1 1 
        3  9106 1 1 195 GLU O    O  24.941 -11.402  -6.151 1.00 . A A . 195 GLU O    1 1 
        3  9107 1 1 195 GLU OE1  O  21.773 -10.481  -0.766 1.00 . A A . 195 GLU OE1  1 1 
        3  9108 1 1 195 GLU OE2  O  20.126  -9.348  -1.676 1.00 . A A . 195 GLU OE2  1 1 
        3  9109 1 1 196 ASP C    C  23.827 -15.014  -5.968 1.00 . A A . 196 ASP C    1 1 
        3  9110 1 1 196 ASP CA   C  24.639 -13.985  -5.189 1.00 . A A . 196 ASP CA   1 1 
        3  9111 1 1 196 ASP CB   C  25.230 -14.627  -3.934 1.00 . A A . 196 ASP CB   1 1 
        3  9112 1 1 196 ASP CG   C  26.532 -13.978  -3.508 1.00 . A A . 196 ASP CG   1 1 
        3  9113 1 1 196 ASP H    H  23.081 -12.954  -4.193 1.00 . A A . 196 ASP H    1 1 
        3  9114 1 1 196 ASP HA   H  25.446 -13.632  -5.815 1.00 . A A . 196 ASP HA   1 1 
        3  9115 1 1 196 ASP HB2  H  24.522 -14.536  -3.123 1.00 . A A . 196 ASP HB2  1 1 
        3  9116 1 1 196 ASP HB3  H  25.415 -15.674  -4.127 1.00 . A A . 196 ASP HB3  1 1 
        3  9117 1 1 196 ASP N    N  23.816 -12.835  -4.830 1.00 . A A . 196 ASP N    1 1 
        3  9118 1 1 196 ASP O    O  23.208 -15.903  -5.382 1.00 . A A . 196 ASP O    1 1 
        3  9119 1 1 196 ASP OD1  O  26.533 -12.753  -3.265 1.00 . A A . 196 ASP OD1  1 1 
        3  9120 1 1 196 ASP OD2  O  27.551 -14.695  -3.418 1.00 . A A . 196 ASP OD2  1 1 
        3  9121 1 1 197 ALA C    C  23.889 -17.090  -8.386 1.00 . A A . 197 ALA C    1 1 
        3  9122 1 1 197 ALA CA   C  23.098 -15.807  -8.150 1.00 . A A . 197 ALA CA   1 1 
        3  9123 1 1 197 ALA CB   C  22.766 -15.141  -9.475 1.00 . A A . 197 ALA CB   1 1 
        3  9124 1 1 197 ALA H    H  24.347 -14.159  -7.699 1.00 . A A . 197 ALA H    1 1 
        3  9125 1 1 197 ALA HA   H  22.170 -16.056  -7.655 1.00 . A A . 197 ALA HA   1 1 
        3  9126 1 1 197 ALA HB1  H  22.765 -15.882 -10.261 1.00 . A A . 197 ALA HB1  1 1 
        3  9127 1 1 197 ALA HB2  H  23.507 -14.386  -9.694 1.00 . A A . 197 ALA HB2  1 1 
        3  9128 1 1 197 ALA HB3  H  21.791 -14.681  -9.413 1.00 . A A . 197 ALA HB3  1 1 
        3  9129 1 1 197 ALA N    N  23.834 -14.889  -7.291 1.00 . A A . 197 ALA N    1 1 
        3  9130 1 1 197 ALA O    O  24.782 -17.134  -9.232 1.00 . A A . 197 ALA O    1 1 
        3  9131 1 1 198 ALA C    C  23.553 -20.486  -6.907 1.00 . A A . 198 ALA C    1 1 
        3  9132 1 1 198 ALA CA   C  24.233 -19.416  -7.759 1.00 . A A . 198 ALA CA   1 1 
        3  9133 1 1 198 ALA CB   C  25.700 -19.280  -7.375 1.00 . A A . 198 ALA CB   1 1 
        3  9134 1 1 198 ALA H    H  22.834 -18.036  -6.974 1.00 . A A . 198 ALA H    1 1 
        3  9135 1 1 198 ALA HA   H  24.186 -19.715  -8.797 1.00 . A A . 198 ALA HA   1 1 
        3  9136 1 1 198 ALA HB1  H  26.037 -20.198  -6.915 1.00 . A A . 198 ALA HB1  1 1 
        3  9137 1 1 198 ALA HB2  H  25.816 -18.465  -6.677 1.00 . A A . 198 ALA HB2  1 1 
        3  9138 1 1 198 ALA HB3  H  26.288 -19.085  -8.260 1.00 . A A . 198 ALA HB3  1 1 
        3  9139 1 1 198 ALA N    N  23.555 -18.133  -7.632 1.00 . A A . 198 ALA N    1 1 
        3  9140 1 1 198 ALA O    O  23.038 -21.472  -7.433 1.00 . A A . 198 ALA O    1 1 
        3  9141 1 1 199 PRO C    C  21.397 -21.252  -4.751 1.00 . A A . 199 PRO C    1 1 
        3  9142 1 1 199 PRO CA   C  22.920 -21.264  -4.655 1.00 . A A . 199 PRO CA   1 1 
        3  9143 1 1 199 PRO CB   C  23.375 -20.783  -3.276 1.00 . A A . 199 PRO CB   1 1 
        3  9144 1 1 199 PRO CD   C  24.134 -19.158  -4.858 1.00 . A A . 199 PRO CD   1 1 
        3  9145 1 1 199 PRO CG   C  23.629 -19.325  -3.451 1.00 . A A . 199 PRO CG   1 1 
        3  9146 1 1 199 PRO HA   H  23.282 -22.268  -4.826 1.00 . A A . 199 PRO HA   1 1 
        3  9147 1 1 199 PRO HB2  H  22.595 -20.965  -2.552 1.00 . A A . 199 PRO HB2  1 1 
        3  9148 1 1 199 PRO HB3  H  24.274 -21.306  -2.987 1.00 . A A . 199 PRO HB3  1 1 
        3  9149 1 1 199 PRO HD2  H  23.788 -18.223  -5.274 1.00 . A A . 199 PRO HD2  1 1 
        3  9150 1 1 199 PRO HD3  H  25.213 -19.205  -4.880 1.00 . A A . 199 PRO HD3  1 1 
        3  9151 1 1 199 PRO HG2  H  22.711 -18.773  -3.314 1.00 . A A . 199 PRO HG2  1 1 
        3  9152 1 1 199 PRO HG3  H  24.375 -18.995  -2.744 1.00 . A A . 199 PRO HG3  1 1 
        3  9153 1 1 199 PRO N    N  23.543 -20.306  -5.574 1.00 . A A . 199 PRO N    1 1 
        3  9154 1 1 199 PRO O    O  20.712 -20.769  -3.850 1.00 . A A . 199 PRO O    1 1 
        3  9155 1 1 200 VAL C    C  19.012 -23.173  -6.667 1.00 . A A . 200 VAL C    1 1 
        3  9156 1 1 200 VAL CA   C  19.433 -21.835  -6.063 1.00 . A A . 200 VAL CA   1 1 
        3  9157 1 1 200 VAL CB   C  18.962 -20.692  -6.983 1.00 . A A . 200 VAL CB   1 1 
        3  9158 1 1 200 VAL CG1  C  19.611 -20.800  -8.355 1.00 . A A . 200 VAL CG1  1 1 
        3  9159 1 1 200 VAL CG2  C  17.445 -20.691  -7.101 1.00 . A A . 200 VAL CG2  1 1 
        3  9160 1 1 200 VAL H    H  21.473 -22.154  -6.533 1.00 . A A . 200 VAL H    1 1 
        3  9161 1 1 200 VAL HA   H  18.952 -21.719  -5.104 1.00 . A A . 200 VAL HA   1 1 
        3  9162 1 1 200 VAL HB   H  19.266 -19.754  -6.540 1.00 . A A . 200 VAL HB   1 1 
        3  9163 1 1 200 VAL HG11 H  19.100 -21.555  -8.935 1.00 . A A . 200 VAL HG11 1 1 
        3  9164 1 1 200 VAL HG12 H  20.650 -21.074  -8.241 1.00 . A A . 200 VAL HG12 1 1 
        3  9165 1 1 200 VAL HG13 H  19.542 -19.848  -8.861 1.00 . A A . 200 VAL HG13 1 1 
        3  9166 1 1 200 VAL HG21 H  17.009 -20.476  -6.136 1.00 . A A . 200 VAL HG21 1 1 
        3  9167 1 1 200 VAL HG22 H  17.110 -21.660  -7.438 1.00 . A A . 200 VAL HG22 1 1 
        3  9168 1 1 200 VAL HG23 H  17.139 -19.936  -7.811 1.00 . A A . 200 VAL HG23 1 1 
        3  9169 1 1 200 VAL N    N  20.875 -21.786  -5.850 1.00 . A A . 200 VAL N    1 1 
        3  9170 1 1 200 VAL O    O  18.040 -23.786  -6.224 1.00 . A A . 200 VAL O    1 1 
        3  9171 1 1 201 VAL C    C  20.683 -25.780  -8.400 1.00 . A A . 201 VAL C    1 1 
        3  9172 1 1 201 VAL CA   C  19.449 -24.885  -8.342 1.00 . A A . 201 VAL CA   1 1 
        3  9173 1 1 201 VAL CB   C  18.925 -24.660  -9.772 1.00 . A A . 201 VAL CB   1 1 
        3  9174 1 1 201 VAL CG1  C  17.562 -23.988  -9.743 1.00 . A A . 201 VAL CG1  1 1 
        3  9175 1 1 201 VAL CG2  C  19.917 -23.837 -10.581 1.00 . A A . 201 VAL CG2  1 1 
        3  9176 1 1 201 VAL H    H  20.511 -23.088  -7.988 1.00 . A A . 201 VAL H    1 1 
        3  9177 1 1 201 VAL HA   H  18.679 -25.385  -7.773 1.00 . A A . 201 VAL HA   1 1 
        3  9178 1 1 201 VAL HB   H  18.817 -25.623 -10.249 1.00 . A A . 201 VAL HB   1 1 
        3  9179 1 1 201 VAL HG11 H  17.680 -22.926  -9.898 1.00 . A A . 201 VAL HG11 1 1 
        3  9180 1 1 201 VAL HG12 H  17.096 -24.161  -8.784 1.00 . A A . 201 VAL HG12 1 1 
        3  9181 1 1 201 VAL HG13 H  16.940 -24.399 -10.524 1.00 . A A . 201 VAL HG13 1 1 
        3  9182 1 1 201 VAL HG21 H  19.599 -22.804 -10.596 1.00 . A A . 201 VAL HG21 1 1 
        3  9183 1 1 201 VAL HG22 H  19.959 -24.215 -11.590 1.00 . A A . 201 VAL HG22 1 1 
        3  9184 1 1 201 VAL HG23 H  20.895 -23.904 -10.129 1.00 . A A . 201 VAL HG23 1 1 
        3  9185 1 1 201 VAL N    N  19.748 -23.621  -7.680 1.00 . A A . 201 VAL N    1 1 
        3  9186 1 1 201 VAL O    O  21.797 -25.303  -8.619 1.00 . A A . 201 VAL O    1 1 
        3  9187 1 1 202 ALA C    C  21.362 -29.079  -9.331 1.00 . A A . 202 ALA C    1 1 
        3  9188 1 1 202 ALA CA   C  21.574 -28.039  -8.233 1.00 . A A . 202 ALA CA   1 1 
        3  9189 1 1 202 ALA CB   C  21.716 -28.718  -6.879 1.00 . A A . 202 ALA CB   1 1 
        3  9190 1 1 202 ALA H    H  19.566 -27.397  -8.033 1.00 . A A . 202 ALA H    1 1 
        3  9191 1 1 202 ALA HA   H  22.485 -27.495  -8.434 1.00 . A A . 202 ALA HA   1 1 
        3  9192 1 1 202 ALA HB1  H  22.488 -28.224  -6.309 1.00 . A A . 202 ALA HB1  1 1 
        3  9193 1 1 202 ALA HB2  H  21.982 -29.755  -7.023 1.00 . A A . 202 ALA HB2  1 1 
        3  9194 1 1 202 ALA HB3  H  20.778 -28.657  -6.346 1.00 . A A . 202 ALA HB3  1 1 
        3  9195 1 1 202 ALA N    N  20.477 -27.078  -8.202 1.00 . A A . 202 ALA N    1 1 
        3  9196 1 1 202 ALA O    O  20.259 -29.599  -9.498 1.00 . A A . 202 ALA O    1 1 
        3  9197 1 1 203 PRO C    C  22.352 -31.816 -10.671 1.00 . A A . 203 PRO C    1 1 
        3  9198 1 1 203 PRO CA   C  22.338 -30.381 -11.184 1.00 . A A . 203 PRO CA   1 1 
        3  9199 1 1 203 PRO CB   C  23.595 -30.094 -12.002 1.00 . A A . 203 PRO CB   1 1 
        3  9200 1 1 203 PRO CD   C  23.776 -28.827  -9.976 1.00 . A A . 203 PRO CD   1 1 
        3  9201 1 1 203 PRO CG   C  24.577 -29.578 -11.008 1.00 . A A . 203 PRO CG   1 1 
        3  9202 1 1 203 PRO HA   H  21.461 -30.224 -11.797 1.00 . A A . 203 PRO HA   1 1 
        3  9203 1 1 203 PRO HB2  H  23.941 -31.005 -12.467 1.00 . A A . 203 PRO HB2  1 1 
        3  9204 1 1 203 PRO HB3  H  23.377 -29.357 -12.759 1.00 . A A . 203 PRO HB3  1 1 
        3  9205 1 1 203 PRO HD2  H  24.177 -29.000  -8.989 1.00 . A A . 203 PRO HD2  1 1 
        3  9206 1 1 203 PRO HD3  H  23.769 -27.770 -10.202 1.00 . A A . 203 PRO HD3  1 1 
        3  9207 1 1 203 PRO HG2  H  25.100 -30.404 -10.546 1.00 . A A . 203 PRO HG2  1 1 
        3  9208 1 1 203 PRO HG3  H  25.277 -28.916 -11.492 1.00 . A A . 203 PRO HG3  1 1 
        3  9209 1 1 203 PRO N    N  22.419 -29.398 -10.101 1.00 . A A . 203 PRO N    1 1 
        3  9210 1 1 203 PRO O    O  23.390 -32.324 -10.249 1.00 . A A . 203 PRO O    1 1 
        3  9211 1 1 204 ALA C    C  21.535 -34.824 -11.325 1.00 . A A . 204 ALA C    1 1 
        3  9212 1 1 204 ALA CA   C  21.076 -33.842 -10.248 1.00 . A A . 204 ALA CA   1 1 
        3  9213 1 1 204 ALA CB   C  19.642 -34.140  -9.831 1.00 . A A . 204 ALA CB   1 1 
        3  9214 1 1 204 ALA H    H  20.399 -32.008 -11.057 1.00 . A A . 204 ALA H    1 1 
        3  9215 1 1 204 ALA HA   H  21.708 -33.957  -9.380 1.00 . A A . 204 ALA HA   1 1 
        3  9216 1 1 204 ALA HB1  H  19.386 -35.150 -10.116 1.00 . A A . 204 ALA HB1  1 1 
        3  9217 1 1 204 ALA HB2  H  18.974 -33.447 -10.319 1.00 . A A . 204 ALA HB2  1 1 
        3  9218 1 1 204 ALA HB3  H  19.550 -34.035  -8.760 1.00 . A A . 204 ALA HB3  1 1 
        3  9219 1 1 204 ALA N    N  21.193 -32.466 -10.709 1.00 . A A . 204 ALA N    1 1 
        3  9220 1 1 204 ALA O    O  22.494 -35.568 -11.127 1.00 . A A . 204 ALA O    1 1 
        3  9221 1 1 205 PRO C    C  22.410 -35.239 -14.381 1.00 . A A . 205 PRO C    1 1 
        3  9222 1 1 205 PRO CA   C  21.202 -35.733 -13.591 1.00 . A A . 205 PRO CA   1 1 
        3  9223 1 1 205 PRO CB   C  19.947 -35.706 -14.460 1.00 . A A . 205 PRO CB   1 1 
        3  9224 1 1 205 PRO CD   C  19.695 -33.984 -12.813 1.00 . A A . 205 PRO CD   1 1 
        3  9225 1 1 205 PRO CG   C  19.368 -34.353 -14.238 1.00 . A A . 205 PRO CG   1 1 
        3  9226 1 1 205 PRO HA   H  21.384 -36.740 -13.245 1.00 . A A . 205 PRO HA   1 1 
        3  9227 1 1 205 PRO HB2  H  20.218 -35.858 -15.495 1.00 . A A . 205 PRO HB2  1 1 
        3  9228 1 1 205 PRO HB3  H  19.266 -36.484 -14.143 1.00 . A A . 205 PRO HB3  1 1 
        3  9229 1 1 205 PRO HD2  H  19.957 -32.939 -12.746 1.00 . A A . 205 PRO HD2  1 1 
        3  9230 1 1 205 PRO HD3  H  18.859 -34.206 -12.167 1.00 . A A . 205 PRO HD3  1 1 
        3  9231 1 1 205 PRO HG2  H  19.818 -33.645 -14.919 1.00 . A A . 205 PRO HG2  1 1 
        3  9232 1 1 205 PRO HG3  H  18.298 -34.382 -14.380 1.00 . A A . 205 PRO HG3  1 1 
        3  9233 1 1 205 PRO N    N  20.855 -34.839 -12.486 1.00 . A A . 205 PRO N    1 1 
        3  9234 1 1 205 PRO O    O  22.326 -35.011 -15.589 1.00 . A A . 205 PRO O    1 1 
        3  9235 1 1 206 ALA C    C  25.973 -35.375 -13.822 1.00 . A A . 206 ALA C    1 1 
        3  9236 1 1 206 ALA CA   C  24.758 -34.603 -14.329 1.00 . A A . 206 ALA CA   1 1 
        3  9237 1 1 206 ALA CB   C  24.939 -33.112 -14.090 1.00 . A A . 206 ALA CB   1 1 
        3  9238 1 1 206 ALA H    H  23.541 -35.268 -12.733 1.00 . A A . 206 ALA H    1 1 
        3  9239 1 1 206 ALA HA   H  24.662 -34.763 -15.394 1.00 . A A . 206 ALA HA   1 1 
        3  9240 1 1 206 ALA HB1  H  23.976 -32.656 -13.911 1.00 . A A . 206 ALA HB1  1 1 
        3  9241 1 1 206 ALA HB2  H  25.396 -32.660 -14.957 1.00 . A A . 206 ALA HB2  1 1 
        3  9242 1 1 206 ALA HB3  H  25.573 -32.961 -13.228 1.00 . A A . 206 ALA HB3  1 1 
        3  9243 1 1 206 ALA N    N  23.534 -35.072 -13.692 1.00 . A A . 206 ALA N    1 1 
        3  9244 1 1 206 ALA O    O  25.870 -36.171 -12.890 1.00 . A A . 206 ALA O    1 1 
        3  9245 1 1 207 PRO C    C  28.660 -35.706 -12.540 1.00 . A A . 207 PRO C    1 1 
        3  9246 1 1 207 PRO CA   C  28.389 -35.822 -14.037 1.00 . A A . 207 PRO CA   1 1 
        3  9247 1 1 207 PRO CB   C  29.467 -35.086 -14.835 1.00 . A A . 207 PRO CB   1 1 
        3  9248 1 1 207 PRO CD   C  27.363 -34.210 -15.552 1.00 . A A . 207 PRO CD   1 1 
        3  9249 1 1 207 PRO CG   C  28.753 -34.540 -16.022 1.00 . A A . 207 PRO CG   1 1 
        3  9250 1 1 207 PRO HA   H  28.377 -36.866 -14.319 1.00 . A A . 207 PRO HA   1 1 
        3  9251 1 1 207 PRO HB2  H  29.892 -34.298 -14.230 1.00 . A A . 207 PRO HB2  1 1 
        3  9252 1 1 207 PRO HB3  H  30.241 -35.780 -15.127 1.00 . A A . 207 PRO HB3  1 1 
        3  9253 1 1 207 PRO HD2  H  27.312 -33.186 -15.215 1.00 . A A . 207 PRO HD2  1 1 
        3  9254 1 1 207 PRO HD3  H  26.647 -34.385 -16.342 1.00 . A A . 207 PRO HD3  1 1 
        3  9255 1 1 207 PRO HG2  H  29.252 -33.647 -16.372 1.00 . A A . 207 PRO HG2  1 1 
        3  9256 1 1 207 PRO HG3  H  28.718 -35.282 -16.804 1.00 . A A . 207 PRO HG3  1 1 
        3  9257 1 1 207 PRO N    N  27.150 -35.145 -14.432 1.00 . A A . 207 PRO N    1 1 
        3  9258 1 1 207 PRO O    O  29.010 -36.688 -11.885 1.00 . A A . 207 PRO O    1 1 
        3  9259 1 1 208 ALA C    C  27.563 -33.480  -9.971 1.00 . A A . 208 ALA C    1 1 
        3  9260 1 1 208 ALA CA   C  28.724 -34.256 -10.587 1.00 . A A . 208 ALA CA   1 1 
        3  9261 1 1 208 ALA CB   C  30.031 -33.504 -10.384 1.00 . A A . 208 ALA CB   1 1 
        3  9262 1 1 208 ALA H    H  28.218 -33.758 -12.580 1.00 . A A . 208 ALA H    1 1 
        3  9263 1 1 208 ALA HA   H  28.809 -35.214 -10.096 1.00 . A A . 208 ALA HA   1 1 
        3  9264 1 1 208 ALA HB1  H  30.854 -34.109 -10.734 1.00 . A A . 208 ALA HB1  1 1 
        3  9265 1 1 208 ALA HB2  H  30.163 -33.288  -9.335 1.00 . A A . 208 ALA HB2  1 1 
        3  9266 1 1 208 ALA HB3  H  30.004 -32.578 -10.942 1.00 . A A . 208 ALA HB3  1 1 
        3  9267 1 1 208 ALA N    N  28.498 -34.500 -12.006 1.00 . A A . 208 ALA N    1 1 
        3  9268 1 1 208 ALA O    O  27.020 -32.566 -10.592 1.00 . A A . 208 ALA O    1 1 
        3  9269 1 1 209 PRO C    C  26.456 -31.789  -7.516 1.00 . A A . 209 PRO C    1 1 
        3  9270 1 1 209 PRO CA   C  26.059 -33.163  -8.044 1.00 . A A . 209 PRO CA   1 1 
        3  9271 1 1 209 PRO CB   C  25.747 -34.111  -6.886 1.00 . A A . 209 PRO CB   1 1 
        3  9272 1 1 209 PRO CD   C  27.752 -34.914  -7.920 1.00 . A A . 209 PRO CD   1 1 
        3  9273 1 1 209 PRO CG   C  27.040 -34.790  -6.599 1.00 . A A . 209 PRO CG   1 1 
        3  9274 1 1 209 PRO HA   H  25.191 -33.067  -8.680 1.00 . A A . 209 PRO HA   1 1 
        3  9275 1 1 209 PRO HB2  H  25.399 -33.543  -6.035 1.00 . A A . 209 PRO HB2  1 1 
        3  9276 1 1 209 PRO HB3  H  24.989 -34.818  -7.189 1.00 . A A . 209 PRO HB3  1 1 
        3  9277 1 1 209 PRO HD2  H  28.814 -34.764  -7.792 1.00 . A A . 209 PRO HD2  1 1 
        3  9278 1 1 209 PRO HD3  H  27.558 -35.880  -8.363 1.00 . A A . 209 PRO HD3  1 1 
        3  9279 1 1 209 PRO HG2  H  27.624 -34.193  -5.914 1.00 . A A . 209 PRO HG2  1 1 
        3  9280 1 1 209 PRO HG3  H  26.856 -35.769  -6.180 1.00 . A A . 209 PRO HG3  1 1 
        3  9281 1 1 209 PRO N    N  27.162 -33.834  -8.737 1.00 . A A . 209 PRO N    1 1 
        3  9282 1 1 209 PRO O    O  25.707 -30.821  -7.649 1.00 . A A . 209 PRO O    1 1 
        3  9283 1 1 210 GLU C    C  28.587 -29.515  -7.477 1.00 . A A . 210 GLU C    1 1 
        3  9284 1 1 210 GLU CA   C  28.135 -30.455  -6.364 1.00 . A A . 210 GLU CA   1 1 
        3  9285 1 1 210 GLU CB   C  29.294 -30.720  -5.399 1.00 . A A . 210 GLU CB   1 1 
        3  9286 1 1 210 GLU CD   C  30.128 -30.522  -3.023 1.00 . A A . 210 GLU CD   1 1 
        3  9287 1 1 210 GLU CG   C  29.140 -30.022  -4.058 1.00 . A A . 210 GLU CG   1 1 
        3  9288 1 1 210 GLU H    H  28.190 -32.518  -6.837 1.00 . A A . 210 GLU H    1 1 
        3  9289 1 1 210 GLU HA   H  27.328 -29.989  -5.821 1.00 . A A . 210 GLU HA   1 1 
        3  9290 1 1 210 GLU HB2  H  29.363 -31.783  -5.221 1.00 . A A . 210 GLU HB2  1 1 
        3  9291 1 1 210 GLU HB3  H  30.214 -30.382  -5.854 1.00 . A A . 210 GLU HB3  1 1 
        3  9292 1 1 210 GLU HG2  H  29.296 -28.962  -4.199 1.00 . A A . 210 GLU HG2  1 1 
        3  9293 1 1 210 GLU HG3  H  28.139 -30.192  -3.691 1.00 . A A . 210 GLU HG3  1 1 
        3  9294 1 1 210 GLU N    N  27.639 -31.711  -6.913 1.00 . A A . 210 GLU N    1 1 
        3  9295 1 1 210 GLU O    O  28.010 -28.413  -7.590 1.00 . A A . 210 GLU O    1 1 
        3  9296 1 1 210 GLU OE1  O  31.305 -30.739  -3.382 1.00 . A A . 210 GLU OE1  1 1 
        3  9297 1 1 210 GLU OE2  O  29.726 -30.699  -1.855 1.00 . A A . 210 GLU OE2  1 1 
        4  9298 1 1   1 ALA C    C   1.968  -9.849 -28.540 1.00 . A A .   1 ALA C    1 1 
        4  9299 1 1   1 ALA CA   C   1.857  -9.755 -27.022 1.00 . A A .   1 ALA CA   1 1 
        4  9300 1 1   1 ALA CB   C   0.459  -9.310 -26.621 1.00 . A A .   1 ALA CB   1 1 
        4  9301 1 1   1 ALA H1   H   3.783  -9.320 -26.448 1.00 . A A .   1 ALA H1   1 1 
        4  9302 1 1   1 ALA H2   H   2.567  -8.550 -25.513 1.00 . A A .   1 ALA H2   1 1 
        4  9303 1 1   1 ALA H3   H   2.915  -7.993 -27.099 1.00 . A A .   1 ALA H3   1 1 
        4  9304 1 1   1 ALA HA   H   2.031 -10.733 -26.599 1.00 . A A .   1 ALA HA   1 1 
        4  9305 1 1   1 ALA HB1  H   0.433  -8.234 -26.536 1.00 . A A .   1 ALA HB1  1 1 
        4  9306 1 1   1 ALA HB2  H   0.198  -9.753 -25.672 1.00 . A A .   1 ALA HB2  1 1 
        4  9307 1 1   1 ALA HB3  H  -0.250  -9.627 -27.373 1.00 . A A .   1 ALA HB3  1 1 
        4  9308 1 1   1 ALA N    N   2.872  -8.820 -26.472 1.00 . A A .   1 ALA N    1 1 
        4  9309 1 1   1 ALA O    O   2.161 -10.932 -29.094 1.00 . A A .   1 ALA O    1 1 
        4  9310 1 1   2 ARG C    C   3.183  -7.904 -31.104 1.00 . A A .   2 ARG C    1 1 
        4  9311 1 1   2 ARG CA   C   1.933  -8.658 -30.663 1.00 . A A .   2 ARG CA   1 1 
        4  9312 1 1   2 ARG CB   C   0.686  -7.993 -31.249 1.00 . A A .   2 ARG CB   1 1 
        4  9313 1 1   2 ARG CD   C  -0.595  -8.805 -33.264 1.00 . A A .   2 ARG CD   1 1 
        4  9314 1 1   2 ARG CG   C  -0.345  -8.983 -31.774 1.00 . A A .   2 ARG CG   1 1 
        4  9315 1 1   2 ARG CZ   C  -0.826 -11.143 -34.005 1.00 . A A .   2 ARG CZ   1 1 
        4  9316 1 1   2 ARG H    H   1.693  -7.877 -28.711 1.00 . A A .   2 ARG H    1 1 
        4  9317 1 1   2 ARG HA   H   1.992  -9.674 -31.027 1.00 . A A .   2 ARG HA   1 1 
        4  9318 1 1   2 ARG HB2  H   0.216  -7.395 -30.481 1.00 . A A .   2 ARG HB2  1 1 
        4  9319 1 1   2 ARG HB3  H   0.982  -7.348 -32.063 1.00 . A A .   2 ARG HB3  1 1 
        4  9320 1 1   2 ARG HD2  H  -1.650  -8.635 -33.420 1.00 . A A .   2 ARG HD2  1 1 
        4  9321 1 1   2 ARG HD3  H  -0.038  -7.945 -33.611 1.00 . A A .   2 ARG HD3  1 1 
        4  9322 1 1   2 ARG HE   H   0.610  -9.892 -34.600 1.00 . A A .   2 ARG HE   1 1 
        4  9323 1 1   2 ARG HG2  H   0.017  -9.987 -31.599 1.00 . A A .   2 ARG HG2  1 1 
        4  9324 1 1   2 ARG HG3  H  -1.272  -8.836 -31.242 1.00 . A A .   2 ARG HG3  1 1 
        4  9325 1 1   2 ARG HH11 H  -2.243 -10.535 -32.695 1.00 . A A .   2 ARG HH11 1 1 
        4  9326 1 1   2 ARG HH12 H  -2.384 -12.174 -33.232 1.00 . A A .   2 ARG HH12 1 1 
        4  9327 1 1   2 ARG HH21 H   0.426 -12.048 -35.307 1.00 . A A .   2 ARG HH21 1 1 
        4  9328 1 1   2 ARG HH22 H  -0.869 -13.035 -34.715 1.00 . A A .   2 ARG HH22 1 1 
        4  9329 1 1   2 ARG N    N   1.845  -8.707 -29.209 1.00 . A A .   2 ARG N    1 1 
        4  9330 1 1   2 ARG NE   N  -0.185  -9.977 -34.033 1.00 . A A .   2 ARG NE   1 1 
        4  9331 1 1   2 ARG NH1  N  -1.906 -11.296 -33.249 1.00 . A A .   2 ARG NH1  1 1 
        4  9332 1 1   2 ARG NH2  N  -0.387 -12.159 -34.735 1.00 . A A .   2 ARG NH2  1 1 
        4  9333 1 1   2 ARG O    O   3.943  -7.405 -30.274 1.00 . A A .   2 ARG O    1 1 
        4  9334 1 1   3 ILE C    C   4.399  -5.619 -32.829 1.00 . A A .   3 ILE C    1 1 
        4  9335 1 1   3 ILE CA   C   4.551  -7.131 -32.962 1.00 . A A .   3 ILE CA   1 1 
        4  9336 1 1   3 ILE CB   C   4.776  -7.487 -34.443 1.00 . A A .   3 ILE CB   1 1 
        4  9337 1 1   3 ILE CD1  C   3.685  -6.905 -36.668 1.00 . A A .   3 ILE CD1  1 1 
        4  9338 1 1   3 ILE CG1  C   3.474  -7.334 -35.233 1.00 . A A .   3 ILE CG1  1 1 
        4  9339 1 1   3 ILE CG2  C   5.318  -8.902 -34.572 1.00 . A A .   3 ILE CG2  1 1 
        4  9340 1 1   3 ILE H    H   2.751  -8.242 -33.028 1.00 . A A .   3 ILE H    1 1 
        4  9341 1 1   3 ILE HA   H   5.421  -7.445 -32.402 1.00 . A A .   3 ILE HA   1 1 
        4  9342 1 1   3 ILE HB   H   5.514  -6.807 -34.846 1.00 . A A .   3 ILE HB   1 1 
        4  9343 1 1   3 ILE HD11 H   2.875  -6.258 -36.973 1.00 . A A .   3 ILE HD11 1 1 
        4  9344 1 1   3 ILE HD12 H   3.709  -7.776 -37.306 1.00 . A A .   3 ILE HD12 1 1 
        4  9345 1 1   3 ILE HD13 H   4.621  -6.372 -36.751 1.00 . A A .   3 ILE HD13 1 1 
        4  9346 1 1   3 ILE HG12 H   2.954  -8.281 -35.244 1.00 . A A .   3 ILE HG12 1 1 
        4  9347 1 1   3 ILE HG13 H   2.853  -6.593 -34.751 1.00 . A A .   3 ILE HG13 1 1 
        4  9348 1 1   3 ILE HG21 H   5.027  -9.479 -33.707 1.00 . A A .   3 ILE HG21 1 1 
        4  9349 1 1   3 ILE HG22 H   6.396  -8.870 -34.638 1.00 . A A .   3 ILE HG22 1 1 
        4  9350 1 1   3 ILE HG23 H   4.917  -9.362 -35.464 1.00 . A A .   3 ILE HG23 1 1 
        4  9351 1 1   3 ILE N    N   3.392  -7.825 -32.415 1.00 . A A .   3 ILE N    1 1 
        4  9352 1 1   3 ILE O    O   4.006  -4.938 -33.776 1.00 . A A .   3 ILE O    1 1 
        4  9353 1 1   4 MET C    C   5.915  -3.128 -30.808 1.00 . A A .   4 MET C    1 1 
        4  9354 1 1   4 MET CA   C   4.611  -3.670 -31.385 1.00 . A A .   4 MET CA   1 1 
        4  9355 1 1   4 MET CB   C   3.454  -3.387 -30.425 1.00 . A A .   4 MET CB   1 1 
        4  9356 1 1   4 MET CE   C  -0.280  -1.784 -31.013 1.00 . A A .   4 MET CE   1 1 
        4  9357 1 1   4 MET CG   C   2.123  -3.162 -31.123 1.00 . A A .   4 MET CG   1 1 
        4  9358 1 1   4 MET H    H   5.019  -5.696 -30.929 1.00 . A A .   4 MET H    1 1 
        4  9359 1 1   4 MET HA   H   4.415  -3.176 -32.326 1.00 . A A .   4 MET HA   1 1 
        4  9360 1 1   4 MET HB2  H   3.346  -4.224 -29.753 1.00 . A A .   4 MET HB2  1 1 
        4  9361 1 1   4 MET HB3  H   3.688  -2.503 -29.849 1.00 . A A .   4 MET HB3  1 1 
        4  9362 1 1   4 MET HE1  H  -1.141  -2.368 -31.298 1.00 . A A .   4 MET HE1  1 1 
        4  9363 1 1   4 MET HE2  H   0.259  -1.481 -31.900 1.00 . A A .   4 MET HE2  1 1 
        4  9364 1 1   4 MET HE3  H  -0.602  -0.907 -30.470 1.00 . A A .   4 MET HE3  1 1 
        4  9365 1 1   4 MET HG2  H   2.231  -2.341 -31.818 1.00 . A A .   4 MET HG2  1 1 
        4  9366 1 1   4 MET HG3  H   1.860  -4.057 -31.664 1.00 . A A .   4 MET HG3  1 1 
        4  9367 1 1   4 MET N    N   4.712  -5.102 -31.646 1.00 . A A .   4 MET N    1 1 
        4  9368 1 1   4 MET O    O   5.927  -2.510 -29.743 1.00 . A A .   4 MET O    1 1 
        4  9369 1 1   4 MET SD   S   0.792  -2.770 -29.971 1.00 . A A .   4 MET SD   1 1 
        4  9370 1 1   5 LYS C    C   9.117  -2.323 -32.241 1.00 . A A .   5 LYS C    1 1 
        4  9371 1 1   5 LYS CA   C   8.324  -2.903 -31.076 1.00 . A A .   5 LYS CA   1 1 
        4  9372 1 1   5 LYS CB   C   9.105  -4.053 -30.435 1.00 . A A .   5 LYS CB   1 1 
        4  9373 1 1   5 LYS CD   C  10.227  -5.448 -32.199 1.00 . A A .   5 LYS CD   1 1 
        4  9374 1 1   5 LYS CE   C  10.706  -6.884 -32.343 1.00 . A A .   5 LYS CE   1 1 
        4  9375 1 1   5 LYS CG   C   9.058  -5.345 -31.235 1.00 . A A .   5 LYS CG   1 1 
        4  9376 1 1   5 LYS H    H   6.940  -3.865 -32.358 1.00 . A A .   5 LYS H    1 1 
        4  9377 1 1   5 LYS HA   H   8.171  -2.131 -30.338 1.00 . A A .   5 LYS HA   1 1 
        4  9378 1 1   5 LYS HB2  H  10.139  -3.757 -30.333 1.00 . A A .   5 LYS HB2  1 1 
        4  9379 1 1   5 LYS HB3  H   8.697  -4.248 -29.454 1.00 . A A .   5 LYS HB3  1 1 
        4  9380 1 1   5 LYS HD2  H   9.916  -5.085 -33.167 1.00 . A A .   5 LYS HD2  1 1 
        4  9381 1 1   5 LYS HD3  H  11.040  -4.842 -31.829 1.00 . A A .   5 LYS HD3  1 1 
        4  9382 1 1   5 LYS HE2  H  11.109  -7.211 -31.396 1.00 . A A .   5 LYS HE2  1 1 
        4  9383 1 1   5 LYS HE3  H   9.864  -7.505 -32.610 1.00 . A A .   5 LYS HE3  1 1 
        4  9384 1 1   5 LYS HG2  H   9.092  -6.182 -30.552 1.00 . A A .   5 LYS HG2  1 1 
        4  9385 1 1   5 LYS HG3  H   8.135  -5.377 -31.796 1.00 . A A .   5 LYS HG3  1 1 
        4  9386 1 1   5 LYS HZ1  H  11.320  -7.144 -34.322 1.00 . A A .   5 LYS HZ1  1 1 
        4  9387 1 1   5 LYS HZ2  H  12.362  -7.839 -33.184 1.00 . A A .   5 LYS HZ2  1 1 
        4  9388 1 1   5 LYS HZ3  H  12.351  -6.163 -33.410 1.00 . A A .   5 LYS HZ3  1 1 
        4  9389 1 1   5 LYS N    N   7.014  -3.366 -31.517 1.00 . A A .   5 LYS N    1 1 
        4  9390 1 1   5 LYS NZ   N  11.758  -7.017 -33.389 1.00 . A A .   5 LYS NZ   1 1 
        4  9391 1 1   5 LYS O    O   8.685  -2.386 -33.391 1.00 . A A .   5 LYS O    1 1 
        4  9392 1 1   6 ALA C    C  11.529  -2.192 -34.007 1.00 . A A .   6 ALA C    1 1 
        4  9393 1 1   6 ALA CA   C  11.134  -1.162 -32.955 1.00 . A A .   6 ALA CA   1 1 
        4  9394 1 1   6 ALA CB   C  12.373  -0.553 -32.317 1.00 . A A .   6 ALA CB   1 1 
        4  9395 1 1   6 ALA H    H  10.569  -1.736 -30.997 1.00 . A A .   6 ALA H    1 1 
        4  9396 1 1   6 ALA HA   H  10.578  -0.369 -33.434 1.00 . A A .   6 ALA HA   1 1 
        4  9397 1 1   6 ALA HB1  H  12.618   0.373 -32.817 1.00 . A A .   6 ALA HB1  1 1 
        4  9398 1 1   6 ALA HB2  H  13.201  -1.241 -32.410 1.00 . A A .   6 ALA HB2  1 1 
        4  9399 1 1   6 ALA HB3  H  12.182  -0.358 -31.272 1.00 . A A .   6 ALA HB3  1 1 
        4  9400 1 1   6 ALA N    N  10.280  -1.755 -31.933 1.00 . A A .   6 ALA N    1 1 
        4  9401 1 1   6 ALA O    O  11.144  -3.359 -33.922 1.00 . A A .   6 ALA O    1 1 
        4  9402 1 1   7 ILE C    C  13.715  -3.691 -35.539 1.00 . A A .   7 ILE C    1 1 
        4  9403 1 1   7 ILE CA   C  12.747  -2.639 -36.066 1.00 . A A .   7 ILE CA   1 1 
        4  9404 1 1   7 ILE CB   C  13.431  -1.849 -37.199 1.00 . A A .   7 ILE CB   1 1 
        4  9405 1 1   7 ILE CD1  C  13.080   0.670 -37.086 1.00 . A A .   7 ILE CD1  1 1 
        4  9406 1 1   7 ILE CG1  C  12.568  -0.653 -37.611 1.00 . A A .   7 ILE CG1  1 1 
        4  9407 1 1   7 ILE CG2  C  13.694  -2.758 -38.391 1.00 . A A .   7 ILE CG2  1 1 
        4  9408 1 1   7 ILE H    H  12.573  -0.814 -35.009 1.00 . A A .   7 ILE H    1 1 
        4  9409 1 1   7 ILE HA   H  11.878  -3.135 -36.473 1.00 . A A .   7 ILE HA   1 1 
        4  9410 1 1   7 ILE HB   H  14.381  -1.491 -36.835 1.00 . A A .   7 ILE HB   1 1 
        4  9411 1 1   7 ILE HD11 H  12.766   1.465 -37.746 1.00 . A A .   7 ILE HD11 1 1 
        4  9412 1 1   7 ILE HD12 H  14.158   0.646 -37.039 1.00 . A A .   7 ILE HD12 1 1 
        4  9413 1 1   7 ILE HD13 H  12.681   0.844 -36.098 1.00 . A A .   7 ILE HD13 1 1 
        4  9414 1 1   7 ILE HG12 H  12.539  -0.592 -38.689 1.00 . A A .   7 ILE HG12 1 1 
        4  9415 1 1   7 ILE HG13 H  11.564  -0.795 -37.237 1.00 . A A .   7 ILE HG13 1 1 
        4  9416 1 1   7 ILE HG21 H  14.636  -3.267 -38.254 1.00 . A A .   7 ILE HG21 1 1 
        4  9417 1 1   7 ILE HG22 H  13.733  -2.165 -39.293 1.00 . A A .   7 ILE HG22 1 1 
        4  9418 1 1   7 ILE HG23 H  12.900  -3.486 -38.473 1.00 . A A .   7 ILE HG23 1 1 
        4  9419 1 1   7 ILE N    N  12.300  -1.754 -34.996 1.00 . A A .   7 ILE N    1 1 
        4  9420 1 1   7 ILE O    O  13.550  -4.885 -35.791 1.00 . A A .   7 ILE O    1 1 
        4  9421 1 1   8 PHE C    C  15.702  -4.101 -32.719 1.00 . A A .   8 PHE C    1 1 
        4  9422 1 1   8 PHE CA   C  15.726  -4.145 -34.243 1.00 . A A .   8 PHE CA   1 1 
        4  9423 1 1   8 PHE CB   C  17.121  -3.781 -34.753 1.00 . A A .   8 PHE CB   1 1 
        4  9424 1 1   8 PHE CD1  C  16.901  -5.005 -36.932 1.00 . A A .   8 PHE CD1  1 1 
        4  9425 1 1   8 PHE CD2  C  17.724  -2.768 -36.968 1.00 . A A .   8 PHE CD2  1 1 
        4  9426 1 1   8 PHE CE1  C  17.019  -5.074 -38.307 1.00 . A A .   8 PHE CE1  1 1 
        4  9427 1 1   8 PHE CE2  C  17.846  -2.830 -38.343 1.00 . A A .   8 PHE CE2  1 1 
        4  9428 1 1   8 PHE CG   C  17.251  -3.853 -36.248 1.00 . A A .   8 PHE CG   1 1 
        4  9429 1 1   8 PHE CZ   C  17.491  -3.986 -39.013 1.00 . A A .   8 PHE CZ   1 1 
        4  9430 1 1   8 PHE H    H  14.808  -2.280 -34.639 1.00 . A A .   8 PHE H    1 1 
        4  9431 1 1   8 PHE HA   H  15.484  -5.147 -34.566 1.00 . A A .   8 PHE HA   1 1 
        4  9432 1 1   8 PHE HB2  H  17.357  -2.772 -34.447 1.00 . A A .   8 PHE HB2  1 1 
        4  9433 1 1   8 PHE HB3  H  17.843  -4.460 -34.322 1.00 . A A .   8 PHE HB3  1 1 
        4  9434 1 1   8 PHE HD1  H  16.531  -5.857 -36.380 1.00 . A A .   8 PHE HD1  1 1 
        4  9435 1 1   8 PHE HD2  H  18.001  -1.864 -36.445 1.00 . A A .   8 PHE HD2  1 1 
        4  9436 1 1   8 PHE HE1  H  16.742  -5.978 -38.829 1.00 . A A .   8 PHE HE1  1 1 
        4  9437 1 1   8 PHE HE2  H  18.216  -1.978 -38.893 1.00 . A A .   8 PHE HE2  1 1 
        4  9438 1 1   8 PHE HZ   H  17.585  -4.037 -40.088 1.00 . A A .   8 PHE HZ   1 1 
        4  9439 1 1   8 PHE N    N  14.729  -3.242 -34.806 1.00 . A A .   8 PHE N    1 1 
        4  9440 1 1   8 PHE O    O  15.562  -3.036 -32.121 1.00 . A A .   8 PHE O    1 1 
        4  9441 1 1   9 VAL C    C  17.235  -5.625 -30.104 1.00 . A A .   9 VAL C    1 1 
        4  9442 1 1   9 VAL CA   C  15.833  -5.362 -30.643 1.00 . A A .   9 VAL CA   1 1 
        4  9443 1 1   9 VAL CB   C  14.888  -6.475 -30.155 1.00 . A A .   9 VAL CB   1 1 
        4  9444 1 1   9 VAL CG1  C  14.742  -6.431 -28.642 1.00 . A A .   9 VAL CG1  1 1 
        4  9445 1 1   9 VAL CG2  C  13.531  -6.358 -30.831 1.00 . A A .   9 VAL CG2  1 1 
        4  9446 1 1   9 VAL H    H  15.947  -6.084 -32.628 1.00 . A A .   9 VAL H    1 1 
        4  9447 1 1   9 VAL HA   H  15.479  -4.421 -30.249 1.00 . A A .   9 VAL HA   1 1 
        4  9448 1 1   9 VAL HB   H  15.318  -7.430 -30.423 1.00 . A A .   9 VAL HB   1 1 
        4  9449 1 1   9 VAL HG11 H  15.555  -6.977 -28.185 1.00 . A A .   9 VAL HG11 1 1 
        4  9450 1 1   9 VAL HG12 H  13.803  -6.878 -28.356 1.00 . A A .   9 VAL HG12 1 1 
        4  9451 1 1   9 VAL HG13 H  14.768  -5.404 -28.309 1.00 . A A .   9 VAL HG13 1 1 
        4  9452 1 1   9 VAL HG21 H  13.661  -6.379 -31.905 1.00 . A A .   9 VAL HG21 1 1 
        4  9453 1 1   9 VAL HG22 H  13.063  -5.430 -30.544 1.00 . A A .   9 VAL HG22 1 1 
        4  9454 1 1   9 VAL HG23 H  12.906  -7.186 -30.530 1.00 . A A .   9 VAL HG23 1 1 
        4  9455 1 1   9 VAL N    N  15.839  -5.267 -32.096 1.00 . A A .   9 VAL N    1 1 
        4  9456 1 1   9 VAL O    O  17.541  -6.727 -29.646 1.00 . A A .   9 VAL O    1 1 
        4  9457 1 1  10 LEU C    C  20.069  -3.351 -29.427 1.00 . A A .  10 LEU C    1 1 
        4  9458 1 1  10 LEU CA   C  19.458  -4.727 -29.682 1.00 . A A .  10 LEU CA   1 1 
        4  9459 1 1  10 LEU CB   C  20.308  -5.496 -30.694 1.00 . A A .  10 LEU CB   1 1 
        4  9460 1 1  10 LEU CD1  C  21.531  -4.228 -32.482 1.00 . A A .  10 LEU CD1  1 1 
        4  9461 1 1  10 LEU CD2  C  19.996  -6.099 -33.109 1.00 . A A .  10 LEU CD2  1 1 
        4  9462 1 1  10 LEU CG   C  20.248  -4.964 -32.129 1.00 . A A .  10 LEU CG   1 1 
        4  9463 1 1  10 LEU H    H  17.785  -3.753 -30.540 1.00 . A A .  10 LEU H    1 1 
        4  9464 1 1  10 LEU HA   H  19.436  -5.275 -28.751 1.00 . A A .  10 LEU HA   1 1 
        4  9465 1 1  10 LEU HB2  H  21.337  -5.468 -30.362 1.00 . A A .  10 LEU HB2  1 1 
        4  9466 1 1  10 LEU HB3  H  19.979  -6.524 -30.699 1.00 . A A .  10 LEU HB3  1 1 
        4  9467 1 1  10 LEU HD11 H  21.419  -3.178 -32.253 1.00 . A A .  10 LEU HD11 1 1 
        4  9468 1 1  10 LEU HD12 H  21.735  -4.346 -33.535 1.00 . A A .  10 LEU HD12 1 1 
        4  9469 1 1  10 LEU HD13 H  22.350  -4.637 -31.908 1.00 . A A .  10 LEU HD13 1 1 
        4  9470 1 1  10 LEU HD21 H  20.926  -6.603 -33.326 1.00 . A A .  10 LEU HD21 1 1 
        4  9471 1 1  10 LEU HD22 H  19.582  -5.699 -34.024 1.00 . A A .  10 LEU HD22 1 1 
        4  9472 1 1  10 LEU HD23 H  19.299  -6.802 -32.677 1.00 . A A .  10 LEU HD23 1 1 
        4  9473 1 1  10 LEU HG   H  19.429  -4.264 -32.209 1.00 . A A .  10 LEU HG   1 1 
        4  9474 1 1  10 LEU N    N  18.087  -4.607 -30.162 1.00 . A A .  10 LEU N    1 1 
        4  9475 1 1  10 LEU O    O  21.280  -3.169 -29.542 1.00 . A A .  10 LEU O    1 1 
        4  9476 1 1  11 ASN C    C  20.051  -0.862 -27.342 1.00 . A A .  11 ASN C    1 1 
        4  9477 1 1  11 ASN CA   C  19.678  -1.029 -28.811 1.00 . A A .  11 ASN CA   1 1 
        4  9478 1 1  11 ASN CB   C  18.594  -0.020 -29.192 1.00 . A A .  11 ASN CB   1 1 
        4  9479 1 1  11 ASN CG   C  19.144   1.384 -29.358 1.00 . A A .  11 ASN CG   1 1 
        4  9480 1 1  11 ASN H    H  18.267  -2.593 -29.005 1.00 . A A .  11 ASN H    1 1 
        4  9481 1 1  11 ASN HA   H  20.555  -0.848 -29.415 1.00 . A A .  11 ASN HA   1 1 
        4  9482 1 1  11 ASN HB2  H  18.142  -0.320 -30.125 1.00 . A A .  11 ASN HB2  1 1 
        4  9483 1 1  11 ASN HB3  H  17.839  -0.002 -28.419 1.00 . A A .  11 ASN HB3  1 1 
        4  9484 1 1  11 ASN HD21 H  20.332   0.772 -30.830 1.00 . A A .  11 ASN HD21 1 1 
        4  9485 1 1  11 ASN HD22 H  20.436   2.449 -30.430 1.00 . A A .  11 ASN HD22 1 1 
        4  9486 1 1  11 ASN N    N  19.221  -2.388 -29.081 1.00 . A A .  11 ASN N    1 1 
        4  9487 1 1  11 ASN ND2  N  20.064   1.552 -30.301 1.00 . A A .  11 ASN ND2  1 1 
        4  9488 1 1  11 ASN O    O  21.199  -0.565 -27.011 1.00 . A A .  11 ASN O    1 1 
        4  9489 1 1  11 ASN OD1  O  18.748   2.306 -28.645 1.00 . A A .  11 ASN OD1  1 1 
        4  9490 1 1  12 ALA C    C  18.118  -1.486 -24.238 1.00 . A A .  12 ALA C    1 1 
        4  9491 1 1  12 ALA CA   C  19.296  -0.929 -25.028 1.00 . A A .  12 ALA CA   1 1 
        4  9492 1 1  12 ALA CB   C  19.537   0.528 -24.662 1.00 . A A .  12 ALA CB   1 1 
        4  9493 1 1  12 ALA H    H  18.178  -1.293 -26.789 1.00 . A A .  12 ALA H    1 1 
        4  9494 1 1  12 ALA HA   H  20.184  -1.491 -24.778 1.00 . A A .  12 ALA HA   1 1 
        4  9495 1 1  12 ALA HB1  H  19.896   0.589 -23.645 1.00 . A A .  12 ALA HB1  1 1 
        4  9496 1 1  12 ALA HB2  H  18.613   1.079 -24.751 1.00 . A A .  12 ALA HB2  1 1 
        4  9497 1 1  12 ALA HB3  H  20.275   0.950 -25.329 1.00 . A A .  12 ALA HB3  1 1 
        4  9498 1 1  12 ALA N    N  19.073  -1.058 -26.464 1.00 . A A .  12 ALA N    1 1 
        4  9499 1 1  12 ALA O    O  17.231  -2.133 -24.797 1.00 . A A .  12 ALA O    1 1 
        4  9500 1 1  13 ALA C    C  16.347  -0.543 -21.365 1.00 . A A .  13 ALA C    1 1 
        4  9501 1 1  13 ALA CA   C  17.043  -1.707 -22.065 1.00 . A A .  13 ALA CA   1 1 
        4  9502 1 1  13 ALA CB   C  17.591  -2.689 -21.042 1.00 . A A .  13 ALA CB   1 1 
        4  9503 1 1  13 ALA H    H  18.848  -0.711 -22.546 1.00 . A A .  13 ALA H    1 1 
        4  9504 1 1  13 ALA HA   H  16.321  -2.227 -22.679 1.00 . A A .  13 ALA HA   1 1 
        4  9505 1 1  13 ALA HB1  H  16.936  -2.719 -20.184 1.00 . A A .  13 ALA HB1  1 1 
        4  9506 1 1  13 ALA HB2  H  18.577  -2.375 -20.732 1.00 . A A .  13 ALA HB2  1 1 
        4  9507 1 1  13 ALA HB3  H  17.651  -3.673 -21.483 1.00 . A A .  13 ALA HB3  1 1 
        4  9508 1 1  13 ALA N    N  18.113  -1.232 -22.934 1.00 . A A .  13 ALA N    1 1 
        4  9509 1 1  13 ALA O    O  16.595  -0.279 -20.188 1.00 . A A .  13 ALA O    1 1 
        4  9510 1 1  14 PRO C    C  13.971   0.946 -20.253 1.00 . A A .  14 PRO C    1 1 
        4  9511 1 1  14 PRO CA   C  14.732   1.315 -21.521 1.00 . A A .  14 PRO CA   1 1 
        4  9512 1 1  14 PRO CB   C  13.756   1.700 -22.637 1.00 . A A .  14 PRO CB   1 1 
        4  9513 1 1  14 PRO CD   C  15.109  -0.073 -23.492 1.00 . A A .  14 PRO CD   1 1 
        4  9514 1 1  14 PRO CG   C  14.377   1.180 -23.886 1.00 . A A .  14 PRO CG   1 1 
        4  9515 1 1  14 PRO HA   H  15.394   2.143 -21.315 1.00 . A A .  14 PRO HA   1 1 
        4  9516 1 1  14 PRO HB2  H  12.796   1.242 -22.452 1.00 . A A .  14 PRO HB2  1 1 
        4  9517 1 1  14 PRO HB3  H  13.648   2.773 -22.669 1.00 . A A .  14 PRO HB3  1 1 
        4  9518 1 1  14 PRO HD2  H  14.461  -0.933 -23.583 1.00 . A A .  14 PRO HD2  1 1 
        4  9519 1 1  14 PRO HD3  H  15.996  -0.199 -24.095 1.00 . A A .  14 PRO HD3  1 1 
        4  9520 1 1  14 PRO HG2  H  13.610   0.954 -24.611 1.00 . A A .  14 PRO HG2  1 1 
        4  9521 1 1  14 PRO HG3  H  15.069   1.907 -24.283 1.00 . A A .  14 PRO HG3  1 1 
        4  9522 1 1  14 PRO N    N  15.463   0.173 -22.081 1.00 . A A .  14 PRO N    1 1 
        4  9523 1 1  14 PRO O    O  13.873   1.745 -19.322 1.00 . A A .  14 PRO O    1 1 
        4  9524 1 1  15 LYS C    C  13.567  -1.573 -18.144 1.00 . A A .  15 LYS C    1 1 
        4  9525 1 1  15 LYS CA   C  12.683  -0.744 -19.069 1.00 . A A .  15 LYS CA   1 1 
        4  9526 1 1  15 LYS CB   C  11.481  -1.575 -19.521 1.00 . A A .  15 LYS CB   1 1 
        4  9527 1 1  15 LYS CD   C  11.067  -2.795 -21.686 1.00 . A A .  15 LYS CD   1 1 
        4  9528 1 1  15 LYS CE   C  10.363  -4.128 -21.887 1.00 . A A .  15 LYS CE   1 1 
        4  9529 1 1  15 LYS CG   C  11.857  -2.769 -20.387 1.00 . A A .  15 LYS CG   1 1 
        4  9530 1 1  15 LYS H    H  13.548  -0.862 -20.996 1.00 . A A .  15 LYS H    1 1 
        4  9531 1 1  15 LYS HA   H  12.327   0.120 -18.527 1.00 . A A .  15 LYS HA   1 1 
        4  9532 1 1  15 LYS HB2  H  10.962  -1.942 -18.647 1.00 . A A .  15 LYS HB2  1 1 
        4  9533 1 1  15 LYS HB3  H  10.814  -0.943 -20.086 1.00 . A A .  15 LYS HB3  1 1 
        4  9534 1 1  15 LYS HD2  H  10.327  -2.009 -21.665 1.00 . A A .  15 LYS HD2  1 1 
        4  9535 1 1  15 LYS HD3  H  11.746  -2.631 -22.511 1.00 . A A .  15 LYS HD3  1 1 
        4  9536 1 1  15 LYS HE2  H  11.087  -4.922 -21.782 1.00 . A A .  15 LYS HE2  1 1 
        4  9537 1 1  15 LYS HE3  H   9.600  -4.235 -21.128 1.00 . A A .  15 LYS HE3  1 1 
        4  9538 1 1  15 LYS HG2  H  12.910  -2.715 -20.619 1.00 . A A .  15 LYS HG2  1 1 
        4  9539 1 1  15 LYS HG3  H  11.656  -3.676 -19.835 1.00 . A A .  15 LYS HG3  1 1 
        4  9540 1 1  15 LYS HZ1  H   9.791  -5.200 -23.585 1.00 . A A .  15 LYS HZ1  1 1 
        4  9541 1 1  15 LYS HZ2  H  10.210  -3.592 -23.900 1.00 . A A .  15 LYS HZ2  1 1 
        4  9542 1 1  15 LYS HZ3  H   8.726  -3.954 -23.173 1.00 . A A .  15 LYS HZ3  1 1 
        4  9543 1 1  15 LYS N    N  13.435  -0.269 -20.223 1.00 . A A .  15 LYS N    1 1 
        4  9544 1 1  15 LYS NZ   N   9.728  -4.225 -23.230 1.00 . A A .  15 LYS NZ   1 1 
        4  9545 1 1  15 LYS O    O  14.005  -2.667 -18.502 1.00 . A A .  15 LYS O    1 1 
        4  9546 1 1  16 ASP C    C  13.814  -2.651 -15.093 1.00 . A A .  16 ASP C    1 1 
        4  9547 1 1  16 ASP CA   C  14.659  -1.739 -15.975 1.00 . A A .  16 ASP CA   1 1 
        4  9548 1 1  16 ASP CB   C  15.414  -0.729 -15.111 1.00 . A A .  16 ASP CB   1 1 
        4  9549 1 1  16 ASP CG   C  16.629  -0.156 -15.815 1.00 . A A .  16 ASP CG   1 1 
        4  9550 1 1  16 ASP H    H  13.449  -0.172 -16.725 1.00 . A A .  16 ASP H    1 1 
        4  9551 1 1  16 ASP HA   H  15.374  -2.340 -16.517 1.00 . A A .  16 ASP HA   1 1 
        4  9552 1 1  16 ASP HB2  H  14.751   0.086 -14.858 1.00 . A A .  16 ASP HB2  1 1 
        4  9553 1 1  16 ASP HB3  H  15.742  -1.214 -14.204 1.00 . A A .  16 ASP HB3  1 1 
        4  9554 1 1  16 ASP N    N  13.828  -1.047 -16.953 1.00 . A A .  16 ASP N    1 1 
        4  9555 1 1  16 ASP O    O  12.638  -2.384 -14.852 1.00 . A A .  16 ASP O    1 1 
        4  9556 1 1  16 ASP OD1  O  17.588  -0.918 -16.056 1.00 . A A .  16 ASP OD1  1 1 
        4  9557 1 1  16 ASP OD2  O  16.620   1.053 -16.125 1.00 . A A .  16 ASP OD2  1 1 
        4  9558 1 1  17 ASN C    C  13.859  -4.294 -12.287 1.00 . A A .  17 ASN C    1 1 
        4  9559 1 1  17 ASN CA   C  13.725  -4.683 -13.756 1.00 . A A .  17 ASN CA   1 1 
        4  9560 1 1  17 ASN CB   C  14.276  -6.094 -13.974 1.00 . A A .  17 ASN CB   1 1 
        4  9561 1 1  17 ASN CG   C  14.346  -6.468 -15.442 1.00 . A A .  17 ASN CG   1 1 
        4  9562 1 1  17 ASN H    H  15.363  -3.891 -14.840 1.00 . A A .  17 ASN H    1 1 
        4  9563 1 1  17 ASN HA   H  12.681  -4.669 -14.027 1.00 . A A .  17 ASN HA   1 1 
        4  9564 1 1  17 ASN HB2  H  15.271  -6.154 -13.558 1.00 . A A .  17 ASN HB2  1 1 
        4  9565 1 1  17 ASN HB3  H  13.636  -6.805 -13.470 1.00 . A A .  17 ASN HB3  1 1 
        4  9566 1 1  17 ASN HD21 H  12.372  -6.698 -15.503 1.00 . A A .  17 ASN HD21 1 1 
        4  9567 1 1  17 ASN HD22 H  13.208  -6.993 -16.986 1.00 . A A .  17 ASN HD22 1 1 
        4  9568 1 1  17 ASN N    N  14.423  -3.731 -14.613 1.00 . A A .  17 ASN N    1 1 
        4  9569 1 1  17 ASN ND2  N  13.193  -6.749 -16.036 1.00 . A A .  17 ASN ND2  1 1 
        4  9570 1 1  17 ASN O    O  14.958  -4.285 -11.736 1.00 . A A .  17 ASN O    1 1 
        4  9571 1 1  17 ASN OD1  O  15.425  -6.504 -16.034 1.00 . A A .  17 ASN OD1  1 1 
        4  9572 1 1  18 THR C    C  11.396  -3.950  -9.599 1.00 . A A .  18 THR C    1 1 
        4  9573 1 1  18 THR CA   C  12.722  -3.584 -10.256 1.00 . A A .  18 THR CA   1 1 
        4  9574 1 1  18 THR CB   C  12.977  -2.083 -10.119 1.00 . A A .  18 THR CB   1 1 
        4  9575 1 1  18 THR CG2  C  13.411  -1.673  -8.729 1.00 . A A .  18 THR CG2  1 1 
        4  9576 1 1  18 THR H    H  11.886  -4.001 -12.154 1.00 . A A .  18 THR H    1 1 
        4  9577 1 1  18 THR HA   H  13.517  -4.122  -9.757 1.00 . A A .  18 THR HA   1 1 
        4  9578 1 1  18 THR HB   H  12.065  -1.551 -10.351 1.00 . A A .  18 THR HB   1 1 
        4  9579 1 1  18 THR HG1  H  13.866  -0.727 -11.217 1.00 . A A .  18 THR HG1  1 1 
        4  9580 1 1  18 THR HG21 H  12.732  -2.092  -8.001 1.00 . A A .  18 THR HG21 1 1 
        4  9581 1 1  18 THR HG22 H  13.400  -0.595  -8.651 1.00 . A A .  18 THR HG22 1 1 
        4  9582 1 1  18 THR HG23 H  14.410  -2.037  -8.541 1.00 . A A .  18 THR HG23 1 1 
        4  9583 1 1  18 THR N    N  12.732  -3.974 -11.660 1.00 . A A .  18 THR N    1 1 
        4  9584 1 1  18 THR O    O  10.327  -3.680 -10.146 1.00 . A A .  18 THR O    1 1 
        4  9585 1 1  18 THR OG1  O  13.981  -1.660 -11.024 1.00 . A A .  18 THR OG1  1 1 
        4  9586 1 1  19 TRP C    C  10.394  -4.622  -6.214 1.00 . A A .  19 TRP C    1 1 
        4  9587 1 1  19 TRP CA   C  10.276  -4.969  -7.694 1.00 . A A .  19 TRP CA   1 1 
        4  9588 1 1  19 TRP CB   C  10.034  -6.471  -7.859 1.00 . A A .  19 TRP CB   1 1 
        4  9589 1 1  19 TRP CD1  C   9.284  -6.720 -10.296 1.00 . A A .  19 TRP CD1  1 1 
        4  9590 1 1  19 TRP CD2  C  11.231  -7.721  -9.826 1.00 . A A .  19 TRP CD2  1 1 
        4  9591 1 1  19 TRP CE2  C  10.936  -7.932 -11.186 1.00 . A A .  19 TRP CE2  1 1 
        4  9592 1 1  19 TRP CE3  C  12.410  -8.259  -9.302 1.00 . A A .  19 TRP CE3  1 1 
        4  9593 1 1  19 TRP CG   C  10.162  -6.944  -9.274 1.00 . A A .  19 TRP CG   1 1 
        4  9594 1 1  19 TRP CH2  C  12.922  -9.171 -11.487 1.00 . A A .  19 TRP CH2  1 1 
        4  9595 1 1  19 TRP CZ2  C  11.776  -8.656 -12.027 1.00 . A A .  19 TRP CZ2  1 1 
        4  9596 1 1  19 TRP CZ3  C  13.242  -8.979 -10.138 1.00 . A A .  19 TRP CZ3  1 1 
        4  9597 1 1  19 TRP H    H  12.353  -4.755  -8.039 1.00 . A A .  19 TRP H    1 1 
        4  9598 1 1  19 TRP HA   H   9.437  -4.432  -8.111 1.00 . A A .  19 TRP HA   1 1 
        4  9599 1 1  19 TRP HB2  H  10.752  -7.012  -7.261 1.00 . A A .  19 TRP HB2  1 1 
        4  9600 1 1  19 TRP HB3  H   9.037  -6.709  -7.516 1.00 . A A .  19 TRP HB3  1 1 
        4  9601 1 1  19 TRP HD1  H   8.366  -6.160 -10.198 1.00 . A A .  19 TRP HD1  1 1 
        4  9602 1 1  19 TRP HE1  H   9.288  -7.291 -12.317 1.00 . A A .  19 TRP HE1  1 1 
        4  9603 1 1  19 TRP HE3  H  12.674  -8.120  -8.263 1.00 . A A .  19 TRP HE3  1 1 
        4  9604 1 1  19 TRP HH2  H  13.603  -9.741 -12.104 1.00 . A A .  19 TRP HH2  1 1 
        4  9605 1 1  19 TRP HZ2  H  11.543  -8.814 -13.070 1.00 . A A .  19 TRP HZ2  1 1 
        4  9606 1 1  19 TRP HZ3  H  14.158  -9.401  -9.750 1.00 . A A .  19 TRP HZ3  1 1 
        4  9607 1 1  19 TRP N    N  11.471  -4.567  -8.424 1.00 . A A .  19 TRP N    1 1 
        4  9608 1 1  19 TRP NE1  N   9.742  -7.311 -11.448 1.00 . A A .  19 TRP NE1  1 1 
        4  9609 1 1  19 TRP O    O  11.489  -4.630  -5.650 1.00 . A A .  19 TRP O    1 1 
        4  9610 1 1  20 TYR C    C   7.836  -4.150  -3.597 1.00 . A A .  20 TYR C    1 1 
        4  9611 1 1  20 TYR CA   C   9.236  -3.970  -4.175 1.00 . A A .  20 TYR CA   1 1 
        4  9612 1 1  20 TYR CB   C   9.703  -2.528  -3.973 1.00 . A A .  20 TYR CB   1 1 
        4  9613 1 1  20 TYR CD1  C   9.423  -1.451  -6.240 1.00 . A A .  20 TYR CD1  1 1 
        4  9614 1 1  20 TYR CD2  C   8.037  -0.693  -4.455 1.00 . A A .  20 TYR CD2  1 1 
        4  9615 1 1  20 TYR CE1  C   8.822  -0.549  -7.096 1.00 . A A .  20 TYR CE1  1 1 
        4  9616 1 1  20 TYR CE2  C   7.431   0.212  -5.306 1.00 . A A .  20 TYR CE2  1 1 
        4  9617 1 1  20 TYR CG   C   9.042  -1.539  -4.907 1.00 . A A .  20 TYR CG   1 1 
        4  9618 1 1  20 TYR CZ   C   7.826   0.280  -6.625 1.00 . A A .  20 TYR CZ   1 1 
        4  9619 1 1  20 TYR H    H   8.421  -4.332  -6.094 1.00 . A A .  20 TYR H    1 1 
        4  9620 1 1  20 TYR HA   H   9.913  -4.634  -3.657 1.00 . A A .  20 TYR HA   1 1 
        4  9621 1 1  20 TYR HB2  H   9.483  -2.223  -2.960 1.00 . A A .  20 TYR HB2  1 1 
        4  9622 1 1  20 TYR HB3  H  10.769  -2.476  -4.135 1.00 . A A .  20 TYR HB3  1 1 
        4  9623 1 1  20 TYR HD1  H  10.203  -2.103  -6.606 1.00 . A A .  20 TYR HD1  1 1 
        4  9624 1 1  20 TYR HD2  H   7.729  -0.748  -3.421 1.00 . A A .  20 TYR HD2  1 1 
        4  9625 1 1  20 TYR HE1  H   9.133  -0.497  -8.130 1.00 . A A .  20 TYR HE1  1 1 
        4  9626 1 1  20 TYR HE2  H   6.651   0.861  -4.937 1.00 . A A .  20 TYR HE2  1 1 
        4  9627 1 1  20 TYR HH   H   6.277   1.171  -7.331 1.00 . A A .  20 TYR HH   1 1 
        4  9628 1 1  20 TYR N    N   9.261  -4.319  -5.590 1.00 . A A .  20 TYR N    1 1 
        4  9629 1 1  20 TYR O    O   6.839  -3.982  -4.300 1.00 . A A .  20 TYR O    1 1 
        4  9630 1 1  20 TYR OH   O   7.225   1.179  -7.475 1.00 . A A .  20 TYR OH   1 1 
        4  9631 1 1  21 ALA C    C   6.512  -4.141  -0.226 1.00 . A A .  21 ALA C    1 1 
        4  9632 1 1  21 ALA CA   C   6.487  -4.696  -1.647 1.00 . A A .  21 ALA CA   1 1 
        4  9633 1 1  21 ALA CB   C   6.130  -6.175  -1.631 1.00 . A A .  21 ALA CB   1 1 
        4  9634 1 1  21 ALA H    H   8.597  -4.613  -1.807 1.00 . A A .  21 ALA H    1 1 
        4  9635 1 1  21 ALA HA   H   5.729  -4.174  -2.212 1.00 . A A .  21 ALA HA   1 1 
        4  9636 1 1  21 ALA HB1  H   7.035  -6.764  -1.650 1.00 . A A .  21 ALA HB1  1 1 
        4  9637 1 1  21 ALA HB2  H   5.530  -6.410  -2.498 1.00 . A A .  21 ALA HB2  1 1 
        4  9638 1 1  21 ALA HB3  H   5.572  -6.401  -0.736 1.00 . A A .  21 ALA HB3  1 1 
        4  9639 1 1  21 ALA N    N   7.767  -4.493  -2.314 1.00 . A A .  21 ALA N    1 1 
        4  9640 1 1  21 ALA O    O   7.570  -4.051   0.396 1.00 . A A .  21 ALA O    1 1 
        4  9641 1 1  22 GLY C    C   3.815  -3.011   2.062 1.00 . A A .  22 GLY C    1 1 
        4  9642 1 1  22 GLY CA   C   5.249  -3.231   1.622 1.00 . A A .  22 GLY CA   1 1 
        4  9643 1 1  22 GLY H    H   4.530  -3.868  -0.264 1.00 . A A .  22 GLY H    1 1 
        4  9644 1 1  22 GLY HA2  H   5.722  -3.919   2.309 1.00 . A A .  22 GLY HA2  1 1 
        4  9645 1 1  22 GLY HA3  H   5.773  -2.288   1.655 1.00 . A A .  22 GLY HA3  1 1 
        4  9646 1 1  22 GLY N    N   5.340  -3.772   0.278 1.00 . A A .  22 GLY N    1 1 
        4  9647 1 1  22 GLY O    O   2.878  -3.428   1.381 1.00 . A A .  22 GLY O    1 1 
        4  9648 1 1  23 GLY C    C   2.209  -0.737   4.392 1.00 . A A .  23 GLY C    1 1 
        4  9649 1 1  23 GLY CA   C   2.310  -2.088   3.714 1.00 . A A .  23 GLY CA   1 1 
        4  9650 1 1  23 GLY H    H   4.428  -2.043   3.703 1.00 . A A .  23 GLY H    1 1 
        4  9651 1 1  23 GLY HA2  H   1.610  -2.120   2.891 1.00 . A A .  23 GLY HA2  1 1 
        4  9652 1 1  23 GLY HA3  H   2.050  -2.857   4.425 1.00 . A A .  23 GLY HA3  1 1 
        4  9653 1 1  23 GLY N    N   3.643  -2.352   3.203 1.00 . A A .  23 GLY N    1 1 
        4  9654 1 1  23 GLY O    O   3.174  -0.262   4.993 1.00 . A A .  23 GLY O    1 1 
        4  9655 1 1  24 LYS C    C  -0.517   1.230   5.651 1.00 . A A .  24 LYS C    1 1 
        4  9656 1 1  24 LYS CA   C   0.815   1.191   4.907 1.00 . A A .  24 LYS CA   1 1 
        4  9657 1 1  24 LYS CB   C   0.847   2.289   3.841 1.00 . A A .  24 LYS CB   1 1 
        4  9658 1 1  24 LYS CD   C  -1.407   2.659   2.794 1.00 . A A .  24 LYS CD   1 1 
        4  9659 1 1  24 LYS CE   C  -2.236   2.521   1.527 1.00 . A A .  24 LYS CE   1 1 
        4  9660 1 1  24 LYS CG   C  -0.046   2.001   2.644 1.00 . A A .  24 LYS CG   1 1 
        4  9661 1 1  24 LYS H    H   0.305  -0.543   3.803 1.00 . A A .  24 LYS H    1 1 
        4  9662 1 1  24 LYS HA   H   1.611   1.366   5.613 1.00 . A A .  24 LYS HA   1 1 
        4  9663 1 1  24 LYS HB2  H   0.527   3.218   4.287 1.00 . A A .  24 LYS HB2  1 1 
        4  9664 1 1  24 LYS HB3  H   1.862   2.401   3.487 1.00 . A A .  24 LYS HB3  1 1 
        4  9665 1 1  24 LYS HD2  H  -1.935   2.189   3.611 1.00 . A A .  24 LYS HD2  1 1 
        4  9666 1 1  24 LYS HD3  H  -1.267   3.709   3.010 1.00 . A A .  24 LYS HD3  1 1 
        4  9667 1 1  24 LYS HE2  H  -3.198   2.982   1.690 1.00 . A A .  24 LYS HE2  1 1 
        4  9668 1 1  24 LYS HE3  H  -1.725   3.028   0.722 1.00 . A A .  24 LYS HE3  1 1 
        4  9669 1 1  24 LYS HG2  H   0.430   2.382   1.753 1.00 . A A .  24 LYS HG2  1 1 
        4  9670 1 1  24 LYS HG3  H  -0.179   0.933   2.555 1.00 . A A .  24 LYS HG3  1 1 
        4  9671 1 1  24 LYS HZ1  H  -3.276   1.004   0.538 1.00 . A A .  24 LYS HZ1  1 1 
        4  9672 1 1  24 LYS HZ2  H  -2.581   0.516   2.002 1.00 . A A .  24 LYS HZ2  1 1 
        4  9673 1 1  24 LYS HZ3  H  -1.609   0.739   0.636 1.00 . A A .  24 LYS HZ3  1 1 
        4  9674 1 1  24 LYS N    N   1.036  -0.115   4.297 1.00 . A A .  24 LYS N    1 1 
        4  9675 1 1  24 LYS NZ   N  -2.439   1.095   1.150 1.00 . A A .  24 LYS NZ   1 1 
        4  9676 1 1  24 LYS O    O  -1.487   0.588   5.246 1.00 . A A .  24 LYS O    1 1 
        4  9677 1 1  25 LEU C    C  -2.203   3.582   7.626 1.00 . A A .  25 LEU C    1 1 
        4  9678 1 1  25 LEU CA   C  -1.765   2.122   7.543 1.00 . A A .  25 LEU CA   1 1 
        4  9679 1 1  25 LEU CB   C  -1.534   1.567   8.952 1.00 . A A .  25 LEU CB   1 1 
        4  9680 1 1  25 LEU CD1  C  -2.688  -0.108  10.426 1.00 . A A .  25 LEU CD1  1 1 
        4  9681 1 1  25 LEU CD2  C  -3.099   2.336  10.757 1.00 . A A .  25 LEU CD2  1 1 
        4  9682 1 1  25 LEU CG   C  -2.809   1.244   9.738 1.00 . A A .  25 LEU CG   1 1 
        4  9683 1 1  25 LEU H    H   0.251   2.480   7.009 1.00 . A A .  25 LEU H    1 1 
        4  9684 1 1  25 LEU HA   H  -2.546   1.552   7.063 1.00 . A A .  25 LEU HA   1 1 
        4  9685 1 1  25 LEU HB2  H  -0.948   0.662   8.865 1.00 . A A .  25 LEU HB2  1 1 
        4  9686 1 1  25 LEU HB3  H  -0.965   2.291   9.512 1.00 . A A .  25 LEU HB3  1 1 
        4  9687 1 1  25 LEU HD11 H  -2.005  -0.733   9.871 1.00 . A A .  25 LEU HD11 1 1 
        4  9688 1 1  25 LEU HD12 H  -3.658  -0.580  10.464 1.00 . A A .  25 LEU HD12 1 1 
        4  9689 1 1  25 LEU HD13 H  -2.314   0.032  11.430 1.00 . A A .  25 LEU HD13 1 1 
        4  9690 1 1  25 LEU HD21 H  -2.277   2.407  11.454 1.00 . A A .  25 LEU HD21 1 1 
        4  9691 1 1  25 LEU HD22 H  -4.005   2.097  11.295 1.00 . A A .  25 LEU HD22 1 1 
        4  9692 1 1  25 LEU HD23 H  -3.223   3.281  10.250 1.00 . A A .  25 LEU HD23 1 1 
        4  9693 1 1  25 LEU HG   H  -3.643   1.195   9.052 1.00 . A A .  25 LEU HG   1 1 
        4  9694 1 1  25 LEU N    N  -0.555   1.993   6.740 1.00 . A A .  25 LEU N    1 1 
        4  9695 1 1  25 LEU O    O  -1.371   4.490   7.642 1.00 . A A .  25 LEU O    1 1 
        4  9696 1 1  26 GLY C    C  -5.420   5.198   8.380 1.00 . A A .  26 GLY C    1 1 
        4  9697 1 1  26 GLY CA   C  -4.038   5.148   7.756 1.00 . A A .  26 GLY CA   1 1 
        4  9698 1 1  26 GLY H    H  -4.128   3.036   7.660 1.00 . A A .  26 GLY H    1 1 
        4  9699 1 1  26 GLY HA2  H  -3.366   5.750   8.349 1.00 . A A .  26 GLY HA2  1 1 
        4  9700 1 1  26 GLY HA3  H  -4.089   5.561   6.760 1.00 . A A .  26 GLY HA3  1 1 
        4  9701 1 1  26 GLY N    N  -3.513   3.798   7.678 1.00 . A A .  26 GLY N    1 1 
        4  9702 1 1  26 GLY O    O  -6.011   4.161   8.681 1.00 . A A .  26 GLY O    1 1 
        4  9703 1 1  27 TRP C    C  -8.258   7.070   8.118 1.00 . A A .  27 TRP C    1 1 
        4  9704 1 1  27 TRP CA   C  -7.255   6.593   9.162 1.00 . A A .  27 TRP CA   1 1 
        4  9705 1 1  27 TRP CB   C  -7.185   7.598  10.313 1.00 . A A .  27 TRP CB   1 1 
        4  9706 1 1  27 TRP CD1  C  -6.337   6.540  12.488 1.00 . A A .  27 TRP CD1  1 1 
        4  9707 1 1  27 TRP CD2  C  -4.762   7.612  11.312 1.00 . A A .  27 TRP CD2  1 1 
        4  9708 1 1  27 TRP CE2  C  -4.172   7.081  12.474 1.00 . A A .  27 TRP CE2  1 1 
        4  9709 1 1  27 TRP CE3  C  -3.963   8.328  10.419 1.00 . A A .  27 TRP CE3  1 1 
        4  9710 1 1  27 TRP CG   C  -6.149   7.254  11.340 1.00 . A A .  27 TRP CG   1 1 
        4  9711 1 1  27 TRP CH2  C  -2.060   7.949  11.871 1.00 . A A .  27 TRP CH2  1 1 
        4  9712 1 1  27 TRP CZ2  C  -2.820   7.244  12.764 1.00 . A A .  27 TRP CZ2  1 1 
        4  9713 1 1  27 TRP CZ3  C  -2.620   8.490  10.706 1.00 . A A .  27 TRP CZ3  1 1 
        4  9714 1 1  27 TRP H    H  -5.414   7.197   8.310 1.00 . A A .  27 TRP H    1 1 
        4  9715 1 1  27 TRP HA   H  -7.581   5.639   9.549 1.00 . A A .  27 TRP HA   1 1 
        4  9716 1 1  27 TRP HB2  H  -6.949   8.574   9.917 1.00 . A A .  27 TRP HB2  1 1 
        4  9717 1 1  27 TRP HB3  H  -8.145   7.637  10.807 1.00 . A A .  27 TRP HB3  1 1 
        4  9718 1 1  27 TRP HD1  H  -7.286   6.127  12.798 1.00 . A A .  27 TRP HD1  1 1 
        4  9719 1 1  27 TRP HE1  H  -5.031   5.964  14.029 1.00 . A A .  27 TRP HE1  1 1 
        4  9720 1 1  27 TRP HE3  H  -4.376   8.752   9.515 1.00 . A A .  27 TRP HE3  1 1 
        4  9721 1 1  27 TRP HH2  H  -1.007   8.101  12.057 1.00 . A A .  27 TRP HH2  1 1 
        4  9722 1 1  27 TRP HZ2  H  -2.372   6.832  13.658 1.00 . A A .  27 TRP HZ2  1 1 
        4  9723 1 1  27 TRP HZ3  H  -1.988   9.042  10.027 1.00 . A A .  27 TRP HZ3  1 1 
        4  9724 1 1  27 TRP N    N  -5.935   6.408   8.572 1.00 . A A .  27 TRP N    1 1 
        4  9725 1 1  27 TRP NE1  N  -5.154   6.431  13.176 1.00 . A A .  27 TRP NE1  1 1 
        4  9726 1 1  27 TRP O    O  -7.877   7.593   7.071 1.00 . A A .  27 TRP O    1 1 
        4  9727 1 1  28 SER C    C -11.751   7.950   8.253 1.00 . A A .  28 SER C    1 1 
        4  9728 1 1  28 SER CA   C -10.600   7.295   7.494 1.00 . A A .  28 SER CA   1 1 
        4  9729 1 1  28 SER CB   C -11.111   6.091   6.699 1.00 . A A .  28 SER CB   1 1 
        4  9730 1 1  28 SER H    H  -9.782   6.460   9.258 1.00 . A A .  28 SER H    1 1 
        4  9731 1 1  28 SER HA   H -10.182   8.016   6.807 1.00 . A A .  28 SER HA   1 1 
        4  9732 1 1  28 SER HB2  H -11.785   6.431   5.928 1.00 . A A .  28 SER HB2  1 1 
        4  9733 1 1  28 SER HB3  H -10.274   5.580   6.246 1.00 . A A .  28 SER HB3  1 1 
        4  9734 1 1  28 SER HG   H -12.376   4.627   7.005 1.00 . A A .  28 SER HG   1 1 
        4  9735 1 1  28 SER N    N  -9.541   6.883   8.408 1.00 . A A .  28 SER N    1 1 
        4  9736 1 1  28 SER O    O -12.893   7.493   8.186 1.00 . A A .  28 SER O    1 1 
        4  9737 1 1  28 SER OG   O -11.801   5.181   7.538 1.00 . A A .  28 SER OG   1 1 
        4  9738 1 1  29 GLN C    C -11.898  11.063  10.264 1.00 . A A .  29 GLN C    1 1 
        4  9739 1 1  29 GLN CA   C -12.450   9.738   9.747 1.00 . A A .  29 GLN CA   1 1 
        4  9740 1 1  29 GLN CB   C -12.932   8.879  10.919 1.00 . A A .  29 GLN CB   1 1 
        4  9741 1 1  29 GLN CD   C -14.797   8.815  12.621 1.00 . A A .  29 GLN CD   1 1 
        4  9742 1 1  29 GLN CG   C -14.431   8.962  11.158 1.00 . A A .  29 GLN CG   1 1 
        4  9743 1 1  29 GLN H    H -10.515   9.336   8.989 1.00 . A A .  29 GLN H    1 1 
        4  9744 1 1  29 GLN HA   H -13.285   9.940   9.094 1.00 . A A .  29 GLN HA   1 1 
        4  9745 1 1  29 GLN HB2  H -12.677   7.850  10.723 1.00 . A A .  29 GLN HB2  1 1 
        4  9746 1 1  29 GLN HB3  H -12.429   9.201  11.819 1.00 . A A .  29 GLN HB3  1 1 
        4  9747 1 1  29 GLN HE21 H -14.761   6.833  12.457 1.00 . A A .  29 GLN HE21 1 1 
        4  9748 1 1  29 GLN HE22 H -15.150   7.450  14.024 1.00 . A A .  29 GLN HE22 1 1 
        4  9749 1 1  29 GLN HG2  H -14.787   9.920  10.808 1.00 . A A .  29 GLN HG2  1 1 
        4  9750 1 1  29 GLN HG3  H -14.916   8.174  10.599 1.00 . A A .  29 GLN HG3  1 1 
        4  9751 1 1  29 GLN N    N -11.442   9.021   8.975 1.00 . A A .  29 GLN N    1 1 
        4  9752 1 1  29 GLN NE2  N -14.915   7.574  13.080 1.00 . A A .  29 GLN NE2  1 1 
        4  9753 1 1  29 GLN O    O -10.816  11.493   9.867 1.00 . A A .  29 GLN O    1 1 
        4  9754 1 1  29 GLN OE1  O -14.971   9.805  13.332 1.00 . A A .  29 GLN OE1  1 1 
        4  9755 1 1  30 TYR C    C -11.546  12.776  13.071 1.00 . A A .  30 TYR C    1 1 
        4  9756 1 1  30 TYR CA   C -12.235  12.980  11.725 1.00 . A A .  30 TYR CA   1 1 
        4  9757 1 1  30 TYR CB   C -13.442  13.905  11.891 1.00 . A A .  30 TYR CB   1 1 
        4  9758 1 1  30 TYR CD1  C -14.509  13.069  14.022 1.00 . A A .  30 TYR CD1  1 1 
        4  9759 1 1  30 TYR CD2  C -15.747  12.884  11.994 1.00 . A A .  30 TYR CD2  1 1 
        4  9760 1 1  30 TYR CE1  C -15.555  12.493  14.717 1.00 . A A .  30 TYR CE1  1 1 
        4  9761 1 1  30 TYR CE2  C -16.799  12.307  12.682 1.00 . A A .  30 TYR CE2  1 1 
        4  9762 1 1  30 TYR CG   C -14.588  13.275  12.649 1.00 . A A .  30 TYR CG   1 1 
        4  9763 1 1  30 TYR CZ   C -16.696  12.114  14.044 1.00 . A A .  30 TYR CZ   1 1 
        4  9764 1 1  30 TYR H    H -13.502  11.312  11.432 1.00 . A A .  30 TYR H    1 1 
        4  9765 1 1  30 TYR HA   H -11.533  13.437  11.042 1.00 . A A .  30 TYR HA   1 1 
        4  9766 1 1  30 TYR HB2  H -13.136  14.791  12.429 1.00 . A A .  30 TYR HB2  1 1 
        4  9767 1 1  30 TYR HB3  H -13.805  14.190  10.915 1.00 . A A .  30 TYR HB3  1 1 
        4  9768 1 1  30 TYR HD1  H -13.613  13.367  14.546 1.00 . A A .  30 TYR HD1  1 1 
        4  9769 1 1  30 TYR HD2  H -15.825  13.036  10.926 1.00 . A A .  30 TYR HD2  1 1 
        4  9770 1 1  30 TYR HE1  H -15.475  12.342  15.784 1.00 . A A .  30 TYR HE1  1 1 
        4  9771 1 1  30 TYR HE2  H -17.692  12.010  12.155 1.00 . A A .  30 TYR HE2  1 1 
        4  9772 1 1  30 TYR HH   H -17.769  10.600  14.545 1.00 . A A .  30 TYR HH   1 1 
        4  9773 1 1  30 TYR N    N -12.649  11.705  11.153 1.00 . A A .  30 TYR N    1 1 
        4  9774 1 1  30 TYR O    O -11.874  11.850  13.811 1.00 . A A .  30 TYR O    1 1 
        4  9775 1 1  30 TYR OH   O -17.739  11.540  14.734 1.00 . A A .  30 TYR OH   1 1 
        4  9776 1 1  31 HIS C    C  -9.458  14.950  15.129 1.00 . A A .  31 HIS C    1 1 
        4  9777 1 1  31 HIS CA   C  -9.856  13.563  14.637 1.00 . A A .  31 HIS CA   1 1 
        4  9778 1 1  31 HIS CB   C  -8.612  12.690  14.466 1.00 . A A .  31 HIS CB   1 1 
        4  9779 1 1  31 HIS CD2  C  -7.068  11.711  16.307 1.00 . A A .  31 HIS CD2  1 1 
        4  9780 1 1  31 HIS CE1  C  -8.586  10.608  17.443 1.00 . A A .  31 HIS CE1  1 1 
        4  9781 1 1  31 HIS CG   C  -8.259  11.904  15.689 1.00 . A A .  31 HIS CG   1 1 
        4  9782 1 1  31 HIS H    H -10.375  14.365  12.748 1.00 . A A .  31 HIS H    1 1 
        4  9783 1 1  31 HIS HA   H -10.507  13.106  15.370 1.00 . A A .  31 HIS HA   1 1 
        4  9784 1 1  31 HIS HB2  H  -8.778  11.992  13.660 1.00 . A A .  31 HIS HB2  1 1 
        4  9785 1 1  31 HIS HB3  H  -7.771  13.323  14.221 1.00 . A A .  31 HIS HB3  1 1 
        4  9786 1 1  31 HIS HD1  H -10.148  11.141  16.233 1.00 . A A .  31 HIS HD1  1 1 
        4  9787 1 1  31 HIS HD2  H  -6.115  12.118  16.001 1.00 . A A .  31 HIS HD2  1 1 
        4  9788 1 1  31 HIS HE1  H  -9.064   9.989  18.187 1.00 . A A .  31 HIS HE1  1 1 
        4  9789 1 1  31 HIS HE2  H  -6.611  10.527  17.979 1.00 . A A .  31 HIS HE2  1 1 
        4  9790 1 1  31 HIS N    N -10.591  13.648  13.380 1.00 . A A .  31 HIS N    1 1 
        4  9791 1 1  31 HIS ND1  N  -9.189  11.199  16.425 1.00 . A A .  31 HIS ND1  1 1 
        4  9792 1 1  31 HIS NE2  N  -7.300  10.902  17.392 1.00 . A A .  31 HIS NE2  1 1 
        4  9793 1 1  31 HIS O    O  -9.913  15.402  16.179 1.00 . A A .  31 HIS O    1 1 
        4  9794 1 1  32 ASP C    C  -7.908  17.803  13.474 1.00 . A A .  32 ASP C    1 1 
        4  9795 1 1  32 ASP CA   C  -8.141  16.956  14.720 1.00 . A A .  32 ASP CA   1 1 
        4  9796 1 1  32 ASP CB   C  -6.854  16.871  15.542 1.00 . A A .  32 ASP CB   1 1 
        4  9797 1 1  32 ASP CG   C  -7.100  16.362  16.949 1.00 . A A .  32 ASP CG   1 1 
        4  9798 1 1  32 ASP H    H  -8.275  15.206  13.537 1.00 . A A .  32 ASP H    1 1 
        4  9799 1 1  32 ASP HA   H  -8.910  17.423  15.318 1.00 . A A .  32 ASP HA   1 1 
        4  9800 1 1  32 ASP HB2  H  -6.165  16.199  15.052 1.00 . A A .  32 ASP HB2  1 1 
        4  9801 1 1  32 ASP HB3  H  -6.410  17.853  15.607 1.00 . A A .  32 ASP HB3  1 1 
        4  9802 1 1  32 ASP N    N  -8.603  15.620  14.363 1.00 . A A .  32 ASP N    1 1 
        4  9803 1 1  32 ASP O    O  -7.029  18.666  13.453 1.00 . A A .  32 ASP O    1 1 
        4  9804 1 1  32 ASP OD1  O  -8.122  16.751  17.552 1.00 . A A .  32 ASP OD1  1 1 
        4  9805 1 1  32 ASP OD2  O  -6.270  15.572  17.449 1.00 . A A .  32 ASP OD2  1 1 
        4  9806 1 1  33 THR C    C  -9.475  19.524  11.194 1.00 . A A .  33 THR C    1 1 
        4  9807 1 1  33 THR CA   C  -8.577  18.291  11.186 1.00 . A A .  33 THR CA   1 1 
        4  9808 1 1  33 THR CB   C  -8.937  17.392  10.001 1.00 . A A .  33 THR CB   1 1 
        4  9809 1 1  33 THR CG2  C  -8.107  17.671   8.765 1.00 . A A .  33 THR CG2  1 1 
        4  9810 1 1  33 THR H    H  -9.380  16.852  12.513 1.00 . A A .  33 THR H    1 1 
        4  9811 1 1  33 THR HA   H  -7.550  18.609  11.086 1.00 . A A .  33 THR HA   1 1 
        4  9812 1 1  33 THR HB   H  -9.974  17.551   9.744 1.00 . A A .  33 THR HB   1 1 
        4  9813 1 1  33 THR HG1  H  -9.623  15.602  10.397 1.00 . A A .  33 THR HG1  1 1 
        4  9814 1 1  33 THR HG21 H  -8.332  16.935   8.008 1.00 . A A .  33 THR HG21 1 1 
        4  9815 1 1  33 THR HG22 H  -7.059  17.620   9.017 1.00 . A A .  33 THR HG22 1 1 
        4  9816 1 1  33 THR HG23 H  -8.340  18.657   8.391 1.00 . A A .  33 THR HG23 1 1 
        4  9817 1 1  33 THR N    N  -8.699  17.552  12.436 1.00 . A A .  33 THR N    1 1 
        4  9818 1 1  33 THR O    O -10.482  19.567  11.901 1.00 . A A .  33 THR O    1 1 
        4  9819 1 1  33 THR OG1  O  -8.764  16.028  10.335 1.00 . A A .  33 THR OG1  1 1 
        4  9820 1 1  34 GLY C    C  -9.278  22.871  11.149 1.00 . A A .  34 GLY C    1 1 
        4  9821 1 1  34 GLY CA   C  -9.885  21.746  10.336 1.00 . A A .  34 GLY CA   1 1 
        4  9822 1 1  34 GLY H    H  -8.291  20.436   9.862 1.00 . A A .  34 GLY H    1 1 
        4  9823 1 1  34 GLY HA2  H  -9.955  22.059   9.304 1.00 . A A .  34 GLY HA2  1 1 
        4  9824 1 1  34 GLY HA3  H -10.879  21.544  10.706 1.00 . A A .  34 GLY HA3  1 1 
        4  9825 1 1  34 GLY N    N  -9.103  20.526  10.403 1.00 . A A .  34 GLY N    1 1 
        4  9826 1 1  34 GLY O    O  -8.222  23.401  10.800 1.00 . A A .  34 GLY O    1 1 
        4  9827 1 1  35 PHE C    C  -9.274  23.807  14.534 1.00 . A A .  35 PHE C    1 1 
        4  9828 1 1  35 PHE CA   C  -9.464  24.308  13.106 1.00 . A A .  35 PHE CA   1 1 
        4  9829 1 1  35 PHE CB   C -10.446  25.482  13.092 1.00 . A A .  35 PHE CB   1 1 
        4  9830 1 1  35 PHE CD1  C -10.941  26.132  10.720 1.00 . A A .  35 PHE CD1  1 1 
        4  9831 1 1  35 PHE CD2  C  -9.456  27.505  11.985 1.00 . A A .  35 PHE CD2  1 1 
        4  9832 1 1  35 PHE CE1  C -10.789  26.966   9.630 1.00 . A A .  35 PHE CE1  1 1 
        4  9833 1 1  35 PHE CE2  C  -9.300  28.343  10.898 1.00 . A A .  35 PHE CE2  1 1 
        4  9834 1 1  35 PHE CG   C -10.278  26.391  11.909 1.00 . A A .  35 PHE CG   1 1 
        4  9835 1 1  35 PHE CZ   C  -9.966  28.073   9.718 1.00 . A A .  35 PHE CZ   1 1 
        4  9836 1 1  35 PHE H    H -10.781  22.778  12.465 1.00 . A A .  35 PHE H    1 1 
        4  9837 1 1  35 PHE HA   H  -8.513  24.643  12.723 1.00 . A A .  35 PHE HA   1 1 
        4  9838 1 1  35 PHE HB2  H -11.456  25.099  13.076 1.00 . A A .  35 PHE HB2  1 1 
        4  9839 1 1  35 PHE HB3  H -10.304  26.070  13.988 1.00 . A A .  35 PHE HB3  1 1 
        4  9840 1 1  35 PHE HD1  H -11.584  25.268  10.650 1.00 . A A .  35 PHE HD1  1 1 
        4  9841 1 1  35 PHE HD2  H  -8.935  27.717  12.907 1.00 . A A .  35 PHE HD2  1 1 
        4  9842 1 1  35 PHE HE1  H -11.311  26.754   8.708 1.00 . A A .  35 PHE HE1  1 1 
        4  9843 1 1  35 PHE HE2  H  -8.657  29.209  10.969 1.00 . A A .  35 PHE HE2  1 1 
        4  9844 1 1  35 PHE HZ   H  -9.845  28.727   8.866 1.00 . A A .  35 PHE HZ   1 1 
        4  9845 1 1  35 PHE N    N  -9.945  23.238  12.238 1.00 . A A .  35 PHE N    1 1 
        4  9846 1 1  35 PHE O    O  -9.482  22.629  14.822 1.00 . A A .  35 PHE O    1 1 
        4  9847 1 1  36 TYR C    C  -9.978  24.099  17.532 1.00 . A A .  36 TYR C    1 1 
        4  9848 1 1  36 TYR CA   C  -8.653  24.359  16.822 1.00 . A A .  36 TYR CA   1 1 
        4  9849 1 1  36 TYR CB   C  -7.889  25.475  17.536 1.00 . A A .  36 TYR CB   1 1 
        4  9850 1 1  36 TYR CD1  C  -6.006  25.798  15.883 1.00 . A A .  36 TYR CD1  1 1 
        4  9851 1 1  36 TYR CD2  C  -5.444  25.294  18.143 1.00 . A A .  36 TYR CD2  1 1 
        4  9852 1 1  36 TYR CE1  C  -4.665  25.843  15.555 1.00 . A A .  36 TYR CE1  1 1 
        4  9853 1 1  36 TYR CE2  C  -4.101  25.340  17.823 1.00 . A A .  36 TYR CE2  1 1 
        4  9854 1 1  36 TYR CG   C  -6.419  25.523  17.181 1.00 . A A .  36 TYR CG   1 1 
        4  9855 1 1  36 TYR CZ   C  -3.717  25.613  16.529 1.00 . A A .  36 TYR CZ   1 1 
        4  9856 1 1  36 TYR H    H  -8.724  25.634  15.134 1.00 . A A .  36 TYR H    1 1 
        4  9857 1 1  36 TYR HA   H  -8.062  23.456  16.847 1.00 . A A .  36 TYR HA